3FLGA

The pwwp domain of human dna (cytosine-5-)-methyltransferase 3 beta
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
135
structure length
135
Chain Sequence
EYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the PWWP domain of Human DNA (cytosine-5-)-methyltransferase 3 beta
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DNA (cytosine-5)-methyltransferase 3B
total genus 33
structure length 135
sequence length 135
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.50 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 PWWP, helical domain 3flgA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3flgA01
2E5QA 2DAQA 3S6WA 4II1A 5FRNA 2K3XA 5J39A 1WJRA 4PLIA 4B9WA 2P0KA 3ASKA 3UWNA 2X4YA 2RHZA 3OYGA 4IURA 4BE2A 3M9QA 2EKOA 2RI5A 3LLRA 1OI1A 2RHUA 3EAEA 3ZEHA 4B9XA 3OS1A 4E7HA 3S3MA 4IUQA 2LCCA 2X4XA 3MEVA 2LDMA 2LTOA 3NTIA 5D6WA 3OY9A 3SD4A 2RJDA 2JZ2A 2RJEA 4UC4A 2X4WA 3MEAA 2HQXA 1MHNA 2EFIA 3LX7A 5FROA 3NTKA 4IUUA 2IG0A 4IUVA 3MP8A 3OYIA 3QKJA 4BD3A 3ME9A 3L2RA 2E6NA 4N4GA 2O4XB 5IN1A 2RHYA 3NTHA 4A4EA 3OYEA 3BDLA 4ZTJA 4QQ6A 3PMIA 2VYTA 2EQJA 2R5AA 3S3OA 3H6ZA 4BE1A 1KHCA 5KCHA 5KCOA 4PL6A 2R5MA 3OYAA 3OYKA 4L59A 3OA6A 2RI2A 4BACA 2RJFA 2M16A 2F5KA 1WJQA 3OYFA 3PFSA 2RHIA 4N4HA 2EQMA 5CIUA 3LH0A 3OQ5A 3QBYA 2MWOA 3F70A 3PNWC 3OYMA 3OYCA 2MWPA 4HCZA 2PQWA 4BE0A 3H8ZA 4C5EA 4IUTA 4PLLA 3MP1A 3CEYA 2LVMA 3LGFA 4E7JA 3FDRA 4X34A 3OB9A 4E7KA 2M0OA 3FC3A 3DLMA 3Q1JA 3LYIA 3MO8A 2D9TA 5J26A 2QQRA 2WACA 3O8VA 2EQUA 3C4SA 2CKKA 4QQGA 5KH6A 5IAYA 3MP6A 1N27A 2YRVA 2FHDA 4LD6A 1WGSA 1SSFA 2BIVA 4QVZA 4A4FA 3L2VA 4ZTFA 2DIGA 3E9GA 4Q5WA 3QJ6A 2X35A 2K3YA 2XDPA 4FU6A 1WJSA 3DB3A 2M1HA 3OYBA 2JTFA 3L42A 3L2QA 1H3ZA 2LRQA 1XNIA 2NLUA 4QQDA 4N4IA 2RJCA 4QW2A 4C5IA 2GFUA 2RI3A 2L3RA 3PMTA 4CRIA 3L2UA 2HQEA 4E7IA 2RHXA 3OYJA 