3LLRA

Crystal structure of the pwwp domain of human dna (cytosine-5-)-methyltransferase 3 alpha
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
143
structure length
131
Chain Sequence
b'EYEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPAVEVQNKPMIEWALGGFQPSGPKGLEPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (cytosine-5)-methyltransferase 3A
publication title Structural and histone binding ability characterizations of human PWWP domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 40
structure length 131
sequence length 143
chains with identical sequence B, C, D, E
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.50 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 PWWP, helical domain 3llrA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3llrA01
5D6XA 2QQRA 4Z02A 3DB3A 3OYLA 2RHUA 4QQDA 5FROA 3OS1A 2O4XB 3LH0A 2F5KA 2GFAA 3FDRA 3H6ZA 4QQ6A 3S6WA 3OYJA 3OMGA 5IN1A 2R5MA 4ZTFA 2X4YA 4A4EA 3L42A 3ME9A 2RI5A 3S3MA 2BUDA 2RJCA 3CEYA 3OS0A 2EQKA 1OZ2A 2YRVA 4Q5WA 3LX7A 3OYFA 2JTFA 2EQJA 3MEVA 2RHIA 4NS5A 4E7HA 3S3OA 3UT1A 3L2RA 3OYNA 4PLLA 2L89A 2BKDN 1WJQA 1MHNA 2HQEA 2R5AA 3DB4A 3NTKA 3MEUA 3OB9A 4B9WA 4IURA 4BE2A 3OMCA 4N4GA 4C5GA 4CRIA 3OY9A 4BACA 4N4HA 2IG0A 4BDZA 4B9XA 2DIQA 3ASKA 3SD4A 4IKFA 5J39A 4PL6A 3L2QA 5D6WA 4E7IA 3F70A 4FL6A 5FRMA 1OZ3A 3OYAA 4X34A 2L8DA 2RHXA 3C4SA 2X4WA 3EAEA 2R57A 1WJRA 2WACA 1KHCA 2RO0A 1OI1A 4QW2A 4A4GA 3OYMA 1WGSA 3OQ5A 3P8HA 4A4FA 4LD6A 2XDPA 2JZ2A 4BD3A 3BDLA 2D9TA 3OYEA 2LRQA 2CKKA 2LDMA 3MP8A 5KE3A 4GY5A 2K3XA 2XK0A 4C5HA 3QKJA 3FEOA 2M1HA 3PFSA 2GF7A 4UC4A 3OYDA 4QQGA 2B8AA 5C6SA 4FU6A 4N4IA 3S3NA 5C0MA 3Q1JA 3QBYA 2RJEA 2MWOA 4BE1A 1N27A 4E7KA 3LGFA 4RG2A 3OYKA 1WJSA 2X4XA 3LYIA 4QVZA 2RJFA 2E5QA 5D6YA 5KCHA 2K3YA 3MEWA 4C5IA 2EQMA 2LVMA 3MP6A 4IUQA 5J26A 5M9OA 5KE2A 2RI2A 4E7LA 3NTIA 3META 3E9GA 2FHDA 3QJ6A 5IAYA 3L2VA 3FC3A 1G5VA 1SSFA 2RJDA 4BDYA 5FRNA 2QQSA 2G3RA 3OYBA 4E7JA 2MWPA 4IUTA 3H8ZA 4OVAA 2P0KA 2RI3A 1XNIA 3PMIA 3QIIA 2L3RA 2PQWA 2VYTA 3MEAA 3PMTA 4IUUA 3KUFA 3GOXA 2M0OA 2RHYA 3P8DA 2EFIA 2EQUA 2RHZA 3OYHA 2O4XA 3OYIA 4EDUA 3L2UA 4ZTJA 2DAQA 4IUVA 2LCCA 4HCZA 1H3ZA 5KCOA 5CIUA 3MO8A 2NLUA 4C5EA 2EKOA 4II1A 4BE0A 2LTOA 3L2WA 3UWNA 2GFUA 4L59A 3M9QA 1OYXA 2M16A 3OYCA 3DLMA 3ZEHA 2BIVA 2E6NA 3O8VA 3OYGA 4PLIA 3PNWC 3FLGA 2R58A 3MP1A 3LLRA 3E9FA 4A4HA 4IUPA 3OS2A 1RI0A 2DIGA 5KH6A 3LGLA 3NTHA 2X35A 2HQXA 3OA6A
chains in the Genus database with same CATH superfamily
5KYXB 2C06A 1O75A 4Z02A 2KVQG 3V7CA 3CCMT 3V8JA 5FROA 4M78F 4JRPA 3S6WA 2D0NA 2FPDA 3L42A 3S3MA 3VKIA 1KQSA 1D1BA 3MPUB 2E6ZA 4Q5WA 4JJNK 1U3OA 2IPOB 2MK5A 5HY6A 1ZLMA 2XKOC 3CCJQ 3L2RA 1K73U 4AFZC 3CCUT 1YIJQ 1R77A 3LWIA 2RD1A 4HVWA 5GAN2 4EIKA 2NUTA 5CKDA 2IIMA 2VV5A 1ZSZC 3VYHB 4DEXA 3REBB 4QW2A 3CCUA 4LD6A 2DE0X 5AT1B 4XAXB 1KSWA 1UTIA 1WA7A 1NLPC 1RAIB 3JCMf 2HBPA 1D1CA 2AHJB 2RJEA 3TU4K 4E7KA 3ULRB 2QTXA 4RG2A 4M77D 1UEBA 2X4XA 2KI7A 4LE9A 2K3YA 3MEWA 2LVMA 2JMAA 1NG2A 4M78C 5FRNA 2EJ9A 1RLQC 1E7DA 3OYBA 4OVAA 2ODGC 1Q86U 2VGMA 1X2QA 1Y96B 2DTIA 4FSSA 2E4HA 2GQVA 3R6OA 3KFVA 1E6GA 4BI8B 1VIEA 1IO6A 1VA7A 2QQBA 2DTOA 4M78D 4C5EA 2A08A 2EKOA 1JJRA 5IXFA 3M9QA 4JJCA 3CC4T 4PLIA 3JCMQ 1K9MR 4M78E 3ZL7C 2LJ0A 2JM8A 4AG2C 1D0ZA 1H641 2RQRA 4QVDA 2FPEA 3OYJA 3G4SQ 3CC4A 2X4YA 5LL6S 1CKBA 1ARKA 3L1AA 3HFOA 4JUVA 2RJCA 1TTHB 4CI0C 4Y92A 2KNBB 2E3HA 3SWNB 2ZPEB 3S3OA 1M90U 2EPDA 5LJ3h 2JN0A 3FIFA 1UGPB 5GAOr 1W4SA 3PE0A 4OGEA 3I56T 2RM4A 2BTTA 3T9NA 2DO3A 4B9XA 2CZ6B 3F70A 1NE8A 5FRMA 1UGRB 3OYAA 3CCQQ 1N8RC 5L23A 1IB8A 2YUPA 3TCJA 3QWXX 1AHJB 5KYWB 2QAZA 3G71T 2D9TA 2CSIA 1OU9A 2F2XA 2OTLT 3I56A 1YI2Q 4XTZA 1ZUYA 2GBQA 2GF7A 1VYVA 1YWOA 5FWBA 1V29B 4M7DA 1LPLA 2QEXQ 1X6BA 3OYKA 1WJSA 4ELYC 4C5IA 4IUQA 5KE2A 2VASA 2Y4YA 5GAN5 2NWMA 2FG0A 2OTLA 3I9QA 3URGA 1VQMT 3BDUA 3JB9F 2LCLA 1G3WA 2XD0A 1M4ZA 2QQAA 1ZA2B 3MEAA 2EYQA 5FWCA 1VQKQ 2LX7A 1OPLA 4DQ2A 1KC8U 2KVDA 2O4XA 1MGQA 1SSHA 1ZSGA 2HEQA 3A5ZB 3MO8A 1VQMA 4KBMB 4R56A 4OMFB 1IHVA 1PKTA 1M8MA 3CCVQ 3R6NA 3OW2P 4E7SA 1BIBA 2CP5A 1ZUKA 2VVKA 4IUPA 1AT1B 1Q82U 2JMCA 5KH6A 2EIFA 4N4IA 1SPKA 4E2FB 4XU2A 2A0FB 1WXTA 4P5NA 4M7DC 3X20B 4QKUA 2M51A 2YUNA 4C92G 1PG5B 3EFOB 1OULA 3OMGA 5IN1A 2ZZDA 4GLKA 4A54A 1RAAB 4PJMA 1OQKA 1D3BA 3C0CA 5LJ3j 1QCFA 1W70A 1D09B 3VS1A 1K73R 2LP5A 2DVEA 4M7DD 2KRNA 4C5GA 4OMPA 3I5SA 3SD4A 4F04B 1WZOA 3HRSA 5LJ3d 1YBYA 4F7UG 4E7ZA 2YSQA 4KRTA 4DBHA 2WACA 1KHCA 1YJ9Q 2G6FX 1TWBA 3C95A 3NPFA 3JB9D 3OYEA 3CCRQ 3QSUA 3QWYA 1BI0A 2AKKA 3CC7T 4PJNA 2SRCA 3Q1JA 5GANe 3EGXA 3EFSA 5GAN6 1A8VA 3FRNA 4EPCA 1NYGA 2L0AA 2E5QA 1ACMB 2HD0A 5M9OA 1K1ZA 4JZ3A 2RI2A 4PJOA 2DTHA 4HKEA 4BI3A 4JZ4A 5CVIA 1YHQQ 2KVUA 5IH2A 2KR3A 2FZCB 2YLBA 3CC7A 1GCPA 1VQPA 1QWFA 2JM9A 3H8ZA 1Q86R 2GQIA 5LJ5h 1G3TA 3GOXA 1Q81C 2EYXA 2V1RA 3L2UA 4J9EA 2OAWA 2RQUA 5GAMe 2NLUA 4D6WA 3HL8A 2D0QB 3J81E 1YJWT 3DLMA 1SEMA 5AYFA 4C92B 1W6XA 1JBMA 1WNLA 2DXTA 3LGLA 3EH2A 3NTHA 3HFNA 2LC4A 2X3XD 2QQRA 2C0OA 1N6AA 2PVDB 2ZPGB 2DEQA 2NUZA 1GCQC 5GAMd 3CMEQ 4PJOC 4AMCA 3EHRA 5GAOl 1K0XA 2EQJA 2KGTA 2CZ1B 1JU5C 4AFUC 2DXBA 4M7AF 3EG1A 2BKDN 1WJQA 3OB9A 4J9BA 1AWXA 4F7UB 2A3LA 4IURA 2KMTA 1OOTA 1SG5A 2DD5A 1AWJA 2JTMA 4JLGA 3M0RA 4BDZA 2C0TA 3CPWP 2DM1A 1NYFA 2D1XA 5GMKe 4PJOD 4JPBW 1Y02A 2MPXC 4EMKB 4J7IA 1VQOT 1VQ8A 4O6JA 3CCST 2OI3A 2QYZA 5HK3A 3EGDA 4NOYA 2CKKA 1BCMA 1TSFA 4HCBA 4VUBA 1O9SA 2DYIA 4QQGA 1AWOA 2X3WD 2MWOA 1VQLQ 1VQOA 1B7TA 1G3SA 3VUBA 3CCSA 1M2VA 5GANg 4FT4A 4J9DA 5LJ5j 4C0GA 3QJYA 2OTJT 4HCKA 1VQ4Q 2HSPA 3EG9B 3OBWA 1BI2A 2V1QA 3QIIA 4IUUA 1TUCA 3JCMP 4M7AC 1IGQA 1UECA 3RIRA 4HVVA 1SRMA 5LJ5d 3J7AF 3CCET 2BZXA 2PZ1A 1H3ZA 5KCOA 1M27C 2JW4A 3H41A 3UWNA 2GFUA 4OB0B 1UGSB 4C8QG 2BIVA 3O5ZA 3OYGA 2PUOB 3MCAB 1AWWA 1RL2A 2E12A 2YXYA 1YCSB 1QVFS 3CMAQ 2HKNA 2RF0A 1OV3A 4LUDA 3OS1A 5GANf 3LH0A 2QQ9A 2LJ3A 4M7AE 5KYYB 1XQHA 1UHCA 1R0CB 4LDYA 3EH1A 2QA4T 3QZ9B 2A28A 2V8JA 4Y28E 1NJIR 4RTUA 2YUOA 1KQSS 4J5YA 3UT1A 3TQ7P 5D7UA 4IIOA 2M02A 3A8GB 1K9MU 2HQEA 3CCLT 1HD3A 1QCNA 3OMCA 4OB1B 2EW3A 1HYOA 2RK2A 2QA4A 5J39A 1VQ5Q 5D6WA 3RKXA 2KBTA 1B34A 2XDDA 4X34A 2K9GA 5GAMf 4K11A 1MNEA 3H0IA 1ZA1B 4KGZB 3P8HA 5ECAA 3CCLA 2OX7A 4PFZA 2COYA 2CREA 5KE3A 1CSKA 1M3BA 3U23A 3QKJA 3AHUA 2L5QA 4LD9K 5GAN8 4F14A 3TEEA 2Y4XA 4RCCA 1X6GA 2HZYA 4RTYA 2K3BA 3MP6A 1M3CA 5DM7R 2COWA 3CXCP 2KW9A 1UFFA 4YTLA 4KUDK 2O31A 2PUKB 1UJ0A 2FPFA 5J3BA 5GMKm 5GAOq 2L3RA 3A1PA 2RMOA 3QHSA 4HA8A 4J9GA 2RHYA 4C8QB 1AZEA 1NEGA 2YRCA 2EQUA 1M1KR 2A36A 1YITT 4ZTJA 2LCCA 1KD1R 3UDCA 1M1KC 3JCMc 2CS7A 2MF2A 4JS4A 5A2QE 3SB2A 4BY6B 2XDBA 1PRMC 1U1TA 1C0MA 4XU3A 1RLPC 3LLRA 2LD7A 4AT1B 4CC2A 2J6OA 1HK9A 2RK1A 2DFUA 1YITA 3HRUA 1K8AC 1JEGA 1M9SA 4FYVB 2F5TX 2X4JA 3DB3A 