3LLRA

Crystal structure of the pwwp domain of human dna (cytosine-5-)-methyltransferase 3 alpha
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
143
structure length
131
Chain Sequence
EYEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPAVEVQNKPMIEWALGGFQPSGPKGLEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA (cytosine-5)-methyltransferase 3A
publication title Structural and histone binding ability characterizations of human PWWP domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 131
sequence length 143
chains with identical sequence B, C, D, E
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.50 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 PWWP, helical domain 3llrA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3llrA01
4IURA 4C5GA 3OYIA 4E7LA 3S6WA 2HQEA 4BD3A 3OYCA 4E7HA 3OYNA 5D6XA 4ZTFA 3O8VA 3PNWC 3ZEHA 3OA6A 1WJRA 1XNIA 2R5AA 5IN1A 5C0MA 5IAYA 1KHCA 2BUDA 5KCOA 3QIIA 4E7IA 4Q5WA 2WACA 2LDMA 3UWNA 5KE2A 3S3NA 1OZ3A 4BE1A 2HQXA 4A4HA 3LGLA 2RI3A 3E9FA 4QW2A 3L2VA 4ZTJA 4C5IA 4A4FA 3OYLA 3OYJA 2L3RA 3KUFA 2RHYA 2RHIA 3MEWA 2YRVA 3PMTA 3LLRA 4L59A 3L2UA 1OZ2A 2RHZA 3OB9A 3OQ5A 4LD6A 2QQRA 2JZ2A 4A4EA 3OYGA 3OY9A 4X34A 1OYXA 2RI2A 2FHDA 3L2RA 4PL6A 4NS5A 3ASKA 1RI0A 3L2WA 2CKKA 2GFUA 4BACA 2BKDN 2O4XB 2MWPA 3BDLA 3H6ZA 2DIGA 3MP6A 2EKOA 3NTIA 5M9OA 4QQ6A 2O4XA 4IUQA 4PLLA 1MHNA 2K3XA 4E7KA 1SSFA 3MO8A 2L8DA 1OI1A 2X4XA 2XDPA 2IG0A 3MEVA 3S3OA 3GOXA 2EQJA 2RHXA 1H3ZA 4N4HA 3ME9A 3QBYA 2GFAA 4IUPA 2XK0A 3LYIA 2D9TA 3META 3LGFA 2L89A 3NTKA 3QJ6A 4B9XA 3L2QA 4N4IA 4BDZA 2M16A 3EAEA 5FROA 2G3RA 3QKJA 2BIVA 1G5VA 3L42A 2NLUA 3FLGA 5CIUA 3DB3A 3MP1A 4QVZA 2DAQA 4QQDA 1WJQA 4RG2A 3DB4A 3OYBA 3LH0A 2X4YA 3CEYA 4IUTA 3OS2A 2B8AA 3S3MA 4N4GA 4IKFA 3DLMA 3OYKA 5KE3A 4IUVA 4FU6A 5FRNA 2MWOA 1WJSA 3OS1A 2EQUA 4HCZA 3FDRA 4QQGA 3MEUA 2RJCA 4EDUA 4PLIA 2RHUA 3OMCA 2VYTA 5J39A 3MP8A 2P0KA 2M1HA 1WGSA 2M0OA 2RJDA 2JTFA 3FC3A 3SD4A 4Z02A 2QQSA 5J26A 5D6WA 3OYAA 2RO0A 2LVMA 2R57A 3LX7A 2RJFA 3H8ZA 3OYMA 2DIQA 3OYFA 3PMIA 3OYDA 3P8HA 2EFIA 4A4GA 3E9GA 4B9WA 5FRMA 2GF7A 2X35A 4UC4A 4C5HA 2LCCA 2K3YA 3OYHA 4BDYA 2F5KA 3C4SA 3OMGA 4FL6A 3M9QA 5D6YA 4C5EA 3PFSA 2PQWA 2RI5A 4BE2A 2RJEA 3OYEA 2R58A 3NTHA 4II1A 2E6NA 5KH6A 3MEAA 3OS0A 4BE0A 2LTOA 2LRQA 2E5QA 4IUUA 1N27A 3P8DA 4GY5A 5C6SA 2X4WA 3F70A 2EQMA 3UT1A 2R5MA 3FEOA 5KCHA 4E7JA 4OVAA 4CRIA 2EQKA 3Q1JA
chains in the Genus database with same CATH superfamily
1RI9A 3RR6A 2OJ2A 4ELYC 2HBWA 1VQ4Q 2B86A 5CVIA 4QW2A 1U8RA 1N6AA 4J9EA 3OYGA 3RESA 5GAOq 3CC4T 3PE0A 4X34A 2ECZA 4KULA 5I21A 1MGQA 4A54A 2YXYA 2KRSA 1JEIA 1W2BS 2DLPA 3TSZA 2JTMA 3NMZC 2LMJA 2AZSA 2H8HA 1OQKA 5GAMg 1VUBA 3QKJA 4BY6B 1VQNA 1QMCA 2DX1A 3QPHA 3MKDA 3S3MA 5GANe 1UG1A 1UGPB 2WSFE 2SEMA 2RPNA 1Q81U 3OMCA 2VYTA 1VQLA 1M2VB 2LC3A 1FX7A 2VWFA 3GLXA 1YCYA 1IGQA 5LJ3d 5J26A 2FZCB 4QVCA 4OB2B 1WPYA 1M27C 3PMIA 2E3IA 2IPOB 2ZPGB 4XU2A 4C8QE 2YUOA 3I55T 2A8VA 2RNNA 3A98A 4F7UF 2F1LA 1D09B 4M7DG 2L2PA 4PJMA 1QW1A 2KEAA 2IVWA 3V8KA 3HRSA 5KH6A 4KUIA 1NPPA 1E7DA 1YIJT 4JRPA 1A8VA 1JXOA 2EQKA 5GJVB 4E7LA 1X43A 2MI6A 3EFOA 2O88A 2HNIA 1XNIA 2EYZA 2QYZA 3CQTA 4O5VA 2KVEA 4C8QB 3CCUT 5GAMj 4OMNA 3BY7A 2LDMA 3UATA 2PUOB 3LGLA 5IT9E 4EMKA 4ZN3A 3CC4Q 4A4FA 1U1SA 1X2QA 3M57A 3EG2A 2GGRA 2F2WA 3CMET 2QEXA 4RKUE 4M7AD 3C12A 3BW1A 2EGAA 2CSIA 2O4XB 5J3BA 2DL8A 2QGGA 1SRLA 4NL2A 1QLYA 2V1RA 1QP2A 2E1HA 1VQ6Q 1YCSB 1M8VA 3OSSC 4RMOA 1X01A 1YP5A 1M3BA 1M2OA 4LN2A 4PJOA 2YDLA 1FMKA 1BCOA 2DM1A 4LDXA 3HRUA 2EJFA 1WZOA 2DAQA 2KSSA 1WJQA 2CP7A 2K2VA 5IHIA 5GAN6 1TUCA 4IUVA 3CCEQ 3JB9H 2LD7A 5LJ5e 1SSHA 2M9UA 5CKBA 1K8AC 2KVQG 2RA2A 2OI3A 1QVGS 4JS4A 2RQVA 2M1HA 3MCAB 2CREA 4M77D 1LPLA 3V8LA 1XTDA 2RJFA 3NHNA 1BI2A 3TEEA 5FU6C 2AKKA 3GBQA 5GAOm 2LC4A 4M4ZA 2JTEA 3OS0A 5GMKl 1N27A 5GAOp 3M58A 4C92G 1T3LA 3JB9G 4L6V5 5GMKj 3H0FA 3OYIA 2VASA 1K73R 1C0MA 4M7AE 3H41A 3CBPA 1VQOQ 1WJRA 1Y71A 3ER0A 4K11A 1IRXA 3PVLA 1VQ7Q 2DVEA 3QIIA 3UWNA 1CSKA 4BE1A 4J9IA 2OTLA 2XKOC 1A63A 1VQNT 3MEWA 2YRVA 3PMTA 3CCSQ 1GL9B 3OY9A 3P8BB 4PJLA 4C0DC 1QVFP 4J6YA 4M75D 3L2WA 3U23A 5GJWB 2DBKA 4M7AB 2YT6A 3NTIA 2HEQA 4IUQA 4Y28E 2FEIA 5LJ5h 3JCMX 3SWNC 1Q81C 2WQGA 2EYWA 2IG0A 1VQLT 2QQAA 4N4HA 1WIEA 2MCNA 4IUPA 3CXCA 4E47A 2A08A 1K9MR 1KQSP 5GAN3 1TOVA 2JM9A 3LGFA 4DBRA 2RMOA 3DB3A 3KBGA 4QVZA 2MK5A 6AT1B 4EIKA 4RG2A 4M77E 2HDAA 3LH0A 3VV0A 3RKWA 4J6WA 2DF6A 4EMHA 2Y4YA 4FU6A 2NUPB 3M5AA 2MWOA 4F14A 4QQGA 3EFSA 2A37A 5I2SA 4EDUA 2QDLA 3UA7A 4FYYB 4ZN1A 2X3XD 2E64A 5LJ3f 3X24B 5J39A 2SRCA 3BE3A 1M30A 5GAMd 1QCFA 4M77B 1JEQA 3VS2A 2AT1B 3UA6A 5KYWB 3OYDA 3FJPA 2EFIA 4B9WA 5FRMA 2X35A 1UE9A 1BK2A 2ABLA 3M9QA 2LCSA 3KXTA 1LCKA 1YJWQ 4OMMA 3A8LB 3A8HB 2DXUA 2EIFA 1TTHB 1TXQA 2K9GA 2QEXT 4RTVA 1RADB 1K73U 3EG3A 1QVFS 5CO7A 1N5ZA 4E7JA 1C1AA 2P4RA 4C5GA 4RTUA 3OYNA 5A0LA 4M75E 1VQPA 5IXFA 3HP9A 2BUDA 1MUZA 4Q5WA 2MIOA 1JJ2A 4L59A 2X3WD 3G6EQ 1Y07A 2XIDA 4XQ3A 1KQSS 5IHKA 2FPFA 1TH7A 5I11A 1MV0B 2CP5A 4NS5A 1EIFA 1JRIA 2W10A 3PIOA 2EKOA 1MMGA 4RTXA 5M9OA 1RL2A 1K9MU 2CS7A 5IHNA 4QT7A 2HAXA 1EZZB 4XU3A 5AYFA 1VIEA 2HD0A 1B34A 1VQ8Q 5GANj 2NWMA 4P5NA 3LYIA 1M9SA 2V26A 4B9XA 3L2QA 3CXCP 3VU3C 5FROA 1I8FA 5HK0A 4HVVA 3VJPA 5CIUA 1ZSZB 1YITQ 2X51A 1KQ2A 1G3SA 1UEBA 1G2BA 4PJJA 1PSEA 2K4YA 2OAWA 5KE3A 3CPWP 3HL8A 4AFSC 4JRIA 3J80E 1N9RA 1X6GA 2XD0A 4KT0E 1ZBXA 2RHUA 4AT1B 3CD6A 1D3BB 5L8RE 2JMAA 3EG1A 5GMKm 2JTFA 3SD4A 3BDUA 5LJ5g 1N8RU 1VQKT 4KBMB 4Z02A 1QKXA 2EYXA 4FCYA 1W2BA 2NUTA 2GBQA 3VRZA 1RAGB 8ATCB 2M0YA 1V76A 1M1FA 4OGCA 3HFOA 3A8MB 3QZ5B 5KYXA 2VGNA 2F5KA 2OTLT 5DM7R 2M51A 5A2QE 1JB0E 1WHHA 2RNOA 1W1FA 2OAUA 4BY6C 5AT1B 2LTOA 4MDWA 1VQ6A 2DD4A 1WQ7A 5CKDA 1YFNA 1QKWA 5FRNA 1GCPA 1K0XA 2EGCA 3REAB 4JPBW 1NJIR 3ZEHA 1IHVA 4XAXB 4N0AC 1QWFA 1WFWA 4HCKA 1OZ3A 5HY6A 2QI2A 2COWA 2DILA 2E5KA 2RH2A 4LDYA 1BI0A 1UHCA 3CCRA 1H9EA 3CCEA 1JJ2P 2K7AA 3URGA 3GPLA 4LDWA 5GMKi 1B7TA 1K8AR 4PJOD 3EFRA 4D8KA 4PFZA 2KYMA 3HSBA 1MHNA 2CGHA 2VXEA 3CPWS 4KGVB 1H3HA 2DMOA 1M3CA 5LJ5j 1PRMC 1UFFA 2GQVA 1IHWA 4JUVA 2G3RA 2J05A 2G80A 1BBZA 4M7AF 2DEQA 1KFZA 2XI9A 2XU8A 3N5BB 1Z9QA 1ZQ1A 1SEMA 2HMAA 1ZLMA 1M4ZA 4TVRA 1VA7A 1K73C 1MNDA 2RJCA 1HYOA 1J3TA 1G3YA 2BE7D 2RN8A 3J81E 4OMOA 2J6FA 2LJ0A 3ZFJA 4M78A 3L2ZA 4PK4A 5GAMf 3OYAA 2LT4A 2FPDA 1ZA1B 1VQPT 2HSPA 3X28B 2LQNA 1W2BP 3CCSA 4ZGEB 3UPUA 3M54A 4DOWA 1RAHB 5GAN4 3VS6A 2EW3A 2BZ8A 1JU5C 1U5SA 1KHIA 2MF2A 1RAFB 3OBWA 1WLPB 3I35A 1NJIU 3C94A 2BE9B 4JRKA 4GY5A 2X4WA 2AHJB 1TG0A 3EFOB 1LOJA 3PIPA 1S72Q 3FEOA 4JJDA 2HQHA 1K9MC 2HZYA 3S6WA 5D6XA 2DL4A 2FO0A 2O9SA 4XTYA 2V8JA 5GANd 2DXTA 3TU4K 4EMKB 4X1VA 1ZBJA 4JZ4A 4UZWA 5IN1A 5IAYA 1QVGA 4PJOE 2XHCA 1GCQA 2RQRA 1VOMA 3E9FA 2D1XA 5KYNA 3VS7A 2KQWA 