3FLGA

The pwwp domain of human dna (cytosine-5-)-methyltransferase 3 beta
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
135
structure length
135
Chain Sequence
EYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA (cytosine-5)-methyltransferase 3B
publication title Crystal Structure of the PWWP domain of Human DNA (cytosine-5-)-methyltransferase 3 beta
rcsb
source organism Homo sapiens
total genus 33
structure length 135
sequence length 135
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.50 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 PWWP, helical domain 3flgA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3flgA01
2JZ2A 3QIIA 4HCZA 3L2WA 2EQJA 4X34A 4E7HA 3OY9A 4CRIA 2RHIA 3NTKA 3NTHA 2RHYA 4B9WA 2RHUA 4BE1A 3S3OA 2RI3A 3MO8A 5KE2A 2GF7A 4IUPA 2PQWA 1MHNA 5FRNA 2RJFA 4C5GA 4BD3A 4BACA 1OZ2A 2EFIA 2JTFA 3OB9A 4Z02A 4EDUA 4N4GA 2YRVA 5D6XA 2LDMA 3UT1A 3OYDA 2L3RA 5D6YA 2B8AA 3LH0A 4RG2A 4B9XA 4E7IA 2MWOA 3PMTA 4QQDA 3MEAA 2NLUA 4N4HA 4BE0A 5FROA 3ZEHA 2RI2A 2RI5A 2BIVA 3EAEA 5J39A 3Q1JA 5FRMA 2X4YA 3ME9A 4LD6A 4QVZA 2K3XA 2E6NA 3S3MA 4PL6A 4GY5A 2K3YA 5IAYA 2O4XB 2X4WA 2QQRA 4C5HA 3FDRA 2IG0A 4BDZA 3LYIA 4II1A 3L2RA 4ZTFA 2L8DA 3LGFA 1H3ZA 1N27A 2LRQA 3OQ5A 3MEWA 4A4GA 3OYFA 3L2QA 3PFSA 5KCHA 3PMIA 3FLGA 3P8DA 2M0OA 3OYHA 1WJQA 2CKKA 1SSFA 3F70A 4BDYA 2P0KA 3C4SA 4A4HA 2DIQA 3E9GA 3MP8A 2RJCA 2M1HA 3OMCA 5IN1A 3LLRA 3E9FA 2VYTA 3SD4A 3DB3A 5KE3A 1G5VA 2R5AA 3DB4A 4A4EA 3OYLA 2X4XA 2GFAA 3QKJA 4IUVA 2MWPA 3OYIA 5KH6A 3LGLA 4E7LA 2HQXA 5C0MA 3OYCA 3O8VA 3OS1A 2LVMA 2RJEA 4C5EA 3S6WA 2D9TA 2XK0A 3MP6A 1KHCA 2E5QA 2BKDN 2F5KA 4N4IA 3GOXA 1OI1A 4UC4A 2L89A 3LX7A 5KCOA 4BE2A 2GFUA 3OYNA 2HQEA 2LCCA 3DLMA 3OYAA 3P8HA 3OMGA 2RHXA 4PLIA 2XDPA 4C5IA 3OYMA 4IUQA 3L42A 4FU6A 3KUFA 4IUTA 3OYBA 3L2UA 5J26A 4OVAA 3PNWC 4A4FA 5D6WA 4IURA 3QJ6A 4FL6A 4PLLA 2R58A 3MEVA 3NTIA 3FC3A 4IUUA 2M16A 3OS2A 3OYJA 1WGSA 4QW2A 3OYKA 2FHDA 2EQKA 4L59A 2EQUA 2RO0A 2X35A 4QQ6A 2G3RA 2LTOA 2BUDA 3ASKA 3BDLA 3M9QA 2O4XA 3S3NA 2EKOA 3UWNA 1RI0A 2WACA 3OYGA 3CEYA 2RHZA 3QBYA 4NS5A 3L2VA 1WJSA 2DAQA 2EQMA 3OS0A 3META 1OYXA 3OYEA 5C6SA 3MP1A 2DIGA 5M9OA 5CIUA 1XNIA 2QQSA 3H8ZA 3FEOA 3MEUA 4E7KA 4ZTJA 4Q5WA 2R57A 3OA6A 2RJDA 3H6ZA 4QQGA 1OZ3A 2R5MA 4E7JA 4IKFA 1WJRA
chains in the Genus database with same CATH superfamily
2M9UA 1YITQ 4M75G 4WF2A 4DBFA 4BY6C 2QNFA 4M77F 2K9GA 1HK9A 5GMKl 1YIJA 3CC4Q 2RK1A 5IXBA 4FSSA 3CCLQ 1C6VX 1VQOQ 1FX7A 2JS2A 1KHIA 4F7UE 3PVQA 4M7AF 3H41A 3SWNB 5FRMA 3EGUA 3M57A 2LQKA 2KVQG 4C8QE 2DMOA 3R6OA 2OTLT 3NFCA 1TSFA 2RQVA 1BKBA 1AWXA 5CK9A 2FB7A 4BITA 1ABOA 3OYHA 1RUWA 5EC7A 3I9QA 1W1FA 3QWXX 3CC7Q 4FCYA 4M4ZA 1G3TA 3I55Q 2JMAA 2L0AA 1BIBA 2C06A 2BKDN 1MMNA 1LOJA 2LC4A 3M5AA 2GFUA 2QXFA 5GAN7 3OYNA 3OYAA 2DD5A 3OMGA 3CCVA 2XHCA 1G8XA 1LNXA 1KC8C 1B07A 2MF2A 1Q86C 2JTEA 1Q7YC 4XTYA 3EFSA 2MK5A 1HYOA 1Q81C 5DM7R 2MPXC 3H0HA 3REBB 3ZBDA 1PC0A 3VKIA 3CMEQ 1N8RU 2DA9A 4HCKA 2VKNA 9ATCB 1H3HA 2PVGB 1R0BG 1NEGA 4M77D 2KRNA 1ZQ1A 2CZ0B 4VUBA 1B34B 1FWZA 4C92C 4M78B 3FJPA 4E7JA 2HBWA 4M7AD 2I0NA 1U3OA 2G6FX 4HCZA 3L2WA 4QVCA 2QG9B 2V8KA 2PVDB 3UA6A 2RK2A 2RM4A 5AT1B 2DX1A 1B7TA 4C5GA 2CP3A 4EMKC 2LDMA 5A2QE 4J9HA 4E7IA 2MAMA 4AT1B 4RTYA 2HBPA 2K3XA 1YJ9Q 4DEXA 2EYZA 1YIJQ 1UJ0A 4C5HA 1TG0A 2QQBA 2HCKA 4OMPA 1VQKA 5LJ3f 1WX6A 1NG2A 2JVVA 2LD7A 3F70A 3MP8A 1PSFA 3M0SA 3LLRA 4JS4A 1WHLA 1A0NB 1GCPA 4M75B 2BZXA 3ER0A 5C0MA 5GAOm 3OYCA 3OS1A 1JEGA 3PT9A 1M8VA 3BFMA 1OI1A 2X3XD 2LCCA 4ESRA 1K73C 1UGQB 1RAEB 2MYSA 3GNFB 1WQWA 3EG2A 4ME7A 1ZA2B 4OGEA 1VQ8A 2L2PA 2KMTA 2V8JA 2LX7A 1H9FA 2A7YA 3ZFJA 4IURA 5IHNA 2QQ9A 2X3WD 3G71T 2HKNA 2LX9A 5GMKi 4M77G 1NZ9A 3M0QA 1PG5B 3FC3A 3M55A 3QDRB 1RABB 5L23A 4BI8B 1GKUB 2ZGWA 1T0HA 2DEUA 4M7AG 4J9DA 5C6SA 1YJWT 1NEBA 1WHHA 2MI6A 2CGHA 2JOYA 1AWOA 1D09B 2R57A 2DJQA 5FU6B 4J5YA 1VQ7A 2DILA 3X20B 5IT9E 1GBQA 4E7HA 3TSWA 3VJPA 2E5KA 2K3BA 4DOVA 3S3OA 2RI3A 4JZ3A 3QDFA 3EFOA 3C0CA 1OQKA 3NMZC 1JXOA 2YRVA 5I22A 3CCMA 4JJBA 4RUGA 5LJ5e 2ZPIB 4J7FA 4QQDA 2RQTA 2OTLA 1AZEA 2PNIA 1T3SA 4LDVA 3Q1JA 2A3LA 3S3MA 3KXTA 4R56A 1RAGB 3GBQA 4DBRA 1TUGB 4E7SA 3CMAT 3CPWS 4R55A 4OGCA 2AHJB 2JW4A 3A98A 4PJJA 3OYFA 3V7RA 5LJ5j 1NJIR 3CD6T 1IGUA 1QVGP 1QP2A 3JCMe 1KQSP 4KGXB 1VQKQ 3CC4T 4MDXA 2DF6A 3CCLT 3E19A 3GOXA 2P0QA 5FWCA 2HL5C 1A63A 2ED0A 1ZSGA 2Y4YA 1M1FA 1WLPB 2A08A 5D6WA 5I11A 2KBTA 3NGPA 3M0UA 1K8AR 2DE0X 1BIAA 8AT1B 4AFZC 3QZ9B 2KQWA 4XAXB 1VQ8Q 2VGMA 1GXIE 2KXCA 1H1JS 3E2UA 3OYGA 3CEYA 3G1JA 4NS5A 1CKBA 5LJ5g 3CBPA 3X25B 3QHSA 4RTTA 1UE9A 2AZVA 1QP3A 1UTIA 1GL9B 3H6ZA 4QQGA 1H8KA 4LE9A 3JV3A 4M78F 1QCNA 1RLQC 2PVOB 1WHKA 1OEBA 3RKYA 4BE1A 4KGVB 2RQWA 2AK5A 2V8IA 3GP8A 2RJFA 1TUCA 1OZ2A 1E7DA 3EG1A 3UT1A 1I8FA 1VQ7Q 1PKSA 5D6YA 3LWIA 2E3HA 1JEQA 3JRZA 5FROA 1QQJA 3VS1A 3JCMg 5GANe 4ZGEB 1QVGA 1XJWB 3CC2T 4Z89A 4M77B 1VQNA 3A8HB 2FVUA 3RUXA 3VS7A 4GY5A 4KBMB 2ROLA 1KQSA 5IAYA 2L3SA 1VQMT 4N0AC 2VB6A 4FYWB 3CCMQ 2E10A 1A62A 1D1AA 1IREB 4M7AB 1UG1A 1X6OA 4OB0B 1WJQA 1MMAA 4XTVA 1DJ7B 2KXDA 2DIQA 3SFMA 4F7UA 3DB3A 3IQLA 1WQ7A 1F1BB 2GFAA 4M7DC 1NBEB 5GAOn 2FPFA 3OYIA 2HQXA 4C8QA 4C5EA 2DTIA 1BI1A 5KYXA 4M75F 2HQEA 1I4K1 5A0LA 2W10A 2E6ZA 2HSEB 2L3QA 1AWWA 4OB1B 1NPRA 2J06A 4J6YA 1VQ9A 1QVPA 1ZUKA 1LVKA 5CVIA 3BE3A 2QGFB 3PVLA 3OS2A 2LQWA 1MNDA 1HXDA 3OYJA 2KVUA 2FZKB 1M90R 4M78D 3X24B 1WZOA 3BDLA 2VWFA 2KT8A 2O4XA 1PHTA 2RHZA 2DK3A 1W70A 5CO7A 1BI2A 3QWYA 4DBHA 2KW9A 2XI9A 5GANg 1KFZA 2EYWA 4KT0E 2YRDA 1I1JA 5EG2A 1WA7A 2E70A 2O9VA 2RHIA 2LT1A 3OBWA 3TU4K 3MKDA 4PJOB 2DLPA 2VC8A 4IUPA 3RDVA 2CZ1B 2BE7D 1VQLT 1XQHA 2OTJA 2L3RA 5KYYA 2B8AA 4RG2A 4JRKA 2DBMA 3ZEHA 2D1XA 2BTTA 4OF1A 4M78E 3G6EA 1E6HA 4LD6A 1M1KR 1G3YA 2AIRB 1IXDA 3CCJT 4ANJA 5LJ5f 3MHXA 2ATCB 3EG9B 2EJFA 1KK7A 2SRCA 1MUZA 4M75D 1ZSZC 1WHJA 3OSSC 1KQ1A 4O5VA 1VQNQ 2EYQA 4BY6B 1K0SA 2VXFA 4C0ZA 3EHQA 1RAFB 1HD3A 1VIEA 1BBZA 2X4XA 3I56T 1H641 1QKWA 1M1KC 2NUTA 2FPDA 1WIEA 4M77A 3CCUA 2E5QA 2DZ9A 4QVDA 2L89A 2KAFA 2PTKA 1VQ6Q 4PLIA 2QASA 6AT1B 2MPHA 1QVFA 3L42A 2KRMA 2W0ZA 3JCMf 4CI0C 3QSUA 1YCSB 4MZMA 3L2UA 1E6GA 4M7AA 3VS2A 2LNVA 3T9NA 3U23A 3R6NA 4DBQA 2MIOA 2EGEA 1JJ2P 2PZ1A 2H3JA 4M75E 3VV0A 3A5ZB 1R77A 2QTVA 4AG2C 2G3RA 2KI7A 4GLMA 2K5IA 1VQ9Q 1FMKA 2ZCFB 1TXQA 3VRYA 3CCQA 1MV0B 2QNCA 1NLOC 5CCAA 1VQ5A 4A4KA 1ABQA 1WPYA 2JN0A 1X27A 5DLOA 1YJNA 1OV3A 4FM4B 1NJIU 4B9WA 2HMAA 3RBBB 2PQWA 5FRNA 4OMLA 3RR6A 4RTXA 5LJ3h 2EYXA 1RL2A 4RTUA 2KVEA 4ELYC 1O9SA 3PMTA 2NLUA 4MZPA 2YLCA 1UEBA 2YUPA 2EQIA 4C0FA 2ROTA 1UFFA 2P4RA 1M1GA 2QQRA 5IXFA 2VGNA 3FDRA 2IG0A 2DK4A 5GJWB 4C92B 4HKEA 2OTJQ 5J3BA 5FWBA 3SEMA 5GANf 2P84A 1IRXA 3EGXB 1AZGB 1K8AU 2JS0A 3G6EQ 2JM8A 2COYA 4A4HA 1OU9A 1YI2T 5GAMh 4LDUA 2EKHA 