3OMGA 4FL6A 3MEUA 2R58A 2L8DA 3QIIA 1G5VA 4A4HA 4C5GA 3OMCA 1OZ3A 4GY5A 2GF7A 4RG2A 4EDUA 4BDZA 2G3RA 2QQSA 2R57A 3DB4A 3LGLA 4IUPA 4A4GA 4BDYA 3GOXA 3OYNA 4OVAA 5C6SA 4E7LA 3L2WA 2XK0A 2DIQA 2O4XA 2L89A 3S3NA 1OZ2A 3OS2A 2EQKA 2BUDA 4C5HA 2BKDN 5C0MA 2B8AA 3OYDA 5D6XA 3P8DA 5D6YA 1RI0A 3E9FA 3FEOA 3UT1A 3MEWA 1OYXA 3OYLA 2RO0A 4NS5A 2GFAA 5M9OA 3KUFA 4IKFA 4Z02A 5FRMA 3OS0A 3P8HA 3FLGA 3META 3OYHA 5KE3A 5KE2A
chains in the Genus database with same CATH superfamily
1WHLA 2E5QA 4M77D 4C92E 4KT0E 1G3WA 2DXCA 2P84A 1YNSA 2EIFA 3GIBA 3EHRA 2ENMA 2LTOA 2XIDA 4C0ZA 2RH2A 3UDCA 3VRZA 3OYIA 4C8QD 1X2QA 2E6NA 2COYA 2O2OA 3NTHA 4BY6C 4QKUA 1VQNT 2D8HA 2XI9A 1NBEB 5LJ5h 1M1FA 3HRTA 3G7ZA 2CDTA 1VQPA 1WA7A 1D0YA 3ULRB 2KSSA 1NE8A 1PRMC 2KVQG 3CCVQ 4N4HA 1U8RA 4C8QG 2CUDA 4MZMA 2KFVA 1BYMA 4PLLA 1Q95G 3H41A 1JEIA 2KNBB 3CCRQ 3CBPA 5CKHA 5EG2A 1MV3A 1IO6A 1YJWT 3DKMA 4M78C 2JNGA 3GNGA 2X3XD 3CCMQ 2MI6A 4C0DC 3RESA 1U3OA 5GAMg 2CZ0B 1FMWA 3OYBA 4D6WA 2EW3A 1GBRA 1E6HA 1RLPC 1N6AA 4ZNXA 1WYXA 1VQOT 2WSFE 2DILA 2PU9B 1NZ9A 5LJ5f 1JB0E 2ED1A 3QXEB 1T0JA 2KT8A 5CKDA 4L5GA 5GAN4 2J05A 1LCKA 2EQKA 5A2QE 3UT1A 2ZPIB 5KYXB 2EGCA 1K73C 1X2KA 1UFFA 1VQPQ 3GBQA 2RB6A 1AWXA 3OS0A 3FLGA 4JJCA 4M7DA 2HJQA 3S6WA 2PZ1A 4C0FA 4PLIA 2VWFA 1PRLC 3PTAA 2JTMA 4CC3A 3OBWA 1H3HA 4IUQA 4XTZA 2X4XA 3CMAQ 1I5OB 2CH4W 5FU6C 3UA7A 3EGDB 3CXCA 2SEMA 1Z9QA 4E7ZA 1PKSA 1XJWB 5GAOq 3H0FA 3FJ5A 2OTLT 4Z8AA 5IN1A 2DERA 1OEBA 5GAN2 3VYGA 4M7DC 1AWWA 3H6ZA 3OS5A 4KGZB 4BI3A 3X28B 1GKUB 2O9VA 2EYWA 1SG5A 3ER0A 1C0MA 3WVEB 5KYUA 4AFSC 2DX1A 2A3LA 1M9SA 2DL4A 2PQWA 3R6NA 1BI2A 4CC4B 2A0FB 3J7AF 1ZSZB 3JCMf 3CCST 2MF2A 2RMOA 2DTHA 3CCLA 1K0XA 1UGSB 2CKKA 2J7IA 4Z88A 5IAYA 4FM4B 4M78E 3JCMb 5AYFA 3EGUA 3X20B 4ATOA 4RMOA 5CAIA 4OMLA 1B07A 1NM7A 1M90C 2M1HA 3CC2Q 2HNIA 1Y96B 1CKBA 3EFOB 4C5IA 3REAB 