4RUGA 1H3HA 2DXUA 2GFAA 1OPKA 2OJ2A 4AFQC 2LNVA 1ZSZA 2MAMA 3CCJT 1V66A 3CEYA 1YIJT 1TH7A 1HJDA 3SWNC 4NS5A 4A4KA 3OYNA 2AZVA 1QVFA 1H9EA 2JUFA 3EG3A 4LDWA 1TS9A 2B86A 2LNHB 1K76A 4M75F 3ASKA 3CCJA 3JCMg 2LQNA 4J6WA 4E7IA 1YIJA 3VS0A 5GAN4 4M78A 1LOJA 4A4FA 2L2PA 2FRYA 2RA2A 1VQ9Q 3JB9I 2RPNA 3GP8A 2XK0A 4C5HA 1QVGP 3OYYA 3HKSA 4OP0A 1JRIA 3DKMA 3S3NA 3HRTA 1S72Q 5C0MA 1RAHB 4BE1A 2P0PA 5IXBA 1G2BA 3X24B 4LDVA 1VYTA 5I21A 4PFOA 1ZS9A 1V1CA 4FM4B 2RJFA 1ZBXA 4KGVB 2LT1A 3GBQA 3OSVA 2HMAA 2FYKA 4DBRA 3BY7A 2KRSA 2RJDA 1LNXA 3KBGA 1BIAA 3RESA 2G80A 3PTAA 1SF9A 2ZPFB 2PQWA 4KULA 4KH0B 3KUFA 3CQTA 2KAFA 4PKCC 2X51A 1X01A 1GXIE 1G3YA 3CCMQ 3L2WA 1MV0B 3QO3A 3OYCA 5DLQE 1JB0E 1WXUA 2HKQB 3EFRA 3VS7A 2K2MA 4TVRA 3G4ST 1S1NA 4RTXA 2O2OA 2BZ8A 3FDRA 4C0FA 2DBMA 2F69A 2J06A 2NUPB 1E6HA 1OZ2A 1WHMA 2YT6A 4M75E 3QYHB 5KYUA 3G4SA 3ZFJA 3UATA 3JCMW 2VUBA 4M77G 4M75G 5CO7A 4FW2A 3CCQT 5A0LA 2EKHA 4FCYA 2FL7A 2EAYA 2ZGWA 4N0AC 2RHXA 4C92F 2WSFE 2O9SA 1OI1A 5GAOn 1VOMA 2QGFB 1SHFA 1YI2T 3G6EQ 2JZ2A 4BD3A 3BDLA 1PHTA 4WCIA 3CCQA 4GY5A 1UGVA 4LDUA 2QEXT 4MZMA 2Y90A 4JDSA 4PNOA 4UC4A 3M57A 3OYDA 1QVGS 1M30A 2E10A 3N5BB 4GBQA 1TUDA 1N8RR 1IRXA 4DBQA 4J7FA 1YI2A 3NMZC 4MMLA 1GJJA 2HL3A 4F7UF 3M55A 1VQ6T 2QEXA 1I8FA 2ED1A 2EGCA 3M0TA 2HJQA 2J6KA 1B3QA 4Y91A 2DZCA 3HHTB 1WDXA 2J7IA 3G1JA 4IUVA 3CCVT 2KVEA 4EMKA 1VQ6A 3L0OA 2LTOA 1VQKA 4L59A 1GBRA 1GFDA 1BU1A 4LNPA 4IIMA 2A37A 3RERA 1PCXA 4BUGA 1TXQA 3VRZA 4C92C 2ABLA 1Y57A 2ZPHB 1QLYA 2RQVA 5GAN7 3CCVA 2ZCFB 1VYUA 1GL5A 2E1HA 2RQWA 2F5KA 3NHNA 3TVTA 4WF2A 2SEMA 1VQNQ 1ZHIA 4M77B 4C92D 4M75B 2YRVA 1YJNT 2KQWA 2DX1A 2GNCA 2QNFA 5A0GA 3EG0A 2R5AA 3CBOA 4NL3A 3G71Q 5HKCA 4N4GA 4C92E 5CKFA 2EBPA 5LJ3e 4HT9A 1JQQA 3NGPA 1BKBA 3X26B 4GLMA 2XIDA 2QXFA 2CT3A 1YJNA 3IQLA 4B6MA 2L8DA 4EMKC 2X4WA 4FYXB 5IHIA 3CCRT 1XOVA 2CUBA 3VU3C 1NJIU 1ZUUA 4QT7A 4JLIA 4XK8E 4J9FA 4RMOA 2L3SA 1YJ9A 4R55A 1YP5A 1QQJA 4F7UE 3CCRA 2NUTB 3M56A 1UGQB 1YHQT 3C12A 3JCMV 2YLCA 1TU0B 2ZPIB 2DXCA 1UG1A 3QJ6A 3EG2A 2KY9A 1HXDA 5GAN3 3QG1A 1WI7A 2QTVA 5FU7B 3VUZA 3UA6A 1QVGA 4BB7A 1FMWA 1YHQA 1VQPT 3M0QA 3X28B 2RHZA 3M59A 2MCNA 5CIUA 2EYZA 3CD6Q 1GCQA 4E47A 3GLXA 1Y71A 3A8OB 2BE7D 1Z9ZA 2LZ6B 1WFWA 4DOWA 3MP1A 2K5LA 2XMFA 1Q81R 2DL7A 2JXBA 3HPWA 2EJGA 2DL5A 3CMET 2JVWA 1M1KU 3UA7A 1D0XA 4CC7A 3RDVA 1KD1U 8AT1B 2H3EB 1I4K1 4XTWA 1LCKA 3QXEB 3PVQA 2CZ0B 4C8QF 3OW2S 1OEBA 1PSEA 1K8AU 2DZ9A 3CMEA 1VQ7T 2P4RA 4RG8A 2EJFA 1M2OA 3GPLA 3CC2Q 1FYNA 4KH1B 3INZA 1NBEB 5LJ3g 1X75C 4J9HA 1VQ7A 4BITA 3TSZA 1BB9A 4HT8A 3GIBA 1VQLT 1VQ8T 1WX6A 1JXOA 5A0DA 5C6SA 1XJWB 4M7AA 2K5FA 3H0FA 3LGFA 4HVUA 2E3IA 3LH5A 5D6YA 1PM3A 1PKSA 3M5AA 4E7LA 3WVDB 2FHDA 2V26A 1KQ2A 1SSFA 1W1FA 1VQLA 4DOVA 1RAEB 1JEIA 2M0YA 1YJWQ 2P0KA 2YWWA 3SEMA 1M90C 3FB9A 4C0DB 5CR2A 5KYXA 2KXDA 4AG1C 4BI4A 4C8QC 5LJ5e 1VQ4A 2COZA 3OYHA 3OYIA 1JO8A 4O5VA 5LJ3f 3H9NA 2CDTA 4DA4A 2KSSA 2LQWA 2KFVA 1KK7A 1FWZA 4OMMA 1IHWA 1OYXA 4OMLA 2MPHA 4CC3A 2OAUA 3ZEHA 4XTYA 4BY6C 3JCMh 4LXCA 1A62A 2CP6A 3CMAT 2F2VA 3OS2A 4C8QD 4QVCA 1NM7A 1QW1A 2DIGA 1KJWA 3M58A 2HL5C 2X9HA 4WTOB 2EGEA 3D7SB 2QI2A 2O4XB 2RNAA 3H6ZA 4C8QE 1WHLA 5KYNA 3ME9A 5FU6B 4E6RA 4MDXA 3CMAA 2ROLA 2QK0A 2DD4A 3LX7A 3JB9J 5GAMg 2JTFA 3MEVA 3GNGA 2F1LA 2VWFA 2RH2A 2H8HA 2L89A 1I0CA 1B07A 2DPPB 5L8RE 4M7AD 1BK2A 1NPRA 2V8IA 1VQ5T 4BE2A 2YHTA 2I0NA 4BACA 1A0NB 2KE9A 1KC8C 2I2LA 4PL6A 3SHWA 2DVJA 4KT0E 4FL6A 2P0QA 3EAEA 4ATOA 2ED0A 1D3BB 3OQ5A 1VQ5A 3OW2A 1Y96A 3MP8A 2XU8A 1X6OA 5I22A 2OTJQ 2HDAA 3I55Q 3PFSA 5IHNA 2B8AA 3QBYA 2L3QA 3SFMA 5CKHA 4OB2B 1GBQA 2IVWA 3CPWS 4KGXB 2MI6A 3CCEQ 4XTXA 3L2VA 2RN8A 1QP2A 5GMKl 1M3AA 4ELZC 1QP3A 4OMNA 1WHJA 1RI9A 4DEYA 1OU8A 2VYTA 3PMTA 5CQYA 1PD1A 2DK4A 1XTDA 2EFIA 3EGXB 4EDUA 2J05A 1N8RU 2DA9A 5LJ5g 1WXBA 3WXMB 4X1VA 3PT9A 2E6NA 4MZTA 1TOVA 4M4ZA 3SWNA 4XU0A 1RAFB 3FJPA 1T0HA 2AK5A 2DF6A 1V76A 1X2KA 2DL4A 2X35A 4OB3B 2DETA 1NZ9A 2LMJA 5DY9A 4QQDA 5FLXE 2FZGB 4QQ6A 3P8BB 2KK4A 4C0ZA 2R5MA 4A4EA 1X69A 1WHGA 1Q7YC 1E7OA 5KYWA 4ZGDB 2JVVA 5I2MA 1QKXA 9ATCB 4PLLA 2DILA 1K8AR 2CT4A 2L3PA 4FSXA 2MYSA 2DL3A 3OY9A 4LUEA 2LQKA 1ABQA 3BE3A 1U1SA 3M54A 2CYZB 2XHCA 5LJ5f 1U8RA 2EWNA 2ATCB 3DLLA 1VQ9T 1YWPA 2DLPA 1W2BP 1D0YA 1FX7A 2VGNA 1GFCA 2XI9A 3KXTA 6AT1B 3M53A 1S72T 2XG8D 2EYYA 4ME7A 7AT1B 1A63A 1M1GA 1Y7XA 1YCYA 1VQ9A 1N27A 4M77F 5I2SA 4F16A 1T3LA 2RQTA 3VYGA 1R8OB 5CQXA 2RB6A 1S72A 4MMKA 4DBFA 1G5VA 1AD5A 1MMNA 2LX9A 4BDYA 1Z9QA 4IUTA 3EGDB 3OS5A 1C6VX 3VS6A 5IHKA 3PMIA 5CKEA 3RKYA 1EFNA 1Y07A 2E70A 2HQHA 1MMDA 1M5Q1 1H8KA 2VB6A 3A8HB 5GJWB 3CPWA 3EFOA 5I11A 1UHFA 3PIPA 3NFCA 1M2VB 2K5IA 3VS4A 4R0KA 3CXCS 1AEYA 3CCMA 3CPFA 2PNIA 1BI1A 4X9CA 3VS5A 1BBZA 2HQXA 1UJYA 2RNNA 2WSEE 2PU9B 2RHUA 1I81A 2A7YA 2LCSA 4N0AA 4OMQA 4M77C 2W10A 4M75C 1D1AA 4HXJA 1MNDA 2RHIA 5EC7A 2E65A 2W51A 1N5ZA 4JS5A 1WHKA 2C0IA 2JS0A 4B9WA 1Q81U 4CRIA 4N4HA 1FMVA 3CCUQ 4OMOA 2JOYA 4M75D 3V7SA 3G6ET 3THKA 2QNCA 3HSBA 1OX8A 3M0UA 2K57A 1NEBA 1AOJA 2RO0A 1WGSA 1UUEA 2HBWA 2XDPA 1JEQA 4M77E 5GJVB 1DJ7B 1W2BS 1MV3A 2K3XA 3M4GA 8ATCB 4OF1A 3TREA 1Q95G 4FU6A 3G6EA 1EN7A 1IXDA 4D8KA 4NL2A 1B34B 5J26A 4RTWA 1UDLA 2DJZA 2ENMA 3E9GA 1RUWA 5IAYA 2KYMA 4CC4B 1M1FA 1RAGB 2QQSA 1EIFA 3A8LB 5FU7C 4C92A 5CKBA 5EG2A 1YN8A 1KHIA 1K9MC 4EMGA 2QDYB 4M78G 4XU1A 2D8HA 1GKUB 4JJDA 2KDSA 2K6DA 1VIFA 2AKLA 4MZPA 2WSCE 4MDWA 5GMKi 1UE9A 3CBMA 1AVZC 4F17A 2GGRA 4RCBA 2KT1A 3O8VA 3MJXA 4PFPA 2R58A 3BFMA 1VQKT 2J6FA 1FXXA 1F1BB 3CC4Q 4J6XA 4F7UA 3RNJA 3VS3A 4JRKA 1PNJA 5D6XA 1VQNT 3OYLA 1IGUA 3GF5A 2PVOB 3RMQA 2RNOA 3OS0A 3CXCA 4RTTA 5HK0A 1MUZA 1KG1A 4M7DF 1TUGB 4ESRA 2LQ8A 1VQNA 3QYGB 1ZQ1A 1CKAA 2JTEA 1I5LA 1OX9A 3A8MB 1SHGA 4IKFA 3L2QA 3M0SA 3E19A 2DK3A 2JJ9A 3I56Q 3G71A 3V7RA 1ZSZB 2M9UA 4FT2A 1JXMA 3ER0A 3EG9A 2LRQA 4FW1A 1KIKA 1R0BG 2DERA 1VQ6Q 5GANh 2OTLQ 1FMKA 2O01E 3HP9A 5KCHA 1YNZA 1YJ9T 2EQMA 3TSWA 4JRIA 4L6V5 4LDXA 3FC3A 4M78B 4J8OA 1QCOA 1SKUB 2E41A 1W2BA 4ZNXA 2P84A 2RI3A 2ZAEA 5CAIA 1VQMQ 4C0DC 5GAMh 3CD6T 2XICA 2K79A 4HCZA 2DYBA 1G83A 5KYYA 4OGCA 1EZZB 4BE0A 3M4YA 1TG0A 2FZKB 2LT4A 2AT1B 2GCXA 2NYSA 4FYWB 3RMSA 2Z0WA 5CCAA 1YJNQ 3CD6A 1K73C 2F2WA 4UZWA 2KROA 2V8KA 1H92A 2BZYA 1YFNA 2HNIA 4M7DE 4ZTFA 2BE9B 4PJLA 4RTVA 5FU6C 1AZGB 2BUDA 2QDLA 5FW9A 2FB7A 1I1JA 1K9AA 2EVRA 4M7DG 1WQ7A 2CH4A 3JSCA 1WIEA 3SDZA 3NTKA 1SRLA 3MEUA 3CC2T 5GMKh 4JJBA 4RTZA 4FIBA 2IG0A 3RKWA 4PJOF 1VUBA 4D8DA 2O88A 1Q7YU 3JB9G 1X43A 1WJRA 2CH4W 3A98A 5GANj 2H3JA 1HSQA 3CC2A 2DKGA 1K0SA 3VJPA 5KYUB 1JJ2P 4XQ3A 3JCMJ 4Z88A 2JT4A 1Q86C 3FEOA 3QDRB 3QZ5B 4LN2A 4C8QA 1GRIA 2ECZA 2LC3A 5GANd 3CC7Q 1U5SA 1RADB 1VQPQ 3BW1A 3LYIA 1PSFA 3V8LA 2MMPA 3META 2DJQA 1QVFP 5GAMj 3M0PA 4FYYB 1G8XA 4XTUA 2GTOA 2D8JA 1QKWA 2M0OA 4J9CA 3P8DA 1YJWA 2DAQA 2ZPBB 3C94A 