2RHIA 1PKTA 5GMKh 4HA8A 2OTJQ 3JCMc 5CQYA 1R8OB 4MZMA 2YSQA 1Q82R 4JRQA 1D0YA 4L5GA 3M56A 3PT9A 4LDUA 1K4US 2VKNA 2L8DA 3H0HA 2CDTA 5GAOl 3CD6T 4PJOB 2QASA 1B3QA 1I0CA 1N8RC 2ENMA 2D9TA 1V1CA 3MJXA 3FLGA 5CQXA 1YJNQ 1WYXA 1X27A 3QJYA 3JRZA 3VYHB 1YJWA 1DJ7B 4X9DA 2KXCA 3HTRA 3CCLQ 4VUBA 3UDCA 2LNHB 3OS1A 1E6GA 4RG8A 4D6WA 1D0ZA 4C0GA 1VQ6T 2NUZA 1QCOA 1OOTA 4WF2A 4DEXA 2FRWA 1MMDA 2C0OA 3OSVA 1VQPQ 1UDLA 3WXMB 2KVDA 1M3AA 2Z0WA 2J6KA 4M7AC 1NM7A 2CYZB 3G6EA 3HKSA 5GAN7 2CH4A 2DRMA 2ROLA 3CCRT 3D7SB 2JXBA 3CCET 5CK9A 2AK5A 1G8XA 4HKEA 3RUXA 2ZPEB 1GRIA 3I5SA 3G7ZA 3EGXA 3KFVA 3M0RA 1VQ8A 2RM4A 4J9HA 3PNWC 3OA6A 2RK2A 5LJ5d 1R77A 3R6OA 1KHCA 1NEBA 3M59A 1ZX6A 4HVUA 2HQXA 1WDXA 1YITA 1Q82U 3OYJA 1QVGP 1BIBA 3X25B 4A4EA 2KRMA 2JS0A 3L2RA 1SF9A 4FW1A 2YLCA 4LNPA 2GFUA 4OB3B 4XTUA 1X6OA 4Z88A 4DBFA 3CD6Q 3LH5A 2DO3A 2DVJA 1XQHA 2K3XA 4M7DA 3O5ZA 2K3BA 3CPFA 3CCQA 1VQOT 2CP6A 4MZTA 3VS1A 1OULA 2D0NA 2HBPA 3V8JA 1QVFA 1VQ7T 4J9CA 3L42A 2JN0A 1LNXA 3CCMA 3VS4A 3CCST 5L23A 2HL5C 3M4GA 3H0IA 2J06A 1UTIA 5GANh 2CZ6B 3GP8A 4MMLA 1TUDA 2ESWA 4KGXB 1KQSA 1OEBA 3E1SA 4F04B 3JCMP 1NJIC 4IIOA 3A1PA 4ATOA 4E6RA 1Y02A 2MPXC 2M0OA 2QQBA 4BUGA 2D6FA 4HCBA 1VQ9A 5A0DA 5GAOn 3EGDA 1SHFA 1Q86R 1IZ6A 2DFUA 4J6XA 3LWHA 2LT1A 3CCRQ 2MPHA 1AWXA 2E12A 4FSXA 2DA9A 2LCCA 2K3YA 4BDYA 2KVUA 3QYGB 5D6YA 2RI5A 1R0BG 4ELZC 2LZ6B 2R58A 3M4YA 4XK8E 1K76A 3MPUB 2V1QA 2LX9A 5FU7B 2E5QA 3JCMe 1ZSZC 2ZPIB 2KR3A 2LQ8A 3GF5A 3GNGA 1AZEA 2CZ7B 1BI1A 2MMPA 3OYCA 3QWYA 4A53A 3FRNA 2FPEA 5ECAA 1ZUYA 5C0MA 2WACA 4R56A 1W6XA 4C5IA 3TSWA 4LD9K 2L3RA 1UGSB 1Q7YR 1I81A 3OB9A 2JZ2A 4OMQA 1YJWT 4RTTA 1M1KR 2ODGC 1RI0A 1B07A 2BKDN 2D8JA 2HJQA 3VUZA 2FZGB 4YTLA 3OW2S 5HKCA 2WSCE 1AZGB 4QQ6A 1B34B 2RD1A 4AG1C 4E7KA 2XDPA 2EBPA 2K57A 5DLOA 2H3JA 3RMQA 3QJ6A 4N0AA 4C92A 2VV5A 3G6ET 2C0TA 2JOYA 2E10A 4PJOF 2XICA 1H1JS 3QDFA 4JJBA 2DK3A 1VYUA 4M78D 4PNOA 2ZGWA 3TQ7P 1S72A 1W4SA 2KMTA 1KJWA 1D1CA 1YWOA 3MP8A 3JCMh 1Q86U 2JS2A 1WX6A 4RTWA 1OX8A 1Y96A 4AFQC 4OF1A 2EYQA 2NUTB 1U3OA 1VQ8T 5GAN2 2R57A 4LE9A 5KYXB 3JAME 2DZ9A 3CPWA 4KH0B 4UC4A 2DK4A 4C5HA 2OTJA 4A63B 2DL7A 1Q82C 1YITT 1BYMA 2J7IA 3NFCA 5I22A 1NG2A 4JZ3A 3PGGA 1TS9A 3MEAA 5GANg 2RQTA 2PVDB 3G71A 4KH1B 4DEYA 7AT1B 1ZUUA 1X69A 5LJ5f 1Q7YU 4HT9A 1N8RR 3CCQT 2F2XA 3QHSA 2COZA 4E7IA 2K79A 1YJNA 3CC7Q 1M1KU 2CH4W 4ORZA 1NLOC 1WI7A 3LLRA 1OZ2A 2EVRA 3CCMT 4FSSA 2DTIA 2XMFA 3AT1B 3T9NA 3CCLA 3JCMQ 4DOVA 3NPFA 2E41A 1BI3A 2O9VA 4ESRA 2DYBA 3EG0A 1AWOA 1M90R 2A3LA 1YHQQ 2GTOA 2DPPB 2VXFA 1YBYA 5CKFA 2K5LA 5CKEA 1GJJA 3QDRB 3VS5A 1VQ5A 4M78E 1D1BA 4XTWA 1PHTA 1VQ9T 1JXMA 2QAZA 3EAEA 1I5OB 4LXCA 2PVGB 2K2MA 2JW4A 5KYYA 1OPKA 4C8QD 4E2FB 2X9HA 4C8QF 3CEYA 4EMKC 4M75B 2YUNA 1T0HA 2J6OA 4J83A 1NPRA 4M78B 2QK0A 2RJDA 3JSCA 1WHGA 1AWJA 5EC7A 2QQSA 1TUGB 2KYBA 2RO0A 3LWIA 4PFPA 2DTOA 2D0QB 4AFUC 1KIKA 3M0PA 4ZGJB 2KE9A 3A8OB 2EQIA 4AG2C 4PJOC 3LW5E 3OMGA 3SDZA 4M7AG 2PQWA 2KK4A 2O01E 3QSUA 2LRQA 1WHMA 2ZAEA 1EN7A 4IUUA 4CC2A 4IIMA 2PUKB 4IURA 3CCQQ 5GAMe 4E7HA 1D0XA 4PJNA 3JCMg 1BCMA 5DY9A 2DNUA 4LDVA 4O6JA 3CCMQ 4ZTJA 4A4HA 3EHQA 3CMAQ 3M0SA 2DXCA 2YHTA 3E2UA 1X75C 2RHZA 3RBBB 2KBTA 1KG1A 1TWBA 1M90U 1UGVA 4M7DD 4MMKA 4QKUA 3C0CA 1M1GA 1BU1A 2DIGA 4FW2A 2AIRB 2M02A 1ZS9A 1S72T 4BB7A 2DD5A 3OS5A 3M55A 1VQ9Q 1BIAA 1H8KA 1Q86C 1K0SA 1OU8A 2KRNA 5A0GA 2DRKA 5DLQE 2VB6A 2BTTA 3X20B 3MP1A 3CC2Q 1IXDA 3INZA 4R55A 2OTJT 1GKUB 2DEUA 1S1NA 3DLMA 3OYKA 1OV3A 2VGMA 3M0TA 2H3EB 3NGPA 3QG1A 3X26B 3CCJQ 1QVPA 3FDRA 4PLIA 4ZNXA 1ZHIA 2HSEB 3G71T 4D8DA 2E6ZA 4LUEA 1Y57A 4OB1B 1Q7YC 4J8OA 4OP0A 4WTOB 1KSWA 4JLGA 4Z8AA 1WXUA 3REBB 4C8QC 1YJNT 2VC8A 1M1KC 1EX4A 3FIFA 2YLBA 1K9AA 4EMGA 4BE2A 1NLPC 2I2LA 2LQKA 1K1ZA 2KAFA 4II1A 2Y4XA 3CCLT 2QNCA 4FIBA 4BE0A 2V8KA 3M0QA 5C6SA 5EG2A 3UT1A 4JDSA 1WHJA 3JCMb 5D7UA 2IIMA 4M7DE 2HQEA 1T3SA 4ZGDB 4ZTFA 1Q95G 4JS5A 1VQMA 2NYSA 2V8IA 4FYXB 4CC7A 4BI8B 3CCUA 2YUQA 1IO6A 2FB7A 2K5FA 4E7SA 1YI2Q 4M77F 1KC8R 2FVUA 5I2MA 3CMEA 4PFOA 4XTVA 3ZL7C 4M7DB 3MP6A 1KD1R 1ZUKA 2VVKA 2YRCA 3UF4A 3EH1A 4C92D 2E4HA 1A62A 4FT2A 1Y7XA 3JB9D 5HK3A 5FWBA 2EQJA 1H3ZA 3ME9A 2QG9B 1YN8A 1AD5A 5FU7C 2M16A 3VKIA 1KQ1A 2JUFA 3JV3A 2X4YA 2DJZA 1SHGA 4F7UG 4N4GA 1WQWA 3JB9I 2QA4A 2EAYA 4OMPA 4RTZA 3G71Q 3CBOA 4BI4A 3HFNA 4HCZA 2HCKA 4NL3A 3MEUA 4C0FA 2DE0X 4J5YA 2EYYA 1YNZA 1UJ0A 1WGSA 2WSEE 1Z9ZA 1YWPA 1WHLA 1HD3A 3EGDB 1G83A 2L0AA 2MAMA 4F7UA 3J7AF 3RERA 5FLXE 2LVMA 4M75F 3OYMA 2E3HA 3CC7A 2AZVA 3P8HA 1HXDA 2JVWA 1JJRA 2ZZDA 1V66A 4M78F 3SEMA 1WHKA 2DZCA 3G4SQ 3RKXA 2P84A 3NTHA 4HXJA 1M90C 1RLQC 2JMCA 3SWNA 1YHQA 2DKGA 1H9FA 3I56Q 3A8GB 2OX7A 5IH2A 2R5MA 1JQQA 4CRIA 2DYIA 1VQ5Q 4BD3A 2CUBA 1RUWA 1CKAA 1KC8U 1WNLA 2RI3A 1W70A 4C92E 2PNIA 3OYLA 1G3WA 1PD1A 2PTKA 1QWEA 3JB9J 2L3SA 3AHUA 1KD1U 3G1JA 5FW9A 1AOJA 4F16A 2C0IA 2LJ3A 1HJDA 4CC4B 4PLLA 4R0KA 4QVDA 2A0FB 1SSFA 2JM8A 3S3OA 1GFDA 2CSQA 4HCCA 3SFMA 4C92B 2RNAA 4V2SA 1I4K1 1JO8A 3JCMd 3EH2A 2COYA 1I07A 4ME7A 4AFZC 3EG9A 1ACMB 4M77C 1TU0B 5CCAA 4IUTA 4RTYA 1GFCA 4AMCA 1Y96B 4C0ZA 4OMFB 2MOXA 1H92A 4GLKA 2EJ9A 2CZ0B 2EKHA 3FC3A 1UGRB 1NBEB 2DIQA 2XDDA 3OYFA 2ROTA 3CMAA 3OW2P 5KYUA 1VQMT 1WXTA 3TREA 4FL6A 4C5EA 2LJ1A 1UECA 3VRYA 3M53A 4WCIA 3CCVA 5IXBA 4PJOG 2LCLA 4KGZB 2EWNA 4OVAA 3RNJA 5GAN8 4CC3A 2YWWA 2XDBA 4M75C 1X2KA 1MMAA 2R5AA 4OB0B 1U06A 1WXBA 1X6BA 2CUDA 3CC2A 1PG5B 4M78C 5KE2A 3HHTB 3OYYA 2RHYA 4LD6A 1SPKA 2CT3A 2KROA 2F5TX 4FYVB 1OYXA 5LJ3e 1XJWB 3CCJA 3BDLA 2QA4T 5GANf 3VUBA 1HK9A 2CZ1B 3TCJA 4XU1A 2X4XA 2PZ1A 1U1TA 3MEVA 4HVWA 4DQ2A 1AWWA 2FL7A 1MNEA 4KRTA 5KYYB 4N4IA 1SKUB 4RUGA 4XTZA 4NOYA 4M7DF 3CC7T 3RKYA 9ATCB 2NLUA 3OBYA 4QQDA 1FYNA 2X4JA 3I55Q 3DB4A 2DL3A 1YJ9A 3OS2A 1C6VX 1GCQC 1E7LA 3SB2A 1UJYA 2LNVA 1PM3A 1WJSA 1YIJQ 2HKQB 1YHQT 1ZSGA 1AHJB 2BZXA 1VQMQ 1M2VA 4B6MA 3EHRA 1VQKA 3CCUQ 1AT1B 3E9GA 2GF7A 3QZ9B 1KC8C 3VS3A 4GLMA 4DBHA 3OYHA 1YI2A 1O75A 3CMEQ 4LUDA 4F17A 1KD1C 4C8QG 4JJCA 1E6HA 2CP2A 2DL5A 5LJ3h 2DJQA 1IB8A 4MZPA 3BFMA 2W51A 2F2VA 3L0OA 1UGQB 2A28A 4A4KA 1YNSA 1FMVA 1MMNA 2KT8A 1SG5A 2A7YA 2RQWA 2PU9B 4C8QA 4OMLA 5HCKA 3JCMW 4PKCC 3L2UA 2ED0A 3OQ5A 3FJ5A 2QA4Q 3IQLA 1SRMA 2RI2A 2QNFA 2KNBB 3H6ZA 4GBQA 5FWCA 1M5Q1 1PC0A 4E7ZA 1I1JA 2O4XA 1H641 1RLPC 2DETA 2P0PA 3GOXA 2RHXA 3JCMf 1QQJA 2GFAA 3QWXX 3RIRA 2XK0A 2ED1A 1KK7A 4BDZA 2F69A 3GIBA 2BIVA 1FXXA 1VQ4A 4MDXA 3C95A 1VYVA 3CMAT 2O2OA 3WVDB 3G4SA 2KGTA 2B8AA 2VUBA 2Y90A 4C92F 2DERA 3JB9F 3I56A 1PCXA 3CCVT 3RDVA 1FMWA 1OPLA 2A36A 2XG8D 3V7SA 4FYWB 1GBRA 2RF0A 1NEGA 3LX7A 4DA4A 4M7DC 1JEGA 1G3TA 1EFNA 4A4GA 2DTHA 3CC2T 2HL3A 1VQNQ 3C4SA 3PVQA 1RAAB 4KUDK 1ZA2B 4J9BA 2RJEA 3OYEA 2KT1A 3JCMV 2QTVA 2JJ9A 3CCJT 2EJGA 1MV3A 2KDSA 3V7RA 1VQLQ 2CT4A 3A5ZB 1UB4A 2QXFA 3SHWA 1UHFA 3DLLA 4J7FA 2JT4A 