5KE3A 2GCXA 1KQ2A 1IHVA 2KEAA 2NUPA 1JJ2A 2RNAA 4EMKB 3MP6A 1KD1C 2GQIA 3C95A 2HD0A 2YWWA 5GAOr 5KYWB 4ZN1A 3P8HA 1S72T 3GF5A 1KC8R 1KG1A 2F5TX 3OYBA 1ACMB 4J8OA 4HVWA 4AG1C 3PNWC 3M54A 1Q86R 1Q7YR 4KGZB 1FXXA 2K2MA 1Q81R 2LCLA 1RAHB 3HFOA 3CCUQ 5CR2A 4FYYB 4RG8A 2MCNA 1ZA1B 3LW5E 4NOYA 4QQ6A 2LTOA 3JB9J 1M2OA 2WQGA 4TVRA 4X1VA 3CXCP 1LPLA 1FMVA 1X01A 3X28B 4CC4B 3OA6A 1Y96A 2RJDA 2DJZA 3FB9A 5CKEA 4OMOA 2LC3A 2GTOA 4R0KA 2HQHA 3OS5A 5GAN5 2FRYA 2QA4Q 4PJNA 2HKQB 4E47A 1MMDA 1RI9A 2AKLA 1U8RA 4N4GA 4PJOF 1TOVA 3OYDA 3CCJA 3HKSA 3CCET 3BY7A 3VUBA 4B9XA 4DOWA 3G4SA 2COZA 2RF0A 1W2BP 1MGQA 3RMSA 1YJNQ 3HHTB 1QVGS 2QDLA 2A8VA 1PSEA 4FT2A 4KH1B 3UPUA 1KQSS 3OSVA 1SHGA 1TWBA 2FZCB 4Z88A 3MPUB 4ZTFA 2L8DA 2V1QA 3MEWA 4LD9K 1SF9A 5KCHA 2M0OA 4OMNA 2CP6A 2K4YA 4GBQA 1PRMC 2QEXA 3M56A 1MV3A 3C4SA 3G7ZA 2XDBA 1KIKA 1TUDA 3AHUA 2VYTA 2DVJA 2A28A 1M90U 1G5VA 3OYLA 1VQ4T 1UECA 3LGLA 5GMKe 4M77E 1YHQA 2LVMA 2KYMA 3HP9A 3S6WA 2D9TA 1QCFA 1EIFA 2GQVA 2OAWA 1WXTA 4JRIA 1K73R 3DLMA 1G3SA 1W4SA 4DEYA 5GAN2 4JS5A 1U06A 5FW9A 1VQPA 1VA7A 3P8BB 4M7AE 3INZA 3CXCA 1E7LA 2F1LA 3QXEB 3EH2A 1Y71A 2PU9B 3VS3A 1X2KA 1GFDA 1A8VA 5GMKj 3I5RA 3SWNA 2J6KA 1ZBHA 1WGSA 2QGGA 1OX8A 2ZPFB 5GAN8 4LNPA 3QBYA 1WHMA 1M1KU 2DL8A 4HCCA 2EYYA 3OS0A 2EJ9A 5KYWA 3H8ZA 1W2BA 4PJOD 1V76A 3CPFA 3M0PA 2ODGC 1I5LA 2E65A 2EQJA 4PJLA 4NL3A 2KK4A 3CCVQ 3WXMB 3HPWA 1JO8A 3JCMJ 1EX4A 2JTFA 2K79A 4RTVA 1Z9ZA 2E3IA 5GAOl 1PM3A 3LH0A 2YUNA 2EWNA 3AT1B 1E7OA 2RNOA 3EGDB 2XDDA 4HCBA 4BE0A 2YUQA 2AKKA 3WVDB 3CCST 5LJ3d 4PL6A 4PFPA 2LJ1A 1K1ZA 1YI2A 4BDZA 3EHRA 2ENMA 3CCRT 2HAXA 3LGFA 4PJOE 3G4SQ 2LQ8A 3N5BB 3OQ5A 1X75C 1NLPC 3OW2P 1C0MA 4C92F 2K7AA 2E64A 3V8KA 2DRMA 3MCAB 3V8JA 1B34A 2JVWA 2MWPA 2DRKA 4M78A 3VS0A 3GPLA 5GAN4 2F2VA 3TCJA 5KYNA 5CAIA 4N4IA 4Y28E 5GAMd 4FSXA 2QEXQ 2CT4A 2CREA 4NL2A 2XDPA 3OYMA 1QVFS 1VOMA 2DXUA 3QYGB 3GLXA 2LJ3A 2DD4A 2OAUA 4B6MA 5HKCA 4OMQA 1YITT 2D8HA 1YHQQ 4C0DC 1I07A 3LWHA 3NTIA 2XMFA 4IUUA 2KVDA 4XTXA 2O31A 1VQOT 4PJOG 1ZLMA 3DLLA 3OYYA 4M7DB 2DL7A 2HSPA 3V8LA 4IIOA 4XQ3A 5GJVB 2K2VA 4MDWA 1RACB 3MEUA 4BI3A 2QAZA 4Q5WA 1JQQA 2B86A 5AYFA 1NM7A 1IZ6A 3PE0A 2O88A 2V26A 2QI2A 3CCEA 2ZPBB 5L8RE 1SEMA 3MO8A 4M75A 1UHFA 4RCBA 1UDLA 3OW2A 2A37A 5FLXE 4EDUA 1JEIA 3CC7T 4J9GA 4C92D 4WCIA 4JJCA 3I55T 5I2MA 1WDXA 3THKA 2JMCA 1KC8U 4JZ4A 2DETA 2X4WA 2FRWA 1WHGA 5D7UA 3C12A 2VVKA 1Q82R 1Q86U 2KR3A 3JCMP 1Q7YU 3L0OA 4L6V5 3J80E 2HZYA 2LRQA 4RMOA 1Q81U 4KUDK 1AT1B 1VYUA 3P8DA 1OULA 3H0FA 4EMGA 1JRIA 1V29B 2PUOB 2CYZB 2DERA 4ATOA 3CMET 2QA4T 1GCQA 2DM1A 3EGDA 4IUVA 1JJ2S 1NYGA 4C8QC 2GNCA 4J83A 1Q82C 1B3QA 4IUQA 4C92E 1HSQA 2OTLQ 3A8MB 4LDXA 5GANj 3EG3A 1AHJB 2K5FA 1M5Q1 1ZSZB 3KFVA 2CP5A 3BW1A 3VU3C 2FHDA 4L59A 2L5QA 2RO0A 3ASKA 3UWNA 3G71A 3HRSA 2KSSA 1U1SA 1OYXA 3LH5A 5I21A 5CIUA 1M27C 3M53A 1RAIB 1I5OB 1P92A 1YJ9T 4PNOA 1Q95G 3JCMX 2C0IA 3VYGA 1YIJT 1TTHB 2YT6A 3NTHA 2EAYA 1YJWA 5KYUB 2GF7A 3D7SB 2EVRA 1MHNA 2D0QB 3QZ5B 4C92G 3OB9A 4K11A 2RI2A 1K73U 2CZ7B 3A8GB 2E4HA 2W51A 1R8OB 1OX9A 2DKGA 2ECZA 3LYIA 1YFNA 4DQ2A 1I81A 2K5LA 2RH2A 4RTZA 2O9SA 2H8HA 4KULA 1WFWA 3H0IA 2NUZA 2R5AA 3CMAA 3CCVT 1ZBXA 1PCXA 1YN8A 1K0XA 3CD6A 2FYKA 3A8OB 3QPHA 3LX7A 3HTRA 2LP5A 2RNNA 5FU7C 4XTZA 3M58A 3REAB 1I0CA 1X6GA 4E7ZA 3CXCS 3CC4A 4OVAA 3CCLA 1VIFA 3RKXA 2EJGA 1V1CA 4A54A 2I2LA 1AWJA 3C94A 2YHTA 3QYHB 2WSCE 1G2BA 1AD5A 1RADB 5ECAA 2X35A 1VYVA 1NE8A 2LMJA 3S3NA 3EH1A 4J7IA 4J6WA 2AZSA 2D8JA 1WXUA 2KY9A 3PIPA 1EFNA 3OYEA 1ZUYA 1XNIA 4XU3A 2GGRA 1N9SA 1W2BS 4M7DF 1X43A 3OY9A 4CRIA 3J81E 1W6XA 4HT8A 3G71Q 4P5NA 2YSQA 5KE2A 1D1BA 2L3PA 3UA7A 5CKHA 4BB7A 2HDAA 4BACA 5A0DA 1QKXA 2XIDA 4ORZA 4N4HA 1VQKT 2P4TA 1PNJA 2JM9A 5LJ5d 1YJWQ 1QW1A 2Y4XA 4GLKA 2DZCA 5GAMe 1M30A 2K3YA 3JCMQ 2LNHB 3TSZA 2KT1A 3L2RA 4LDYA 1X2QA 4QT7A 3CMEA 4J9FA 3CC2A 3TEEA 1N6AA 1LJOA 2CH4A 2QDYB 3PFSA 4PFZA 3PMIA 4PFOA 3ULRB 1VQMA 2Y90A 5CQXA 1ZUUA 3SD4A 1AEYA 5GMKm 1JJRA 1Z9QA 4HVVA 4E7LA 1BCMA 1M3AA 4IIMA 3JCMd 1KD1R 1VQ8T 3JB9I 4V2SA 3J7AF 2XU8A 4BE2A 4EPCA 2WSFE 4F04B 4PJMA 4LDWA 4WTOB 4PJOA 8ATCB 2RQRA 3CMAQ 3RMQA 1CKAA 5HCKA 2X4JA 2CDTA 2A36A 3CD6Q 3H9NA 4FL6A 1H9EA 2COWA 2DO3A 4M7DD 1C1AA 3JCMW 1YJ9A 2EQKA 1IB8A 3M59A 2ODCI 2LJ0A 1V66A 2E12A 1VQ7T 4CC3A 4Y92A 4XU0A 2ZPHB 2FL7A 4MZTA 1ZS9A 2RQUA 3QJYA 3EG9A 3JAME 4E7KA 1KJWA 2Z0WA 1Y0MA 3VYHB 1VYTA 1Q82U 5GAMg 2JZ2A 4LXCA 3CCMT 2EGAA 2J6FA 3NTKA 1IHWA 5HK0A 1QWEA 2ZPEB 1YBYA 4BD3A 4BUGA 3OW2S 2EFIA 1SKUB 4Z02A 3V7CA 3A1PA 2OX7A 5DLQE 4M7DE 3MEAA 1UHCA 3ME9A 1GJJA 3RERA 5GANd 1VQLA 3QO3A 2KE9A 2SEMA 4XTWA 4KRTA 3CCQQ 1H3ZA 1N27A 1K9MR 3HRTA 4EIKA 1VQ5Q 1BCOA 4D8KA 3VUZA 2EGCA 4OMMA 4F7UG 1BI3A 4XU1A 2KYBA 2P0KA 3X26B 1EZZB 2DFUA 3DB4A 3V7SA 4C8QG 1FYNA 2K57A 4Y91A 2OJ2A 3EFOB 1BB9A 3CC2Q 1D1CA 4J6XA 2CP7A 3M4GA 2CSQA 1VQMQ 4FIBA 3I56A 3RESA 1K9MC 1Y07A 1AOJA 5J26A 3NPFA 4M7DG 3UF4A 2ZPGB 3QJ6A 2J05A 1SRMA 3SWNC 2DPPB 2DTOA 3ZL7C 1RI0A 1WNLA 4QKUA 1UJYA 4C92A 2O01E 1XOVA 4HXJA 4RCCA 1KSWA 2EIFA 2IIMA 4LN2A 2DXBA 3EGXA 1EN7A 4AFQC 1D0ZA 2KDSA 2J6OA 2P0PA 4KH0B 2IPOB 3CBMA 2CH4W 2H3EB 2JUFA 1VQNT 4EMKA 2RN8A 4C0DB 1YWOA 3SDZA 1QLYA 1JU5C 3E1SA 4RKUE 1D0XA 1U5SA 3EAEA 4FYXB 1K9AA 2X4YA 5A0GA 2E6NA 3MJXA 4OB3B 2RMOA 1VQ6T 2V1RA 3FJ5A 1OPKA 3BDUA 1M4ZA 2CUDA 2F69A 4A4GA 3FLGA 5GAMf 1VQLQ 3JSCA 5GMKh 3E9FA 3GNGA 1ZX6A 2PUKB 3RKWA 1RLPC 4FYVB 2VASA 4AMCA 2DBKA 3FIFA 4M78C 3RNJA 1YNSA 4CC7A 4UC4A 1VQ9T 3JB9H 4F14A 3CCJQ 1UUEA 1YWPA 2DYBA 1Y7XA 3TVTA 1GL5A 3JCMV 2D0NA 1MMGA 1PKTA 4PLLA 1S72A 2EPDA 4XU2A 2M0YA 2CSIA 2R58A 3MEVA 1VUBA 3I56Q 3RIRA 4XTUA 3O5ZA 2EQUA 2QTXA 3EFRA 1M9SA 2DL5A 4JJDA 3UATA 2LQNA 3VRZA 4F7UB 2DAQA 5M9OA 1BU1A 2ABLA 3JCMc 4ZTJA 4F16A 4C8QB 1ARKA 2CS7A 2FO0A 1OZ3A 2R5MA 4ZGDB 2JTMA 3M0RA 5KYXB 2F2WA 2RD1A 1TS9A 2OTJT 3WVEB 4UZWA 2RHUA 1XTDA 1VQPQ 4JRPA 2VV5A 3G6ET 1FMWA 4M75C 3VS6A 5GAOq 2HNIA 1AVZC 2XICA 2YLBA 5LL6S 3FRNA 4JLIA 1KD1U 2FEIA 2X9HA 4Z8AA 1SG5A 4XK8E 2ZAEA 2FPEA 1UGVA 2BIVA 2VUBA 1WXBA 4QVZA 2G80A 7AT1B 2D6FA 3GIBA 2XKOC 2O4XB 2MMPA 1JBMA 3QG1A 4D8DA 5LJ5h 3L2QA 5GAOp 2CKKA 2IVWA 2DXCA 1NJIC 1SSFA 4BDYA 3CCUT 2X51A 5GAN6 4PK4A 1X69A 3OMCA 1M3CA 2E41A 4FW1A 3QUIA 2DL3A 5KH6A 1GCQC 2XK0A 1KHCA 4ZN3A 3VS5A 1LCKA 5FU6C 5CKBA 1WI7A 1G83A 2YUOA 5KYYB 2KROA 2CT3A 4AFUC 2KGTA 1VQ4A 5HY6A 1RAAB 3JCMh 1D3BB 3EG0A 5IHKA 1TH7A 3NHNA 3I35A 2JXBA 1QCOA 4HVUA 1YI2Q 1YCYA 1IGQA 3KBGA 3CCQT 1K8AC 1GBRA 2DXTA 2HJQA 1VQ5T 3OYKA 2AT1B 1TU0B 4C0GA 3M9QA 1ZBJA 2EKOA 1K4US 2YDLA 1X6BA 1YJNT 2EQMA 2FZGB 2QQSA 1S72Q 2XD0A 4LUEA 1QWFA 2NUTB 1M2VB 4O6JA 1GFCA 1OU8A 3QIIA 5FU7B 1Y57A 2NWMA 4X34A 1K9MU 2ESWA 2RHYA 1N5ZA 4J9BA 1D0YA 3UDCA 3JB9F 4J9CA 4E6RA 4EMHA 2E1HA 2K6DA 3M4YA 2CZ6B 4LUDA 1OOTA 2GBQA 3M0TA 5D6XA 4HA8A 