1PWTA 4PJJA 1KQSP 2CP2A 1VQ4T 3MKDA 3PVLA 2VXEA 2JNGA 4EMHA 4ZN1A 3PNWC 4RKUE 2K2VA 1WPYA 2VKNA 1WQWA 1M90R 2YRDA 3X25B 3OBYA 1BYMA 3WVEB 3OA6A 3JCMb 1K4US 4M7DB 1VQ7Q 2KYBA 2PVGB 2KXCA 1Y0MA 3JAME 2ESWA 3G7ZA 2KRMA 2RI5A 1KQ1A 2VC8A 2A8VA 1IREB 4V2SA 3OYFA 5GMKj 3JB9H 2YUQA 4PJOE 4E7HA 1T3SA 5GAOm 3QUIA 1LJOA 2HAXA 4PJOG 3LWHA 4ORZA 1VQ8Q 1NPPA 3J80E 2KT8A 4ZN3A 1KFZA 3H0HA 2R57A 3OYMA 3I55T 2DRMA 4AFSC 1BI3A 3REAB 2JS2A 1VQOQ 1WLPB 2M1HA 3CCSQ 1UB4A 1JJ2S 2CUDA 1MMAA 1KC8R 3QDFA 4L5GA 4KUIA 2DL8A 2DNUA 1QVPA 1RABB 2YDLA 4JRQA 4QVZA 4XTVA 2OTJA 3PIOA 3VS2A 3E2UA 5HCKA 3I55A 3JV3A 3L2ZA 4J83A 1PD0A 2W0ZA 2G3RA 2MIOA 1EX4A 3PGGA 4J6YA 4E7JA 2MWPA 1Q82R 1ZX6A 4ANJA 1ABOA 2D6FA 3CCEA 1Q82C 1ZBJA 1ZBHA 2MOXA 2E5KA 2EYWA 2KEAA 3FJ5A 1IZ6A 2PTKA 3JRZA 2EGAA 1I5OB 2NUPA 1WYXA 1PC0A 2M16A 4M7AG 3EHQA 2DEUA 3I35A 1NJIC 2K4YA 1QMCA 1RI0A 1WHHA 3MHXA 3JCMe 3ZBDA 2CP3A 2FEIA 2HCKA 3HTRA 4ZGJB 3AT1B 2ODCI 2DMOA 4PJOB 1MMGA 2EQKA 3UF4A 1I07A 2GTJA 2QA4Q 2VXFA 2CP0A 1MHNA 3DB4A 2DRKA 2QG9B 3CBPA 2ROTA 1H9FA 3JCMd 3LW5E 5CK9A 1E7LA 2K7AA 2P4TA 3V8KA 1T0JA 2DIQA 3CCLQ 1P92A 3EGUA 2CGHA 4X9DA 2CZ7B 3UPUA 2QGGA 1U06A 1Q7YR 1OZ3A 3C4SA 2FRWA 1H1JS 4A4GA 2AIRB 3RBBB 4A53A 1GL9B 2FVUA 2LDMA 1NLOC 2AZSA 2CSQA 2WQGA 2DBKA 2HSEB 4ZGEB 1YNSA 4Z8AA 4HCCA 2FO0A 2E64A 1N9RA 4Z89A 1KD1C 3RR6A 3NTIA 1C1AA 4J9IA 1LVKA 2EQIA 1RACB 1BCOA 4PK4A 1PRLC 1XNIA 1JJ2A 2CP7A 2LJ1A 2O9VA 3RUXA 5GAOp 1N9SA 5IT9E 4M7AB 1M8VA 4II1A 1QWEA 3QPHA 4M77A 3VRYA 1YITQ 3GNFB 4M75A 2QASA 3FLGA 3OSSC 1X27A 3E9FA 3I5RA 5DLOA 3E1SA 3JCMX 3VV0A 1J3TA 4A63B 4A4HA
chains in the Genus database with same CATH topology
4JRKA 2C06A 3HPWA 1O75A 5D6XA 4Z02A 2KVQG 2EJGA 3V7CA 3OYLA 1VQNT 3CCMT 3V8JA 5FROA 3CMET 4M78F 3GF5A 5GANf 3OS1A 4JRPA 3LH0A 2PVOB 2QQ9A 3S6WA 3RMQA 1M1KU 4M7AE 1KD1U 3L42A 1XQHA 3S3MA 4LDYA 2QA4T 3VKIA 1KQSA 3QZ9B 2V8JA 3OS0A 2E6ZA 1I4K1 4Q5WA 4Y28E 5HK0A 3CXCA 4JJNK 4XTWA 1KQSS 3QXEB 1KG1A 4J5YA 5HY6A 2XKOC 2CZ0B 3UT1A 4C8QF 3L2RA 1K73U 4M7DF 3A8GB 2LQ8A 3CCUT 3OW2S 1PSEA 2HQEA 2DZ9A 3QYGB 3LWIA 1ZQ1A 2RD1A 3CCLT 1K8AU 3CMEA 1VQ7T 3OMCA 4OB1B 1I5LA 5GAN2 4RG8A 2RK2A 2EJFA 3A8MB 3GPLA 4IKFA 2QA4A 5J39A 5CKDA 3L2QA 5D6WA 3RKXA 1B34A 3E19A 2XDDA 2DK3A 3INZA 2VV5A 4X34A 3G71A 5GAMf 5LJ3g 3V7RA 1X75C 3VYHB 2M9UA 4QW2A 3CCUA 4FT2A 3CCLA 3P8HA 3ER0A 4LD6A 1VQ7A 2LRQA 4XAXB 4HT8A 5KE3A 3GIBA 5GANh 3QKJA 1VQLT 3AHUA 2L5QA 1VQ8T 4LD9K 3JCMf 5A0DA 2HBPA 5C6SA 5GAN8 4M7AA 2AHJB 2K5FA 2RJEA 3TEEA 3TU4K 4E7KA 2Y4XA 2O01E 2QTXA 3HP9A 3LGFA 4RCCA 4RG2A 4M77D 1UEBA 2X4XA 5D6YA 5KCHA 1YJ9T 2K3YA 3MEWA 2EQMA 2LVMA 3MP6A 4JRIA 5DM7R 3M5AA 4E7LA 3WVDB 4L6V5 2FHDA 4LDXA 4M78C 4M78B 4YTLA 1SSFA 4J8OA 3FC3A 1KQ2A 1VQLA 2E41A 4DOVA 1W2BA 2EJ9A 3OYBA 4KUDK 5FRNA 2PUKB 4OVAA 2P0KA 1Q86U 2RI3A 2VGMA 1Y96B 2DTIA 5J3BA 5GMKm 1M90C 5GAOq 5CAIA 3FB9A 2GQVA 2L3RA 3R6OA 4C0DC 4C0DB 5CR2A 3QHSA 4HA8A 5GAMh 2RHYA 4BI8B 4BI4A 4C8QB 4C8QC 3CD6T 5LJ5e 1VQ4A 1VIEA 2EQUA 2XICA 3OYHA 2QQBA 3OYIA 4ZTJA 1YITT 4O5VA 2DTOA 2LCCA 4HCZA 4M78D 5LJ3f 3UDCA 4DA4A 2KSSA 4C5EA 4OGCA 1M1KC 2EKOA 4BE0A 3JCMc 2CS7A 1FWZA 2MF2A 3M9QA 3M4YA 4JS4A 1OYXA 5A2QE 2OAUA 2LT4A 3ZEHA 3CC4T 3SB2A 4XTYA 4BY6C 4BY6B 2XDBA 2GCXA 4PLIA 3JCMh 1U1TA 3JCMQ 4XU3A 3CMAT 3RMSA 3LLRA 4M78E 5CCAA 3OS2A 4C8QD 4QVCA 3CD6A 1HK9A 1QW1A 2DIGA 2RK1A 1K73C 1YITA 3M58A 3HRUA 1K8AC 1M9SA 2F5TX 2X4JA 3DB3A 1H641 2V8KA 2QI2A 2DXUA 4QVDA 2O4XB 2HNIA 2GFAA 3H6ZA 3CC4A 3OYJA 4C8QE 4M7DE 4ZTFA 2X4YA 5LL6S 3ME9A 5FU6C 5FU6B 2LNVA 3L1AA 2BUDA 2MAMA 3HFOA 2RJCA 4JUVA 3CMAA 3CCJT 4MDXA 2FB7A 4CI0C 2DD4A 3CEYA 1YIJT 4M7DG 3LX7A 1TH7A 5GAMg 3JB9J 1WQ7A 2JTFA 3MEVA 3SWNC 2ZPEB 3SWNB 4NS5A 3S3OA 3GNGA 4A4KA 3OYNA 3JSCA 1M90U 2RH2A 2L89A 3SDZA 1QVFA 5L8RE 2DPPB 3NTKA 4M7AD 2V8IA 1NPRA 3MEUA 5LJ3h 1VQ5T 2JN0A 3FIFA 1UGPB 2YHTA 5GMKh 4BE2A 2JUFA 5GAOr 3CC2T 4LDWA 1W4SA 4BACA 4FIBA 4OGEA 2IG0A 3RKWA 3I56T 2RM4A 4M75F 3T9NA 2DO3A 3ASKA 4PJOF 2CZ6B 4B9XA 3CCJA 3JCMg 1KC8C 2I2LA 4J6WA 4PL6A 1VUBA 4KT0E 4E7IA 3F70A 1NE8A 1YIJA 4FL6A 5FRMA 1UGRB 3OYAA 1Q7YU 1N8RC 2P0QA 3JB9G 3EAEA 1WJRA 5GAN4 1VQNA 4M78A 3TCJA 4ATOA 5GANj 2H3JA 1D3BB 1LOJA 3OQ5A 4A4FA 1AHJB 1VQ5A 2RA2A 3JB9I 2DKGA 3CC2A 3OW2A 3G71T 2D9TA 3VJPA 1Y96A 2OTLT 3MP8A 3GP8A 4XQ3A 3JCMJ 2XU8A 2XK0A 4C5HA 1X6OA 3OYYA 3HKSA 3I56A 3FEOA 1Q86C 4XTZA 3PFSA 2GF7A 3QDRB 4OP0A 1JRIA 3QZ5B 1V29B 2B8AA 3DKMA 3S3NA 3HRTA 4C8QA 4M7DA 5C0MA 3QBYA 4BE1A 2P0PA 3SFMA 5CKHA 3X24B 5GANd 3OYKA 4LDVA 5I21A 4OB2B 1WJSA 2IVWA 3BW1A 3LYIA 2RJFA 4FM4B 1ZBXA 4ELYC 2LT1A 4C5IA 4IUQA 3CPWS 1PSFA 5KE2A 2Y4YA 3OSVA 5GAN5 3V8LA 2MMPA 3META 2MI6A 2FYKA 4XTXA 3L2VA 2OTLA 3URGA 1VQMT 3BDUA 2RJDA 3BY7A 1LNXA 3KBGA 1BIAA 3JB9F 1QP2A 2LCLA 5GMKl 4ELZC 5GAMj 1QP3A 3RESA 1G3WA 3PTAA 2XD0A 1M4ZA 2QQAA 4XTUA 2ZPFB 2PQWA 2VYTA 2EYQA 3MEAA 3PMTA 4KULA 3KUFA 5CQYA 2M0OA 4DQ2A 2KAFA 1XTDA 4PKCC 1KC8U 3P8DA 2EFIA 1YJWA 2O4XA 4EDUA 1MGQA 2DAQA 1X01A 2ZPBB 3C94A 1G3YA 3A5ZB 3MO8A 1N8RU 1GXIE 1VQMA 4KBMB 5LJ5g 4R56A 3L2WA 1VQ4T 4OMFB 3WXMB 3PT9A 2VXEA 2JNGA 3QO3A 3OYCA 2E6NA 4MZTA 4EMHA 5DLQE 4ZN1A 3PNWC 4RKUE 3SWNA 1BIBA 2K2VA 1WPYA 3FJPA 4XU0A 1WQWA 3X25B 1JB0E 3OBYA 4IUPA 1BYMA 3EFRA 1Q82U 5KH6A 4TVRA 2EIFA 3WVEB 2X35A 4N4IA 3G4ST 3OA6A 4OB3B 3JCMb 4XU2A 1NZ9A 4P5NA 4M7DC 3X20B 5DY9A 4M7DB 2PVGB 4QQDA 4C92G 3JAME 5FLXE 3FDRA 3P8BB 4QQ6A 4C0FA 2KK4A 3OMGA 2R5MA 2ZZDA 5IN1A 4A4EA 4C0ZA 3G7ZA 4GLKA 2RI5A 4A54A 2F69A 1KQ1A 1Q7YC 1D3BA 2VC8A 1OZ2A 5LJ3j 1IREB 4V2SA 4ZGDB 3OYFA 5GMKj 3JB9H 2JVVA 4M75E 3QYHB 5I2MA 4PJOE 4E7HA 3G4SA 2DVEA 4PLLA 3ZFJA 5GAOm 3QUIA 3JCMW 4M7DD 4FSXA 2VUBA 1LJOA 4M77G 4M75G 2HAXA 5CO7A 4PJOG 4C5GA 3OY9A 3LWHA 2LQKA 3CCQT 5A0LA 1U1SA 3SD4A 2FL7A 3M54A 1NPPA 3HRSA 2CYZB 2XHCA 5LJ5f 5LJ3d 3J80E 1YBYA 4ZN3A 1U8RA 4F7UG 2EAYA 2EWNA 1VQ9T 3DLLA 2ZGWA 4N0AC 2RHXA 4C92F 2R57A 2WSFE 2WACA 1KHCA 3OYMA 1OI1A 5GAOn 1YI2T 1FX7A 2VGNA 3I55T 3C95A 2JZ2A 2XI9A 3BDLA 4BD3A 3KXTA 3JB9D 3M53A 3OYEA 1BI3A 1S72T 3QSUA 3CCQA 2XG8D 4GY5A 4LDUA 1BI0A 2QEXT 2M1HA 4ME7A 1UB4A 4MZMA 1JJ2S 2Y90A 4JDSA 4PNOA 1M1GA 1Y7XA 3M57A 4UC4A 3OYDA 3CC7T 1QVGS 4L5GA 4KUIA 3Q1JA 2E10A 1YCYA 3N5BB 5GANe 1VQ9A 3EFSA 1N27A 4M77F 5GAN6 5I2SA 1QVPA 3FRNA 4EPCA 4JRQA 4QVZA 2E5QA 4J7FA 2HD0A 4XTVA 5M9OA 3PIOA 1YI2A 2OTJA 3VYGA 3I55A 1R8OB 2RI2A 5CQXA 4MMLA 4PJOA 2DTHA 2RB6A 4HKEA 3L2ZA 4J83A 4BI3A 5CVIA 1S72A 4MMKA 1G5VA 4F7UF 2LX9A 3M55A 1VQ6T 2QEXA 1I8FA 4BDYA 2YLBA 2G3RA 3CC7A 3PGGA 4J6YA 4E7JA 1VQPA 2MWPA 4IUTA 3H8ZA 3OS5A 5LJ5h 1G3TA 3PMIA 2D6FA 5CKEA 3RKYA 3CCEA 1Q82C 1Y07A 2E70A 4Y91A 1M5Q1 3GOXA 1Q81C 2DZCA 3HHTB 3L2UA 3A8HB 4IUVA 3CPWA 3CCVT 1IZ6A 3JRZA 5GAMe 4EMKA 2NLUA 1VQ6A 4D6WA 3HL8A 3PIPA 2LTOA 2K5IA 3NFCA 1VQKA 2D0QB 4L59A 3J81E 1YJWT 2M16A 4M7AG 3DLMA 