2RQUA 1JBMA 2W0ZA 1RAEB 3KUFA 4DBQA 2QGFB 1YJ9T 2FHDA 4J9GA 3I5RA 3ASKA 4FM4B 3VS0A 4J9DA 2GQIA 5FU6B 1WA7A 5LJ3g 1OI1A 4M7AA 2LP5A 2ZPHB 1QP3A 2KY9A 1Y0MA 4F7UE 2KXDA 2L89A 2FG0A 4J7IA 1AEYA 1G5VA 2AKLA 5CKHA 1F1BB 3CC4A 1YI2T 1OU9A 4IKFA 5CAIA 3CCVQ 3JCMJ 2ATCB 2QEXQ 4M77G 3QXEB 2P0QA 2PVOB 2E65A 1GXIE 1VIFA 2NUPA 4Z89A 1GBQA 1RACB 2RB6A 2CP3A 4F7UB 2P0KA 2C06A 3VYGA 1XOVA 2LQWA 4C0DB 4ANJA 2D8HA 2O31A 4XU0A 1HSQA 3I9QA 4HT8A 4M77A 1IGUA 3M0UA 5KYWA 2RK1A 3SWNB 3RMSA 4C92C 4JJNK 3PFSA 2YRDA 4Y92A 1IREB 4J9FA 5LL6S 4JLIA 4XTXA 3H9NA 2K6DA 3CXCS 1T0JA 3HRTA 2BZYA 1RAIB 1PSFA 3F70A 1UUEA 3E19A 5KCHA 3META 3PTAA 5GAMh 1TSFA 3FB9A 1NYGA 4BITA 1I5LA 8AT1B 3O8VA 2JVVA 5LJ3j 2DXBA 5CR2A 3EGUA 2GCXA 1NE8A 2ZPBB 3CBMA 2E70A 5KCOA 1PKSA 2ZCFB 3S3NA 3QYHB 4FT4A 3I55A 3L2VA 1YJ9Q 4M75G 1VQ4T 3L1AA 1O9SA 3EGXB 4CI0C 5GMKe 4RCBA 2QQRA 1OX9A 3GNFB 1QCNA 3THKA 3G4ST 4M78G 4PL6A 1ABOA 1V29B 2QQ9A 1YIJA 2CKKA 4BACA 2MWPA 2P4TA 2QTXA 3I56T 2QDYB 2YUPA 1BB9A 5GAOr 1ARKA 3TVTA 4OGEA 3MO8A 1GL5A 1VQ5T 1FWZA 1PNJA 2GNCA 4RCCA 2KW9A 4M75A 1VQKQ 3QBYA 3QUIA 3HPWA 3MHXA 1RABB 3V7CA 2ZPFB 3EG9B 1PD0A 1AVZC 3NTKA 1VQOA 1CKBA 2CP0A 1VQ7A 2EGEA 2I0NA 3DKMA 2KFVA 2L3QA 1NZ9A 3OYBA 2OTLQ 1ZSZA 4EPCA 1NYFA 2G6FX 2FRYA 2MYSA 2L3PA 2LX7A 2FYKA 2JNGA 2EPDA 2L5QA 2EQUA 4Y91A 1A0NB 3QO3A 1ZBHA 2K5IA 2HKNA 1JJ2S 1D3BA 1Q81R 5D6WA 5KYUB 4BI3A 1ABQA 2FZKB 3H8ZA 2DBMA 1LVKA 1BKBA 1N9SA 4X9CA 2ODCI 2KI7A 5GAN5 3ULRB 1R0CB 1PRLC 1LJOA 3R6NA 1P92A 1E7OA 2GTJA 2E6NA 3WVEB 1M8MA 1D1AA 3ZBDA 1K8AU 1PWTA 3P8DA 2EQMA 3OW2A 3Q1JA 1VYTA
chains in the Genus database with same CATH topology
5LJ5f 2XDBA 4M75C 3ZEHA 4ELYC 1Q7YU 4HT9A 4XAXB 2R5AA 4OB0B 3CCQT 3QHSA 4E7IA 4N0AC 4M78C 5CVIA 5HY6A 1OZ3A 5KE2A 3HHTB 2QI2A 3OYYA 1YJNA 4QW2A 1M1KU 1U8RA 2RH2A 2RHYA 1BI0A 4LDYA 3LLRA 3CCRA 1N6AA 1OZ2A 3CCMT 3OYGA 4LD6A 3CCEA 2DTIA 3RESA 2F5TX 5GAOq 3CC4T 4X34A 1OYXA 3T9NA 3URGA 3JCMQ 3GPLA 3CCLA 4KULA 5I21A 5LJ3e 1MGQA 4DOVA 2E41A 3CCJA 1BI3A 3BDLA 4LDWA 4A54A 2QA4T 5GANf 5GMKi 3VUBA 1W2BS 4PJOD 1HK9A 2A3LA 2JTMA 3EFRA 2CZ1B 2DPPB 2VXFA 3TCJA 3HSBA 1YBYA 5CKFA 2VXEA 1MHNA 2CGHA 3CPWS 4XU1A 2X4XA 1U1TA 3MEVA 2K5LA 5CKEA 3QDRB 4DQ2A 1VQ5A 4M78E 5GAMg 3CC2A 5LJ5j 4XTWA 2FL7A 1VQ9T 1VUBA 2GQVA 4N4IA 3EAEA 4JUVA 4XTZA 2G3RA 3QKJA 4NOYA 4BY6B 3RKYA 3CC7T 2NLUA 1VQNA 4M7DF 4M7AF 3OBYA 4QQDA 2PVGB 2DEQA 2X4JA 3DB4A 2XI9A 3QPHA 4C8QF 3CEYA 2XU8A 1YJ9A 3OS2A 3N5BB 3S3MA 4EMKC 3SB2A 1ZQ1A 4M75B 5GANe 2LNVA 1WJSA 1UGPB 2WSFE 1M4ZA 4J83A 4TVRA 1NPRA 1YHQT 1Q81U 4M78B 1K73C 2RJCA 3OMCA 1G3YA 2VYTA 1VQLA 3J81E 1FX7A 2RJDA 3JSCA 3GLXA 4M78A 1YCYA 3ZFJA 3L2ZA 5LJ3d 5GAMf 1AHJB 2QQSA 5J26A 3OYAA 2LT4A 2RO0A 1VQKA 4QVCA 3LWIA 1VQPT 4OB2B 2DTOA 1WPYA 3X28B 2D0QB 3PMIA 4ZGJB 3E9GA 3CCSA 2GF7A 3QZ9B 2ZPGB 4ZGEB 4XU2A 4C8QE 3UPUA 3A8OB 3M54A 1KC8C 3OYHA 4DOWA 5GAN4 3I55T 1YI2A 4PJOC 1O75A 3LW5E 4F7UF 3OMGA 4M7DG 3SDZA 4M7AG 2PQWA 1KHIA 2MF2A 2KK4A 3OBWA 1QW1A 1KD1C 2O01E 3QSUA 2IVWA 3V8KA 3HRSA 4C8QG 5KH6A 4KUIA 3OW2A 1NPPA 2LRQA 1NJIU 4IUUA 3C94A 1YIJT 4JRPA 5LJ3h 4JRKA 4GY5A 2X4WA 2AHJB 4MZPA 3PIPA 1LOJA 2PUKB 3BFMA 3FEOA 2EQKA 1K9MC 4IURA 5GAMe 3S6WA 4E7HA 4E7LA 2MI6A 1UGQB 5D6XA 4A4KA 4XTYA 2HNIA 2V8JA 3JCMg 5GANd 1XNIA 2DXTA 3TU4K 4C8QB 5DY9A 4O5VA 4EMKB 3CCUT 5IN1A 2A7YA 5IAYA 5GAMj 4LDVA 1QVGA 3BY7A 2XHCA 4O6JA 4PJOE 2LDMA 2PU9B 4ZTJA 4A4HA 2PUOB 3LGLA 3E9FA 4C8QA 4EMKA 4ZN3A 5IT9E 4A4FA 3JCMW 1U1SA 3M57A 2KQWA 2RHIA 4PKCC 2DXCA 2YHTA 3L2UA 5GMKh 1X75C 2RHZA 4HA8A 3OQ5A 3CMET 3JCMc 1KG1A 5CQYA 1M90U 4M7DD 1R8OB 2RI2A 4MMKA 4MZMA 2QEXA 4RKUE 4M7AD 3C12A 4JRQA 1M1GA 3BW1A 2O4XB 3H6ZA 5J3BA 4L5GA 2DIGA 3M56A 4NL2A 1M5Q1 3PT9A 1QP2A 4LDUA 2E1HA 1S72T 2O4XA 1M8VA 1H641 4BB7A 2DD5A 3OSSC 3OS5A 3M55A 2L8DA 5GAOl 3CD6T 4PJOB 1BIAA 2P0PA 4RMOA 3GOXA 2RHXA 3JCMf 1X01A 1Q86C 2GFAA 5A0GA 1N8RC 4PJOA 3RIRA 2XK0A 5DLQE 2D9TA 4BDZA 2F69A 4LDXA 3GIBA 3HRUA 2BIVA 1FXXA 3X20B 1VQ4A 4MDXA 2EJFA 3C95A 3FLGA 3MP1A 2DAQA 5CQXA 3CMAT 2KSSA 3INZA 1WJQA 3WVDB 3QJYA 3JRZA 3VYHB 3G4SA 1YJWA 4R55A 2OTJT 2K2VA 1DJ7B 2B8AA 2VUBA 4X9DA 5GAN6 3DLMA 3OYKA 2Y90A 4IUVA 2VGMA 4C92F 3JB9F 3I56A 4VUBA 3JB9H 5LJ5e 3UDCA 3OS1A 3QG1A 2M9UA 5CKBA 4RG8A 3X26B 4D6WA 1QVPA 3FDRA 3CCVT 1K8AC 1GXIE 2KVQG 4C0GA 1VQ6T 4PLIA 2RA2A 1QVGS 1ZHIA 4JS4A 2XG8D 4WF2A 3V7SA 2M1HA 3G71T 3OSVA 3MCAB 2E6ZA 4M77D 3WXMB 3V8LA 1XTDA 3LX7A 4DA4A 2RJFA 4M7DC 4OB1B 1BI2A 1Q7YC 1G3TA 4J8OA 4M7AC 3TEEA 4OP0A 4JLGA 4A4GA 2CYZB 3G6EA 5FU6C 2DTHA 4C8QC 3HKSA 1YJNT 3CC2T 2VC8A 3C4SA 1M1KC 5GAN7 5GAOm 3FIFA 2YLBA 4KUDK 3CCRT 4EMGA 4BE2A 2RJEA 2LC4A 3OYEA 3CCET 5CK9A 4HKEA 2I2LA 2LQKA 2KAFA 4II1A 3RUXA 2Y4XA 3CCLT 4FIBA 3OS0A 5GMKl 4BE0A 2ZPEB 3JCMV 2V8KA 1N27A 3G7ZA 5GAOp 3CCJT 2EJGA 3M58A 5C6SA 5EG2A 4C92G 3UT1A 3JB9G 4L6V5 5GMKj 4JDSA 3JCMb 2KDSA 3V7RA 3OYIA 4M7DE 1VQ8A 2HQEA 2RM4A 4M7AE 4ZGDB 3PNWC 3OA6A 4ZTFA 3A5ZB 3CBPA 1WJRA 1Y71A 4JS5A 1UB4A 3ER0A 2RK2A 5LJ5d 2QXFA 1VQMA 2V8IA 3R6OA 1KHCA 2DVEA 3M59A 3QIIA 3DLLA 4J7FA 3UWNA 4BI8B 3CCUA 1JBMA 2HQXA 4BE1A 1Q82U 1YITA 2OTLA 2XKOC 3OYJA 3KUFA 1BIBA 3X25B 1VQNT 3MEWA 2YRVA 3PMTA 2FB7A 2K5FA 4A4EA 4M77F 3OY9A 3P8BB 4C0DC 2FVUA 5I2MA 1YJ9T 4J6YA 2FHDA 3L2RA 3CMEA 4M75D 3ASKA 2YLCA 3L2WA 4XTVA 2GFUA 4FM4B 4OB3B 4XTUA 4M7DB 1X6OA 3MP6A 4M7AB 3NTIA 2DO3A 1XQHA 4IUQA 4Y28E 5FU6B 4C92D 2K3XA 5LJ5h 4FT2A 3SWNC 1Y7XA 5LJ3g 3JCMX 3JB9D 1Q81C 4M7DA 1OI1A 5HK3A 4M7AA 2IG0A 1VQLT 2EQJA 2QQAA 3CPFA 4N4HA 3ME9A 2ZPHB 3CCQA 1H3ZA 4IUPA 3CXCA 1VQOT 4E47A 4MZTA 1QP3A 2KY9A 5FU7C 4F7UE 5GAN3 2HBPA 3V8JA 1QVFA 3LGFA 2L89A 1VQ7T 4ATOA 2M16A 3VKIA 4J7IA 1G5VA 3L42A 2JN0A 3DB3A 3KBGA 4QVZA 5CKHA 1LNXA 3CCMA 3CCST 4RG2A 4M77E 1KQ1A 2JUFA 3LH0A 3M4GA 2X4YA 2DJZA 3VV0A 3RKWA 4F7UG 3CC4A 4J6WA 1YI2T 4N4GA 4IKFA 4EMHA 1WQWA 5CAIA 3JB9I 3JCMJ 5GANh 2QA4A 2Y4YA 2CZ6B 3GP8A 4FU6A 4MMLA 5FRNA 2EAYA 3M5AA 2MWOA 4M77G 3QXEB 2P0QA 3CBOA 4BI4A 1KQSA 3E1SA 3EFSA 2PVOB 3HFNA 3MEUA 2E65A 4HCZA 4QQGA 4C0FA 1VIFA 4EDUA 5I2SA 4NL3A 3JCMP 1NJIC 2RB6A 4ZN1A 5J39A 2E64A 5LJ3f 3X24B 4J5YA 2P0KA 4F7UB 1WGSA 2WSEE 2M0OA 2QQBA 2C06A 4BUGA 2D6FA 3VYGA 1XOVA 4HCBA 2MAMA 4C0DB 4F7UA 1VQ9A 3J7AF 3RERA 5FLXE 2LVMA 4M75F 5A0DA 5GAOn 3OYMA 5GAMd 3CC7A 4M77B 4XU0A 1IZ6A 4J6XA 3FJPA 3P8HA 3OYDA 3LWHA 2EFIA 2LT1A 1HXDA 4B9WA 2X35A 2ZZDA 5FRMA 4HT8A 2E12A 4FSXA 4M77A 2LCCA 4M78F 2K3YA 4BDYA 2RK1A 2DZCA 3SWNB 3M9QA 3QYGB 5D6YA 3RMSA 4C92C 3PFSA 3RKXA 3KXTA 4JJNK 2RI5A 4ELZC 5LL6S 1IREB 3A8HB 3A8LB 2R58A 2DXUA 3NTHA 2EIFA 3M4YA 1M90C 4XK8E 4JLIA 4XTXA 2QEXT 3SWNA 2LX9A 1YHQA 5FU7B 1K73U 3CXCS 2E5QA 3JCMe 2DKGA 2ZPIB 3HRTA 2LQ8A 1PSFA 3A8GB 3GF5A 3F70A 1QVFS 5CO7A 2R5MA 3E19A 3GNGA 5KCHA 4E7JA 4CRIA 3META 2CZ7B 5GAMh 3PTAA 1BI1A 3FB9A 4C5GA 4BD3A 2MMPA 3OYCA 