4JJNK 1N8RR 2NYSA 1VQ6A 2C0OA 4JUVA 2RPNA 2DYIA 2MWOA 5CQYA 5IH2A 2JJ9A 2QK0A 1SPKA 2BZ8A 5J39A 2ED1A 2LZ6B 1NPPA 4DA4A 4N0AA 1YP5A 4D6WA 3HSBA 1PRLC 3PGGA 5CKFA 2O2OA 1ZHIA 2J7IA 1J3TA 4AFSC 2HEQA 4JRQA 4JLGA 3CCSA 5CKDA 5GANh 3PIOA 1HJDA 1PWTA 1WYXA 1T3LA 2BE9B 3E9GA 1GRIA 1N8RC 2M1HA 4M7DA 3CCRA 2JNGA 3A8LB 3CCEQ 1PD1A 4RTWA 1N9RA 4ELZC 4BI4A 3O8VA 3PTAA 4ZGJB 1G3WA 2VXEA 3HFNA 2LT4A 4ZNXA 5KCOA 3CPWP 1QVFP 4FU6A 3KUFA 1UGPB 2FG0A 4IUTA 4A4FA 2RB6A 3L1AA 3URGA 1R0CB 2EW3A 2BZYA 3TREA 1S1NA 2DL4A 4A63B 4OMFB 1VQ4Q 4QW2A 4E2FB 2BUDA 5IHIA 1BK2A 4M77C 1YITA 1M90C 2KRSA 3L2ZA 2YXYA 2DNUA 2CUBA 3JB9D 4KUIA 4X9CA 1UGRB 2DIGA 1T0JA 3FEOA 2KFVA 2NUPB 4F17A 4M7AC 1VQOA 4F7UF 2LCSA 1OPLA 1D3BA 1IO6A 4J9EA 2DVEA 1WJRA 4JPBW 4OB2B 3HRUA 1K76A 3DKMA 3SB2A 3G4ST 1SHFA 4C8QF 1M3BA 2ZZDA 1BYMA 3VS4A 3HL8A 1UGSB 2DTHA 2A0FB 4OP0A 2RI5A 2M51A 5LJ3e 1O75A 4A53A 3I5SA 3CQTA 3TQ7P 2QEXT 1SSHA 1M2VA 3CC7A 4X9DA 4FT4A 4II1A 2RA2A 1NYFA 1YNZA 3CPWA 3I55A 1ZSZA 1Y02A 2EBPA 5HK3A 1Y96B 1JXMA 1YHQT 3OBYA 2QYZA 5LJ3j 2RJCA 2CP2A 5IN1A 1H92A 2QQAA 4M78G 4A4EA 1QMCA 3JCMb 3QKJA 1VQPT 4MMLA 2MOXA 4CC2A 1JB0E 2RJEA 2JT4A 2WSEE 3CCSQ 2F5KA 2YRCA 2OI3A 1U1TA 4YTLA 3SHWA 1CSKA 2QA4A 2RHXA 4C5IA 4HT9A 2F2XA 1UB4A 5KYUA 1SRLA 3CCRQ 5DY9A 4PJOC 1BI0A 4JDSA 5GAMj 4L5GA 4J9IA 3JB9G 2M16A 2HL3A 5GAN3 5I2SA 1MNEA 2C0TA 4C8QD 1M8MA 2DEQA 2WACA 1PD0A 4MMKA 4PKCC 2KNBB 3L2VA 1WJSA 2CP0A 2GTJA 3META 3MP1A 5LJ3g 4FW2A 2M02A 2XG8D 3CBOA 4IKFA
chains in the Genus database with same CATH topology
2P0PA 2M9UA 2E70A 2QI2A 3CCEA 4M75G 2RHIA 2LT1A 3OBWA 2ZPBB 4WF2A 5L8RE 3TU4K 4BY6C 4PJOB 4M77F 3MO8A 3CBMA 4M75A 2VC8A 4IUPA 1HK9A 5GMKl 2JUFA 1YIJA 1VQNT 2RK1A 2CZ1B 4EMKA 4RCBA 1XQHA 1VQLT 3OW2A 4EDUA 4C0DB 3SDZA 5FLXE 2OTJA 2L3RA 1FX7A 2B8AA 4RG2A 3CC7T 1KHIA 3E1SA 4RKUE 4F7UE 4JRKA 4M7AF 3ZEHA 3SWNB 4OF1A 4C92D 3EAEA 3I55T 4M78E 2X4YA 3M57A 4LD6A 5A0GA 3G6EA 2E6NA 5I2MA 5FRMA 2LQKA 2KVQG 4C8QE 4OB3B 1G3YA 1KC8U 3R6OA 1VQ6T 3CCJT 2X4WA 3C12A 3BDUA 2OTLT 3NFCA 1Q86U 1M4ZA 5LJ5f 3JCMP 1Q7YU 1BKBA 5CK9A 3MHXA 4L6V5 3J80E 2F69A 2LRQA 2EJFA 4RMOA 4A4GA 2FB7A 1Q81U 4KUDK 3FLGA 3OSSC 3P8DA 4M75D 3OYHA 1KQ1A 4O5VA 4EMGA 1JRIA 5GAMf 1V29B 2EYQA 2PUOB 3JSCA 5GMKh 4BY6B 2VXFA 3E9FA 2CYZB 4C0ZA 4ATOA 3GNGA 1VIEA 2PUKB 3CMET 2QA4T 3RKWA 2X4XA 3I56T 4IUVA 1H641 1M1KC 1JJ2S 1G3TA 3FIFA 4M78C 4M77A 1BIBA 2C06A 3CCUA 2E5QA 2BKDN 2DZ9A 4C8QC 1LOJA 4QVDA 4UC4A 2L89A 2KAFA 1VQ9T 2LC4A 3M5AA 2GFUA 2QXFA 5GAN7 3OYNA 4LD9K 3OYAA 3JB9H 4J83A 2DD5A 3OMGA 4PLIA 3CCVA 2XHCA 1Q82C 4IUQA 4C92E 1LNXA 1QVFA 3L42A 1KC8C 3JCMf 4CI0C 1Y7XA 3QSUA 4MZMA 3L2UA 4M7AA 3A8MB 3JCMV 4LDXA 5GANj 2MF2A 1Q86C 2LNVA 3T9NA 1Q7YC 4XTYA 3EFSA 4PLLA 1S72A 1Q81C 5DM7R 1AHJB 2K5FA 4XU2A 3ZBDA 2R58A 3VKIA 1M5Q1 3MEVA 1VUBA 2H3JA 4M75E 3VV0A 3A5ZB 1N8RU 3BW1A 3VU3C 3RIRA 1M8VA 2FHDA 4L59A 4XTUA 2EQUA 2L5QA 2RO0A 2G3RA 3ASKA 2PVGB 2QTXA 3EFRA 1M9SA 3UWNA 4M77D 3G71A 3HRSA 2K5IA 2KSSA 1U1SA 4F7UB 2DAQA 1ZQ1A 1OYXA 2ZCFB 5I21A 2CZ0B 4VUBA 3CCQA 5M9OA 5CIUA 1B34B 3M53A 1P92A 5CCAA 1FWZA 4C92C 3JCMc 4PNOA 4M78B 1YJ9T 1VQ5A 3FJPA 4A4KA 4ZTJA 3JCMX 4C8QB 2CS7A 3VYGA 1WPYA 1YIJT 4E7JA 1OZ3A 2R5MA 4M7AD 2JN0A 4ZGDB 2JTMA 5DLOA 3L2WA 4HCZA 4QVCA 2RD1A 1YJNA 2V8KA 2OTJT 2PVDB 4FM4B 3WVEB 2RK2A 1NJIU 3NTHA 2EAYA 4B9WA 1YJWA 2RHUA 1XTDA 2GF7A 2RM4A 2PQWA 4JRPA 1MHNA 2D0QB 2VV5A 3G6ET 4M75C 5FRNA 3QZ5B 4C5GA 4C92G 3OB9A 5LJ3h 2HNIA 2YLBA 2XICA 1RL2A 5LL6S 4EMKC 2LDMA 5GAOq 3FRNA 5A2QE 4ELYC 4E7IA 2MAMA 4JLIA 1O9SA 1KD1U 3PMTA 2NLUA 4XK8E 2RI2A 4MZPA 2BIVA 2YLCA 2HBPA 2VUBA 1K73U 1UEBA 4QVZA 2K3XA 4C0FA 2D6FA 3GIBA 2CZ7B 2XKOC 3A8GB 2O4XB 1M1GA 1R8OB 2DKGA 2QQRA 4C5HA 2MMPA 1JBMA 2VGNA 2QQBA 3FDRA 2IG0A 3LYIA 3QG1A 4DQ2A 4C92B 4HKEA 1I81A 1VQKA 2K5LA 5J3BA 2RH2A 5LJ5h 5GANf 3L2QA 5LJ3f 4KULA 2JVVA 1K8AU 5GAOp 2CKKA 2IVWA 2DXCA 1NJIC 1SSFA 3F70A 4BDYA 3CCUT 5GAN6 4A4HA 3MP8A 1YI2T 1PSFA 3OMCA 5GAMh 3LLRA 4JS4A 4LDUA 5KE3A 2R5AA 3CMAA 3CCVT 1ZBXA 2E41A 1VQ8T 2GCXA 3QUIA 4M75B 1KQ2A 5KH6A 5C0MA 3ER0A 3OYCA 5GAOm 3CD6A 3OS1A 1JJ2A 2FYKA 3PT9A 4EMKB 2XK0A 3A8OB 3MP6A 1KHCA 3QPHA 4ZN3A 3C95A 3BFMA 1KD1C 2HD0A 5FU6C 1OI1A 5CKBA 3LX7A 2LCCA 5GAOr 5FU7C 4ZN1A 3P8HA 1S72T 1K73C 1UGQB 3GF5A 1KG1A 4XTZA 1VQ4A 3M58A 5HY6A 3GNFB 2F5TX 1WQWA 3CXCS 3OYBA 3CC4A 4ME7A 4OGEA 3JCMh 4J8OA 4OVAA 1VQ8A 3PNWC 3M54A 3CCLA 1D3BB 2KMTA 2V8JA 2A7YA 1TH7A 1VIFA 3RKXA 4IURA 3ZFJA 1FXXA 2QQ9A 2EJGA 2LCLA 3HFOA 4A54A 3G71T 2I2LA 5CR2A 3C94A 2LX9A 5GMKi 1YCYA 2YHTA 3KBGA 1NZ9A 4M77G 3CCQT 1K8AC 4RG8A 3FC3A 3M55A 2DXTA 2WSCE 3QDRB 3QYHB 3LW5E 1VQ5T 4NOYA 3OYKA 2X35A 4QQ6A 4C0GA 1NE8A 2LTOA 3M9QA 3S3NA 4J7IA 3JB9J 2EKOA 4J6WA 4BI8B 2ZGWA 2KY9A 1YJNT 4M7AG 2EQMA 3PIPA 3OYEA 4TVRA 5C6SA 1X01A 1YJWT 1XNIA 2QQSA 2XD0A 4XU3A 1N9SA 2MI6A 3X28B 2CGHA 2JOYA 1W2BS 2R57A 3OA6A 1Y96A 2RJDA 5FU6B 2DJZA 4J5YA 1VQ7A 3FB9A 4M7DF 5CKEA 4O6JA 3X20B 5IT9E 3QIIA 5FU7B 4E7HA 4X34A 3OY9A 3VJPA 4CRIA 1K9MU 3J81E 4HT8A 2RHYA 3OS5A 5GAN5 4P5NA 4DOVA 3S3OA 2RI3A 4E47A 5KE2A 3UDCA 3JB9F 4EMHA 5CKHA 2E1HA 4BB7A 1U8RA 4BACA 3M4YA 2CZ6B 4N4GA 5A0DA 4JJNK 3CCMA 2YRVA 5D6XA 4HA8A 4PJOF 3OYDA 3CCJA 3HKSA 3CCET 4JUVA 1VQ6A 3BY7A 3VUBA 4B9XA 4DOWA 5LJ5e 2MWOA 2XIDA 2ZPIB 4J7FA 5CQYA 4QQDA 3G4SA 2OTLA 4N4HA 1MGQA 3RMSA 1VQKT 2P4TA 3HHTB 4LDVA 5LJ5d 1QVGS 5J39A 3Q1JA 1QW1A 1NPPA 2Y4XA 1PSEA 2A3LA 4FT2A 2DZCA 4GLKA 3OSVA 4N0AA 5GAMe 3UPUA 3S3MA 2K3YA 1KQSS 4D6WA 3JCMQ 3HSBA 3KXTA 4R56A 3PGGA 5CKFA 3L2RA 1ZHIA 4LDYA 4ZTFA 2L8DA 3CMEA 3CMAT 3CPWS 4R55A 4JRQA 4OGCA 2AHJB 3MEWA 4JLGA 3TEEA 1N6AA 3CCSA 1LJOA 3OYFA 2QDYB 3PFSA 3V7RA 3PMIA 5CKDA 5KCHA 5LJ5j 5GANh 3PIOA 2M0OA 3CD6T 2K4YA 2QEXA 1VQMA 3C4SA 3M56A 3G7ZA 2XDBA 2Y90A 3E9GA 1N8RC 2M1HA 3AHUA 5CQXA 2VYTA 3SD4A 4M7DA 5GMKm 3CCRA 2JNGA 3A8LB 1M90U 1G5VA 1QP2A 3JCMe 3OYLA 1VQ4T 1N9RA 4ELZC 4E7LA 3LGLA 4BI4A 3O8VA 5GMKe 4ZGJB 4M77E 3JCMd 3PTAA 2LVMA 3JB9I 3HP9A 3S6WA 2D9TA 3CCLT 1YHQA 2XU8A 3J7AF 4MDXA 1G3WA 2VXEA 3E19A 3HFNA 2LT4A 3GOXA 2P0QA 5KCOA 1EIFA 2GQVA 4JRIA 4BE2A 3DLMA 1G3SA 1W4SA 4EPCA 2WSFE 5GAN2 4JS5A 4LDWA 4PJOA 2Y4YA 1VQPA 4FU6A 3CC2A 3KUFA 3P8BB 1M1FA 1UGPB 3INZA 4IUTA 3CXCA 4M7AE 3RMQA 4A4FA 5D6WA 2RB6A 2X4JA 3L1AA 3QXEB 1Y71A 3URGA 2PU9B 4FL6A 5GMKj 2DO3A 3TREA 3SWNA 4M7DD 1BIAA 4OMFB 1WGSA 3JCMW 1YJ9A 4QW2A 2EQKA 3QZ9B 3M59A 2KQWA 2E12A 2BUDA 1YITA 2ZPFB 4M77C 4XAXB 5GAN8 2VGMA 1M90C 1VQ7T 1GXIE 3L2ZA 4XU0A 3OYGA 2ZPHB 3CEYA 3QBYA 4NS5A 1M1KU 2FL7A 3JB9D 4MZTA 4KUIA 4X9CA 4HCCA 3OS0A 5LJ5g 2EJ9A 3CBPA 1UGRB 2DIGA 3QHSA 3X25B 3QJYA 3H8ZA 3FEOA 1W2BA 3JAME 4E7KA 3CPFA 4PJOD 3VYHB 1VQOA 4M7AC 1Q82U 1QP3A 3H6ZA 4QQGA 4F7UF 5GAMg 1D3BA 2DVEA 1WJRA 2JZ2A 4OB2B 1I5LA 2E65A 2EQJA 3HRUA 3CCMT 4V2SA 3DKMA 4M78F 