3RERA 4BUGA 3CXCS 1NJIC 5AYFA 4C92C 4C92B 2K4YA 2ZPHB 1RI0A 3CCMA 3CPFA 1JBMA 3MHXA 3JCMe 1WNLA 1BI1A 2DXTA 4X9CA 3ZBDA 3LGLA 3NTHA 5GAN7 3CCVA 2HQXA 2ZCFB 3HFNA 2LC4A 2QQRA 2WSEE 2E1HA 2PU9B 1N6AA 2PVDB 2RHUA 2ZPGB 2DEQA 2F5KA 4ZGJB 1I81A 2A7YA 4WF2A 4N0AA 1ZHIA 1K9MU 5GAMd 4M77C 4M77B 4M75C 4M75B 4C92D 4PJOB 4PJOC 2EQKA 2YRVA 1YJNT 2KQWA 5GAOl 2EQJA 2CZ1B 2RHIA 2E65A 2DXBA 4M7AF 2VXFA 4JS5A 5A0GA 2BKDN 1WJQA 1MHNA 2R5AA 3DB4A 3OB9A 3CBOA 4F7UB 4NL3A 4B9WA 2A3LA 4IURA 5HKCA 1Q81U 2KMTA 3CBPA 4N4GA 4CRIA 2DD5A 4C92E 3LW5E 5CKFA 4JLGA 2JTMA 5CK9A 4N4HA 3JCMd 2P4TA 3V8KA 4BDZA 2DIQA 5LJ3e 4HT9A 3X26B 1BKBA 1P92A 2JOYA 2XIDA 5GMKe 2CGHA 4M75D 2CZ7B 4X9DA 2QXFA 3V7SA 3UPUA 1YJNA 4PJOD 1OZ3A 3G6ET 2L8DA 4EMKC 4EMKB 3C4SA 2X4WA 3HSBA 3CCRT 2K57A 4J7IA 1VQOT 2RO0A 4A4GA 1XOVA 1WGSA 4O6JA 1VQ8A 4A53A 3CCST 2XDPA 3VU3C 1NJIU 5HK3A 4M77E 2FVUA 4NOYA 1DJ7B 2CKKA 2LDMA 1W2BS 4JLIA 4HCBA 4XK8E 2K3XA 4VUBA 1O9SA 3M4GA 4RMOA 4OF1A 3TREA 4ZGEB 1YJ9A 4QQGA 4FU6A 4R55A 3G6EA 2MWOA 4F7UE 4HCCA 3CCRA 2E64A 3M56A 1UGQB 1YHQT 1VQOA 1N9RA 4NL2A 1G3SA 3C12A 3JCMV 2YLCA 1B34B 3VUBA 5J26A 5GANg 3CCSA 1KD1C 4FT4A 2ZPIB 3NTIA 2DXCA 2DJZA 3E9GA 3QJ6A 5IAYA 2KY9A 5LJ5j 1HXDA 1M1FA 4C0GA 3QJYA 2QQSA 2OTJT 1EIFA 3A8LB 5GAN3 3QG1A 5FU7C 5FU7B 4C92A 5CKBA 3OBWA 5EG2A 1BI2A 1XNIA 3VUZA 1JJ2A 1KHIA 3RUXA 4EMGA 3QIIA 1K9MC 1QVGA 5GAOp 2QDYB 1N9SA 4IUUA 4BB7A 4M78G 5IT9E 4XU1A 1YHQA 1VQPT 3JCMP 4M7AC 4M7AB 3X28B 3RIRA 2RHZA 5LJ5d 2KDSA 3J7AF 3M59A 3CCET 1M8VA 1VIFA 1H3ZA 5KCOA 5CIUA 2WSCE 4MDWA 4MZPA 4II1A 5GMKi 4E47A 3QPHA 3CBMA 4M77A 2GFUA 4OB0B 3UWNA 3GLXA 1UGSB 1Y71A 3A8OB 3GNFB 4M75A 4C8QG 2BIVA 4RCBA 3O8VA 3OYGA 2PUOB 3MCAB 3FLGA 4DOWA 3OSSC 1RL2A 2R58A 3BFMA 3MP1A 1VQKT 2K5LA 1FXXA 3E9FA 2E12A 4J6XA 4F7UA 5DLOA 3E1SA 3JCMX 3VV0A 1QVFS 4A4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D6X A;  2QQR A;  4Z02 A;  3DB3 A;  3OYL A;  2RHU A;  4QQD A;  5FRO A;  3OS1 A;  2O4X B;  3LH0 A;  2F5K A;  2GFA A;  3FDR A;  3H6Z A;  4QQ6 A;  3S6W A;  3OYJ A;  3OMG A;  5IN1 A;  2R5M A;  4ZTF A;  2X4Y A;  4A4E A;  3L42 A;  3ME9 A;  2RI5 A;  3S3M A;  2BUD A;  2RJC A;  3CEY A;  3OS0 A;  2EQK A;  1OZ2 A;  2YRV A;  4Q5W A;  3LX7 A;  3OYF A;  2JTF A;  2EQJ A;  3MEV A;  2RHI A;  4NS5 A;  4E7H A;  3S3O A;  3UT1 A;  3L2R A;  3OYN A;  4PLL A;  2L89 A;  2BKD N;  1WJQ A;  1MHN A;  2HQE A;  2R5A A;  3DB4 A;  3NTK A;  3MEU A;  3OB9 A;  4B9W A;  4IUR A;  4BE2 A;  3OMC A;  4N4G A;  4C5G A;  4CRI A;  3OY9 A;  4BAC A;  4N4H A;  2IG0 A;  4BDZ A;  4B9X A;  2DIQ A;  3ASK A;  3SD4 A;  4IKF A;  5J39 A;  4PL6 A;  3L2Q A;  5D6W A;  4E7I A;  3F70 A;  4FL6 A;  5FRM A;  1OZ3 A;  3OYA A;  4X34 A;  2L8D A;  2RHX A;  3C4S A;  2X4W A;  3EAE A;  2R57 A;  1WJR A;  2WAC A;  1KHC A;  2RO0 A;  1OI1 A;  4QW2 A;  4A4G A;  3OYM A;  1WGS A;  3OQ5 A;  3P8H A;  4A4F A;  4LD6 A;  2XDP A;  2JZ2 A;  4BD3 A;  3BDL A;  2D9T A;  3OYE A;  2LRQ A;  2CKK A;  2LDM A;  3MP8 A;  5KE3 A;  4GY5 A;  2K3X A;  2XK0 A;  4C5H A;  3QKJ A;  3FEO A;  2M1H A;  3PFS A;  2GF7 A;  4UC4 A;  3OYD A;  4QQG A;  2B8A A;  5C6S A;  4FU6 A;  4N4I A;  3S3N A;  5C0M A;  3Q1J A;  3QBY A;  2RJE A;  2MWO A;  4BE1 A;  1N27 A;  4E7K A;  3LGF A;  4RG2 A;  3OYK A;  1WJS A;  2X4X A;  3LYI A;  4QVZ A;  2RJF A;  2E5Q A;  5D6Y A;  5KCH A;  2K3Y A;  3MEW A;  4C5I A;  2EQM A;  2LVM A;  3MP6 A;  4IUQ A;  5J26 A;  5M9O A;  5KE2 A;  2RI2 A;  4E7L A;  3NTI A;  3MET A;  3E9G A;  2FHD A;  3QJ6 A;  5IAY A;  3L2V A;  3FC3 A;  1G5V A;  1SSF A;  2RJD A;  4BDY A;  5FRN A;  2QQS A;  2G3R A;  3OYB A;  4E7J A;  2MWP A;  4IUT A;  3H8Z A;  4OVA A;  2P0K A;  2RI3 A;  1XNI A;  3PMI A;  3QII A;  2L3R A;  2PQW A;  2VYT A;  3MEA A;  3PMT A;  4IUU A;  3KUF A;  3GOX A;  2M0O A;  2RHY A;  3P8D A;  2EFI A;  2EQU A;  2RHZ A;  3OYH A;  2O4X A;  3OYI A;  4EDU A;  3L2U A;  4ZTJ A;  2DAQ A;  4IUV A;  2LCC A;  4HCZ A;  1H3Z A;  5KCO A;  5CIU A;  3MO8 A;  2NLU A;  4C5E A;  2EKO A;  4II1 A;  4BE0 A;  2LTO A;  3L2W A;  3UWN A;  2GFU A;  4L59 A;  3M9Q A;  1OYX A;  2M16 A;  3OYC A;  3DLM A;  3ZEH A;  2BIV A;  2E6N A;  3O8V A;  3OYG A;  4PLI A;  3PNW C;  3FLG A;  2R58 A;  3MP1 A;  3LLR A;  3E9F A;  4A4H A;  4IUP A;  3OS2 A;  1RI0 A;  2DIG A;  5KH6 A;  3LGL A;  3NTH A;  2X35 A;  2HQX A;  3OA6 A; 
#chains in the Genus database with same CATH topology
 5KYX B;  2C06 A;  1O75 A;  4Z02 A;  2KVQ G;  3V7C A;  3CCM T;  3V8J A;  5FRO A;  4M78 F;  4JRP A;  3S6W A;  2D0N A;  2FPD A;  3L42 A;  3S3M A;  3VKI A;  1KQS A;  1D1B A;  3MPU B;  2E6Z A;  4Q5W A;  4JJN K;  1U3O A;  2IPO B;  2MK5 A;  5HY6 A;  1ZLM A;  2XKO C;  3CCJ Q;  3L2R A;  1K73 U;  4AFZ C;  3CCU T;  1YIJ Q;  1R77 A;  3LWI A;  2RD1 A;  4HVW A;  5GAN 2;  4EIK A;  2NUT A;  5CKD A;  2IIM A;  2VV5 A;  1ZSZ C;  3VYH B;  4DEX A;  3REB B;  4QW2 A;  3CCU A;  4LD6 A;  2DE0 X;  5AT1 B;  4XAX B;  1KSW A;  1UTI A;  1WA7 A;  1NLP C;  1RAI B;  3JCM f;  2HBP A;  1D1C A;  2AHJ B;  2RJE A;  3TU4 K;  4E7K A;  3ULR B;  2QTX A;  4RG2 A;  4M77 D;  1UEB A;  2X4X A;  2KI7 A;  4LE9 A;  2K3Y A;  3MEW A;  2LVM A;  2JMA A;  1NG2 A;  4M78 C;  5FRN A;  2EJ9 A;  1RLQ C;  1E7D A;  3OYB A;  4OVA A;  2ODG C;  1Q86 U;  2VGM A;  1X2Q A;  1Y96 B;  2DTI A;  4FSS A;  2E4H A;  2GQV A;  3R6O A;  3KFV A;  1E6G A;  4BI8 B;  1VIE A;  1IO6 A;  1VA7 A;  2QQB A;  2DTO A;  4M78 D;  4C5E A;  2A08 A;  2EKO A;  1JJR A;  5IXF A;  3M9Q A;  4JJC A;  3CC4 T;  4PLI A;  3JCM Q;  1K9M R;  4M78 E;  3ZL7 C;  2LJ0 A;  2JM8 A;  4AG2 C;  1D0Z A;  1H64 1;  2RQR A;  4QVD A;  2FPE A;  3OYJ A;  3G4S Q;  3CC4 A;  2X4Y A;  5LL6 S;  1CKB A;  1ARK A;  3L1A A;  3HFO A;  4JUV A;  2RJC A;  1TTH B;  4CI0 C;  4Y92 A;  2KNB B;  2E3H A;  3SWN B;  2ZPE B;  3S3O A;  1M90 U;  2EPD A;  5LJ3 h;  2JN0 A;  3FIF A;  1UGP B;  5GAO r;  1W4S A;  3PE0 A;  4OGE A;  3I56 T;  2RM4 A;  2BTT A;  3T9N A;  2DO3 A;  4B9X A;  2CZ6 B;  3F70 A;  1NE8 A;  5FRM A;  1UGR B;  3OYA A;  3CCQ Q;  1N8R C;  5L23 A;  1IB8 A;  2YUP A;  3TCJ A;  3QWX X;  1AHJ B;  5KYW B;  2QAZ A;  3G71 T;  2D9T A;  2CSI A;  1OU9 A;  2F2X A;  2OTL T;  3I56 A;  1YI2 Q;  4XTZ A;  1ZUY A;  2GBQ A;  2GF7 A;  1VYV A;  1YWO A;  5FWB A;  1V29 B;  4M7D A;  1LPL A;  2QEX Q;  1X6B A;  3OYK A;  1WJS A;  4ELY C;  4C5I A;  4IUQ A;  5KE2 A;  2VAS A;  2Y4Y A;  5GAN 5;  2NWM A;  2FG0 A;  2OTL A;  3I9Q A;  3URG A;  1VQM T;  3BDU A;  3JB9 F;  2LCL A;  1G3W A;  2XD0 A;  1M4Z A;  2QQA A;  1ZA2 B;  3MEA A;  2EYQ A;  5FWC A;  1VQK Q;  2LX7 A;  1OPL A;  4DQ2 A;  1KC8 U;  2KVD A;  2O4X A;  1MGQ A;  1SSH A;  1ZSG A;  2HEQ A;  3A5Z B;  3MO8 A;  1VQM A;  4KBM B;  4R56 A;  4OMF B;  1IHV A;  1PKT A;  1M8M A;  3CCV Q;  3R6N A;  3OW2 P;  4E7S A;  1BIB A;  2CP5 A;  1ZUK A;  