1I5LA 3OYNA 4A53A 3FRNA 5A0LA 4M75E 3O8VA 2JVVA 5LJ3j 2DXBA 5CR2A 1VQPA 2GCXA 1NE8A 2ZPBB 5C0MA 3HP9A 2BUDA 2E70A 3CBMA 5KCOA 4Q5WA 2WACA 2ZCFB 3S3NA 3QYHB 1KC8U 1WNLA 4FT4A 3I55A 4R56A 2RI3A 4C92E 3L2VA 4C5IA 3OYLA 4LD9K 2L3RA 1UGSB 4M75G 1VQ4T 1G3WA 3L1AA 1JJ2A 1O9SA 4L59A 4CI0C 1I81A 1Y07A 2XIDA 4XQ3A 1KQSS 5GMKe 3OB9A 3JB9J 4RCBA 2QQRA 2JZ2A 3GNFB 3AHUA 3G4ST 1KD1U 1YJWT 1TH7A 4M78G 4PL6A 2QQ9A 1V29B 4NS5A 1JRIA 1EIFA 1RI0A 1YIJA 2CKKA 4BACA 2BKDN 2MWPA 3PIOA 2P4TA 2QTXA 4YTLA 3VUZA 3OW2S 3I56T 2EKOA 2QDYB 2WSCE 5HKCA 5M9OA 1RL2A 1K9MU 4QQ6A 2CS7A 5GAOr 4PLLA 1B34B 2RD1A 4QVDA 4E7KA 4OGEA 1SSFA 3MO8A 1VQ5T 1FWZA 2XDPA 4RCCA 2HAXA 4M75A 2K57A 4XU3A 3S3OA 5AYFA 1VIEA 2HD0A 5DLOA 2H3JA 3SFMA 3QBYA 3QUIA 1B34A 4HCCA 3HPWA 3MHXA 4C92B 3V7CA 1I4K1 5GANj 4V2SA 3RMQA 2ZPFB 4P5NA 3LYIA 3NTKA 3JCMd 1M9SA 3QJ6A 1VQOA 4B9XA 4N0AA 3L2QA 4ME7A 3VU3C 5FROA 1I8FA 4C92A 5HK0A 3VJPA 5CIUA 1VQ7A 2VV5A 3DKMA 4M77C 3G6ET 1NZ9A 1G3SA 1UEBA 2JOYA 2E10A 3OYBA 5CCAA 4IUTA 1KQ2A 4PJOF 1PSEA 4EPCA 2XICA 2K4YA 5KE3A 3HL8A 2DK3A 4M78D 4JRIA 2FYKA 1N9RA 3J80E 2JNGA 4PNOA 2XD0A 2ZGWA 2L5QA 1S72A 2EQUA 1W4SA 1Y96B 4Y91A 4C0ZA 2KMTA 4KT0E 1ZBXA 3QO3A 4GLKA 4OMFB 2RHUA 3CD6A 1D3BB 2EJ9A 5L8RE 3MP8A 3JCMh 1Q86U 2CZ0B 5GMKm 1Y96A 2K5IA 2JTFA 3FC3A 4OF1A 2EYQA 3SD4A 1UGRB 3BDUA 5LJ5g 1N8RU 1D3BA 4KBMB 4Z02A 5GAN2 5D6WA 1JJ2S 1VQ8T 1VQKT 1W2BA 4BI3A 2R57A 3H8ZA 2DIQA 2XDDA 3JAME 3OYFA 2DZ9A 3CMAA 1M1FA 3CPWA 4OGCA 1VQMT 1BKBA 3HFOA 1N9SA 3A8MB 3QZ5B 4UC4A 4X9CA 5GAN5 4C5HA 2OTJA 2VGNA 1Q82C 2F5KA 1YITT 3TREA 2OTLT 5DM7R 4FL6A 5A2QE 4C5EA 1BYMA 1JB0E 1LJOA 3M53A 1P92A 3NFCA 2OAUA 2E6NA 3WVEB 3PGGA 3MEAA 3ZBDA 4BY6C 3CCVA 1K8AU 2LTOA 4MDWA 4PJOG 1VQ6A 5GANg 2DD4A 1WQ7A 2LCLA 3P8DA 2EWNA 5CKDA 2PVDB 3G71A 2EQMA 4OVAA 5GAN8 3Q1JA 4C8QD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUR A;  4C5G A;  3OYI A;  4E7L A;  3S6W A;  2HQE A;  4BD3 A;  3OYC A;  4E7H A;  3OYN A;  5D6X A;  4ZTF A;  3O8V A;  3PNW C;  3ZEH A;  3OA6 A;  1WJR A;  1XNI A;  2R5A A;  5IN1 A;  5C0M A;  5IAY A;  1KHC A;  2BUD A;  5KCO A;  3QII A;  4E7I A;  4Q5W A;  2WAC A;  2LDM A;  3UWN A;  5KE2 A;  3S3N A;  1OZ3 A;  4BE1 A;  2HQX A;  4A4H A;  3LGL A;  2RI3 A;  3E9F A;  4QW2 A;  3L2V A;  4ZTJ A;  4C5I A;  4A4F A;  3OYL A;  3OYJ A;  2L3R A;  3KUF A;  2RHY A;  2RHI A;  3MEW A;  2YRV A;  3PMT A;  3LLR A;  4L59 A;  3L2U A;  1OZ2 A;  2RHZ A;  3OB9 A;  3OQ5 A;  4LD6 A;  2QQR A;  2JZ2 A;  4A4E A;  3OYG A;  3OY9 A;  4X34 A;  1OYX A;  2RI2 A;  2FHD A;  3L2R A;  4PL6 A;  4NS5 A;  3ASK A;  1RI0 A;  3L2W A;  2CKK A;  2GFU A;  4BAC A;  2BKD N;  2O4X B;  2MWP A;  3BDL A;  3H6Z A;  2DIG A;  3MP6 A;  2EKO A;  3NTI A;  5M9O A;  4QQ6 A;  2O4X A;  4IUQ A;  4PLL A;  1MHN A;  2K3X A;  4E7K A;  1SSF A;  3MO8 A;  2L8D A;  1OI1 A;  2X4X A;  2XDP A;  2IG0 A;  3MEV A;  3S3O A;  3GOX A;  2EQJ A;  2RHX A;  1H3Z A;  4N4H A;  3ME9 A;  3QBY A;  2GFA A;  4IUP A;  2XK0 A;  3LYI A;  2D9T A;  3MET A;  3LGF A;  2L89 A;  3NTK A;  3QJ6 A;  4B9X A;  3L2Q A;  4N4I A;  4BDZ A;  2M16 A;  3EAE A;  5FRO A;  2G3R A;  3QKJ A;  2BIV A;  1G5V A;  3L42 A;  2NLU A;  3FLG A;  5CIU A;  3DB3 A;  3MP1 A;  4QVZ A;  2DAQ A;  4QQD A;  1WJQ A;  4RG2 A;  3DB4 A;  3OYB A;  3LH0 A;  2X4Y A;  3CEY A;  4IUT A;  3OS2 A;  2B8A A;  3S3M A;  4N4G A;  4IKF A;  3DLM A;  3OYK A;  5KE3 A;  4IUV A;  4FU6 A;  5FRN A;  2MWO A;  1WJS A;  3OS1 A;  2EQU A;  4HCZ A;  3FDR A;  4QQG A;  3MEU A;  2RJC A;  4EDU A;  4PLI A;  2RHU A;  3OMC A;  2VYT A;  5J39 A;  3MP8 A;  2P0K A;  2M1H A;  1WGS A;  2M0O A;  2RJD A;  2JTF A;  3FC3 A;  3SD4 A;  4Z02 A;  2QQS A;  5J26 A;  5D6W A;  3OYA A;  2RO0 A;  2LVM A;  2R57 A;  3LX7 A;  2RJF A;  3H8Z A;  3OYM A;  2DIQ A;  3OYF A;  3PMI A;  3OYD A;  3P8H A;  2EFI A;  4A4G A;  3E9G A;  4B9W A;  5FRM A;  2GF7 A;  2X35 A;  4UC4 A;  4C5H A;  2LCC A;  2K3Y A;  3OYH A;  4BDY A;  2F5K A;  3C4S A;  3OMG A;  4FL6 A;  3M9Q A;  5D6Y A;  4C5E A;  3PFS A;  2PQW A;  2RI5 A;  4BE2 A;  2RJE A;  3OYE A;  2R58 A;  3NTH A;  4II1 A;  2E6N A;  5KH6 A;  3MEA A;  3OS0 A;  4BE0 A;  2LTO A;  2LRQ A;  2E5Q A;  4IUU A;  1N27 A;  3P8D A;  4GY5 A;  5C6S A;  2X4W A;  3F70 A;  2EQM A;  3UT1 A;  2R5M A;  3FEO A;  5KCH A;  4E7J A;  4OVA A;  4CRI A;  2EQK A;  3Q1J A; 
#chains in the Genus database with same CATH topology
 1RI9 A;  3RR6 A;  2OJ2 A;  4ELY C;  2HBW A;  1VQ4 Q;  2B86 A;  5CVI A;  4QW2 A;  1U8R A;  1N6A A;  4J9E A;  3OYG A;  3RES A;  5GAO q;  3CC4 T;  3PE0 A;  4X34 A;  2ECZ A;  4KUL A;  5I21 A;  1MGQ A;  4A54 A;  2YXY A;  2KRS A;  1JEI A;  1W2B S;  2DLP A;  3TSZ A;  2JTM A;  3NMZ C;  2LMJ A;  2AZS A;  2H8H A;  1OQK A;  5GAM g;  1VUB A;  3QKJ A;  4BY6 B;  1VQN A;  1QMC A;  2DX1 A;  3QPH A;  3MKD A;  3S3M A;  5GAN e;  1UG1 A;  1UGP B;  2WSF E;  2SEM A;  2RPN A;  1Q81 U;  3OMC A;  2VYT A;  1VQL A;  1M2V B;  2LC3 A;  1FX7 A;  2VWF A;  3GLX A;  1YCY A;  1IGQ A;  5LJ3 d;  5J26 A;  2FZC B;  4QVC A;  4OB2 B;  1WPY A;  1M27 C;  3PMI A;  2E3I A;  2IPO B;  2ZPG B;  4XU2 A;  4C8Q E;  2YUO A;  3I55 T;  2A8V A;  2RNN A;  3A98 A;  4F7U F;  2F1L A;  1D09 B;  4M7D G;  2L2P A;  4PJM A;  1QW1 A;  2KEA A;  2IVW A;  3V8K A;  3HRS A;  5KH6 A;  4KUI A;  1NPP A;  1E7D A;  1YIJ T;  4JRP A;  1A8V A;  1JXO A;  2EQK A;  5GJV B;  4E7L A;  1X43 A;  2MI6 A;  3EFO A;  2O88 A;  2HNI A;  1XNI A;  2EYZ A;  2QYZ A;  3CQT A;  4O5V A;  2KVE A;  4C8Q B;  3CCU T;  5GAM j;  4OMN A;  3BY7 A;  2LDM A;  3UAT A;  2PUO B;  3LGL A;  5IT9 E;  4EMK A;  4ZN3 A;  3CC4 Q;  4A4F A;  1U1S A;  1X2Q A;  3M57 A;  3EG2 A;  2GGR A;  2F2W A;  3CME T;  2QEX A;  4RKU E;  4M7A D;  3C12 A;  3BW1 A;  2EGA A;  2CSI A;  2O4X B;  5J3B A;  2DL8 A;  2QGG A;  1SRL A;  4NL2 A;  1QLY A;  2V1R A;  1QP2 A;  2E1H A;  1VQ6 Q;  1YCS B;  1M8V A;  3OSS C;  4RMO A;  1X01 A;  1YP5 A;  1M3B A;  1M2O A;  4LN2 A;  4PJO A;  2YDL A;  1FMK A;  1BCO A;  2DM1 A;  4LDX A;  3HRU A;  2EJF A;  1WZO A;  2DAQ A;  2KSS A;  1WJQ A;  2CP7 A;  2K2V A;  5IHI A;  5GAN 6;  1TUC A;  4IUV A;  3CCE Q;  3JB9 H;  2LD7 A;  5LJ5 e;  1SSH A;  2M9U A;  5CKB A;  1K8A C;  2KVQ G;  2RA2 A;  2OI3 A;  1QVG S;  4JS4 A;  2RQV A;  2M1H A;  3MCA B;  2CRE A;  4M77 D;  1LPL A;  3V8L A;  1XTD A;  2RJF A;  3NHN A;  1BI2 A;  3TEE A;  5FU6 C;  2AKK A;  3GBQ A;  5GAO m;  2LC4 A;  4M4Z A;  2JTE A;  3OS0 A;  5GMK l;  1N27 A;  5GAO p;  3M58 A;  4C92 G;  1T3L A;  3JB9 G;  4L6V 5;  5GMK j;  3H0F A;  3OYI A;  2VAS A;  1K73 R;  1C0M A;  4M7A E;  3H41 A;  3CBP A;  1VQO Q;  1WJR A;  1Y71 A;  3ER0 A;  4K11 A;  1IRX A;  3PVL A;  1VQ7 Q;  2DVE A;  3QII A;  3UWN A;  1CSK A;  4BE1 A;  4J9I A;  2OTL A;  2XKO C;  1A63 A;  1VQN T;  3MEW A;  2YRV A;  3PMT A;  3CCS Q;  1GL9 B;  3OY9 