3SB2A 3NTKA 2PVOB 4NL3A 3G4ST 4C8QF 2KK4A 2ZZDA 1BYMA 3RKYA 4BE1A 3HL8A 5HK0A 1UGSB 2ZPEB 3WXMB 2V8IA 3HPWA 3GP8A 1YBYA 2RJFA 3JCMJ 2DTHA 4BD3A 4BUGA 1OZ2A 3OW2S 2EFIA 2JTFA 4Z02A 3V7CA 3UT1A 1I8FA 5GAOl 5D6YA 3LWIA 3LH0A 4OP0A 2EWNA 5DLQE 4M7DE 4DA4A 3MEAA 3JRZA 2XDDA 4HCBA 4BE0A 5FROA 5GANe 3CC4T 3JCMg 2RI5A 5LJ3e 4ZGEB 3WVDB 1O75A 4A53A 1QVGA 3CC2T 3CCST 3ME9A 4M77B 1VQNA 3RERA 3A8HB 5GANd 1VQLA 2FVUA 3QO3A 3RUXA 5LJ3d 4PL6A 4GY5A 4KBMB 1KQSA 5IAYA 2QEXT 4XTWA 1VQMT 4N0AC 3CC7A 1YI2A 4X9DA 4BDZA 4FT4A 4II1A 2E10A 2RA2A 3CCRT 2HAXA 3LGFA 4PJOE 1H3ZA 3CPWA 1N27A 1IREB 2LQ8A 3N5BB 3OQ5A 1X75C 4M7AB 3I55A 3HRTA 5HK3A 1Y96B 1X6OA 4OB0B 1YHQT 1WJQA 3OBYA 3VUZA 4F7UG 1BI3A 4XU1A 4XTVA 2P0KA 4C92F 1DJ7B 2E64A 2DIQA 3SFMA 3V8KA 2RJCA 3MCAB 5IN1A 3X26B 5LJ3j 2QQAA 3V8JA 3DB3A 4F7UA 4M78G 1WQ7A 3DB4A 3V7SA 4A4EA 4C8QG 1B34A 3JCMb 2GFAA 3QKJA 2K57A 4M7DC 5GAOn 2MWPA 3OYIA 1VQPT 4M78A 3GPLA 2HQXA 5GAN4 4MMLA 4Y91A 4C8QA 1JB0E 3TCJA 2RJEA 4C5EA 2WSEE 2DTIA 5CAIA 1BI1A 2F5KA 4N4IA 4Y28E 5GAMd 4J6XA 4FSXA 3M4GA 4M75F 1U1TA 2HQEA 4YTLA 1I4K1 5A0LA 2QA4A 4NL2A 2RHXA 4C5IA 2XDPA 3OYMA 4FIBA 3I56A 1QVFS 4HT9A 2DXUA 2E6ZA 3QYGB 1UB4A 3GLXA 3RESA 2DD4A 1K9MC 5DY9A 1Y07A 2OAUA 5J26A 4PJOC 4M7DG 1BI0A 4OB1B 5HKCA 1NPRA 4JDSA 4J6YA 1YITT 1VQ9A 1QVPA 2ZPGB 3QJ6A 4C0DC 5GAMj 4L5GA 3LWHA 5CVIA 3NTIA 4IUUA 2M16A 3OS2A 3JB9G 5GAN3 1HXDA 5I2SA 3OYJA 3SWNC 4XTXA 4M78D 3X24B 1VQOT 2DPPB 2DTOA 2O4XA 3BDLA 4PJOG 4C8QD 2DEQA 1RI0A 2WACA 4MMKA 1WNLA 2RHZA 4PKCC 3L2VA 3DLLA 2DK3A 1WJSA 3OYYA 4M7DB 3META 4C92A 5CO7A 3V8LA 2O01E 1XOVA 1BI2A 3MP1A 4XQ3A 2K2VA 2XI9A 4RCCA 4MDWA 5GANg 2EIFA 5LJ3g 3MEUA 4BI3A 4Q5WA 2DXBA 4KT0E 2XG8D 3CBOA 5AYFA 1IZ6A 2KDSA 4IKFA 5EG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZ2 A;  3QII A;  4HCZ A;  3L2W A;  2EQJ A;  4X34 A;  4E7H A;  3OY9 A;  4CRI A;  2RHI A;  3NTK A;  3NTH A;  2RHY A;  4B9W A;  2RHU A;  4BE1 A;  3S3O A;  2RI3 A;  3MO8 A;  5KE2 A;  2GF7 A;  4IUP A;  2PQW A;  1MHN A;  5FRN A;  2RJF A;  4C5G A;  4BD3 A;  4BAC A;  1OZ2 A;  2EFI A;  2JTF A;  3OB9 A;  4Z02 A;  4EDU A;  4N4G A;  2YRV A;  5D6X A;  2LDM A;  3UT1 A;  3OYD A;  2L3R A;  5D6Y A;  2B8A A;  3LH0 A;  4RG2 A;  4B9X A;  4E7I A;  2MWO A;  3PMT A;  4QQD A;  3MEA A;  2NLU A;  4N4H A;  4BE0 A;  5FRO A;  3ZEH A;  2RI2 A;  2RI5 A;  2BIV A;  3EAE A;  5J39 A;  3Q1J A;  5FRM A;  2X4Y A;  3ME9 A;  4LD6 A;  4QVZ A;  2K3X A;  2E6N A;  3S3M A;  4PL6 A;  4GY5 A;  2K3Y A;  5IAY A;  2O4X B;  2X4W A;  2QQR A;  4C5H A;  3FDR A;  2IG0 A;  4BDZ A;  3LYI A;  4II1 A;  3L2R A;  4ZTF A;  2L8D A;  3LGF A;  1H3Z A;  1N27 A;  2LRQ A;  3OQ5 A;  3MEW A;  4A4G A;  3OYF A;  3L2Q A;  3PFS A;  5KCH A;  3PMI A;  3FLG A;  3P8D A;  2M0O A;  3OYH A;  1WJQ A;  2CKK A;  1SSF A;  3F70 A;  4BDY A;  2P0K A;  3C4S A;  4A4H A;  2DIQ A;  3E9G A;  3MP8 A;  2RJC A;  2M1H A;  3OMC A;  5IN1 A;  3LLR A;  3E9F A;  2VYT A;  3SD4 A;  3DB3 A;  5KE3 A;  1G5V A;  2R5A A;  3DB4 A;  4A4E A;  3OYL A;  2X4X A;  2GFA A;  3QKJ A;  4IUV A;  2MWP A;  3OYI A;  5KH6 A;  3LGL A;  4E7L A;  2HQX A;  5C0M A;  3OYC A;  3O8V A;  3OS1 A;  2LVM A;  2RJE A;  4C5E A;  3S6W A;  2D9T A;  2XK0 A;  3MP6 A;  1KHC A;  2E5Q A;  2BKD N;  2F5K A;  4N4I A;  3GOX A;  1OI1 A;  4UC4 A;  2L89 A;  3LX7 A;  5KCO A;  4BE2 A;  2GFU A;  3OYN A;  2HQE A;  2LCC A;  3DLM A;  3OYA A;  3P8H A;  3OMG A;  2RHX A;  4PLI A;  2XDP A;  4C5I A;  3OYM A;  4IUQ A;  3L42 A;  4FU6 A;  3KUF A;  4IUT A;  3OYB A;  3L2U A;  5J26 A;  4OVA A;  3PNW C;  4A4F A;  5D6W A;  4IUR A;  3QJ6 A;  4FL6 A;  4PLL A;  2R58 A;  3MEV A;  3NTI A;  3FC3 A;  4IUU A;  2M16 A;  3OS2 A;  3OYJ A;  1WGS A;  4QW2 A;  3OYK A;  2FHD A;  2EQK A;  4L59 A;  2EQU A;  2RO0 A;  2X35 A;  4QQ6 A;  2G3R A;  2LTO A;  2BUD A;  3ASK A;  3BDL A;  3M9Q A;  2O4X A;  3S3N A;  2EKO A;  3UWN A;  1RI0 A;  2WAC A;  3OYG A;  3CEY A;  2RHZ A;  3QBY A;  4NS5 A;  3L2V A;  1WJS A;  2DAQ A;  2EQM A;  3OS0 A;  3MET A;  1OYX A;  3OYE A;  5C6S A;  3MP1 A;  2DIG A;  5M9O A;  5CIU A;  1XNI A;  2QQS A;  3H8Z A;  3FEO A;  3MEU A;  4E7K A;  4ZTJ A;  4Q5W A;  2R57 A;  3OA6 A;  2RJD A;  3H6Z A;  4QQG A;  1OZ3 A;  2R5M A;  4E7J A;  4IKF A;  1WJR A; 
#chains in the Genus database with same CATH topology
 2M9U A;  1YIT Q;  4M75 G;  4WF2 A;  4DBF A;  4BY6 C;  2QNF A;  4M77 F;  2K9G A;  1HK9 A;  5GMK l;  1YIJ A;  3CC4 Q;  2RK1 A;  5IXB A;  4FSS A;  3CCL Q;  1C6V X;  1VQO Q;  1FX7 A;  2JS2 A;  1KHI A;  4F7U E;  3PVQ A;  4M7A F;  3H41 A;  3SWN B;  5FRM A;  3EGU A;  3M57 A;  2LQK A;  2KVQ G;  4C8Q E;  2DMO A;  3R6O A;  2OTL T;  3NFC A;  1TSF A;  2RQV A;  1BKB A;  1AWX A;  5CK9 A;  2FB7 A;  4BIT A;  1ABO A;  3OYH A;  1RUW A;  5EC7 A;  3I9Q A;  1W1F A;  3QWX X;  3CC7 Q;  4FCY A;  4M4Z A;  1G3T A;  3I55 Q;  2JMA A;  2L0A A;  1BIB A;  2C06 A;  2BKD N;  1MMN A;  1LOJ A;  2LC4 A;  3M5A A;  2GFU A;  2QXF A;  5GAN 7;  3OYN A;  3OYA A;  2DD5 A;  3OMG A;  3CCV A;  2XHC A;  1G8X A;  1LNX A;  1KC8 C;  1B07 A;  2MF2 A;  1Q86 C;  2JTE A;  1Q7Y C;  4XTY A;  3EFS A;  2MK5 A;  1HYO A;  1Q81 C;  5DM7 R;  2MPX C;  3H0H A;  3REB B;  3ZBD A;  1PC0 A;  3VKI A;  3CME Q;  1N8R U;  2DA9 A;  4HCK A;  2VKN A;  9ATC B;  1H3H A;  2PVG B;  1R0B G;  1NEG A;  4M77 D;  2KRN A;  1ZQ1 A;  2CZ0 B;  4VUB A;  1B34 B;  1FWZ A;  4C92 C;  4M78 B;  3FJP A;  4E7J A;  2HBW A;  4M7A D;  2I0N A;  1U3O A;  2G6F X;  4HCZ A;  3L2W A;  4QVC A;  2QG9 B;  2V8K A;  2PVD B;  3UA6 A;  2RK2 A;  2RM4 A;  5AT1 B;  2DX1 A;  1B7T A;  4C5G A;  2CP3 A;  4EMK C;  2LDM A;  5A2Q E;  4J9H A;  4E7I A;  2MAM A;  4AT1 B;  4RTY A;  2HBP A;  2K3X A;  1YJ9 Q;  4DEX A;  2EYZ A;  1YIJ Q;  1UJ0 A;  4C5H A;  1TG0 A;  2QQB A;  2HCK A;  4OMP A;  1VQK A;  5LJ3 f;  1WX6 A;  1NG2 A;  2JVV A;  2LD7 A;  3F70 A;  3MP8 A;  1PSF A;  3M0S A;  3LLR A;  4JS4 A;  1WHL A;  1A0N B;  1GCP A;  4M75 B;  2BZX A;  3ER0 A;  5C0M A;  5GAO m;  3OYC A;  3OS1 A;  1JEG A;  3PT9 A;  1M8V A;  3BFM A;  1OI1 A;  2X3X D;  2LCC A;  4ESR A;  1K73 C;  1UGQ B;  1RAE B;  2MYS A;  3GNF B;  1WQW A;  3EG2 A;  4ME7 A;  1ZA2 B;  4OGE A;  1VQ8 A;  2L2P A;  2KMT A;  2V8J A;  2LX7 A;  1H9F A;  2A7Y A;  3ZFJ A;  4IUR A;  5IHN A;  2QQ9 A;  2X3W D;  3G71 T;  2HKN A;  2LX9 A;  5GMK i;  4M77 G;  1NZ9 A;  3M0Q A;  1PG5 B;  3FC3 A;  3M55 A;  3QDR B;  1RAB B;  5L23 A;  4BI8 B;  1GKU B;  2ZGW A;  1T0H A;  2DEU A;  4M7A G;  4J9D A;  5C6S A;  1YJW T;  1NEB A;  1WHH A;  2MI6 A;  2CGH A;  2JOY A;  1AWO A;  1D09 B;  2R57 A;  2DJQ A;  5FU6 B;  4J5Y A;  1VQ7 A;  2DIL A;  3X20 B;  5IT9 E;  1GBQ A;  4E7H A;  3TSW A;  3VJP A;  2E5K A;  2K3B A;  4DOV A;  3S3O A;  2RI3 A;  4JZ3 A;  3QDF A;  3EFO A;  3C0C A;  1OQK A;  3NMZ C;  1JXO A;  