2VVK A;  4IUP A;  1AT1 B;  1Q82 U;  2JMC A;  5KH6 A;  2EIF A;  4N4I A;  1SPK A;  4E2F B;  4XU2 A;  2A0F B;  1WXT A;  4P5N A;  4M7D C;  3X20 B;  4QKU A;  2M51 A;  2YUN A;  4C92 G;  1PG5 B;  3EFO B;  1OUL A;  3OMG A;  5IN1 A;  2ZZD A;  4GLK A;  4A54 A;  1RAA B;  4PJM A;  1OQK A;  1D3B A;  3C0C A;  5LJ3 j;  1QCF A;  1W70 A;  1D09 B;  3VS1 A;  1K73 R;  2LP5 A;  2DVE A;  4M7D D;  2KRN A;  4C5G A;  4OMP A;  3I5S A;  3SD4 A;  4F04 B;  1WZO A;  3HRS A;  5LJ3 d;  1YBY A;  4F7U G;  4E7Z A;  2YSQ A;  4KRT A;  4DBH A;  2WAC A;  1KHC A;  1YJ9 Q;  2G6F X;  1TWB A;  3C95 A;  3NPF A;  3JB9 D;  3OYE A;  3CCR Q;  3QSU A;  3QWY A;  1BI0 A;  2AKK A;  3CC7 T;  4PJN A;  2SRC A;  3Q1J A;  5GAN e;  3EGX A;  3EFS A;  5GAN 6;  1A8V A;  3FRN A;  4EPC A;  1NYG A;  2L0A A;  2E5Q A;  1ACM B;  2HD0 A;  5M9O A;  1K1Z A;  4JZ3 A;  2RI2 A;  4PJO A;  2DTH A;  4HKE A;  4BI3 A;  4JZ4 A;  5CVI A;  1YHQ Q;  2KVU A;  5IH2 A;  2KR3 A;  2FZC B;  2YLB A;  3CC7 A;  1GCP A;  1VQP A;  1QWF A;  2JM9 A;  3H8Z A;  1Q86 R;  2GQI A;  5LJ5 h;  1G3T A;  3GOX A;  1Q81 C;  2EYX A;  2V1R A;  3L2U A;  4J9E A;  2OAW A;  2RQU A;  5GAM e;  2NLU A;  4D6W A;  3HL8 A;  2D0Q B;  3J81 E;  1YJW T;  3DLM A;  1SEM A;  5AYF A;  4C92 B;  1W6X A;  1JBM A;  1WNL A;  2DXT A;  3LGL A;  3EH2 A;  3NTH A;  3HFN A;  2LC4 A;  2X3X D;  2QQR A;  2C0O A;  1N6A A;  2PVD B;  2ZPG B;  2DEQ A;  2NUZ A;  1GCQ C;  5GAM d;  3CME Q;  4PJO C;  4AMC A;  3EHR A;  5GAO l;  1K0X A;  2EQJ A;  2KGT A;  2CZ1 B;  1JU5 C;  4AFU C;  2DXB A;  4M7A F;  3EG1 A;  2BKD N;  1WJQ A;  3OB9 A;  4J9B A;  1AWX A;  4F7U B;  2A3L A;  4IUR A;  2KMT A;  1OOT A;  1SG5 A;  2DD5 A;  1AWJ A;  2JTM A;  4JLG A;  3M0R A;  4BDZ A;  2C0T A;  3CPW P;  2DM1 A;  1NYF A;  2D1X A;  5GMK e;  4PJO D;  4JPB W;  1Y02 A;  2MPX C;  4EMK B;  4J7I A;  1VQO T;  1VQ8 A;  4O6J A;  3CCS T;  2OI3 A;  2QYZ A;  5HK3 A;  3EGD A;  4NOY A;  2CKK A;  1BCM A;  1TSF A;  4HCB A;  4VUB A;  1O9S A;  2DYI A;  4QQG A;  1AWO A;  2X3W D;  2MWO A;  1VQL Q;  1VQO A;  1B7T A;  1G3S A;  3VUB A;  3CCS A;  1M2V A;  5GAN g;  4FT4 A;  4J9D A;  5LJ5 j;  4C0G A;  3QJY A;  2OTJ T;  4HCK A;  1VQ4 Q;  2HSP A;  3EG9 B;  3OBW A;  1BI2 A;  2V1Q A;  3QII A;  4IUU A;  1TUC A;  3JCM P;  4M7A C;  1IGQ A;  1UEC A;  3RIR A;  4HVV A;  1SRM A;  5LJ5 d;  3J7A F;  3CCE T;  2BZX A;  2PZ1 A;  1H3Z A;  5KCO A;  1M27 C;  2JW4 A;  3H41 A;  3UWN A;  2GFU A;  4OB0 B;  1UGS B;  4C8Q G;  2BIV A;  3O5Z A;  3OYG A;  2PUO B;  3MCA B;  1AWW A;  1RL2 A;  2E12 A;  2YXY A;  1YCS B;  1QVF S;  3CMA Q;  2HKN A;  2RF0 A;  1OV3 A;  4LUD A;  3OS1 A;  5GAN f;  3LH0 A;  2QQ9 A;  2LJ3 A;  4M7A E;  5KYY B;  1XQH A;  1UHC A;  1R0C B;  4LDY A;  3EH1 A;  2QA4 T;  3QZ9 B;  2A28 A;  2V8J A;  4Y28 E;  1NJI R;  4RTU A;  2YUO A;  1KQS S;  4J5Y A;  3UT1 A;  3TQ7 P;  5D7U A;  4IIO A;  2M02 A;  3A8G B;  1K9M U;  2HQE A;  3CCL T;  1HD3 A;  1QCN A;  3OMC A;  4OB1 B;  2EW3 A;  1HYO A;  2RK2 A;  2QA4 A;  5J39 A;  1VQ5 Q;  5D6W A;  3RKX A;  2KBT A;  1B34 A;  2XDD A;  4X34 A;  2K9G A;  5GAM f;  4K11 A;  1MNE A;  3H0I A;  1ZA1 B;  4KGZ B;  3P8H A;  5ECA A;  3CCL A;  2OX7 A;  4PFZ A;  2COY A;  2CRE A;  5KE3 A;  1CSK A;  1M3B A;  3U23 A;  3QKJ A;  3AHU A;  2L5Q A;  4LD9 K;  5GAN 8;  4F14 A;  3TEE A;  2Y4X A;  4RCC A;  1X6G A;  2HZY A;  4RTY A;  2K3B A;  3MP6 A;  1M3C A;  5DM7 R;  2COW A;  3CXC P;  2KW9 A;  1UFF A;  4YTL A;  4KUD K;  2O31 A;  2PUK B;  1UJ0 A;  2FPF A;  5J3B A;  5GMK m;  5GAO q;  2L3R A;  3A1P A;  2RMO A;  3QHS A;  4HA8 A;  4J9G A;  2RHY A;  4C8Q B;  1AZE A;  1NEG A;  2YRC A;  2EQU A;  1M1K R;  2A36 A;  1YIT T;  4ZTJ A;  2LCC A;  1KD1 R;  3UDC A;  1M1K C;  3JCM c;  2CS7 A;  2MF2 A;  4JS4 A;  5A2Q E;  3SB2 A;  4BY6 B;  2XDB A;  1PRM C;  1U1T A;  1C0M A;  4XU3 A;  1RLP C;  3LLR A;  2LD7 A;  4AT1 B;  4CC2 A;  2J6O A;  1HK9 A;  2RK1 A;  2DFU A;  1YIT A;  3HRU A;  1K8A C;  1JEG A;  1M9S A;  4FYV B;  2F5T X;  2X4J A;  3DB3 A;  4RUG A;  1H3H A;  2DXU A;  2GFA A;  1OPK A;  2OJ2 A;  4AFQ C;  2LNV A;  1ZSZ A;  2MAM A;  3CCJ T;  1V66 A;  3CEY A;  1YIJ T;  1TH7 A;  1HJD A;  3SWN C;  4NS5 A;  4A4K A;  3OYN A;  2AZV A;  1QVF A;  1H9E A;  2JUF A;  3EG3 A;  4LDW A;  1TS9 A;  2B86 A;  2LNH B;  1K76 A;  4M75 F;  3ASK A;  3CCJ A;  3JCM g;  2LQN A;  4J6W A;  4E7I A;  1YIJ A;  3VS0 A;  5GAN 4;  4M78 A;  1LOJ A;  4A4F A;  2L2P A;  2FRY A;  2RA2 A;  1VQ9 Q;  3JB9 I;  2RPN A;  3GP8 A;  2XK0 A;  4C5H A;  1QVG P;  3OYY A;  3HKS A;  4OP0 A;  1JRI A;  3DKM A;  3S3N A;  3HRT A;  1S72 Q;  5C0M A;  1RAH B;  4BE1 A;  2P0P A;  5IXB A;  1G2B A;  3X24 B;  4LDV A;  1VYT A;  5I21 A;  4PFO A;  1ZS9 A;  1V1C A;  4FM4 B;  2RJF A;  1ZBX A;  4KGV B;  2LT1 A;  3GBQ A;  3OSV A;  2HMA A;  2FYK A;  4DBR A;  3BY7 A;  2KRS A;  2RJD A;  1LNX A;  3KBG A;  1BIA A;  3RES A;  2G80 A;  3PTA A;  1SF9 A;  2ZPF B;  2PQW A;  4KUL A;  4KH0 B;  3KUF A;  3CQT A;  2KAF A;  4PKC C;  2X51 A;  1X01 A;  1GXI E;  1G3Y A;  3CCM Q;  3L2W A;  1MV0 B;  3QO3 A;  3OYC A;  5DLQ E;  1JB0 E;  1WXU A;  2HKQ B;  3EFR A;  3VS7 A;  2K2M A;  4TVR A;  3G4S T;  1S1N A;  4RTX A;  2O2O A;  2BZ8 A;  3FDR A;  4C0F A;  2DBM A;  2F69 A;  2J06 A;  2NUP B;  1E6H A;  1OZ2 A;  1WHM A;  2YT6 A;  4M75 E;  3QYH B;  5KYU A;  3G4S A;  3ZFJ A;  3UAT A;  3JCM W;  2VUB A;  4M77 G;  4M75 G;  5CO7 A;  4FW2 A;  3CCQ T;  5A0L A;  2EKH A;  4FCY A;  2FL7 A;  2EAY A;  2ZGW A;  4N0A C;  2RHX A;  4C92 F;  2WSF E;  2O9S A;  1OI1 A;  5GAO n;  1VOM A;  2QGF B;  1SHF A;  1YI2 T;  3G6E Q;  2JZ2 A;  4BD3 A;  3BDL A;  1PHT A;  4WCI A;  3CCQ A;  4GY5 A;  1UGV A;  4LDU A;  2QEX T;  4MZM A;  2Y90 A;  4JDS A;  4PNO A;  4UC4 A;  3M57 A;  3OYD A;  1QVG S;  1M30 A;  2E10 A;  3N5B B;  4GBQ A;  1TUD A;  1N8R R;  1IRX A;  4DBQ A;  4J7F A;  1YI2 A;  3NMZ C;  4MML A;  1GJJ A;  2HL3 A;  4F7U F;  3M55 A;  1VQ6 T;  2QEX A;  1I8F A;  2ED1 A;  2EGC A;  3M0T A;  2HJQ A;  2J6K A;  1B3Q A;  4Y91 A;  2DZC A;  3HHT B;  1WDX A;  2J7I A;  3G1J A;  4IUV A;  3CCV T;  2KVE A;  4EMK A;  1VQ6 A;  3L0O A;  2LTO A;  1VQK A;  4L59 A;  1GBR A;  1GFD A;  1BU1 A;  4LNP A;  4IIM A;  2A37 A;  3RER A;  1PCX A;  4BUG A;  1TXQ A;  3VRZ A;  4C92 C;  2ABL A;  1Y57 A;  2ZPH B;  1QLY A;  2RQV A;  5GAN 7;  3CCV A;  2ZCF B;  1VYU A;  1GL5 A;  2E1H A;  2RQW A;  2F5K A;  3NHN A;  3TVT A;  4WF2 A;  2SEM A;  1VQN Q;  1ZHI A;  4M77 B;  4C92 D;  4M75 B;  2YRV A;  1YJN T;  2KQW A;  2DX1 A;  2GNC A;  2QNF A;  5A0G A;  3EG0 A;  2R5A A;  3CBO A;  4NL3 A;  3G71 Q;  5HKC A;  4N4G A;  4C92 E;  5CKF A;  2EBP A;  5LJ3 e;  4HT9 A;  1JQQ A;  3NGP A;  1BKB A;  3X26 B;  4GLM A;  2XID A;  2QXF A;  2CT3 A;  1YJN A;  3IQL A;  4B6M A;  2L8D A;  4EMK C;  2X4W A;  4FYX B;  5IHI A;  3CCR T;  1XOV