A;  3P8B B;  4PJL A;  4C0D C;  1QVF P;  4J6Y A;  4M75 D;  3L2W A;  3U23 A;  5GJW B;  2DBK A;  4M7A B;  2YT6 A;  3NTI A;  2HEQ A;  4IUQ A;  4Y28 E;  2FEI A;  5LJ5 h;  3JCM X;  3SWN C;  1Q81 C;  2WQG A;  2EYW A;  2IG0 A;  1VQL T;  2QQA A;  4N4H A;  1WIE A;  2MCN A;  4IUP A;  3CXC A;  4E47 A;  2A08 A;  1K9M R;  1KQS P;  5GAN 3;  1TOV A;  2JM9 A;  3LGF A;  4DBR A;  2RMO A;  3DB3 A;  3KBG A;  4QVZ A;  2MK5 A;  6AT1 B;  4EIK A;  4RG2 A;  4M77 E;  2HDA A;  3LH0 A;  3VV0 A;  3RKW A;  4J6W A;  2DF6 A;  4EMH A;  2Y4Y A;  4FU6 A;  2NUP B;  3M5A A;  2MWO A;  4F14 A;  4QQG A;  3EFS A;  2A37 A;  5I2S A;  4EDU A;  2QDL A;  3UA7 A;  4FYY B;  4ZN1 A;  2X3X D;  2E64 A;  5LJ3 f;  3X24 B;  5J39 A;  2SRC A;  3BE3 A;  1M30 A;  5GAM d;  1QCF A;  4M77 B;  1JEQ A;  3VS2 A;  2AT1 B;  3UA6 A;  5KYW B;  3OYD A;  3FJP A;  2EFI A;  4B9W A;  5FRM A;  2X35 A;  1UE9 A;  1BK2 A;  2ABL A;  3M9Q A;  2LCS A;  3KXT A;  1LCK A;  1YJW Q;  4OMM A;  3A8L B;  3A8H B;  2DXU A;  2EIF A;  1TTH B;  1TXQ A;  2K9G A;  2QEX T;  4RTV A;  1RAD B;  1K73 U;  3EG3 A;  1QVF S;  5CO7 A;  1N5Z A;  4E7J A;  1C1A A;  2P4R A;  4C5G A;  4RTU A;  3OYN A;  5A0L A;  4M75 E;  1VQP A;  5IXF A;  3HP9 A;  2BUD A;  1MUZ A;  4Q5W A;  2MIO A;  1JJ2 A;  4L59 A;  2X3W D;  3G6E Q;  1Y07 A;  2XID A;  4XQ3 A;  1KQS S;  5IHK A;  2FPF A;  1TH7 A;  5I11 A;  1MV0 B;  2CP5 A;  4NS5 A;  1EIF A;  1JRI A;  2W10 A;  3PIO A;  2EKO A;  1MMG A;  4RTX A;  5M9O A;  1RL2 A;  1K9M U;  2CS7 A;  5IHN A;  4QT7 A;  2HAX A;  1EZZ B;  4XU3 A;  5AYF A;  1VIE A;  2HD0 A;  1B34 A;  1VQ8 Q;  5GAN j;  2NWM A;  4P5N A;  3LYI A;  1M9S A;  2V26 A;  4B9X A;  3L2Q A;  3CXC P;  3VU3 C;  5FRO A;  1I8F A;  5HK0 A;  4HVV A;  3VJP A;  5CIU A;  1ZSZ B;  1YIT Q;  2X51 A;  1KQ2 A;  1G3S A;  1UEB A;  1G2B A;  4PJJ A;  1PSE A;  2K4Y A;  2OAW A;  5KE3 A;  3CPW P;  3HL8 A;  4AFS C;  4JRI A;  3J80 E;  1N9R A;  1X6G A;  2XD0 A;  4KT0 E;  1ZBX A;  2RHU A;  4AT1 B;  3CD6 A;  1D3B B;  5L8R E;  2JMA A;  3EG1 A;  5GMK m;  2JTF A;  3SD4 A;  3BDU A;  5LJ5 g;  1N8R U;  1VQK T;  4KBM B;  4Z02 A;  1QKX A;  2EYX A;  4FCY A;  1W2B A;  2NUT A;  2GBQ A;  3VRZ A;  1RAG B;  8ATC B;  2M0Y A;  1V76 A;  1M1F A;  4OGC A;  3HFO A;  3A8M B;  3QZ5 B;  5KYX A;  2VGN A;  2F5K A;  2OTL T;  5DM7 R;  2M51 A;  5A2Q E;  1JB0 E;  1WHH A;  2RNO A;  1W1F A;  2OAU A;  4BY6 C;  5AT1 B;  2LTO A;  4MDW A;  1VQ6 A;  2DD4 A;  1WQ7 A;  5CKD A;  1YFN A;  1QKW A;  5FRN A;  1GCP A;  1K0X A;  2EGC A;  3REA B;  4JPB W;  1NJI R;  3ZEH A;  1IHV A;  4XAX B;  4N0A C;  1QWF A;  1WFW A;  4HCK A;  1OZ3 A;  5HY6 A;  2QI2 A;  2COW A;  2DIL A;  2E5K A;  2RH2 A;  4LDY A;  1BI0 A;  1UHC A;  3CCR A;  1H9E A;  3CCE A;  1JJ2 P;  2K7A A;  3URG A;  3GPL A;  4LDW A;  5GMK i;  1B7T A;  1K8A R;  4PJO D;  3EFR A;  4D8K A;  4PFZ A;  2KYM A;  3HSB A;  1MHN A;  2CGH A;  2VXE A;  3CPW S;  4KGV B;  1H3H A;  2DMO A;  1M3C A;  5LJ5 j;  1PRM C;  1UFF A;  2GQV A;  1IHW A;  4JUV A;  2G3R A;  2J05 A;  2G80 A;  1BBZ A;  4M7A F;  2DEQ A;  1KFZ A;  2XI9 A;  2XU8 A;  3N5B B;  1Z9Q A;  1ZQ1 A;  1SEM A;  2HMA A;  1ZLM A;  1M4Z A;  4TVR A;  1VA7 A;  1K73 C;  1MND A;  2RJC A;  1HYO A;  1J3T A;  1G3Y A;  2BE7 D;  2RN8 A;  3J81 E;  4OMO A;  2J6F A;  2LJ0 A;  3ZFJ A;  4M78 A;  3L2Z A;  4PK4 A;  5GAM f;  3OYA A;  2LT4 A;  2FPD A;  1ZA1 B;  1VQP T;  2HSP A;  3X28 B;  2LQN A;  1W2B P;  3CCS A;  4ZGE B;  3UPU A;  3M54 A;  4DOW A;  1RAH B;  5GAN 4;  3VS6 A;  2EW3 A;  2BZ8 A;  1JU5 C;  1U5S A;  1KHI A;  2MF2 A;  1RAF B;  3OBW A;  1WLP B;  3I35 A;  1NJI U;  3C94 A;  2BE9 B;  4JRK A;  4GY5 A;  2X4W A;  2AHJ B;  1TG0 A;  3EFO B;  1LOJ A;  3PIP A;  1S72 Q;  3FEO A;  4JJD A;  2HQH A;  1K9M C;  2HZY A;  3S6W A;  5D6X A;  2DL4 A;  2FO0 A;  2O9S A;  4XTY A;  2V8J A;  5GAN d;  2DXT A;  3TU4 K;  4EMK B;  4X1V A;  1ZBJ A;  4JZ4 A;  4UZW A;  5IN1 A;  5IAY A;  1QVG A;  4PJO E;  2XHC A;  1GCQ A;  2RQR A;  1VOM A;  3E9F A;  2D1X A;  5KYN A;  3VS7 A;  2KQW A;  2RHI A;  1PKT A;  5GMK h;  4HA8 A;  2OTJ Q;  3JCM c;  5CQY A;  1R8O B;  4MZM A;  2YSQ A;  1Q82 R;  4JRQ A;  1D0Y A;  4L5G A;  3M56 A;  3PT9 A;  4LDU A;  1K4U S;  2VKN A;  2L8D A;  3H0H A;  2CDT A;  5GAO l;  3CD6 T;  4PJO B;  2QAS A;  1B3Q A;  1I0C A;  1N8R C;  2ENM A;  2D9T A;  1V1C A;  3MJX A;  3FLG A;  5CQX A;  1YJN Q;  1WYX A;  1X27 A;  3QJY A;  3JRZ A;  3VYH B;  1YJW A;  1DJ7 B;  4X9D A;  2KXC A;  3HTR A;  3CCL Q;  4VUB A;  3UDC A;  2LNH B;  3OS1 A;  1E6G A;  4RG8 A;  4D6W A;  1D0Z A;  4C0G A;  1VQ6 T;  2NUZ A;  1QCO A;  1OOT A;  4WF2 A;  4DEX A;  2FRW A;  1MMD A;  2C0O A;  3OSV A;  1VQP Q;  1UDL A;  3WXM B;  2KVD A;  1M3A A;  2Z0W A;  2J6K A;  4M7A C;  1NM7 A;  2CYZ B;  3G6E A;  3HKS A;  5GAN 7;  2CH4 A;  2DRM A;  2ROL A;  3CCR T;  3D7S B;  2JXB A;  3CCE T;  5CK9 A;  2AK5 A;  1G8X A;  4HKE A;  3RUX A;  2ZPE B;  1GRI A;  3I5S A;  3G7Z A;  3EGX A;  3KFV A;  3M0R A;  1VQ8 A;  2RM4 A;  4J9H A;  3PNW C;  3OA6 A;  2RK2 A;  5LJ5 d;  1R77 A;  3R6O A;  1KHC A;  1NEB A;  3M59 A;  1ZX6 A;  4HVU A;  2HQX A;  1WDX A;  1YIT A;  1Q82 U;  3OYJ A;  1QVG P;  1BIB A;  3X25 B;  4A4E A;  2KRM A;  2JS0 A;  3L2R A;  1SF9 A;  4FW1 A;  2YLC A;  4LNP A;  2GFU A;  4OB3 B;  4XTU A;  1X6O A;  4Z88 A;  4DBF A;  3CD6 Q;  3LH5 A;  2DO3 A;  2DVJ A;  1XQH A;  2K3X A;  4M7D A;  3O5Z A;  2K3B A;  3CPF A;  3CCQ A;  1VQO T;  2CP6 A;  4MZT A;  3VS1 A;  1OUL A;  2D0N A;  2HBP A;  3V8J A;  1QVF A;  1VQ7 T;  4J9C A;  3L42 A;  2JN0 A;  1LNX A;  3CCM A;  3VS4 A;  3CCS T;  5L23 A;  2HL5 C;  3M4G A;  3H0I A;  2J06 A;  1UTI A;  5GAN h;  2CZ6 B;  3GP8 A;  4MML A;  1TUD A;  2ESW A;  4KGX B;  1KQS A;  1OEB A;  3E1S A;  4F04 B;  3JCM P;  1NJI C;  4IIO A;  3A1P A;  4ATO A;  4E6R A;  1Y02 A;  2MPX C;  2M0O A;  2QQB A;  4BUG A;  2D6F A;  4HCB A;  1VQ9 A;  5A0D A;  5GAO n;  3EGD A;  1SHF A;  1Q86 R;  1IZ6 A;  2DFU A;  4J6X A;  3LWH A;  2LT1 A;  3CCR Q;  2MPH A;  1AWX A;  2E12 A;  4FSX A;  2DA9 A;  2LCC A;  2K3Y A;  4BDY A;  2KVU A;  3QYG B;  5D6Y A;  2RI5 A;  1R0B G;  4ELZ C;  2LZ6 B;  2R58 A;  3M4Y A;  4XK8 E;  1K76 A;  3MPU B;  2V1Q A;  2LX9 A;  5FU7 B;  2E5Q A;  3JCM e;  1ZSZ C;  2ZPI B;  2KR3 A;  2LQ8 A;  3GF5 A;  3GNG A;  1AZE A;  2CZ7 B;  1BI1 A;  2MMP A;  3OYC A;  3QWY A;  4A53 A;  3FRN A;  2FPE A;  5ECA A;  1ZUY A;  5C0M A;  2WAC A;  4R56 A;  1W6X A;  4C5I A;  3TSW A;  4LD9 K;  2L3R A;  1UGS B;  1Q7Y R;  1I81 A;  3OB9 A;  2JZ2 A;  4OMQ A;  1YJW T;  4RTT A;  1M1K R;  2ODG C;  1RI0 A;  1B07 A;  2BKD N;  2D8J A;  2HJQ A;  3VUZ A;  2FZG B;  4YTL A;  3OW2 S;  5HKC A;  2WSC E;  1AZG B;  4QQ6 A;  1B34 B;  2RD1 A;  4AG1 C;  4E7K A;  2XDP A;  2EBP A;  2K57 A;  5DLO A;  2H3J A;  3RMQ A;  3QJ6 A;  4N0A A;  4C92 A;  2VV5 