2YRV A;  5I22 A;  3CCM A;  4JJB A;  4RUG A;  5LJ5 e;  2ZPI B;  4J7F A;  4QQD A;  2RQT A;  2OTL A;  1AZE A;  2PNI A;  1T3S A;  4LDV A;  3Q1J A;  2A3L A;  3S3M A;  3KXT A;  4R56 A;  1RAG B;  3GBQ A;  4DBR A;  1TUG B;  4E7S A;  3CMA T;  3CPW S;  4R55 A;  4OGC A;  2AHJ B;  2JW4 A;  3A98 A;  4PJJ A;  3OYF A;  3V7R A;  5LJ5 j;  1NJI R;  3CD6 T;  1IGU A;  1QVG P;  1QP2 A;  3JCM e;  1KQS P;  4KGX B;  1VQK Q;  3CC4 T;  4MDX A;  2DF6 A;  3CCL T;  3E19 A;  3GOX A;  2P0Q A;  5FWC A;  2HL5 C;  1A63 A;  2ED0 A;  1ZSG A;  2Y4Y A;  1M1F A;  1WLP B;  2A08 A;  5D6W A;  5I11 A;  2KBT A;  3NGP A;  3M0U A;  1K8A R;  2DE0 X;  1BIA A;  8AT1 B;  4AFZ C;  3QZ9 B;  2KQW A;  4XAX B;  1VQ8 Q;  2VGM A;  1GXI E;  2KXC A;  1H1J S;  3E2U A;  3OYG A;  3CEY A;  3G1J A;  4NS5 A;  1CKB A;  5LJ5 g;  3CBP A;  3X25 B;  3QHS A;  4RTT A;  1UE9 A;  2AZV A;  1QP3 A;  1UTI A;  1GL9 B;  3H6Z A;  4QQG A;  1H8K A;  4LE9 A;  3JV3 A;  4M78 F;  1QCN A;  1RLQ C;  2PVO B;  1WHK A;  1OEB A;  3RKY A;  4BE1 A;  4KGV B;  2RQW A;  2AK5 A;  2V8I A;  3GP8 A;  2RJF A;  1TUC A;  1OZ2 A;  1E7D A;  3EG1 A;  3UT1 A;  1I8F A;  1VQ7 Q;  1PKS A;  5D6Y A;  3LWI A;  2E3H A;  1JEQ A;  3JRZ A;  5FRO A;  1QQJ A;  3VS1 A;  3JCM g;  5GAN e;  4ZGE B;  1QVG A;  1XJW B;  3CC2 T;  4Z89 A;  4M77 B;  1VQN A;  3A8H B;  2FVU A;  3RUX A;  3VS7 A;  4GY5 A;  4KBM B;  2ROL A;  1KQS A;  5IAY A;  2L3S A;  1VQM T;  4N0A C;  2VB6 A;  4FYW B;  3CCM Q;  2E10 A;  1A62 A;  1D1A A;  1IRE B;  4M7A B;  1UG1 A;  1X6O A;  4OB0 B;  1WJQ A;  1MMA A;  4XTV A;  1DJ7 B;  2KXD A;  2DIQ A;  3SFM A;  4F7U A;  3DB3 A;  3IQL A;  1WQ7 A;  1F1B B;  2GFA A;  4M7D C;  1NBE B;  5GAO n;  2FPF A;  3OYI A;  2HQX A;  4C8Q A;  4C5E A;  2DTI A;  1BI1 A;  5KYX A;  4M75 F;  2HQE A;  1I4K 1;  5A0L A;  2W10 A;  2E6Z A;  2HSE B;  2L3Q A;  1AWW A;  4OB1 B;  1NPR A;  2J06 A;  4J6Y A;  1VQ9 A;  1QVP A;  1ZUK A;  1LVK A;  5CVI A;  3BE3 A;  2QGF B;  3PVL A;  3OS2 A;  2LQW A;  1MND A;  1HXD A;  3OYJ A;  2KVU A;  2FZK B;  1M90 R;  4M78 D;  3X24 B;  1WZO A;  3BDL A;  2VWF A;  2KT8 A;  2O4X A;  1PHT A;  2RHZ A;  2DK3 A;  1W70 A;  5CO7 A;  1BI2 A;  3QWY A;  4DBH A;  2KW9 A;  2XI9 A;  5GAN g;  1KFZ A;  2EYW A;  4KT0 E;  2YRD A;  1I1J A;  5EG2 A;  1WA7 A;  2E70 A;  2O9V A;  2RHI A;  2LT1 A;  3OBW A;  3TU4 K;  3MKD A;  4PJO B;  2DLP A;  2VC8 A;  4IUP A;  3RDV A;  2CZ1 B;  2BE7 D;  1VQL T;  1XQH A;  2OTJ A;  2L3R A;  5KYY A;  2B8A A;  4RG2 A;  4JRK A;  2DBM A;  3ZEH A;  2D1X A;  2BTT A;  4OF1 A;  4M78 E;  3G6E A;  1E6H A;  4LD6 A;  1M1K R;  1G3Y A;  2AIR B;  1IXD A;  3CCJ T;  4ANJ A;  5LJ5 f;  3MHX A;  2ATC B;  3EG9 B;  2EJF A;  1KK7 A;  2SRC A;  1MUZ A;  4M75 D;  1ZSZ C;  1WHJ A;  3OSS C;  1KQ1 A;  4O5V A;  1VQN Q;  2EYQ A;  4BY6 B;  1K0S A;  2VXF A;  4C0Z A;  3EHQ A;  1RAF B;  1HD3 A;  1VIE A;  1BBZ A;  2X4X A;  3I56 T;  1H64 1;  1QKW A;  1M1K C;  2NUT A;  2FPD A;  1WIE A;  4M77 A;  3CCU A;  2E5Q A;  2DZ9 A;  4QVD A;  2L89 A;  2KAF A;  2PTK A;  1VQ6 Q;  4PLI A;  2QAS A;  6AT1 B;  2MPH A;  1QVF A;  3L42 A;  2KRM A;  2W0Z A;  3JCM f;  4CI0 C;  3QSU A;  1YCS B;  4MZM A;  3L2U A;  1E6G A;  4M7A A;  3VS2 A;  2LNV A;  3T9N A;  3U23 A;  3R6N A;  4DBQ A;  2MIO A;  2EGE A;  1JJ2 P;  2PZ1 A;  2H3J A;  4M75 E;  3VV0 A;  3A5Z B;  1R77 A;  2QTV A;  4AG2 C;  2G3R A;  2KI7 A;  4GLM A;  2K5I A;  1VQ9 Q;  1FMK A;  2ZCF B;  1TXQ A;  3VRY A;  3CCQ A;  1MV0 B;  2QNC A;  1NLO C;  5CCA A;  1VQ5 A;  4A4K A;  1ABQ A;  1WPY A;  2JN0 A;  1X27 A;  5DLO A;  1YJN A;  1OV3 A;  4FM4 B;  1NJI U;  4B9W A;  2HMA A;  3RBB B;  2PQW A;  5FRN A;  4OML A;  3RR6 A;  4RTX A;  5LJ3 h;  2EYX A;  1RL2 A;  4RTU A;  2KVE A;  4ELY C;  1O9S A;  3PMT A;  2NLU A;  4MZP A;  2YLC A;  1UEB A;  2YUP A;  2EQI A;  4C0F A;  2ROT A;  1UFF A;  2P4R A;  1M1G A;  2QQR A;  5IXF A;  2VGN A;  3FDR A;  2IG0 A;  2DK4 A;  5GJW B;  4C92 B;  4HKE A;  2OTJ Q;  5J3B A;  5FWB A;  3SEM A;  5GAN f;  2P84 A;  1IRX A;  3EGX B;  1AZG B;  1K8A U;  2JS0 A;  3G6E Q;  2JM8 A;  2COY A;  4A4H A;  1OU9 A;  1YI2 T;  5GAM h;  4LDU A;  2EKH A;  5KE3 A;  2GCX A;  1KQ2 A;  1IHV A;  2KEA A;  2NUP A;  1JJ2 A;  2RNA A;  4EMK B;  3MP6 A;  1KD1 C;  2GQI A;  3C95 A;  2HD0 A;  2YWW A;  5GAO r;  5KYW B;  4ZN1 A;  3P8H A;  1S72 T;  3GF5 A;  1KC8 R;  1KG1 A;  2F5T X;  3OYB A;  1ACM B;  4J8O A;  4HVW A;  4AG1 C;  3PNW C;  3M54 A;  1Q86 R;  1Q7Y R;  4KGZ B;  1FXX A;  2K2M A;  1Q81 R;  2LCL A;  1RAH B;  3HFO A;  3CCU Q;  5CR2 A;  4FYY B;  4RG8 A;  2MCN A;  1ZA1 B;  3LW5 E;  4NOY A;  4QQ6 A;  2LTO A;  3JB9 J;  1M2O A;  2WQG A;  4TVR A;  4X1V A;  3CXC P;  1LPL A;  1FMV A;  1X01 A;  3X28 B;  4CC4 B;  3OA6 A;  1Y96 A;  2RJD A;  2DJZ A;  3FB9 A;  5CKE A;  4OMO A;  2LC3 A;  2GTO A;  4R0K A;  2HQH A;  3OS5 A;  5GAN 5;  2FRY A;  2QA4 Q;  4PJN A;  2HKQ B;  4E47 A;  1MMD A;  1RI9 A;  2AKL A;  1U8R A;  4N4G A;  4PJO F;  1TOV A;  3OYD A;  3CCJ A;  3HKS A;  3CCE T;  3BY7 A;  3VUB A;  4B9X A;  4DOW A;  3G4S A;  2COZ A;  2RF0 A;  1W2B P;  1MGQ A;  3RMS A;  1YJN Q;  3HHT B;  1QVG S;  2QDL A;  2A8V A;  1PSE A;  4FT2 A;  4KH1 B;  3UPU A;  1KQS S;  3OSV A;  1SHG A;  1TWB A;  2FZC B;  4Z88 A;  3MPU B;  4ZTF A;  2L8D A;  2V1Q A;  3MEW A;  4LD9 K;  1SF9 A;  5KCH A;  2M0O A;  4OMN A;  2CP6 A;  2K4Y A;  4GBQ A;  1PRM C;  2QEX A;  3M56 A;  1MV3 A;  3C4S A;  3G7Z A;  2XDB A;  1KIK A;  1TUD A;  3AHU A;  2VYT A;  2DVJ A;  2A28 A;  1M90 U;  1G5V A;  3OYL A;  1VQ4 T;  1UEC A;  3LGL A;  5GMK e;  4M77 E;  1YHQ A;  2LVM A;  2KYM A;  3HP9 A;  3S6W A;  2D9T A;  1QCF A;  1EIF A;  2GQV A;  2OAW A;  1WXT A;  4JRI A;  1K73 R;  3DLM A;  1G3S A;  1W4S A;  4DEY A;  5GAN 2;  4JS5 A;  1U06 A;  5FW9 A;  1VQP A;  1VA7 A;  3P8B B;  4M7A E;  3INZ A;  3CXC A;  1E7L A;  2F1L A;  3QXE B;  3EH2 A;  1Y71 A;  2PU9 B;  3VS3 A;  1X2K A;  1GFD A;  1A8V A;  5GMK j;  3I5R A;  3SWN A;  2J6K A;  1ZBH A;  1WGS A;  2QGG A;  1OX8 A;  2ZPF B;  5GAN 8;  4LNP A;  3QBY A;  1WHM A;  1M1K U;  2DL8 A;  4HCC A;  2EYY A;  3OS0 A;  2EJ9 A;  5KYW A;  3H8Z A;  1W2B A;  4PJO D;  1V76 A;  3CPF A;  3M0P A;  2ODG C;  1I5L A;  2E65 A;  2EQJ A;  4PJL A;  4NL3 A;  2KK4 A;  3CCV Q;  3WXM B;  3HPW A;  1JO8 A;  3JCM J;  1EX4 A;  2JTF A;  2K79 A;  4RTV A;  1Z9Z A;  2E3I A;  5GAO l;  1PM3 A;  3LH0 A;  2YUN A;  2EWN A;  3AT1 B;  1E7O A;  2RNO A;  3EGD B;  2XDD A;  4HCB A;  4BE0 A;  2YUQ A;  2AKK A;  3WVD B;  3CCS T;  5LJ3 d;  4PL6 A;  4PFP A;  2LJ1 A;  1K1Z A;  1YI2 A;  4BDZ A;  3EHR A;  2ENM A;  3CCR T;  2HAX A;  3LGF A;  4PJO E;  3G4S Q;  2LQ8 A;  3N5B B;  3OQ5 A;  1X75 C;  1NLP C;  3OW2 P;  1C0M A;  4C92 F;  2K7A A;  2E64 A;  3V8K A;  2DRM A;  3MCA B;  3V8J A;  1B34 A;  2JVW A;  2MWP A;  2DRK A;  4M78 