A;  2CUB A;  3VU3 C;  1NJI U;  1ZUU A;  4QT7 A;  4JLI A;  4XK8 E;  4J9F A;  4RMO A;  2L3S A;  1YJ9 A;  4R55 A;  1YP5 A;  1QQJ A;  4F7U E;  3CCR A;  2NUT B;  3M56 A;  1UGQ B;  1YHQ T;  3C12 A;  3JCM V;  2YLC A;  1TU0 B;  2ZPI B;  2DXC A;  1UG1 A;  3QJ6 A;  3EG2 A;  2KY9 A;  1HXD A;  5GAN 3;  3QG1 A;  1WI7 A;  2QTV A;  5FU7 B;  3VUZ A;  3UA6 A;  1QVG A;  4BB7 A;  1FMW A;  1YHQ A;  1VQP T;  3M0Q A;  3X28 B;  2RHZ A;  3M59 A;  2MCN A;  5CIU A;  2EYZ A;  3CD6 Q;  1GCQ A;  4E47 A;  3GLX A;  1Y71 A;  3A8O B;  2BE7 D;  1Z9Z A;  2LZ6 B;  1WFW A;  4DOW A;  3MP1 A;  2K5L A;  2XMF A;  1Q81 R;  2DL7 A;  2JXB A;  3HPW A;  2EJG A;  2DL5 A;  3CME T;  2JVW A;  1M1K U;  3UA7 A;  1D0X A;  4CC7 A;  3RDV A;  1KD1 U;  8AT1 B;  2H3E B;  1I4K 1;  4XTW A;  1LCK A;  3QXE B;  3PVQ A;  2CZ0 B;  4C8Q F;  3OW2 S;  1OEB A;  1PSE A;  1K8A U;  2DZ9 A;  3CME A;  1VQ7 T;  2P4R A;  4RG8 A;  2EJF A;  1M2O A;  3GPL A;  3CC2 Q;  1FYN A;  4KH1 B;  3INZ A;  1NBE B;  5LJ3 g;  1X75 C;  4J9H A;  1VQ7 A;  4BIT A;  3TSZ A;  1BB9 A;  4HT8 A;  3GIB A;  1VQL T;  1VQ8 T;  1WX6 A;  1JXO A;  5A0D A;  5C6S A;  1XJW B;  4M7A A;  2K5F A;  3H0F A;  3LGF A;  4HVU A;  2E3I A;  3LH5 A;  5D6Y A;  1PM3 A;  1PKS A;  3M5A A;  4E7L A;  3WVD B;  2FHD A;  2V26 A;  1KQ2 A;  1SSF A;  1W1F A;  1VQL A;  4DOV A;  1RAE B;  1JEI A;  2M0Y A;  1YJW Q;  2P0K A;  2YWW A;  3SEM A;  1M90 C;  3FB9 A;  4C0D B;  5CR2 A;  5KYX A;  2KXD A;  4AG1 C;  4BI4 A;  4C8Q C;  5LJ5 e;  1VQ4 A;  2COZ A;  3OYH A;  3OYI A;  1JO8 A;  4O5V A;  5LJ3 f;  3H9N A;  2CDT A;  4DA4 A;  2KSS A;  2LQW A;  2KFV A;  1KK7 A;  1FWZ A;  4OMM A;  1IHW A;  1OYX A;  4OML A;  2MPH A;  4CC3 A;  2OAU A;  3ZEH A;  4XTY A;  4BY6 C;  3JCM h;  4LXC A;  1A62 A;  2CP6 A;  3CMA T;  2F2V A;  3OS2 A;  4C8Q D;  4QVC A;  1NM7 A;  1QW1 A;  2DIG A;  1KJW A;  3M58 A;  2HL5 C;  2X9H A;  4WTO B;  2EGE A;  3D7S B;  2QI2 A;  2O4X B;  2RNA A;  3H6Z A;  4C8Q E;  1WHL A;  5KYN A;  3ME9 A;  5FU6 B;  4E6R A;  4MDX A;  3CMA A;  2ROL A;  2QK0 A;  2DD4 A;  3LX7 A;  3JB9 J;  5GAM g;  2JTF A;  3MEV A;  3GNG A;  2F1L A;  2VWF A;  2RH2 A;  2H8H A;  2L89 A;  1I0C A;  1B07 A;  2DPP B;  5L8R E;  4M7A D;  1BK2 A;  1NPR A;  2V8I A;  1VQ5 T;  4BE2 A;  2YHT A;  2I0N A;  4BAC A;  1A0N B;  2KE9 A;  1KC8 C;  2I2L A;  4PL6 A;  3SHW A;  2DVJ A;  4KT0 E;  4FL6 A;  2P0Q A;  3EAE A;  4ATO A;  2ED0 A;  1D3B B;  3OQ5 A;  1VQ5 A;  3OW2 A;  1Y96 A;  3MP8 A;  2XU8 A;  1X6O A;  5I22 A;  2OTJ Q;  2HDA A;  3I55 Q;  3PFS A;  5IHN A;  2B8A A;  3QBY A;  2L3Q A;  3SFM A;  5CKH A;  4OB2 B;  1GBQ A;  2IVW A;  3CPW S;  4KGX B;  2MI6 A;  3CCE Q;  4XTX A;  3L2V A;  2RN8 A;  1QP2 A;  5GMK l;  1M3A A;  4ELZ C;  1QP3 A;  4OMN A;  1WHJ A;  1RI9 A;  4DEY A;  1OU8 A;  2VYT A;  3PMT A;  5CQY A;  1PD1 A;  2DK4 A;  1XTD A;  2EFI A;  3EGX B;  4EDU A;  2J05 A;  1N8R U;  2DA9 A;  5LJ5 g;  1WXB A;  3WXM B;  4X1V A;  3PT9 A;  2E6N A;  4MZT A;  1TOV A;  4M4Z A;  3SWN A;  4XU0 A;  1RAF B;  3FJP A;  1T0H A;  2AK5 A;  2DF6 A;  1V76 A;  1X2K A;  2DL4 A;  2X35 A;  4OB3 B;  2DET A;  1NZ9 A;  2LMJ A;  5DY9 A;  4QQD A;  5FLX E;  2FZG B;  4QQ6 A;  3P8B B;  2KK4 A;  4C0Z A;  2R5M A;  4A4E A;  1X69 A;  1WHG A;  1Q7Y C;  1E7O A;  5KYW A;  4ZGD B;  2JVV A;  5I2M A;  1QKX A;  9ATC B;  4PLL A;  2DIL A;  1K8A R;  2CT4 A;  2L3P A;  4FSX A;  2MYS A;  2DL3 A;  3OY9 A;  4LUE A;  2LQK A;  1ABQ A;  3BE3 A;  1U1S A;  3M54 A;  2CYZ B;  2XHC A;  5LJ5 f;  1U8R A;  2EWN A;  2ATC B;  3DLL A;  1VQ9 T;  1YWP A;  2DLP A;  1W2B P;  1D0Y A;  1FX7 A;  2VGN A;  1GFC A;  2XI9 A;  3KXT A;  6AT1 B;  3M53 A;  1S72 T;  2XG8 D;  2EYY A;  4ME7 A;  7AT1 B;  1A63 A;  1M1G A;  1Y7X A;  1YCY A;  1VQ9 A;  1N27 A;  4M77 F;  5I2S A;  4F16 A;  1T3L A;  2RQT A;  3VYG A;  1R8O B;  5CQX A;  2RB6 A;  1S72 A;  4MMK A;  4DBF A;  1G5V A;  1AD5 A;  1MMN A;  2LX9 A;  4BDY A;  1Z9Q A;  4IUT A;  3EGD B;  3OS5 A;  1C6V X;  3VS6 A;  5IHK A;  3PMI A;  5CKE A;  3RKY A;  1EFN A;  1Y07 A;  2E70 A;  2HQH A;  1MMD A;  1M5Q 1;  1H8K A;  2VB6 A;  3A8H B;  5GJW B;  3CPW A;  3EFO A;  5I11 A;  1UHF A;  3PIP A;  3NFC A;  1M2V B;  2K5I A;  3VS4 A;  4R0K A;  3CXC S;  1AEY A;  3CCM A;  3CPF A;  2PNI A;  1BI1 A;  4X9C A;  3VS5 A;  1BBZ A;  2HQX A;  1UJY A;  2RNN A;  2WSE E;  2PU9 B;  2RHU A;  1I81 A;  2A7Y A;  2LCS A;  4N0A A;  4OMQ A;  4M77 C;  2W10 A;  4M75 C;  1D1A A;  4HXJ A;  1MND A;  2RHI A;  5EC7 A;  2E65 A;  2W51 A;  1N5Z A;  4JS5 A;  1WHK A;  2C0I A;  2JS0 A;  4B9W A;  1Q81 U;  4CRI A;  4N4H A;  1FMV A;  3CCU Q;  4OMO A;  2JOY A;  4M75 D;  3V7S A;  3G6E T;  3THK A;  2QNC A;  3HSB A;  1OX8 A;  3M0U A;  2K57 A;  1NEB A;  1AOJ A;  2RO0 A;  1WGS A;  1UUE A;  2HBW A;  2XDP A;  1JEQ A;  4M77 E;  5GJV B;  1DJ7 B;  1W2B S;  1MV3 A;  2K3X A;  3M4G A;  8ATC B;  4OF1 A;  3TRE A;  1Q95 G;  4FU6 A;  3G6E A;  1EN7 A;  1IXD A;  4D8K A;  4NL2 A;  1B34 B;  5J26 A;  4RTW A;  1UDL A;  2DJZ A;  2ENM A;  3E9G A;  1RUW A;  5IAY A;  2KYM A;  4CC4 B;  1M1F A;  1RAG B;  2QQS A;  1EIF A;  3A8L B;  5FU7 C;  4C92 A;  5CKB A;  5EG2 A;  1YN8 A;  1KHI A;  1K9M C;  4EMG A;  2QDY B;  4M78 G;  4XU1 A;  2D8H A;  1GKU B;  4JJD A;  2KDS A;  2K6D A;  1VIF A;  2AKL A;  4MZP A;  2WSC E;  4MDW A;  5GMK i;  1UE9 A;  3CBM A;  1AVZ C;  4F17 A;  2GGR A;  4RCB A;  2KT1 A;  3O8V A;  3MJX A;  4PFP A;  2R58 A;  3BFM A;  1VQK T;  2J6F A;  1FXX A;  1F1B B;  3CC4 Q;  4J6X A;  4F7U A;  3RNJ A;  3VS3 A;  4JRK A;  1PNJ A;  5D6X A;  1VQN T;  3OYL A;  1IGU A;  3GF5 A;  2PVO B;  3RMQ A;  2RNO A;  3OS0 A;  3CXC A;  4RTT A;  5HK0 A;  1MUZ A;  1KG1 A;  4M7D F;  1TUG B;  4ESR A;  2LQ8 A;  1VQN A;  3QYG B;  1ZQ1 A;  1CKA A;  2JTE A;  1I5L A;  1OX9 A;  3A8M B;  1SHG A;  4IKF A;  3L2Q A;  3M0S A;  3E19 A;  2DK3 A;  2JJ9 A;  3I56 Q;  3G71 A;  3V7R A;  1ZSZ B;  2M9U A;  4FT2 A;  1JXM A;  3ER0 A;  3EG9 A;  2LRQ A;  4FW1 A;  1KIK A;  1R0B G;  2DER A;  1VQ6 Q;  5GAN h;  2OTL Q;  1FMK A;  2O01 E;  3HP9 A;  5KCH A;  1YNZ A;  1YJ9 T;  2EQM A;  3TSW A;  4JRI A;  4L6V 5;  4LDX A;  3FC3 A;  4M78 B;  4J8O A;  1QCO A;  1SKU B;  2E41 A;  1W2B A;  4ZNX A;  2P84 A;  2RI3 A;  2ZAE A;  5CAI A;  1VQM Q;  4C0D C;  5GAM h;  3CD6 T;  2XIC A;  2K79 A;  4HCZ A;  2DYB A;  1G83 A;  5KYY A;  4OGC A;  1EZZ B;  4BE0 A;  3M4Y A;  1TG0 A;  2FZK B;  2LT4 A;  2AT1 B;  2GCX A;  2NYS A;  4FYW B;  3RMS A;  2Z0W A;  5CCA A;  1YJN Q;  3CD6 A;  1K73 C;  2F2W A;  4UZW A;  2KRO A;  2V8K A;  1H92 A;  2BZY A;  1YFN A;  2HNI A;  4M7D E;  4ZTF A;  2BE9 B;  4PJL A;  4RTV A;  5FU6 C;  1AZG B;  2BUD A;  2QDL A;  5FW9 A;  2FB7 A;  1I1J A;  1K9A A;  2EVR A;  4M7D G;  1WQ7 A;  2CH4 A;  3JSC A;  1WIE A;  3SDZ A;  3NTK A;  1SRL A;  3MEU A;  3CC2 T;  5GMK h;  4JJB A;  4RTZ A;  