A;  3G6E T;  2C0T A;  2JOY A;  2E10 A;  4PJO F;  2XIC A;  1H1J S;  3QDF A;  4JJB A;  2DK3 A;  1VYU A;  4M78 D;  4PNO A;  2ZGW A;  3TQ7 P;  1S72 A;  1W4S A;  2KMT A;  1KJW A;  1D1C A;  1YWO A;  3MP8 A;  3JCM h;  1Q86 U;  2JS2 A;  1WX6 A;  4RTW A;  1OX8 A;  1Y96 A;  4AFQ C;  4OF1 A;  2EYQ A;  2NUT B;  1U3O A;  1VQ8 T;  5GAN 2;  2R57 A;  4LE9 A;  5KYX B;  3JAM E;  2DZ9 A;  3CPW A;  4KH0 B;  4UC4 A;  2DK4 A;  4C5H A;  2OTJ A;  4A63 B;  2DL7 A;  1Q82 C;  1YIT T;  1BYM A;  2J7I A;  3NFC A;  5I22 A;  1NG2 A;  4JZ3 A;  3PGG A;  1TS9 A;  3MEA A;  5GAN g;  2RQT A;  2PVD B;  3G71 A;  4KH1 B;  4DEY A;  7AT1 B;  1ZUU A;  1X69 A;  5LJ5 f;  1Q7Y U;  4HT9 A;  1N8R R;  3CCQ T;  2F2X A;  3QHS A;  2COZ A;  4E7I A;  2K79 A;  1YJN A;  3CC7 Q;  1M1K U;  2CH4 W;  4ORZ A;  1NLO C;  1WI7 A;  3LLR A;  1OZ2 A;  2EVR A;  3CCM T;  4FSS A;  2DTI A;  2XMF A;  3AT1 B;  3T9N A;  3CCL A;  3JCM Q;  4DOV A;  3NPF A;  2E41 A;  1BI3 A;  2O9V A;  4ESR A;  2DYB A;  3EG0 A;  1AWO A;  1M90 R;  2A3L A;  1YHQ Q;  2GTO A;  2DPP B;  2VXF A;  1YBY A;  5CKF A;  2K5L A;  5CKE A;  1GJJ A;  3QDR B;  3VS5 A;  1VQ5 A;  4M78 E;  1D1B A;  4XTW A;  1PHT A;  1VQ9 T;  1JXM A;  2QAZ A;  3EAE A;  1I5O B;  4LXC A;  2PVG B;  2K2M A;  2JW4 A;  5KYY A;  1OPK A;  4C8Q D;  4E2F B;  2X9H A;  4C8Q F;  3CEY A;  4EMK C;  4M75 B;  2YUN A;  1T0H A;  2J6O A;  4J83 A;  1NPR A;  4M78 B;  2QK0 A;  2RJD A;  3JSC A;  1WHG A;  1AWJ A;  5EC7 A;  2QQS A;  1TUG B;  2KYB A;  2RO0 A;  3LWI A;  4PFP A;  2DTO A;  2D0Q B;  4AFU C;  1KIK A;  3M0P A;  4ZGJ B;  2KE9 A;  3A8O B;  2EQI A;  4AG2 C;  4PJO C;  3LW5 E;  3OMG A;  3SDZ A;  4M7A G;  2PQW A;  2KK4 A;  2O01 E;  3QSU A;  2LRQ A;  1WHM A;  2ZAE A;  1EN7 A;  4IUU A;  4CC2 A;  4IIM A;  2PUK B;  4IUR A;  3CCQ Q;  5GAM e;  4E7H A;  1D0X A;  4PJN A;  3JCM g;  1BCM A;  5DY9 A;  2DNU A;  4LDV A;  4O6J A;  3CCM Q;  4ZTJ A;  4A4H A;  3EHQ A;  3CMA Q;  3M0S A;  2DXC A;  2YHT A;  3E2U A;  1X75 C;  2RHZ A;  3RBB B;  2KBT A;  1KG1 A;  1TWB A;  1M90 U;  1UGV A;  4M7D D;  4MMK A;  4QKU A;  3C0C A;  1M1G A;  1BU1 A;  2DIG A;  4FW2 A;  2AIR B;  2M02 A;  1ZS9 A;  1S72 T;  4BB7 A;  2DD5 A;  3OS5 A;  3M55 A;  1VQ9 Q;  1BIA A;  1H8K A;  1Q86 C;  1K0S A;  1OU8 A;  2KRN A;  5A0G A;  2DRK A;  5DLQ E;  2VB6 A;  2BTT A;  3X20 B;  3MP1 A;  3CC2 Q;  1IXD A;  3INZ A;  4R55 A;  2OTJ T;  1GKU B;  2DEU A;  1S1N A;  3DLM A;  3OYK A;  1OV3 A;  2VGM A;  3M0T A;  2H3E B;  3NGP A;  3QG1 A;  3X26 B;  3CCJ Q;  1QVP A;  3FDR A;  4PLI A;  4ZNX A;  1ZHI A;  2HSE B;  3G71 T;  4D8D A;  2E6Z A;  4LUE A;  1Y57 A;  4OB1 B;  1Q7Y C;  4J8O A;  4OP0 A;  4WTO B;  1KSW A;  4JLG A;  4Z8A A;  1WXU A;  3REB B;  4C8Q C;  1YJN T;  2VC8 A;  1M1K C;  1EX4 A;  3FIF A;  2YLB A;  1K9A A;  4EMG A;  4BE2 A;  1NLP C;  2I2L A;  2LQK A;  1K1Z A;  2KAF A;  4II1 A;  2Y4X A;  3CCL T;  2QNC A;  4FIB A;  4BE0 A;  2V8K A;  3M0Q A;  5C6S A;  5EG2 A;  3UT1 A;  4JDS A;  1WHJ A;  3JCM b;  5D7U A;  2IIM A;  4M7D E;  2HQE A;  1T3S A;  4ZGD B;  4ZTF A;  1Q95 G;  4JS5 A;  1VQM A;  2NYS A;  2V8I A;  4FYX B;  4CC7 A;  4BI8 B;  3CCU A;  2YUQ A;  1IO6 A;  2FB7 A;  2K5F A;  4E7S A;  1YI2 Q;  4M77 F;  1KC8 R;  2FVU A;  5I2M A;  3CME A;  4PFO A;  4XTV A;  3ZL7 C;  4M7D B;  3MP6 A;  1KD1 R;  1ZUK A;  2VVK A;  2YRC A;  3UF4 A;  3EH1 A;  4C92 D;  2E4H A;  1A62 A;  4FT2 A;  1Y7X A;  3JB9 D;  5HK3 A;  5FWB A;  2EQJ A;  1H3Z A;  3ME9 A;  2QG9 B;  1YN8 A;  1AD5 A;  5FU7 C;  2M16 A;  3VKI A;  1KQ1 A;  2JUF A;  3JV3 A;  2X4Y A;  2DJZ A;  1SHG A;  4F7U G;  4N4G A;  1WQW A;  3JB9 I;  2QA4 A;  2EAY A;  4OMP A;  4RTZ A;  3G71 Q;  3CBO A;  4BI4 A;  3HFN A;  4HCZ A;  2HCK A;  4NL3 A;  3MEU A;  4C0F A;  2DE0 X;  4J5Y A;  2EYY A;  1YNZ A;  1UJ0 A;  1WGS A;  2WSE E;  1Z9Z A;  1YWP A;  1WHL A;  1HD3 A;  3EGD B;  1G83 A;  2L0A A;  2MAM A;  4F7U A;  3J7A F;  3RER A;  5FLX E;  2LVM A;  4M75 F;  3OYM A;  2E3H A;  3CC7 A;  2AZV A;  3P8H A;  1HXD A;  2JVW A;  1JJR A;  2ZZD A;  1V66 A;  4M78 F;  3SEM A;  1WHK A;  2DZC A;  3G4S Q;  3RKX A;  2P84 A;  3NTH A;  4HXJ A;  1M90 C;  1RLQ C;  2JMC A;  3SWN A;  1YHQ A;  2DKG A;  1H9F A;  3I56 Q;  3A8G B;  2OX7 A;  5IH2 A;  2R5M A;  1JQQ A;  4CRI A;  2DYI A;  1VQ5 Q;  4BD3 A;  2CUB A;  1RUW A;  1CKA A;  1KC8 U;  1WNL A;  2RI3 A;  1W70 A;  4C92 E;  2PNI A;  3OYL A;  1G3W A;  1PD1 A;  2PTK A;  1QWE A;  3JB9 J;  2L3S A;  3AHU A;  1KD1 U;  3G1J A;  5FW9 A;  1AOJ A;  4F16 A;  2C0I A;  2LJ3 A;  1HJD A;  4CC4 B;  4PLL A;  4R0K A;  4QVD A;  2A0F B;  1SSF A;  2JM8 A;  3S3O A;  1GFD A;  2CSQ A;  4HCC A;  3SFM A;  4C92 B;  2RNA A;  4V2S A;  1I4K 1;  1JO8 A;  3JCM d;  3EH2 A;  2COY A;  1I07 A;  4ME7 A;  4AFZ C;  3EG9 A;  1ACM B;  4M77 C;  1TU0 B;  5CCA A;  4IUT A;  4RTY A;  1GFC A;  4AMC A;  1Y96 B;  4C0Z A;  4OMF B;  2MOX A;  1H92 A;  4GLK A;  2EJ9 A;  2CZ0 B;  2EKH A;  3FC3 A;  1UGR B;  1NBE B;  2DIQ A;  2XDD A;  3OYF A;  2ROT A;  3CMA A;  3OW2 P;  5KYU A;  1VQM T;  1WXT A;  3TRE A;  4FL6 A;  4C5E A;  2LJ1 A;  1UEC A;  3VRY A;  3M53 A;  4WCI A;  3CCV A;  5IXB A;  4PJO G;  2LCL A;  4KGZ B;  2EWN A;  4OVA A;  3RNJ A;  5GAN 8;  4CC3 A;  2YWW A;  2XDB A;  4M75 C;  1X2K A;  1MMA A;  2R5A A;  4OB0 B;  1U06 A;  1WXB A;  1X6B A;  2CUD A;  3CC2 A;  1PG5 B;  4M78 C;  5KE2 A;  3HHT B;  3OYY A;  2RHY A;  4LD6 A;  1SPK A;  2CT3 A;  2KRO A;  2F5T X;  4FYV B;  1OYX A;  5LJ3 e;  1XJW B;  3CCJ A;  3BDL A;  2QA4 T;  5GAN f;  3VUB A;  1HK9 A;  2CZ1 B;  3TCJ A;  4XU1 A;  2X4X A;  2PZ1 A;  1U1T A;  3MEV A;  4HVW A;  4DQ2 A;  1AWW A;  2FL7 A;  1MNE A;  4KRT A;  5KYY B;  4N4I A;  1SKU B;  4RUG A;  4XTZ A;  4NOY A;  4M7D F;  3CC7 T;  3RKY A;  9ATC B;  2NLU A;  3OBY A;  4QQD A;  1FYN A;  2X4J A;  3I55 Q;  3DB4 A;  2DL3 A;  1YJ9 A;  3OS2 A;  1C6V X;  1GCQ C;  1E7L A;  3SB2 A;  1UJY A;  2LNV A;  1PM3 A;  1WJS A;  1YIJ Q;  2HKQ B;  1YHQ T;  1ZSG A;  1AHJ B;  2BZX A;  1VQM Q;  1M2V A;  4B6M A;  3EHR A;  1VQK A;  3CCU Q;  1AT1 B;  3E9G A;  2GF7 A;  3QZ9 B;  1KC8 C;  3VS3 A;  4GLM A;  4DBH A;  3OYH A;  1YI2 A;  1O75 A;  3CME Q;  4LUD A;  4F17 A;  1KD1 C;  4C8Q G;  4JJC A;  1E6H A;  2CP2 A;  2DL5 A;  5LJ3 h;  2DJQ A;  1IB8 A;  4MZP A;  3BFM A;  2W51 A;  2F2V A;  3L0O A;  1UGQ B;  2A28 A;  4A4K A;  1YNS A;  1FMV A;  1MMN A;  2KT8 A;  1SG5 A;  2A7Y A;  2RQW A;  2PU9 B;  4C8Q A;  4OML A;  5HCK A;  3JCM W;  4PKC C;  3L2U A;  2ED0 A;  3OQ5 A;  3FJ5 A;  2QA4 Q;  3IQL A;  1SRM A;  2RI2 A;  2QNF A;  2KNB B;  3H6Z A;  4GBQ A;  5FWC A;  1M5Q 1;  1PC0 A;  4E7Z A;  1I1J A;  2O4X A;  1H64 1;  1RLP C;  2DET A;  2P0P A;  3GOX A;  2RHX A;  3JCM f;  1QQJ A;  2GFA A;  3QWX X;  3RIR A;  2XK0 A;  2ED1 A;  1KK7 A;  4BDZ A;  2F69 A;  3GIB A;  2BIV A;  1FXX A;  1VQ4 