2CP6A 2LX7A 3H9NA 2RM4A 2OTJQ 3G71T 5IH2A 3MHXA 4J9DA 5J3BA 3BDUA 5GJWB 1KD1R 4OB1B 1SKUB 4C5HA 2DNUA 2CT4A 1N5ZA 4HCKA 1ZUYA 5D6YA 3M55A 4JZ3A 5FU7C 3CC4T 5M9OA 2EVRA 2EAYA 3BE3A 4XTVA 5KE3A 2D6FA 2RQTA 1M1KC 3ASKA 2X4YA 3QDFA 3VKIA 2DFUA 2F5TX 5KYYB 3D7SB 4LD9K 3OY9A 3SD4A 4QVCA 1JBMA 5A0GA 3CCLQ 5GANg 3BY7A 3QKJA 1XQHA 4BD3A 1QWEA 1X43A 1BCMA 4E47A 4PJMA 5FW9A 3OYEA 1EIFA 4DA4A 2YRCA 3JB9G 1RAHB 1M90U 1FX7A 3LWIA 1LJOA 1F1BB 1VUBA 4KGXB 5LL6S 1I07A 1QVFA 3QWXX 2E64A 2CZ7B 2ODCI 5GAN8 1N9SA 1OU8A 4PFZA 1VQMA 2KVDA 3SEMA 1W4SA 5GAN7 2K79A 3A5ZB 3OB9A 5GMKe 3FJPA 2E10A 2KQWA 2DXUA 2CP7A 2EQUA 3EH1A 2JUFA 4C92C 1RLQC 2ZGWA 4LN2A 4J9EA 4FT4A 4D8KA 4AMCA 4HXJA 2DZCA 2KEAA 4L6V5 3HFNA 3JCMV 1KQSS 2EJFA 5LJ3f 2DD5A 4X9CA 2FYKA 2R58A 5IHNA 2LQWA 2AKKA 4V2SA 2DYBA 3OMCA 2GF7A 1Y7XA 3CCVT 1VQ7A 2DXBA 3I56A 3GPLA 3RBBB 2LC3A 4F16A 1RABB 3I56T 1RAEB 2HSEB 2A8VA 5IT9E 1K9MR 4J83A 3CCEA 2X9HA 4M7DF 2DVJA 1VYTA 1U1SA 1G3YA 5GAMf 2QG9B 4NOYA 2LQKA 4EMGA 3GNFB 1K9MU 1K1ZA 2KW9A 2EGEA 5KYYA 5HK3A 2DRKA 1PHTA 3R6OA 1Z9ZA 4E7HA 1OI1A 3ZEHA 3VS6A 3GLXA 1U1TA 1VYUA 1X6BA 1D1CA 3NTIA 4UZWA 2VKNA 2ECZA 1NPRA 2KAFA 3LX7A 4KUDK 1VQLT 4N4GA 1ZBJA 4M78A 2DXTA 2FPDA 4JZ4A 1N8RC 2XG8D 4KGVB 3JB9F 4M7AA 4M75B 4C92F 2XKOC 4FSXA 1SRMA 2FVUA 2MOXA 3HRUA 2CZ1B 4IIMA 1C6VX 4J5YA 2YUNA 3NFCA 5LJ5j 3CCJQ 1QVFP 3MJXA 3JCMe 2KVEA 4QVDA 2WACA 1VQ5Q 1V76A 3MP6A 1GCQC 1LNXA 2V8IA 4DEYA 2ROTA 4LDYA 3L42A 4J7FA 4QQDA 3V7SA 3KXTA 4HCBA 1ZA1B 4E7IA 1YNZA 1Q86R 1B7TA 1AT1B 4JRPA 5GMKm 2RA2A 2XDBA 1QWFA 1WQ7A 1V66A 4C5GA 1G3TA 1T0HA 2F2WA 1VQKA 4BDYA 1JJ2S 1WDXA 2O4XA 3JAME 4M7DE 2P0PA 4OB3B 4AG2C 2V8JA 3RKWA 2DK4A 1Q86C 1GL9B 2F2XA 1YHQT 4NS5A 1VQNQ 4C92B 4LUEA 1OPKA 2YLCA 1NG2A 1WHHA 3META 3UWNA 1D1BA 1MMAA 1RL2A 1KC8R 2KR3A 3CD6Q 1ZLMA 2OTLA 2EKHA 3EAEA 2KE9A 2RHUA 1S1NA 1ZUKA 