4FIB A;  2IG0 A;  3RKW A;  4PJO F;  1VUB A;  4D8D A;  2O88 A;  1Q7Y U;  3JB9 G;  1X43 A;  1WJR A;  2CH4 W;  3A98 A;  5GAN j;  2H3J A;  1HSQ A;  3CC2 A;  2DKG A;  1K0S A;  3VJP A;  5KYU B;  1JJ2 P;  4XQ3 A;  3JCM J;  4Z88 A;  2JT4 A;  1Q86 C;  3FEO A;  3QDR B;  3QZ5 B;  4LN2 A;  4C8Q A;  1GRI A;  2ECZ A;  2LC3 A;  5GAN d;  3CC7 Q;  1U5S A;  1RAD B;  1VQP Q;  3BW1 A;  3LYI A;  1PSF A;  3V8L A;  2MMP A;  3MET A;  2DJQ A;  1QVF P;  5GAM j;  3M0P A;  4FYY B;  1G8X A;  4XTU A;  2GTO A;  2D8J A;  1QKW A;  2M0O A;  4J9C A;  3P8D A;  1YJW A;  2DAQ A;  2ZPB B;  3C94 A;  1PWT A;  4PJJ A;  1KQS P;  2CP2 A;  1VQ4 T;  3MKD A;  3PVL A;  2VXE A;  2JNG A;  4EMH A;  4ZN1 A;  3PNW C;  4RKU E;  2K2V A;  1WPY A;  2VKN A;  1WQW A;  1M90 R;  2YRD A;  3X25 B;  3OBY A;  1BYM A;  3WVE B;  3OA6 A;  3JCM b;  1K4U S;  4M7D B;  1VQ7 Q;  2KYB A;  2PVG B;  2KXC A;  1Y0M A;  3JAM E;  2ESW A;  3G7Z A;  2KRM A;  2RI5 A;  1KQ1 A;  2VC8 A;  2A8V A;  1IRE B;  4V2S A;  3OYF A;  5GMK j;  3JB9 H;  2YUQ A;  4PJO E;  4E7H A;  1T3S A;  5GAO m;  3QUI A;  1LJO A;  2HAX A;  4PJO G;  3LWH A;  4ORZ A;  1VQ8 Q;  1NPP A;  3J80 E;  2KT8 A;  4ZN3 A;  1KFZ A;  3H0H A;  2R57 A;  3OYM A;  3I55 T;  2DRM A;  4AFS C;  1BI3 A;  3REA B;  2JS2 A;  1VQO Q;  1WLP B;  2M1H A;  3CCS Q;  1UB4 A;  1JJ2 S;  2CUD A;  1MMA A;  1KC8 R;  3QDF A;  4L5G A;  4KUI A;  2DL8 A;  2DNU A;  1QVP A;  1RAB B;  2YDL A;  4JRQ A;  4QVZ A;  4XTV A;  2OTJ A;  3PIO A;  3VS2 A;  3E2U A;  5HCK A;  3I55 A;  3JV3 A;  3L2Z A;  4J83 A;  1PD0 A;  2W0Z A;  2G3R A;  2MIO A;  1EX4 A;  3PGG A;  4J6Y A;  4E7J A;  2MWP A;  1Q82 R;  1ZX6 A;  4ANJ A;  1ABO A;  2D6F A;  3CCE A;  1Q82 C;  1ZBJ A;  1ZBH A;  2MOX A;  2E5K A;  2EYW A;  2KEA A;  3FJ5 A;  1IZ6 A;  2PTK A;  3JRZ A;  2EGA A;  1I5O B;  2NUP A;  1WYX A;  1PC0 A;  2M16 A;  4M7A G;  3EHQ A;  2DEU A;  3I35 A;  1NJI C;  2K4Y A;  1QMC A;  1RI0 A;  1WHH A;  3MHX A;  3JCM e;  3ZBD A;  2CP3 A;  2FEI A;  2HCK A;  3HTR A;  4ZGJ B;  3AT1 B;  2ODC I;  2DMO A;  4PJO B;  1MMG A;  2EQK A;  3UF4 A;  1I07 A;  2GTJ A;  2QA4 Q;  2VXF A;  2CP0 A;  1MHN A;  3DB4 A;  2DRK A;  2QG9 B;  3CBP A;  2ROT A;  1H9F A;  3JCM d;  3LW5 E;  5CK9 A;  1E7L A;  2K7A A;  2P4T A;  3V8K A;  1T0J A;  2DIQ A;  3CCL Q;  1P92 A;  3EGU A;  2CGH A;  4X9D A;  2CZ7 B;  3UPU A;  2QGG A;  1U06 A;  1Q7Y R;  1OZ3 A;  3C4S A;  2FRW A;  1H1J S;  4A4G A;  2AIR B;  3RBB B;  4A53 A;  1GL9 B;  2FVU A;  2LDM A;  1NLO C;  2AZS A;  2CSQ A;  2WQG A;  2DBK A;  2HSE B;  4ZGE B;  1YNS A;  4Z8A A;  4HCC A;  2FO0 A;  2E64 A;  1N9R A;  4Z89 A;  1KD1 C;  3RR6 A;  3NTI A;  1C1A A;  4J9I A;  1LVK A;  2EQI A;  1RAC B;  1BCO A;  4PK4 A;  1PRL C;  1XNI A;  1JJ2 A;  2CP7 A;  2LJ1 A;  2O9V A;  3RUX A;  5GAO p;  1N9S A;  5IT9 E;  4M7A B;  1M8V A;  4II1 A;  1QWE A;  3QPH A;  4M77 A;  3VRY A;  1YIT Q;  3GNF B;  4M75 A;  2QAS A;  3FLG A;  3OSS C;  1X27 A;  3E9F A;  3I5R A;  5DLO A;  3E1S A;  3JCM X;  3VV0 A;  1J3T A;  4A63 B;  4A4H A; 
#chains in the Genus database with same CATH homology
 4JRK A;  2C06 A;  3HPW A;  1O75 A;  5D6X A;  4Z02 A;  2KVQ G;  2EJG A;  3V7C A;  3OYL A;  1VQN T;  3CCM T;  3V8J A;  5FRO A;  3CME T;  4M78 F;  3GF5 A;  5GAN f;  3OS1 A;  4JRP A;  3LH0 A;  2PVO B;  2QQ9 A;  3S6W A;  3RMQ A;  1M1K U;  4M7A E;  1KD1 U;  3L42 A;  1XQH A;  3S3M A;  4LDY A;  2QA4 T;  3VKI A;  1KQS A;  3QZ9 B;  2V8J A;  3OS0 A;  2E6Z A;  1I4K 1;  4Q5W A;  4Y28 E;  5HK0 A;  3CXC A;  4JJN K;  4XTW A;  1KQS S;  3QXE B;  1KG1 A;  4J5Y A;  5HY6 A;  2XKO C;  2CZ0 B;  3UT1 A;  4C8Q F;  3L2R A;  1K73 U;  4M7D F;  3A8G B;  2LQ8 A;  3CCU T;  3OW2 S;  1PSE A;  2HQE A;  2DZ9 A;  3QYG B;  3LWI A;  1ZQ1 A;  2RD1 A;  3CCL T;  1K8A U;  3CME A;  1VQ7 T;  3OMC A;  4OB1 B;  1I5L A;  5GAN 2;  4RG8 A;  2RK2 A;  2EJF A;  3A8M B;  3GPL A;  4IKF A;  2QA4 A;  5J39 A;  5CKD A;  3L2Q A;  5D6W A;  3RKX A;  1B34 A;  3E19 A;  2XDD A;  2DK3 A;  3INZ A;  2VV5 A;  4X34 A;  3G71 A;  5GAM f;  5LJ3 g;  3V7R A;  1X75 C;  3VYH B;  2M9U A;  4QW2 A;  3CCU A;  4FT2 A;  3CCL A;  3P8H A;  3ER0 A;  4LD6 A;  1VQ7 A;  2LRQ A;  4XAX B;  4HT8 A;  5KE3 A;  3GIB A;  5GAN h;  3QKJ A;  1VQL T;  3AHU A;  2L5Q A;  1VQ8 T;  4LD9 K;  3JCM f;  5A0D A;  2HBP A;  5C6S A;  5GAN 8;  4M7A A;  2AHJ B;  2K5F A;  2RJE A;  3TEE A;  3TU4 K;  4E7K A;  2Y4X A;  2O01 E;  2QTX A;  3HP9 A;  3LGF A;  4RCC A;  4RG2 A;  4M77 D;  1UEB A;  2X4X A;  5D6Y A;  5KCH A;  1YJ9 T;  2K3Y A;  3MEW A;  2EQM A;  2LVM A;  3MP6 A;  4JRI A;  5DM7 R;  3M5A A;  4E7L A;  3WVD B;  4L6V 5;  2FHD A;  4LDX A;  4M78 C;  4M78 B;  4YTL A;  1SSF A;  4J8O A;  3FC3 A;  1KQ2 A;  1VQL A;  2E41 A;  4DOV A;  1W2B A;  2EJ9 A;  3OYB A;  4KUD K;  5FRN A;  2PUK B;  4OVA A;  2P0K A;  1Q86 U;  2RI3 A;  2VGM A;  1Y96 B;  2DTI A;  5J3B A;  5GMK m;  1M90 C;  5GAO q;  5CAI A;  3FB9 A;  2GQV A;  2L3R A;  3R6O A;  4C0D C;  4C0D B;  5CR2 A;  3QHS A;  4HA8 A;  5GAM h;  2RHY A;  4BI8 B;  4BI4 A;  4C8Q B;  4C8Q C;  3CD6 T;  5LJ5 e;  1VQ4 A;  1VIE A;  2EQU A;  2XIC A;  3OYH A;  2QQB A;  3OYI A;  4ZTJ A;  1YIT T;  4O5V A;  2DTO A;  2LCC A;  4HCZ A;  4M78 D;  5LJ3 f;  3UDC A;  4DA4 A;  2KSS A;  4C5E A;  4OGC A;  1M1K C;  2EKO A;  4BE0 A;  3JCM c;  2CS7 A;  1FWZ A;  2MF2 A;  3M9Q A;  3M4Y A;  4JS4 A;  1OYX A;  5A2Q E;  2OAU A;  2LT4 A;  3ZEH A;  3CC4 T;  3SB2 A;  4XTY A;  4BY6 C;  4BY6 B;  2XDB A;  2GCX A;  4PLI A;  3JCM h;  1U1T A;  3JCM Q;  4XU3 A;  3CMA T;  3RMS A;  3LLR A;  4M78 E;  5CCA A;  3OS2 A;  4C8Q D;  4QVC A;  3CD6 A;  1HK9 A;  1QW1 A;  2DIG A;  2RK1 A;  1K73 C;  1YIT A;  3M58 A;  3HRU A;  1K8A C;  1M9S A;  2F5T X;  2X4J A;  3DB3 A;  1H64 1;  2V8K A;  2QI2 A;  2DXU A;  4QVD A;  2O4X B;  2HNI A;  2GFA A;  3H6Z A;  3CC4 A;  3OYJ A;  4C8Q E;  4M7D E;  4ZTF A;  2X4Y A;  5LL6 S;  3ME9 A;  5FU6 C;  5FU6 B;  2LNV A;  3L1A A;  2BUD A;  2MAM A;  3HFO A;  2RJC A;  4JUV A;  3CMA A;  3CCJ T;  4MDX A;  2FB7 A;  4CI0 C;  2DD4 A;  3CEY A;  1YIJ T;  4M7D G;  3LX7 A;  1TH7 A;  5GAM g;  3JB9 J;  1WQ7 A;  2JTF A;  3MEV A;  3SWN C;  2ZPE B;  3SWN B;  4NS5 A;  3S3O A;  3GNG A;  4A4K A;  3OYN A;  3JSC A;  1M90 U;  2RH2 A;  2L89 A;  3SDZ A;  1QVF A;  5L8R E;  2DPP B;  3NTK A;  4M7A D;  2V8I A;  1NPR A;  3MEU A;  5LJ3 h;  1VQ5 T;  2JN0 A;  3FIF A;  1UGP B;  2YHT A;  5GMK h;  4BE2 A;  2JUF A;  5GAO r;  3CC2 T;  4LDW A;  1W4S A;  4BAC A;  4FIB A;  4OGE A;  2IG0 A;  3RKW A;  3I56 T;  2RM4 A;  4M75 F;  3T9N A;  2DO3 A;  3ASK A;  4PJO F;  2CZ6 B;  4B9X A;  3CCJ A;  3JCM g;  1KC8 C;  2I2L A;  4J6W A;  4PL6 A;  1VUB A;  4KT0 E;  4E7I A;  3F70 A;  1NE8 A;  1YIJ A;  4FL6 A;  5FRM A;  1UGR B;  3OYA A;  1Q7Y U;  1N8R C;  2P0Q A;  3JB9 G;  3EAE A;  1WJR A;  5GAN 4;  1VQN A;  