A;  4MDX A;  3C95 A;  1VYV A;  3CMA T;  2O2O A;  3WVD B;  3G4S A;  2KGT A;  2B8A A;  2VUB A;  2Y90 A;  4C92 F;  2DER A;  3JB9 F;  3I56 A;  1PCX A;  3CCV T;  3RDV A;  1FMW A;  1OPL A;  2A36 A;  2XG8 D;  3V7S A;  4FYW B;  1GBR A;  2RF0 A;  1NEG A;  3LX7 A;  4DA4 A;  4M7D C;  1JEG A;  1G3T A;  1EFN A;  4A4G A;  2DTH A;  3CC2 T;  2HL3 A;  1VQN Q;  3C4S A;  3PVQ A;  1RAA B;  4KUD K;  1ZA2 B;  4J9B A;  2RJE A;  3OYE A;  2KT1 A;  3JCM V;  2QTV A;  2JJ9 A;  3CCJ T;  2EJG A;  1MV3 A;  2KDS A;  3V7R A;  1VQL Q;  2CT4 A;  3A5Z B;  1UB4 A;  2QXF A;  3SHW A;  1UHF A;  3DLL A;  4J7F A;  2JT4 A;  2RQU A;  1JBM A;  2W0Z A;  1RAE B;  3KUF A;  4DBQ A;  2QGF B;  1YJ9 T;  2FHD A;  4J9G A;  3I5R A;  3ASK A;  4FM4 B;  3VS0 A;  4J9D A;  2GQI A;  5FU6 B;  1WA7 A;  5LJ3 g;  1OI1 A;  4M7A A;  2LP5 A;  2ZPH B;  1QP3 A;  2KY9 A;  1Y0M A;  4F7U E;  2KXD A;  2L89 A;  2FG0 A;  4J7I A;  1AEY A;  1G5V A;  2AKL A;  5CKH A;  1F1B B;  3CC4 A;  1YI2 T;  1OU9 A;  4IKF A;  5CAI A;  3CCV Q;  3JCM J;  2ATC B;  2QEX Q;  4M77 G;  3QXE B;  2P0Q A;  2PVO B;  2E65 A;  1GXI E;  1VIF A;  2NUP A;  4Z89 A;  1GBQ A;  1RAC B;  2RB6 A;  2CP3 A;  4F7U B;  2P0K A;  2C06 A;  3VYG A;  1XOV A;  2LQW A;  4C0D B;  4ANJ A;  2D8H A;  2O31 A;  4XU0 A;  1HSQ A;  3I9Q A;  4HT8 A;  4M77 A;  1IGU A;  3M0U A;  5KYW A;  2RK1 A;  3SWN B;  3RMS A;  4C92 C;  4JJN K;  3PFS A;  2YRD A;  4Y92 A;  1IRE B;  4J9F A;  5LL6 S;  4JLI A;  4XTX A;  3H9N A;  2K6D A;  3CXC S;  1T0J A;  3HRT A;  2BZY A;  1RAI B;  1PSF A;  3F70 A;  1UUE A;  3E19 A;  5KCH A;  3MET A;  3PTA A;  5GAM h;  1TSF A;  3FB9 A;  1NYG A;  4BIT A;  1I5L A;  8AT1 B;  3O8V A;  2JVV A;  5LJ3 j;  2DXB A;  5CR2 A;  3EGU A;  2GCX A;  1NE8 A;  2ZPB B;  3CBM A;  2E70 A;  5KCO A;  1PKS A;  2ZCF B;  3S3N A;  3QYH B;  4FT4 A;  3I55 A;  3L2V A;  1YJ9 Q;  4M75 G;  1VQ4 T;  3L1A A;  1O9S A;  3EGX B;  4CI0 C;  5GMK e;  4RCB A;  2QQR A;  1OX9 A;  3GNF B;  1QCN A;  3THK A;  3G4S T;  4M78 G;  4PL6 A;  1ABO A;  1V29 B;  2QQ9 A;  1YIJ A;  2CKK A;  4BAC A;  2MWP A;  2P4T A;  2QTX A;  3I56 T;  2QDY B;  2YUP A;  1BB9 A;  5GAO r;  1ARK A;  3TVT A;  4OGE A;  3MO8 A;  1GL5 A;  1VQ5 T;  1FWZ A;  1PNJ A;  2GNC A;  4RCC A;  2KW9 A;  4M75 A;  1VQK Q;  3QBY A;  3QUI A;  3HPW A;  3MHX A;  1RAB B;  3V7C A;  2ZPF B;  3EG9 B;  1PD0 A;  1AVZ C;  3NTK A;  1VQO A;  1CKB A;  2CP0 A;  1VQ7 A;  2EGE A;  2I0N A;  3DKM A;  2KFV A;  2L3Q A;  1NZ9 A;  3OYB A;  2OTL Q;  1ZSZ A;  4EPC A;  1NYF A;  2G6F X;  2FRY A;  2MYS A;  2L3P A;  2LX7 A;  2FYK A;  2JNG A;  2EPD A;  2L5Q A;  2EQU A;  4Y91 A;  1A0N B;  3QO3 A;  1ZBH A;  2K5I A;  2HKN A;  1JJ2 S;  1D3B A;  1Q81 R;  5D6W A;  5KYU B;  4BI3 A;  1ABQ A;  2FZK B;  3H8Z A;  2DBM A;  1LVK A;  1BKB A;  1N9S A;  4X9C A;  2ODC I;  2KI7 A;  5GAN 5;  3ULR B;  1R0C B;  1PRL C;  1LJO A;  3R6N A;  1P92 A;  1E7O A;  2GTJ A;  2E6N A;  3WVE B;  1M8M A;  1D1A A;  3ZBD A;  1K8A U;  1PWT A;  3P8D A;  2EQM A;  3OW2 A;  3Q1J A;  1VYT A; 
#chains in the Genus database with same CATH homology
 5LJ5 f;  2XDB A;  4M75 C;  3ZEH A;  4ELY C;  1Q7Y U;  4HT9 A;  4XAX B;  2R5A A;  4OB0 B;  3CCQ T;  3QHS A;  4E7I A;  4N0A C;  4M78 C;  5CVI A;  5HY6 A;  1OZ3 A;  5KE2 A;  3HHT B;  2QI2 A;  3OYY A;  1YJN A;  4QW2 A;  1M1K U;  1U8R A;  2RH2 A;  2RHY A;  1BI0 A;  4LDY A;  3LLR A;  3CCR A;  1N6A A;  1OZ2 A;  3CCM T;  3OYG A;  4LD6 A;  3CCE A;  2DTI A;  3RES A;  2F5T X;  5GAO q;  3CC4 T;  4X34 A;  1OYX A;  3T9N A;  3URG A;  3JCM Q;  3GPL A;  3CCL A;  4KUL A;  5I21 A;  5LJ3 e;  1MGQ A;  4DOV A;  2E41 A;  3CCJ A;  1BI3 A;  3BDL A;  4LDW A;  4A54 A;  2QA4 T;  5GAN f;  5GMK i;  3VUB A;  1W2B S;  4PJO D;  1HK9 A;  2A3L A;  2JTM A;  3EFR A;  2CZ1 B;  2DPP B;  2VXF A;  3TCJ A;  3HSB A;  1YBY A;  5CKF A;  2VXE A;  1MHN A;  2CGH A;  3CPW S;  4XU1 A;  2X4X A;  1U1T A;  3MEV A;  2K5L A;  5CKE A;  3QDR B;  4DQ2 A;  1VQ5 A;  4M78 E;  5GAM g;  3CC2 A;  5LJ5 j;  4XTW A;  2FL7 A;  1VQ9 T;  1VUB A;  2GQV A;  4N4I A;  3EAE A;  4JUV A;  4XTZ A;  2G3R A;  3QKJ A;  4NOY A;  4BY6 B;  3RKY A;  3CC7 T;  2NLU A;  1VQN A;  4M7D F;  4M7A F;  3OBY A;  4QQD A;  2PVG B;  2DEQ A;  2X4J A;  3DB4 A;  2XI9 A;  3QPH A;  4C8Q F;  3CEY A;  2XU8 A;  1YJ9 A;  3OS2 A;  3N5B B;  3S3M A;  4EMK C;  3SB2 A;  1ZQ1 A;  4M75 B;  5GAN e;  2LNV A;  1WJS A;  1UGP B;  2WSF E;  1M4Z A;  4J83 A;  4TVR A;  1NPR A;  1YHQ T;  1Q81 U;  4M78 B;  1K73 C;  2RJC A;  3OMC A;  1G3Y A;  2VYT A;  1VQL A;  3J81 E;  1FX7 A;  2RJD A;  3JSC A;  3GLX A;  4M78 A;  1YCY A;  3ZFJ A;  3L2Z A;  5LJ3 d;  5GAM f;  1AHJ B;  2QQS A;  5J26 A;  3OYA A;  2LT4 A;  2RO0 A;  1VQK A;  4QVC A;  3LWI A;  1VQP T;  4OB2 B;  2DTO A;  1WPY A;  3X28 B;  2D0Q B;  3PMI A;  4ZGJ B;  3E9G A;  3CCS A;  2GF7 A;  3QZ9 B;  2ZPG B;  4ZGE B;  4XU2 A;  4C8Q E;  3UPU A;  3A8O B;  3M54 A;  1KC8 C;  3OYH A;  4DOW A;  5GAN 4;  3I55 T;  1YI2 A;  4PJO C;  1O75 A;  3LW5 E;  4F7U F;  3OMG A;  4M7D G;  3SDZ A;  4M7A G;  2PQW A;  1KHI A;  2MF2 A;  2KK4 A;  3OBW A;  1QW1 A;  1KD1 C;  2O01 E;  3QSU A;  2IVW A;  3V8K A;  3HRS A;  4C8Q G;  5KH6 A;  4KUI A;  3OW2 A;  1NPP A;  2LRQ A;  1NJI U;  4IUU A;  3C94 A;  1YIJ T;  4JRP A;  5LJ3 h;  4JRK A;  4GY5 A;  2X4W A;  2AHJ B;  4MZP A;  3PIP A;  1LOJ A;  2PUK B;  3BFM A;  3FEO A;  2EQK A;  1K9M C;  4IUR A;  5GAM e;  3S6W A;  4E7H A;  4E7L A;  2MI6 A;  1UGQ B;  5D6X A;  4A4K A;  4XTY A;  2HNI A;  2V8J A;  3JCM g;  5GAN d;  1XNI A;  2DXT A;  3TU4 K;  4C8Q B;  5DY9 A;  4O5V A;  4EMK B;  3CCU T;  5IN1 A;  2A7Y A;  5IAY A;  5GAM j;  4LDV A;  1QVG A;  3BY7 A;  2XHC A;  4O6J A;  4PJO E;  2LDM A;  2PU9 B;  4ZTJ A;  4A4H A;  2PUO B;  3LGL A;  3E9F A;  4C8Q A;  4EMK A;  4ZN3 A;  5IT9 E;  4A4F A;  3JCM W;  1U1S A;  3M57 A;  2KQW A;  2RHI A;  4PKC C;  2DXC A;  2YHT A;  3L2U A;  5GMK h;  1X75 C;  2RHZ A;  4HA8 A;  3OQ5 A;  3CME T;  3JCM c;  1KG1 A;  5CQY A;  1M90 U;  4M7D D;  1R8O B;  2RI2 A;  4MMK A;  4MZM A;  2QEX A;  4RKU E;  4M7A D;  3C12 A;  4JRQ A;  1M1G A;  3BW1 A;  2O4X B;  3H6Z A;  5J3B A;  4L5G A;  2DIG A;  3M56 A;  4NL2 A;  1M5Q 1;  3PT9 A;  1QP2 A;  4LDU A;  2E1H A;  1S72 T;  2O4X A;  1M8V A;  1H64 1;  4BB7 A;  2DD5 A;  3OSS C;  3OS5 A;  3M55 A;  2L8D A;  5GAO l;  3CD6 T;  4PJO B;  1BIA A;  2P0P A;  4RMO A;  3GOX A;  2RHX A;  3JCM f;  1X01 A;  1Q86 C;  2GFA A;  5A0G A;  1N8R C;  4PJO A;  3RIR A;  2XK0 A;  5DLQ E;  2D9T A;  4BDZ A;  2F69 A;  4LDX A;  3GIB A;  3HRU A;  2BIV A;  1FXX A;  3X20 B;  1VQ4 A;  4MDX A;  2EJF A;  3C95 A;  3FLG A;  3MP1 A;  2DAQ A;  5CQX A;  3CMA T;  2KSS A;  3INZ A;  1WJQ A;  3WVD B;  3QJY A;  3JRZ A;  3VYH B;  3G4S A;  1YJW A;  4R55 A;  2OTJ T;  2K2V A;  1DJ7 B;  2B8A A;  2VUB A;  4X9D A;  5GAN 