A;  3VS0 A;  3GPL A;  5GAN 4;  2F2V A;  3TCJ A;  5KYN A;  5CAI A;  4N4I A;  4Y28 E;  5GAM d;  4FSX A;  2QEX Q;  2CT4 A;  2CRE A;  4NL2 A;  2XDP A;  3OYM A;  1QVF S;  1VOM A;  2DXU A;  3QYG B;  3GLX A;  2LJ3 A;  2DD4 A;  2OAU A;  4B6M A;  5HKC A;  4OMQ A;  1YIT T;  2D8H A;  1YHQ Q;  4C0D C;  1I07 A;  3LWH A;  3NTI A;  2XMF A;  4IUU A;  2KVD A;  4XTX A;  2O31 A;  1VQO T;  4PJO G;  1ZLM A;  3DLL A;  3OYY A;  4M7D B;  2DL7 A;  2HSP A;  3V8L A;  4IIO A;  4XQ3 A;  5GJV B;  2K2V A;  4MDW A;  1RAC B;  3MEU A;  4BI3 A;  2QAZ A;  4Q5W A;  1JQQ A;  2B86 A;  5AYF A;  1NM7 A;  1IZ6 A;  3PE0 A;  2O88 A;  2V26 A;  2QI2 A;  3CCE A;  2ZPB B;  5L8R E;  1SEM A;  3MO8 A;  4M75 A;  1UHF A;  4RCB A;  1UDL A;  3OW2 A;  2A37 A;  5FLX E;  4EDU A;  1JEI A;  3CC7 T;  4J9G A;  4C92 D;  4WCI A;  4JJC A;  3I55 T;  5I2M A;  1WDX A;  3THK A;  2JMC A;  1KC8 U;  4JZ4 A;  2DET A;  2X4W A;  2FRW A;  1WHG A;  5D7U A;  3C12 A;  2VVK A;  1Q82 R;  1Q86 U;  2KR3 A;  3JCM P;  1Q7Y U;  3L0O A;  4L6V 5;  3J80 E;  2HZY A;  2LRQ A;  4RMO A;  1Q81 U;  4KUD K;  1AT1 B;  1VYU A;  3P8D A;  1OUL A;  3H0F A;  4EMG A;  1JRI A;  1V29 B;  2PUO B;  2CYZ B;  2DER A;  4ATO A;  3CME T;  2QA4 T;  1GCQ A;  2DM1 A;  3EGD A;  4IUV A;  1JJ2 S;  1NYG A;  4C8Q C;  2GNC A;  4J83 A;  1Q82 C;  1B3Q A;  4IUQ A;  4C92 E;  1HSQ A;  2OTL Q;  3A8M B;  4LDX A;  5GAN j;  3EG3 A;  1AHJ B;  2K5F A;  1M5Q 1;  1ZSZ B;  3KFV A;  2CP5 A;  3BW1 A;  3VU3 C;  2FHD A;  4L59 A;  2L5Q A;  2RO0 A;  3ASK A;  3UWN A;  3G71 A;  3HRS A;  2KSS A;  1U1S A;  1OYX A;  3LH5 A;  5I21 A;  5CIU A;  1M27 C;  3M53 A;  1RAI B;  1I5O B;  1P92 A;  1YJ9 T;  4PNO A;  1Q95 G;  3JCM X;  2C0I A;  3VYG A;  1YIJ T;  1TTH B;  2YT6 A;  3NTH A;  2EAY A;  1YJW A;  5KYU B;  2GF7 A;  3D7S B;  2EVR A;  1MHN A;  2D0Q B;  3QZ5 B;  4C92 G;  3OB9 A;  4K11 A;  2RI2 A;  1K73 U;  2CZ7 B;  3A8G B;  2E4H A;  2W51 A;  1R8O B;  1OX9 A;  2DKG A;  2ECZ A;  3LYI A;  1YFN A;  4DQ2 A;  1I81 A;  2K5L A;  2RH2 A;  4RTZ A;  2O9S A;  2H8H A;  4KUL A;  1WFW A;  3H0I A;  2NUZ A;  2R5A A;  3CMA A;  3CCV T;  1ZBX A;  1PCX A;  1YN8 A;  1K0X A;  3CD6 A;  2FYK A;  3A8O B;  3QPH A;  3LX7 A;  3HTR A;  2LP5 A;  2RNN A;  5FU7 C;  4XTZ A;  3M58 A;  3REA B;  1I0C A;  1X6G A;  4E7Z A;  3CXC S;  3CC4 A;  4OVA A;  3CCL A;  1VIF A;  3RKX A;  2EJG A;  1V1C A;  4A54 A;  2I2L A;  1AWJ A;  3C94 A;  2YHT A;  3QYH B;  2WSC E;  1G2B A;  1AD5 A;  1RAD B;  5ECA A;  2X35 A;  1VYV A;  1NE8 A;  2LMJ A;  3S3N A;  3EH1 A;  4J7I A;  4J6W A;  2AZS A;  2D8J A;  1WXU A;  2KY9 A;  3PIP A;  1EFN A;  3OYE A;  1ZUY A;  1XNI A;  4XU3 A;  2GGR A;  1N9S A;  1W2B S;  4M7D F;  1X43 A;  3OY9 A;  4CRI A;  3J81 E;  1W6X A;  4HT8 A;  3G71 Q;  4P5N A;  2YSQ A;  5KE2 A;  1D1B A;  2L3P A;  3UA7 A;  5CKH A;  4BB7 A;  2HDA A;  4BAC A;  5A0D A;  1QKX A;  2XID A;  4ORZ A;  4N4H A;  1VQK T;  2P4T A;  1PNJ A;  2JM9 A;  5LJ5 d;  1YJW Q;  1QW1 A;  2Y4X A;  4GLK A;  2DZC A;  5GAM e;  1M30 A;  2K3Y A;  3JCM Q;  2LNH B;  3TSZ A;  2KT1 A;  3L2R A;  4LDY A;  1X2Q A;  4QT7 A;  3CME A;  4J9F A;  3CC2 A;  3TEE A;  1N6A A;  1LJO A;  2CH4 A;  2QDY B;  3PFS A;  4PFZ A;  3PMI A;  4PFO A;  3ULR B;  1VQM A;  2Y90 A;  5CQX A;  1ZUU A;  3SD4 A;  1AEY A;  5GMK m;  1JJR A;  1Z9Q A;  4HVV A;  4E7L A;  1BCM A;  1M3A A;  4IIM A;  3JCM d;  1KD1 R;  1VQ8 T;  3JB9 I;  4V2S A;  3J7A F;  2XU8 A;  4BE2 A;  4EPC A;  2WSF E;  4F04 B;  4PJM A;  4LDW A;  4WTO B;  4PJO A;  8ATC B;  2RQR A;  3CMA Q;  3RMQ A;  1CKA A;  5HCK A;  2X4J A;  2CDT A;  2A36 A;  3CD6 Q;  3H9N A;  4FL6 A;  1H9E A;  2COW A;  2DO3 A;  4M7D D;  1C1A A;  3JCM W;  1YJ9 A;  2EQK A;  1IB8 A;  3M59 A;  2ODC I;  2LJ0 A;  1V66 A;  2E12 A;  1VQ7 T;  4CC3 A;  4Y92 A;  4XU0 A;  2ZPH B;  2FL7 A;  4MZT A;  1ZS9 A;  2RQU A;  3QJY A;  3EG9 A;  3JAM E;  4E7K A;  1KJW A;  2Z0W A;  1Y0M A;  3VYH B;  1VYT A;  1Q82 U;  5GAM g;  2JZ2 A;  4LXC A;  3CCM T;  2EGA A;  2J6F A;  3NTK A;  1IHW A;  5HK0 A;  1QWE A;  2ZPE B;  1YBY A;  4BD3 A;  4BUG A;  3OW2 S;  2EFI A;  1SKU B;  4Z02 A;  3V7C A;  3A1P A;  2OX7 A;  5DLQ E;  4M7D E;  3MEA A;  1UHC A;  3ME9 A;  1GJJ A;  3RER A;  5GAN d;  1VQL A;  3QO3 A;  2KE9 A;  2SEM A;  4XTW A;  4KRT A;  3CCQ Q;  1H3Z A;  1N27 A;  1K9M R;  3HRT A;  4EIK A;  1VQ5 Q;  1BCO A;  4D8K A;  3VUZ A;  2EGC A;  4OMM A;  4F7U G;  1BI3 A;  4XU1 A;  2KYB A;  2P0K A;  3X26 B;  1EZZ B;  2DFU A;  3DB4 A;  3V7S A;  4C8Q G;  1FYN A;  2K57 A;  4Y91 A;  2OJ2 A;  3EFO B;  1BB9 A;  3CC2 Q;  1D1C A;  4J6X A;  2CP7 A;  3M4G A;  2CSQ A;  1VQM Q;  4FIB A;  3I56 A;  3RES A;  1K9M C;  1Y07 A;  1AOJ A;  5J26 A;  3NPF A;  4M7D G;  3UF4 A;  2ZPG B;  3QJ6 A;  2J05 A;  1SRM A;  3SWN C;  2DPP B;  2DTO A;  3ZL7 C;  1RI0 A;  1WNL A;  4QKU A;  1UJY A;  4C92 A;  2O01 E;  1XOV A;  4HXJ A;  4RCC A;  1KSW A;  2EIF A;  2IIM A;  4LN2 A;  2DXB A;  3EGX A;  1EN7 A;  4AFQ C;  1D0Z A;  2KDS A;  2J6O A;  2P0P A;  4KH0 B;  2IPO B;  3CBM A;  2CH4 W;  2H3E B;  2JUF A;  1VQN T;  4EMK A;  2RN8 A;  4C0D B;  1YWO A;  3SDZ A;  1QLY A;  1JU5 C;  3E1S A;  4RKU E;  1D0X A;  1U5S A;  3EAE A;  4FYX B;  1K9A A;  2X4Y A;  5A0G A;  2E6N A;  3MJX A;  4OB3 B;  2RMO A;  1VQ6 T;  2V1R A;  3FJ5 A;  1OPK A;  3BDU A;  1M4Z A;  2CUD A;  2F69 A;  4A4G A;  3FLG A;  5GAM f;  1VQL Q;  3JSC A;  5GMK h;  3E9F A;  3GNG A;  1ZX6 A;  2PUK B;  3RKW A;  1RLP C;  4FYV B;  2VAS A;  4AMC A;  2DBK A;  3FIF A;  4M78 C;  3RNJ A;  1YNS A;  4CC7 A;  4UC4 A;  1VQ9 T;  3JB9 H;  4F14 A;  3CCJ Q;  1UUE A;  1YWP A;  2DYB A;  1Y7X A;  3TVT A;  1GL5 A;  3JCM V;  2D0N A;  1MMG A;  1PKT A;  4PLL A;  1S72 A;  2EPD A;  4XU2 A;  2M0Y A;  2CSI A;  2R58 A;  3MEV A;  1VUB A;  3I56 Q;  3RIR A;  4XTU A;  3O5Z A;  2EQU A;  2QTX A;  3EFR A;  1M9S A;  2DL5 A;  4JJD A;  3UAT A;  2LQN A;  3VRZ A;  4F7U B;  2DAQ A;  5M9O A;  1BU1 A;  2ABL A;  3JCM c;  4ZTJ A;  4F16 A;  4C8Q B;  1ARK A;  2CS7 A;  2FO0 A;  1OZ3 A;  2R5M A;  4ZGD B;  2JTM A;  3M0R A;  5KYX B;  2F2W A;  2RD1 A;  1TS9 A;  2OTJ T;  3WVE B;  4UZW A;  2RHU A;  1XTD A;  1VQP Q;  4JRP A;  2VV5 A;  3G6E T;  1FMW A;  4M75 C;  3VS6 A;  5GAO q;  2HNI A;  1AVZ C;  2XIC A;  2YLB A;  5LL6 S;  3FRN A;  4JLI A;  1KD1 U;  2FEI A;  2X9H A;  4Z8A A;  1SG5 A;  4XK8 E;  2ZAE A;  2FPE A;  1UGV A;  2BIV A;  2VUB A;  1WXB A;  4QVZ A;  2G80 A;  7AT1 B;  2D6F A;  3GIB A;  2XKO C;  2O4X B;  2MMP A;  1JBM A;  3QG1 A;  4D8D A;  5LJ5 h;  3L2Q A;  5GAO p;  2CKK A;  2IVW A;  2DXC A;  1NJI C;  1SSF A;  4BDY A;  3CCU T;  2X51 A;  5GAN 6;  4PK4 A;  1X69 A;  3OMC A;  1M3C A;  2E41 A;  4FW1 A;  3QUI A;  2DL3 A;  5KH6 A;  1GCQ C;  2XK0 A;  1KHC A;  4ZN3 A;  3VS5 A;  1LCK A;  5FU6 C;  5CKB A;  1WI7 A;  1G83 A;  2YUO A;  