4M78 A;  3TCJ A;  4ATO A;  5GAN j;  2H3J A;  1D3B B;  1LOJ A;  3OQ5 A;  4A4F A;  1AHJ B;  1VQ5 A;  2RA2 A;  3JB9 I;  2DKG A;  3CC2 A;  3OW2 A;  3G71 T;  2D9T A;  3VJP A;  1Y96 A;  2OTL T;  3MP8 A;  3GP8 A;  4XQ3 A;  3JCM J;  2XU8 A;  2XK0 A;  4C5H A;  1X6O A;  3OYY A;  3HKS A;  3I56 A;  3FEO A;  1Q86 C;  4XTZ A;  3PFS A;  2GF7 A;  3QDR B;  4OP0 A;  1JRI A;  3QZ5 B;  1V29 B;  2B8A A;  3DKM A;  3S3N A;  3HRT A;  4C8Q A;  4M7D A;  5C0M A;  3QBY A;  4BE1 A;  2P0P A;  3SFM A;  5CKH A;  3X24 B;  5GAN d;  3OYK A;  4LDV A;  5I21 A;  4OB2 B;  1WJS A;  2IVW A;  3BW1 A;  3LYI A;  2RJF A;  4FM4 B;  1ZBX A;  4ELY C;  2LT1 A;  4C5I A;  4IUQ A;  3CPW S;  1PSF A;  5KE2 A;  2Y4Y A;  3OSV A;  5GAN 5;  3V8L A;  2MMP A;  3MET A;  2MI6 A;  2FYK A;  4XTX A;  3L2V A;  2OTL A;  3URG A;  1VQM T;  3BDU A;  2RJD A;  3BY7 A;  1LNX A;  3KBG A;  1BIA A;  3JB9 F;  1QP2 A;  2LCL A;  5GMK l;  4ELZ C;  5GAM j;  1QP3 A;  3RES A;  1G3W A;  3PTA A;  2XD0 A;  1M4Z A;  2QQA A;  4XTU A;  2ZPF B;  2PQW A;  2VYT A;  2EYQ A;  3MEA A;  3PMT A;  4KUL A;  3KUF A;  5CQY A;  2M0O A;  4DQ2 A;  2KAF A;  1XTD A;  4PKC C;  1KC8 U;  3P8D A;  2EFI A;  1YJW A;  2O4X A;  4EDU A;  1MGQ A;  2DAQ A;  1X01 A;  2ZPB B;  3C94 A;  1G3Y A;  3A5Z B;  3MO8 A;  1N8R U;  1GXI E;  1VQM A;  4KBM B;  5LJ5 g;  4R56 A;  3L2W A;  1VQ4 T;  4OMF B;  3WXM B;  3PT9 A;  2VXE A;  2JNG A;  3QO3 A;  3OYC A;  2E6N A;  4MZT A;  4EMH A;  5DLQ E;  4ZN1 A;  3PNW C;  4RKU E;  3SWN A;  1BIB A;  2K2V A;  1WPY A;  3FJP A;  4XU0 A;  1WQW A;  3X25 B;  1JB0 E;  3OBY A;  4IUP A;  1BYM A;  3EFR A;  1Q82 U;  5KH6 A;  4TVR A;  2EIF A;  3WVE B;  2X35 A;  4N4I A;  3G4S T;  3OA6 A;  4OB3 B;  3JCM b;  4XU2 A;  1NZ9 A;  4P5N A;  4M7D C;  3X20 B;  5DY9 A;  4M7D B;  2PVG B;  4QQD A;  4C92 G;  3JAM E;  5FLX E;  3FDR A;  3P8B B;  4QQ6 A;  4C0F A;  2KK4 A;  3OMG A;  2R5M A;  2ZZD A;  5IN1 A;  4A4E A;  4C0Z A;  3G7Z A;  4GLK A;  2RI5 A;  4A54 A;  2F69 A;  1KQ1 A;  1Q7Y C;  1D3B A;  2VC8 A;  1OZ2 A;  5LJ3 j;  1IRE B;  4V2S A;  4ZGD B;  3OYF A;  5GMK j;  3JB9 H;  2JVV A;  4M75 E;  3QYH B;  5I2M A;  4PJO E;  4E7H A;  3G4S A;  2DVE A;  4PLL A;  3ZFJ A;  5GAO m;  3QUI A;  3JCM W;  4M7D D;  4FSX A;  2VUB A;  1LJO A;  4M77 G;  4M75 G;  2HAX A;  5CO7 A;  4PJO G;  4C5G A;  3OY9 A;  3LWH A;  2LQK A;  3CCQ T;  5A0L A;  1U1S A;  3SD4 A;  2FL7 A;  3M54 A;  1NPP A;  3HRS A;  2CYZ B;  2XHC A;  5LJ5 f;  5LJ3 d;  3J80 E;  1YBY A;  4ZN3 A;  1U8R A;  4F7U G;  2EAY A;  2EWN A;  1VQ9 T;  3DLL A;  2ZGW A;  4N0A C;  2RHX A;  4C92 F;  2R57 A;  2WSF E;  2WAC A;  1KHC A;  3OYM A;  1OI1 A;  5GAO n;  1YI2 T;  1FX7 A;  2VGN A;  3I55 T;  3C95 A;  2JZ2 A;  2XI9 A;  3BDL A;  4BD3 A;  3KXT A;  3JB9 D;  3M53 A;  3OYE A;  1BI3 A;  1S72 T;  3QSU A;  3CCQ A;  2XG8 D;  4GY5 A;  4LDU A;  1BI0 A;  2QEX T;  2M1H A;  4ME7 A;  1UB4 A;  4MZM A;  1JJ2 S;  2Y90 A;  4JDS A;  4PNO A;  1M1G A;  1Y7X A;  3M57 A;  4UC4 A;  3OYD A;  3CC7 T;  1QVG S;  4L5G A;  4KUI A;  3Q1J A;  2E10 A;  1YCY A;  3N5B B;  5GAN e;  1VQ9 A;  3EFS A;  1N27 A;  4M77 F;  5GAN 6;  5I2S A;  1QVP A;  3FRN A;  4EPC A;  4JRQ A;  4QVZ A;  2E5Q A;  4J7F A;  2HD0 A;  4XTV A;  5M9O A;  3PIO A;  1YI2 A;  2OTJ A;  3VYG A;  3I55 A;  1R8O B;  2RI2 A;  5CQX A;  4MML A;  4PJO A;  2DTH A;  2RB6 A;  4HKE A;  3L2Z A;  4J83 A;  4BI3 A;  5CVI A;  1S72 A;  4MMK A;  1G5V A;  4F7U F;  2LX9 A;  3M55 A;  1VQ6 T;  2QEX A;  1I8F A;  4BDY A;  2YLB A;  2G3R A;  3CC7 A;  3PGG A;  4J6Y A;  4E7J A;  1VQP A;  2MWP A;  4IUT A;  3H8Z A;  3OS5 A;  5LJ5 h;  1G3T A;  3PMI A;  2D6F A;  5CKE A;  3RKY A;  3CCE A;  1Q82 C;  1Y07 A;  2E70 A;  4Y91 A;  1M5Q 1;  3GOX A;  1Q81 C;  2DZC A;  3HHT B;  3L2U A;  3A8H B;  4IUV A;  3CPW A;  3CCV T;  1IZ6 A;  3JRZ A;  5GAM e;  4EMK A;  2NLU A;  1VQ6 A;  4D6W A;  3HL8 A;  3PIP A;  2LTO A;  2K5I A;  3NFC A;  1VQK A;  2D0Q B;  4L59 A;  3J81 E;  1YJW T;  2M16 A;  4M7A G;  3DLM A;  3RER A;  4BUG A;  3CXC S;  1NJI C;  5AYF A;  4C92 C;  4C92 B;  2K4Y A;  2ZPH B;  1RI0 A;  3CCM A;  3CPF A;  1JBM A;  3MHX A;  3JCM e;  1WNL A;  1BI1 A;  2DXT A;  4X9C A;  3ZBD A;  3LGL A;  3NTH A;  5GAN 7;  3CCV A;  2HQX A;  2ZCF B;  3HFN A;  2LC4 A;  2QQR A;  2WSE E;  2E1H A;  2PU9 B;  1N6A A;  2PVD B;  2RHU A;  2ZPG B;  2DEQ A;  2F5K A;  4ZGJ B;  1I81 A;  2A7Y A;  4WF2 A;  4N0A A;  1ZHI A;  1K9M U;  5GAM d;  4M77 C;  4M77 B;  4M75 C;  4M75 B;  4C92 D;  4PJO B;  4PJO C;  2EQK A;  2YRV A;  1YJN T;  2KQW A;  5GAO l;  2EQJ A;  2CZ1 B;  2RHI A;  2E65 A;  2DXB A;  4M7A F;  2VXF A;  4JS5 A;  5A0G A;  2BKD N;  1WJQ A;  1MHN A;  2R5A A;  3DB4 A;  3OB9 A;  3CBO A;  4F7U B;  4NL3 A;  4B9W A;  2A3L A;  4IUR A;  5HKC A;  1Q81 U;  2KMT A;  3CBP A;  4N4G A;  4CRI A;  2DD5 A;  4C92 E;  3LW5 E;  5CKF A;  4JLG A;  2JTM A;  5CK9 A;  4N4H A;  3JCM d;  2P4T A;  3V8K A;  4BDZ A;  2DIQ A;  5LJ3 e;  4HT9 A;  3X26 B;  1BKB A;  1P92 A;  2JOY A;  2XID A;  5GMK e;  2CGH A;  4M75 D;  2CZ7 B;  4X9D A;  2QXF A;  3V7S A;  3UPU A;  1YJN A;  4PJO D;  1OZ3 A;  3G6E T;  2L8D A;  4EMK C;  4EMK B;  3C4S A;  2X4W A;  3HSB A;  3CCR T;  2K57 A;  4J7I A;  1VQO T;  2RO0 A;  4A4G A;  1XOV A;  1WGS A;  4O6J A;  1VQ8 A;  4A53 A;  3CCS T;  2XDP A;  3VU3 C;  1NJI U;  5HK3 A;  4M77 E;  2FVU A;  4NOY A;  1DJ7 B;  2CKK A;  2LDM A;  1W2B S;  4JLI A;  4HCB A;  4XK8 E;  2K3X A;  4VUB A;  1O9S A;  3M4G A;  4RMO A;  4OF1 A;  3TRE A;  4ZGE B;  1YJ9 A;  4QQG A;  4FU6 A;  4R55 A;  3G6E A;  2MWO A;  4F7U E;  4HCC A;  3CCR A;  2E64 A;  3M56 A;  1UGQ B;  1YHQ T;  1VQO A;  1N9R A;  4NL2 A;  1G3S A;  3C12 A;  3JCM V;  2YLC A;  1B34 B;  3VUB A;  5J26 A;  5GAN g;  3CCS A;  1KD1 C;  4FT4 A;  2ZPI B;  3NTI A;  2DXC A;  2DJZ A;  3E9G A;  3QJ6 A;  5IAY A;  2KY9 A;  5LJ5 j;  1HXD A;  1M1F A;  4C0G A;  3QJY A;  2QQS A;  2OTJ T;  1EIF A;  3A8L B;  5GAN 3;  3QG1 A;  5FU7 C;  5FU7 B;  4C92 A;  5CKB A;  3OBW A;  5EG2 A;  1BI2 A;  1XNI A;  3VUZ A;  1JJ2 A;  1KHI A;  3RUX A;  4EMG A;  3QII A;  1K9M C;  1QVG A;  5GAO p;  2QDY B;  1N9S A;  4IUU A;  4BB7 A;  4M78 G;  5IT9 E;  4XU1 A;  1YHQ A;  1VQP T;  3JCM P;  4M7A C;  4M7A B;  3X28 B;  3RIR A;  2RHZ A;  5LJ5 d;  2KDS A;  3J7A F;  3M59 A;  3CCE T;  1M8V A;  1VIF A;  1H3Z A;  5KCO A;  5CIU A;  2WSC E;  4MDW A;  4MZP A;  4II1 A;  5GMK i;  4E47 A;  3QPH A;  3CBM A;  4M77 A;  2GFU A;  4OB0 B;  3UWN A;  3GLX A;  1UGS B;  1Y71 A;  3A8O B;  3GNF B;  4M75 A;  4C8Q G;  2BIV A;  4RCB A;  3O8V A;  3OYG A;  2PUO B;  3MCA B;  3FLG A;  4DOW A;  3OSS C;  1RL2 A;  2R58 A;  3BFM A;  3MP1 A;  1VQK T;  2K5L A;  1FXX A;  3E9F A;  2E12 A;  4J6X A;  4F7U A;  5DLO A;  3E1S A;  3JCM X;  3VV0 A;  1QVF S;  4A4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...