6;  3DLM A;  3OYK A;  2Y90 A;  4IUV A;  2VGM A;  4C92 F;  3JB9 F;  3I56 A;  4VUB A;  3JB9 H;  5LJ5 e;  3UDC A;  3OS1 A;  3QG1 A;  2M9U A;  5CKB A;  4RG8 A;  3X26 B;  4D6W A;  1QVP A;  3FDR A;  3CCV T;  1K8A C;  1GXI E;  2KVQ G;  4C0G A;  1VQ6 T;  4PLI A;  2RA2 A;  1QVG S;  1ZHI A;  4JS4 A;  2XG8 D;  4WF2 A;  3V7S A;  2M1H A;  3G71 T;  3OSV A;  3MCA B;  2E6Z A;  4M77 D;  3WXM B;  3V8L A;  1XTD A;  3LX7 A;  4DA4 A;  2RJF A;  4M7D C;  4OB1 B;  1BI2 A;  1Q7Y C;  1G3T A;  4J8O A;  4M7A C;  3TEE A;  4OP0 A;  4JLG A;  4A4G A;  2CYZ B;  3G6E A;  5FU6 C;  2DTH A;  4C8Q C;  3HKS A;  1YJN T;  3CC2 T;  2VC8 A;  3C4S A;  1M1K C;  5GAN 7;  5GAO m;  3FIF A;  2YLB A;  4KUD K;  3CCR T;  4EMG A;  4BE2 A;  2RJE A;  2LC4 A;  3OYE A;  3CCE T;  5CK9 A;  4HKE A;  2I2L A;  2LQK A;  2KAF A;  4II1 A;  3RUX A;  2Y4X A;  3CCL T;  4FIB A;  3OS0 A;  5GMK l;  4BE0 A;  2ZPE B;  3JCM V;  2V8K A;  1N27 A;  3G7Z A;  5GAO p;  3CCJ T;  2EJG A;  3M58 A;  5C6S A;  5EG2 A;  4C92 G;  3UT1 A;  3JB9 G;  4L6V 5;  5GMK j;  4JDS A;  3JCM b;  2KDS A;  3V7R A;  3OYI A;  4M7D E;  1VQ8 A;  2HQE A;  2RM4 A;  4M7A E;  4ZGD B;  3PNW C;  3OA6 A;  4ZTF A;  3A5Z B;  3CBP A;  1WJR A;  1Y71 A;  4JS5 A;  1UB4 A;  3ER0 A;  2RK2 A;  5LJ5 d;  2QXF A;  1VQM A;  2V8I A;  3R6O A;  1KHC A;  2DVE A;  3M59 A;  3QII A;  3DLL A;  4J7F A;  3UWN A;  4BI8 B;  3CCU A;  1JBM A;  2HQX A;  4BE1 A;  1Q82 U;  1YIT A;  2OTL A;  2XKO C;  3OYJ A;  3KUF A;  1BIB A;  3X25 B;  1VQN T;  3MEW A;  2YRV A;  3PMT A;  2FB7 A;  2K5F A;  4A4E A;  4M77 F;  3OY9 A;  3P8B B;  4C0D C;  2FVU A;  5I2M A;  1YJ9 T;  4J6Y A;  2FHD A;  3L2R A;  3CME A;  4M75 D;  3ASK A;  2YLC A;  3L2W A;  4XTV A;  2GFU A;  4FM4 B;  4OB3 B;  4XTU A;  4M7D B;  1X6O A;  3MP6 A;  4M7A B;  3NTI A;  2DO3 A;  1XQH A;  4IUQ A;  4Y28 E;  5FU6 B;  4C92 D;  2K3X A;  5LJ5 h;  4FT2 A;  3SWN C;  1Y7X A;  5LJ3 g;  3JCM X;  3JB9 D;  1Q81 C;  4M7D A;  1OI1 A;  5HK3 A;  4M7A A;  2IG0 A;  1VQL T;  2EQJ A;  2QQA A;  3CPF A;  4N4H A;  3ME9 A;  2ZPH B;  3CCQ A;  1H3Z A;  4IUP A;  3CXC A;  1VQO T;  4E47 A;  4MZT A;  1QP3 A;  2KY9 A;  5FU7 C;  4F7U E;  5GAN 3;  2HBP A;  3V8J A;  1QVF A;  3LGF A;  2L89 A;  1VQ7 T;  4ATO A;  2M16 A;  3VKI A;  4J7I A;  1G5V A;  3L42 A;  2JN0 A;  3DB3 A;  3KBG A;  4QVZ A;  5CKH A;  1LNX A;  3CCM A;  3CCS T;  4RG2 A;  4M77 E;  1KQ1 A;  2JUF A;  3LH0 A;  3M4G A;  2X4Y A;  2DJZ A;  3VV0 A;  3RKW A;  4F7U G;  3CC4 A;  4J6W A;  1YI2 T;  4N4G A;  4IKF A;  4EMH A;  1WQW A;  5CAI A;  3JB9 I;  3JCM J;  5GAN h;  2QA4 A;  2Y4Y A;  2CZ6 B;  3GP8 A;  4FU6 A;  4MML A;  5FRN A;  2EAY A;  3M5A A;  2MWO A;  4M77 G;  3QXE B;  2P0Q A;  3CBO A;  4BI4 A;  1KQS A;  3E1S A;  3EFS A;  2PVO B;  3HFN A;  3MEU A;  2E65 A;  4HCZ A;  4QQG A;  4C0F A;  1VIF A;  4EDU A;  5I2S A;  4NL3 A;  3JCM P;  1NJI C;  2RB6 A;  4ZN1 A;  5J39 A;  2E64 A;  5LJ3 f;  3X24 B;  4J5Y A;  2P0K A;  4F7U B;  1WGS A;  2WSE E;  2M0O A;  2QQB A;  2C06 A;  4BUG A;  2D6F A;  3VYG A;  1XOV A;  4HCB A;  2MAM A;  4C0D B;  4F7U A;  1VQ9 A;  3J7A F;  3RER A;  5FLX E;  2LVM A;  4M75 F;  5A0D A;  5GAO n;  3OYM A;  5GAM d;  3CC7 A;  4M77 B;  4XU0 A;  1IZ6 A;  4J6X A;  3FJP A;  3P8H A;  3OYD A;  3LWH A;  2EFI A;  2LT1 A;  1HXD A;  4B9W A;  2X35 A;  2ZZD A;  5FRM A;  4HT8 A;  2E12 A;  4FSX A;  4M77 A;  2LCC A;  4M78 F;  2K3Y A;  4BDY A;  2RK1 A;  2DZC A;  3SWN B;  3M9Q A;  3QYG B;  5D6Y A;  3RMS A;  4C92 C;  3PFS A;  3RKX A;  3KXT A;  4JJN K;  2RI5 A;  4ELZ C;  5LL6 S;  1IRE B;  3A8H B;  3A8L B;  2R58 A;  2DXU A;  3NTH A;  2EIF A;  3M4Y A;  1M90 C;  4XK8 E;  4JLI A;  4XTX A;  2QEX T;  3SWN A;  2LX9 A;  1YHQ A;  5FU7 B;  1K73 U;  3CXC S;  2E5Q A;  3JCM e;  2DKG A;  2ZPI B;  3HRT A;  2LQ8 A;  1PSF A;  3A8G B;  3GF5 A;  3F70 A;  1QVF S;  5CO7 A;  2R5M A;  3E19 A;  3GNG A;  5KCH A;  4E7J A;  4CRI A;  3MET A;  2CZ7 B;  5GAM h;  3PTA A;  1BI1 A;  3FB9 A;  4C5G A;  4BD3 A;  2MMP A;  3OYC A;  1I5L A;  3OYN A;  4A53 A;  3FRN A;  5A0L A;  4M75 E;  3O8V A;  2JVV A;  5LJ3 j;  2DXB A;  5CR2 A;  1VQP A;  2GCX A;  1NE8 A;  2ZPB B;  5C0M A;  3HP9 A;  2BUD A;  2E70 A;  3CBM A;  5KCO A;  4Q5W A;  2WAC A;  2ZCF B;  3S3N A;  3QYH B;  1KC8 U;  1WNL A;  4FT4 A;  3I55 A;  4R56 A;  2RI3 A;  4C92 E;  3L2V A;  4C5I A;  3OYL A;  4LD9 K;  2L3R A;  1UGS B;  4M75 G;  1VQ4 T;  1G3W A;  3L1A A;  1JJ2 A;  1O9S A;  4L59 A;  4CI0 C;  1I81 A;  1Y07 A;  2XID A;  4XQ3 A;  1KQS S;  5GMK e;  3OB9 A;  3JB9 J;  4RCB A;  2QQR A;  2JZ2 A;  3GNF B;  3AHU A;  3G4S T;  1KD1 U;  1YJW T;  1TH7 A;  4M78 G;  4PL6 A;  2QQ9 A;  1V29 B;  4NS5 A;  1JRI A;  1EIF A;  1RI0 A;  1YIJ A;  2CKK A;  4BAC A;  2BKD N;  2MWP A;  3PIO A;  2P4T A;  2QTX A;  4YTL A;  3VUZ A;  3OW2 S;  3I56 T;  2EKO A;  2QDY B;  2WSC E;  5HKC A;  5M9O A;  1RL2 A;  1K9M U;  4QQ6 A;  2CS7 A;  5GAO r;  4PLL A;  1B34 B;  2RD1 A;  4QVD A;  4E7K A;  4OGE A;  1SSF A;  3MO8 A;  1VQ5 T;  1FWZ A;  2XDP A;  4RCC A;  2HAX A;  4M75 A;  2K57 A;  4XU3 A;  3S3O A;  5AYF A;  1VIE A;  2HD0 A;  5DLO A;  2H3J A;  3SFM A;  3QBY A;  3QUI A;  1B34 A;  4HCC A;  3HPW A;  3MHX A;  4C92 B;  3V7C A;  1I4K 1;  5GAN j;  4V2S A;  3RMQ A;  2ZPF B;  4P5N A;  3LYI A;  3NTK A;  3JCM d;  1M9S A;  3QJ6 A;  1VQO A;  4B9X A;  4N0A A;  3L2Q A;  4ME7 A;  3VU3 C;  5FRO A;  1I8F A;  4C92 A;  5HK0 A;  3VJP A;  5CIU A;  1VQ7 A;  2VV5 A;  3DKM A;  4M77 C;  3G6E T;  1NZ9 A;  1G3S A;  1UEB A;  2JOY A;  2E10 A;  3OYB A;  5CCA A;  4IUT A;  1KQ2 A;  4PJO F;  1PSE A;  4EPC A;  2XIC A;  2K4Y A;  5KE3 A;  3HL8 A;  2DK3 A;  4M78 D;  4JRI A;  2FYK A;  1N9R A;  3J80 E;  2JNG A;  4PNO A;  2XD0 A;  2ZGW A;  2L5Q A;  1S72 A;  2EQU A;  1W4S A;  1Y96 B;  4Y91 A;  4C0Z A;  2KMT A;  4KT0 E;  1ZBX A;  3QO3 A;  4GLK A;  4OMF B;  2RHU A;  3CD6 A;  1D3B B;  2EJ9 A;  5L8R E;  3MP8 A;  3JCM h;  1Q86 U;  2CZ0 B;  5GMK m;  1Y96 A;  2K5I A;  2JTF A;  3FC3 A;  4OF1 A;  2EYQ A;  3SD4 A;  1UGR B;  3BDU A;  5LJ5 g;  1N8R U;  1D3B A;  4KBM B;  4Z02 A;  5GAN 2;  5D6W A;  1JJ2 S;  1VQ8 T;  1VQK T;  1W2B A;  4BI3 A;  2R57 A;  3H8Z A;  2DIQ A;  2XDD A;  3JAM E;  3OYF A;  2DZ9 A;  3CMA A;  1M1F A;  3CPW A;  4OGC A;  1VQM T;  1BKB A;  3HFO A;  1N9S A;  3A8M B;  3QZ5 B;  4UC4 A;  4X9C A;  5GAN 5;  4C5H A;  2OTJ A;  2VGN A;  1Q82 C;  2F5K A;  1YIT T;  3TRE A;  2OTL T;  5DM7 R;  4FL6 A;  5A2Q E;  4C5E A;  1BYM A;  1JB0 E;  1LJO A;  3M53 A;  1P92 A;  3NFC A;  2OAU A;  2E6N A;  3WVE B;  3PGG A;  3MEA A;  3ZBD A;  4BY6 C;  3CCV A;  1K8A U;  2LTO A;  4MDW A;  4PJO G;  1VQ6 A;  5GAN g;  2DD4 A;  1WQ7 A;  2LCL A;  3P8D A;  2EWN A;  5CKD A;  2PVD B;  3G71 A;  2EQM A;  4OVA A;  5GAN 8;  3Q1J A;  4C8Q D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...