5KYY B;  2KRO A;  2CT3 A;  4AFU C;  2KGT A;  1VQ4 A;  5HY6 A;  1RAA B;  3JCM h;  1D3B B;  3EG0 A;  5IHK A;  1TH7 A;  3NHN A;  3I35 A;  2JXB A;  1QCO A;  4HVU A;  1YI2 Q;  1YCY A;  1IGQ A;  3KBG A;  3CCQ T;  1K8A C;  1GBR A;  2DXT A;  2HJQ A;  1VQ5 T;  3OYK A;  2AT1 B;  1TU0 B;  4C0G A;  3M9Q A;  1ZBJ A;  2EKO A;  1K4U S;  2YDL A;  1X6B A;  1YJN T;  2EQM A;  2FZG B;  2QQS A;  1S72 Q;  2XD0 A;  4LUE A;  1QWF A;  2NUT B;  1M2V B;  4O6J A;  1GFC A;  1OU8 A;  3QII A;  5FU7 B;  1Y57 A;  2NWM A;  4X34 A;  1K9M U;  2ESW A;  2RHY A;  1N5Z A;  4J9B A;  1D0Y A;  3UDC A;  3JB9 F;  4J9C A;  4E6R A;  4EMH A;  2E1H A;  2K6D A;  3M4Y A;  2CZ6 B;  4LUD A;  1OOT A;  2GBQ A;  3M0T A;  5D6X A;  4HA8 A;  4JJN K;  1N8R R;  2NYS A;  1VQ6 A;  2C0O A;  4JUV A;  2RPN A;  2DYI A;  2MWO A;  5CQY A;  5IH2 A;  2JJ9 A;  2QK0 A;  1SPK A;  2BZ8 A;  5J39 A;  2ED1 A;  2LZ6 B;  1NPP A;  4DA4 A;  4N0A A;  1YP5 A;  4D6W A;  3HSB A;  1PRL C;  3PGG A;  5CKF A;  2O2O A;  1ZHI A;  2J7I A;  1J3T A;  4AFS C;  2HEQ A;  4JRQ A;  4JLG A;  3CCS A;  5CKD A;  5GAN h;  3PIO A;  1HJD A;  1PWT A;  1WYX A;  1T3L A;  2BE9 B;  3E9G A;  1GRI A;  1N8R C;  2M1H A;  4M7D A;  3CCR A;  2JNG A;  3A8L B;  3CCE Q;  1PD1 A;  4RTW A;  1N9R A;  4ELZ C;  4BI4 A;  3O8V A;  3PTA A;  4ZGJ B;  1G3W A;  2VXE A;  3HFN A;  2LT4 A;  4ZNX A;  5KCO A;  3CPW P;  1QVF P;  4FU6 A;  3KUF A;  1UGP B;  2FG0 A;  4IUT A;  4A4F A;  2RB6 A;  3L1A A;  3URG A;  1R0C B;  2EW3 A;  2BZY A;  3TRE A;  1S1N A;  2DL4 A;  4A63 B;  4OMF B;  1VQ4 Q;  4QW2 A;  4E2F B;  2BUD A;  5IHI A;  1BK2 A;  4M77 C;  1YIT A;  1M90 C;  2KRS A;  3L2Z A;  2YXY A;  2DNU A;  2CUB A;  3JB9 D;  4KUI A;  4X9C A;  1UGR B;  2DIG A;  1T0J A;  3FEO A;  2KFV A;  2NUP B;  4F17 A;  4M7A C;  1VQO A;  4F7U F;  2LCS A;  1OPL A;  1D3B A;  1IO6 A;  4J9E A;  2DVE A;  1WJR A;  4JPB W;  4OB2 B;  3HRU A;  1K76 A;  3DKM A;  3SB2 A;  3G4S T;  1SHF A;  4C8Q F;  1M3B A;  2ZZD A;  1BYM A;  3VS4 A;  3HL8 A;  1UGS B;  2DTH A;  2A0F B;  4OP0 A;  2RI5 A;  2M51 A;  5LJ3 e;  1O75 A;  4A53 A;  3I5S A;  3CQT A;  3TQ7 P;  2QEX T;  1SSH A;  1M2V A;  3CC7 A;  4X9D A;  4FT4 A;  4II1 A;  2RA2 A;  1NYF A;  1YNZ A;  3CPW A;  3I55 A;  1ZSZ A;  1Y02 A;  2EBP A;  5HK3 A;  1Y96 B;  1JXM A;  1YHQ T;  3OBY A;  2QYZ A;  5LJ3 j;  2RJC A;  2CP2 A;  5IN1 A;  1H92 A;  2QQA A;  4M78 G;  4A4E A;  1QMC A;  3JCM b;  3QKJ A;  1VQP T;  4MML A;  2MOX A;  4CC2 A;  1JB0 E;  2RJE A;  2JT4 A;  2WSE E;  3CCS Q;  2F5K A;  2YRC A;  2OI3 A;  1U1T A;  4YTL A;  3SHW A;  1CSK A;  2QA4 A;  2RHX A;  4C5I A;  4HT9 A;  2F2X A;  1UB4 A;  5KYU A;  1SRL A;  3CCR Q;  5DY9 A;  4PJO C;  1BI0 A;  4JDS A;  5GAM j;  4L5G A;  4J9I A;  3JB9 G;  2M16 A;  2HL3 A;  5GAN 3;  5I2S A;  1MNE A;  2C0T A;  4C8Q D;  1M8M A;  2DEQ A;  2WAC A;  1PD0 A;  4MMK A;  4PKC C;  2KNB B;  3L2V A;  1WJS A;  2CP0 A;  2GTJ A;  3MET A;  3MP1 A;  5LJ3 g;  4FW2 A;  2M02 A;  2XG8 D;  3CBO A;  4IKF A; 
#chains in the Genus database with same CATH homology
 2P0P A;  2M9U A;  2E70 A;  2QI2 A;  3CCE A;  4M75 G;  2RHI A;  2LT1 A;  3OBW A;  2ZPB B;  4WF2 A;  5L8R E;  3TU4 K;  4BY6 C;  4PJO B;  4M77 F;  3MO8 A;  3CBM A;  4M75 A;  2VC8 A;  4IUP A;  1HK9 A;  5GMK l;  2JUF A;  1YIJ A;  1VQN T;  2RK1 A;  2CZ1 B;  4EMK A;  4RCB A;  1XQH A;  1VQL T;  3OW2 A;  4EDU A;  4C0D B;  3SDZ A;  5FLX E;  2OTJ A;  2L3R A;  1FX7 A;  2B8A A;  4RG2 A;  3CC7 T;  1KHI A;  3E1S A;  4RKU E;  4F7U E;  4JRK A;  4M7A F;  3ZEH A;  3SWN B;  4OF1 A;  4C92 D;  3EAE A;  3I55 T;  4M78 E;  2X4Y A;  3M57 A;  4LD6 A;  5A0G A;  3G6E A;  2E6N A;  5I2M A;  5FRM A;  2LQK A;  2KVQ G;  4C8Q E;  4OB3 B;  1G3Y A;  1KC8 U;  3R6O A;  1VQ6 T;  3CCJ T;  2X4W A;  3C12 A;  3BDU A;  2OTL T;  3NFC A;  1Q86 U;  1M4Z A;  5LJ5 f;  3JCM P;  1Q7Y U;  1BKB A;  5CK9 A;  3MHX A;  4L6V 5;  3J80 E;  2F69 A;  2LRQ A;  2EJF A;  4RMO A;  4A4G A;  2FB7 A;  1Q81 U;  4KUD K;  3FLG A;  3OSS C;  3P8D A;  4M75 D;  3OYH A;  1KQ1 A;  4O5V A;  4EMG A;  1JRI A;  5GAM f;  1V29 B;  2EYQ A;  2PUO B;  3JSC A;  5GMK h;  4BY6 B;  2VXF A;  3E9F A;  2CYZ B;  4C0Z A;  4ATO A;  3GNG A;  1VIE A;  2PUK B;  3CME T;  2QA4 T;  3RKW A;  2X4X A;  3I56 T;  4IUV A;  1H64 1;  1M1K C;  1JJ2 S;  1G3T A;  3FIF A;  4M78 C;  4M77 A;  1BIB A;  2C06 A;  3CCU A;  2E5Q A;  2BKD N;  2DZ9 A;  4C8Q C;  1LOJ A;  4QVD A;  4UC4 A;  2L89 A;  2KAF A;  1VQ9 T;  2LC4 A;  3M5A A;  2GFU A;  2QXF A;  5GAN 7;  3OYN A;  4LD9 K;  3OYA A;  3JB9 H;  4J83 A;  2DD5 A;  3OMG A;  4PLI A;  3CCV A;  2XHC A;  1Q82 C;  4IUQ A;  4C92 E;  1LNX A;  1QVF A;  3L42 A;  1KC8 C;  3JCM f;  4CI0 C;  1Y7X A;  3QSU A;  4MZM A;  3L2U A;  4M7A A;  3A8M B;  3JCM V;  4LDX A;  5GAN j;  2MF2 A;  1Q86 C;  2LNV A;  3T9N A;  1Q7Y C;  4XTY A;  3EFS A;  4PLL A;  1S72 A;  1Q81 C;  5DM7 R;  1AHJ B;  2K5F A;  4XU2 A;  3ZBD A;  2R58 A;  3VKI A;  1M5Q 1;  3MEV A;  1VUB A;  2H3J A;  4M75 E;  3VV0 A;  3A5Z B;  1N8R U;  3BW1 A;  3VU3 C;  3RIR A;  1M8V A;  2FHD A;  4L59 A;  4XTU A;  2EQU A;  2L5Q A;  2RO0 A;  2G3R A;  3ASK A;  2PVG B;  2QTX A;  3EFR A;  1M9S A;  3UWN A;  4M77 D;  3G71 A;  3HRS A;  2K5I A;  2KSS A;  1U1S A;  4F7U B;  2DAQ A;  1ZQ1 A;  1OYX A;  2ZCF B;  5I21 A;  2CZ0 B;  4VUB A;  3CCQ A;  5M9O A;  5CIU A;  1B34 B;  3M53 A;  1P92 A;  5CCA A;  1FWZ A;  4C92 C;  3JCM c;  4PNO A;  4M78 B;  1YJ9 T;  1VQ5 A;  3FJP A;  4A4K A;  4ZTJ A;  3JCM X;  4C8Q B;  2CS7 A;  3VYG A;  1WPY A;  1YIJ T;  4E7J A;  1OZ3 A;  2R5M A;  4M7A D;  2JN0 A;  4ZGD B;  2JTM A;  5DLO A;  3L2W A;  4HCZ A;  4QVC A;  2RD1 A;  1YJN A;  2V8K A;  2OTJ T;  2PVD B;  4FM4 B;  3WVE B;  2RK2 A;  1NJI U;  3NTH A;  2EAY A;  4B9W A;  1YJW A;  2RHU A;  1XTD A;  2GF7 A;  2RM4 A;  2PQW A;  4JRP A;  1MHN A;  2D0Q B;  2VV5 A;  3G6E T;  4M75 C;  5FRN A;  3QZ5 B;  4C5G A;  4C92 G;  3OB9 A;  5LJ3 h;  2HNI A;  2YLB A;  2XIC A;  1RL2 A;  5LL6 S;  4EMK C;  2LDM A;  5GAO q;  3FRN A;  5A2Q E;  4ELY C;  4E7I A;  2MAM A;  4JLI A;  1O9S A;  1KD1 U;  3PMT A;  2NLU A;  4XK8 E;  2RI2 A;  4MZP A;  2BIV A;  2YLC A;  2HBP A;  2VUB A;  1K73 U;  1UEB A;  4QVZ A;  2K3X A;  4C0F A;  2D6F A;  3GIB A;  2CZ7 B;  2XKO C;  3A8G B;  2O4X B;  1M1G A;  1R8O B;  2DKG A;  2QQR A;  4C5H A;  2MMP A;  1JBM A;  2VGN A;  2QQB A;  3FDR A;  2IG0 A;  3LYI A;  3QG1 A;  4DQ2 A;  4C92 B;  4HKE A;  1I81 A;  1VQK A;  2K5L A;  5J3B A;  2RH2 A;  5LJ5 h;  5GAN f;  3L2Q A;  5LJ3 f;  4KUL A;  2JVV A;  1K8A U;  5GAO p;  2CKK A;  2IVW A;  2DXC A;  1NJI C;  1SSF A;  3F70 A;  4BDY A;  3CCU T;  5GAN 6;  4A4H A;  3MP8 A;  1YI2 T;  1PSF A;  3OMC A;  5GAM h;  3LLR A;  4JS4 A;  4LDU A;  5KE3 A;  2R5A A;  3CMA A;  3CCV T;  1ZBX A;  2E41 A;  1VQ8 T;  2GCX A;  3QUI A;  4M75 B;  1KQ2 A;  5KH6 A;  5C0M A;  3ER0 A;  3OYC A;  5GAO m;  3CD6 A;  3OS1 A;  1JJ2 A;  2FYK A;  3PT9 A;  4EMK B;  2XK0 A;  3A8O B;  3MP6 A;  1KHC A;  3QPH A;  4ZN3 A;  3C95 A;  3BFM A;  1KD1 C;  2HD0 A;  5FU6 C;  1OI1 A;  5CKB A;  3LX7 A;  2LCC A;  5GAO r;  5FU7 C;  4ZN1 A;  3P8H A;  1S72 T;  1K73 C;  1UGQ B;  3GF5 A;  1KG1 A;  4XTZ A;  1VQ4 A;  3M58 A;  5HY6 A;  3GNF B;  2F5T X;  1WQW A;  3CXC S;  3OYB A;  3CC4 A;  4ME7 A;  4OGE A;  3JCM h;  4J8O A;  4OVA A;  1VQ8 A;  3PNW C;  3M54 A;  3CCL A;  1D3B B;  2KMT A;  2V8J A;  2A7Y A;  1TH7 A;  1VIF A;  3RKX A;  4IUR A;  3ZFJ A;  1FXX A;  2QQ9 A;  2EJG A;  2LCL A;  3HFO A;  4A54 A;  3G71 T;  2I2L A;  5CR2 A;  3C94 A;  2LX9 A;  5GMK i;  1YCY A;  2YHT A;  3KBG A;  1NZ9 A;  4M77 G;  3CCQ T;  1K8A C;  4RG8 A;  3FC3 A;  3M55 A;  2DXT A;  2WSC E;  3QDR B;  3QYH B;  3LW5 E;  1VQ5 T;  4NOY A;  3OYK A;  2X35 A;  4QQ6 A;  4C0G A;  1NE8 A;  2LTO A;  3M9Q A;  3S3N A;  4J7I A;  3JB9 J;  2EKO A;  4J6W A;  4BI8 B;  2ZGW A;  2KY9 A;  1YJN T;  4M7A G;  2EQM A;  3PIP A;  3OYE A;  4TVR A;  5C6S A;  1X01 A;  1YJW T;  1XNI A;  2QQS A;  2XD0 A;  4XU3 A;  1N9S A;  2MI6 A;  3X28 B;  2CGH A;  2JOY A;  1W2B S;  2R57 A;  3OA6 A;  1Y96 A;  2RJD A;  5FU6 B;  2DJZ A;  4J5Y A;  1VQ7 A;  3FB9 A;  4M7D F;  5CKE A;  4O6J A;  3X20 B;  5IT9 E;  3QII A;  5FU7 B;  4E7H A;  4X34 A;  3OY9 A;  3VJP A;  4CRI A;  1K9M U;  3J81 E;  4HT8 A;  2RHY A;  3OS5 A;  5GAN 5;  4P5N A;  4DOV A;  3S3O A;  2RI3 A;  4E47 A;  5KE2 A;  3UDC A;  3JB9 F;  4EMH A;  5CKH A;  2E1H A;  4BB7 A;  1U8R A;  4BAC A;  3M4Y A;  2CZ6 B;  4N4G A;  5A0D A;  4JJN K;  3CCM A;  2YRV A;  5D6X A;  4HA8 A;  4PJO F;  3OYD A;  3CCJ A;  3HKS A;  3CCE T;  4JUV A;  1VQ6 A;  3BY7 A;  3VUB A;  4B9X A;  4DOW A;  5LJ5 e;  2MWO A;  2XID A;  2ZPI B;  4J7F A;  5CQY A;  4QQD A;  3G4S A;  2OTL A;  4N4H A;  1MGQ A;  3RMS A;  1VQK T;  2P4T A;  3HHT B;  4LDV A;  5LJ5 d;  1QVG S;  5J39 A;  3Q1J A;  1QW1 A;  1NPP A;  2Y4X A;  1PSE A;  2A3L A;  4FT2 A;  2DZC A;  4GLK A;  3OSV A;  4N0A A;  5GAM e;  3UPU A;  3S3M A;  2K3Y A;  1KQS S;  4D6W A;  3JCM Q;  3HSB A;  3KXT A;  4R56 A;  3PGG A;  5CKF A;  3L2R A;  1ZHI A;  4LDY A;  4ZTF A;  2L8D A;  3CME A;  3CMA T;  3CPW S;  4R55 A;  4JRQ A;  4OGC A;  2AHJ B;  3MEW A;  4JLG A;  3TEE A;  1N6A A;  3CCS A;  1LJO A;  3OYF A;  2QDY B;  3PFS A;  3V7R A;  3PMI A;  5CKD A;  5KCH A;  5LJ5 j;  5GAN h;  3PIO A;  2M0O A;  3CD6 T;  2K4Y A;  2QEX A;  1VQM A;  3C4S A;  3M56 A;  3G7Z A;  2XDB A;  2Y90 A;  3E9G A;  1N8R C;  2M1H A;  3AHU A;  5CQX A;  2VYT A;  3SD4 A;  4M7D A;  5GMK m;  3CCR A;  2JNG A;  3A8L B;  1M90 U;  1G5V A;  1QP2 A;  3JCM e;  3OYL A;  1VQ4 T;  1N9R A;  4ELZ C;  4E7L A;  3LGL A;  4BI4 A;  3O8V A;  5GMK e;  4ZGJ B;  4M77 E;  3JCM d;  3PTA A;  2LVM A;  3JB9 I;  3HP9 A;  3S6W A;  2D9T A;  3CCL T;  1YHQ A;  2XU8 A;  3J7A F;  4MDX A;  1G3W A;  2VXE A;  3E19 A;  3HFN A;  2LT4 A;  3GOX A;  2P0Q A;  5KCO A;  1EIF A;  2GQV A;  4JRI A;  4BE2 A;  3DLM A;  1G3S A;  1W4S A;  4EPC A;  2WSF E;  5GAN 2;  4JS5 A;  4LDW A;  4PJO A;  2Y4Y A;  1VQP A;  4FU6 A;  3CC2 A;  3KUF A;  3P8B B;  1M1F A;  1UGP B;  3INZ A;  4IUT A;  3CXC A;  4M7A E;  3RMQ A;  4A4F A;  5D6W A;  2RB6 A;  2X4J A;  3L1A A;  3QXE B;  1Y71 A;  3URG A;  2PU9 B;  4FL6 A;  5GMK j;  2DO3 A;  3TRE A;  3SWN A;  4M7D D;  1BIA A;  4OMF B;  1WGS A;  3JCM W;  1YJ9 A;  4QW2 A;  2EQK A;  3QZ9 B;  3M59 A;  2KQW A;  2E12 A;  2BUD A;  1YIT A;  2ZPF B;  4M77 C;  4XAX B;  5GAN 8;  2VGM A;  1M90 C;  1VQ7 T;  1GXI E;  3L2Z A;  4XU0 A;  3OYG A;  2ZPH B;  3CEY A;  3QBY A;  4NS5 A;  1M1K U;  2FL7 A;  3JB9 D;  4MZT A;  4KUI A;  4X9C A;  4HCC A;  3OS0 A;  5LJ5 g;  2EJ9 A;  3CBP A;  1UGR B;  2DIG A;  3QHS A;  3X25 B;  3QJY A;  3H8Z A;  3FEO A;  1W2B A;  3JAM E;  4E7K A;  3CPF A;  4PJO D;  3VYH B;  1VQO A;  4M7A C;  1Q82 U;  1QP3 A;  3H6Z A;  4QQG A;  4F7U F;  5GAM g;  1D3B A;  2DVE A;  1WJR A;  2JZ2 A;  4OB2 B;  1I5L A;  2E65 A;  2EQJ A;  3HRU A;  3CCM T;  4V2S A;  3DKM A;  4M78 F;  3SB2 A;  3NTK A;  2PVO B;  4NL3 A;  3G4S T;  4C8Q F;  2KK4 A;  2ZZD A;  1BYM A;  3RKY A;  4BE1 A;  3HL8 A;  5HK0 A;  1UGS B;  2ZPE B;  3WXM B;  2V8I A;  3HPW A;  3GP8 A;  1YBY A;  2RJF A;  3JCM J;  2DTH A;  4BD3 A;  4BUG A;  1OZ2 A;  3OW2 S;  2EFI A;  2JTF A;  4Z02 A;  3V7C A;  3UT1 A;  1I8F A;  5GAO l;  5D6Y A;  3LWI A;  3LH0 A;  4OP0 A;  2EWN A;  5DLQ E;  4M7D E;  4DA4 A;  3MEA A;  3JRZ A;  2XDD A;  4HCB A;  4BE0 A;  5FRO A;  5GAN e;  3CC4 T;  3JCM g;  2RI5 A;  5LJ3 e;  4ZGE B;  3WVD B;  1O75 A;  4A53 A;  1QVG A;  3CC2 T;  3CCS T;  3ME9 A;  4M77 B;  1VQN A;  3RER A;  3A8H B;  5GAN d;  1VQL A;  2FVU A;  3QO3 A;  3RUX A;  5LJ3 d;  4PL6 A;  4GY5 A;  4KBM B;  1KQS A;  5IAY A;  2QEX T;  4XTW A;  1VQM T;  4N0A C;  3CC7 A;  1YI2 A;  4X9D A;  4BDZ A;  4FT4 A;  4II1 A;  2E10 A;  2RA2 A;  3CCR T;  2HAX A;  3LGF A;  4PJO E;  1H3Z A;  3CPW A;  1N27 A;  1IRE B;  2LQ8 A;  3N5B B;  3OQ5 A;  1X75 C;  4M7A B;  3I55 A;  3HRT A;  5HK3 A;  1Y96 B;  1X6O A;  4OB0 B;  1YHQ T;  1WJQ A;  3OBY A;  3VUZ A;  4F7U G;  1BI3 A;  4XU1 A;  4XTV A;  2P0K A;  4C92 F;  1DJ7 B;  2E64 A;  2DIQ A;  3SFM A;  3V8K A;  2RJC A;  3MCA B;  5IN1 A;  3X26 B;  5LJ3 j;  2QQA A;  3V8J A;  3DB3 A;  4F7U A;  4M78 G;  1WQ7 A;  3DB4 A;  3V7S A;  4A4E A;  4C8Q G;  1B34 A;  3JCM b;  2GFA A;  3QKJ A;  2K57 A;  4M7D C;  5GAO n;  2MWP A;  3OYI A;  1VQP T;  4M78 A;  3GPL A;  2HQX A;  5GAN 4;  4MML A;  4Y91 A;  4C8Q A;  1JB0 E;  3TCJ A;  2RJE A;  4C5E A;  2WSE E;  2DTI A;  5CAI A;  1BI1 A;  2F5K A;  4N4I A;  4Y28 E;  5GAM d;  4J6X A;  4FSX A;  3M4G A;  4M75 F;  1U1T A;  2HQE A;  4YTL A;  1I4K 1;  5A0L A;  2QA4 A;  4NL2 A;  2RHX A;  4C5I A;  2XDP A;  3OYM A;  4FIB A;  3I56 A;  1QVF S;  4HT9 A;  2DXU A;  2E6Z A;  3QYG B;  1UB4 A;  3GLX A;  3RES A;  2DD4 A;  1K9M C;  5DY9 A;  1Y07 A;  2OAU A;  5J26 A;  4PJO C;  4M7D G;  1BI0 A;  4OB1 B;  5HKC A;  1NPR A;  4JDS A;  4J6Y A;  1YIT T;  1VQ9 A;  1QVP A;  2ZPG B;  3QJ6 A;  4C0D C;  5GAM j;  4L5G A;  3LWH A;  5CVI A;  3NTI A;  4IUU A;  2M16 A;  3OS2 A;  3JB9 G;  5GAN 3;  1HXD A;  5I2S A;  3OYJ A;  3SWN C;  4XTX A;  4M78 D;  3X24 B;  1VQO T;  2DPP B;  2DTO A;  2O4X A;  3BDL A;  4PJO G;  4C8Q D;  2DEQ A;  1RI0 A;  2WAC A;  4MMK A;  1WNL A;  2RHZ A;  4PKC C;  3L2V A;  3DLL A;  2DK3 A;  1WJS A;  3OYY A;  4M7D B;  3MET A;  4C92 A;  5CO7 A;  3V8L A;  2O01 E;  1XOV A;  1BI2 A;  3MP1 A;  4XQ3 A;  2K2V A;  2XI9 A;  4RCC A;  4MDW A;  5GAN g;  2EIF A;  5LJ3 g;  3MEU A;  4BI3 A;  4Q5W A;  2DXB A;  4KT0 E;  2XG8 D;  3CBO A;  5AYF A;  1IZ6 A;  2KDS A;  4IKF A;  5EG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...