1KQSP 1BBZA 1QQJA 3S3MA 1TOVA 2RQWA 2LT1A 2FB7A 2RQRA 4OF1A 4NL3A 4OMMA 2O88A 2HMAA 4UC4A 2QDYB 1FXXA 3I55Q 2IG0A 3CCQA 4Z89A 2JN0A 3EG2A 5KYXA 1LVKA 1ACMB 3E19A 2KDSA 2VYTA 2EQJA 1AWOA 1VQ6Q 5LJ3e 1H641 4PL6A 2HD0A 3I5RA 4A54A 1A63A 1QVGS 1AVZC 2VASA 5CIUA 2GTJA 4E7KA 3PGGA 4M75D 1JJ2P 4XK8E 1UB4A 1VQKQ 3FIFA 3MP1A 2GGRA 4FYYB 1BCOA 4AFQC 5CR2A 2A36A 2VGMA 3A8GB 1MMGA 4C8QC 2QEXQ 4M78G 1ZBXA 4YTLA 1W2BP 4F7UE 2YUQA 2VB6A 4M75F 4QVZA 3L2VA 1JEGA 1VQNA 2C0TA 2PNIA 3CPFA 5GMKh 3NPFA 1H92A 5GANj 3SWNB 3CD6A 2RI3A 4PJOE 1YI2T 1G83A 1QVFS 4O6JA 3CCJT 3CCRA 1OQKA 2KRNA 3M53A 4A4GA 2I0NA 2OX7A 4E7LA 3CCQQ 3QHSA 1QCNA 2BZ8A 3JCMP 4CC7A 1VQ4A 4Y92A 5C0MA 5DLOA 1V1CA 1NEGA 2KBTA 2W0ZA 2G80A 3EGXA 2MIOA 4FYWB 4Z02A 4TVRA 1S72T 1BB9A 1MMNA 5KE2A 2E6ZA 1FMVA 3OYGA 2GCXA 3OS1A 4XQ3A 4B6MA 4PJOB 3EGXB 2RJDA 1WPYA 2KYBA 2DEUA 3NTKA 4OB0B 3ME9A 1WZOA 3CQTA 2QAZA 2A28A 3BDLA 4JJDA 3PMIA 4PJLA 2FZCB 4KULA 3JB9J 2R5MA 4L59A 2DA9A 2MMPA 1U5SA 2QQBA 1N8RR 1CKAA 3CMET 4M77G 3OYCA 2VV5A 1D0ZA 4BE0A 2GTOA 2HZYA 1C1AA 2L3PA 3LGFA 2GQVA 5GAMh 2HDAA 1UUEA 2M02A 1VQ4Q 2K9GA 4JRIA 4JRKA 1R8OB 2D9TA 3QWYA 5J26A 5I11A 2RNNA 1VYVA 2K5LA 9ATCB 4FW2A 1J3TA 4Q5WA 4C8QB 1VQ8A 4X9DA 2JTFA 2ED0A 1NLPC 2J6FA 2LJ1A 1T3LA 3J81E 3AHUA 1KSWA 3MEUA 7AT1B 3TEEA 3I55T 1GJJA 2BZYA 2PTKA 2DJZA 3M0TA 1AEYA 1BU1A 3LGLA 1YHQA 4LUDA 3NMZC 4E7SA 2JW4A 5FWBA 3UA6A 3JB9I 2DL3A 3FRNA 1K9AA 1YITA 2DTIA 2CUBA 2HEQA 4GLKA 2COWA 1IRXA 2DLPA 3VUBA 3CC2A 1YFNA 4DOWA 3RKXA 5CKFA 3CCET 4ZGDB 3M58A 3JCMd 1ZUUA 1Q7YU 4MMKA 2W51A 2P4RA 3O5ZA 3HFOA 4Y28E 2XDDA 3CMAT 4HCCA 4C92A 2LCCA 2YWWA 1YJ9T 3OSSC 1W2BA 3REBB 2DF6A 3C0CA 1YJNA 4ZN1A 4PJOA 1I8FA 2O4XB 2RHYA 4AFZC 3GP8A 2E65A 4M75C 1YIJQ 1VQ8Q 3RR6A 2KMTA 2YUPA 1ABQA 4ZGJB 3G4SQ 1P92A 2HCKA 1VA7A 3OYAA 3OA6A 3EG3A 1QVGP 4XTXA 2KYMA 2CGHA 5L8RE 5GANh 1I4K1 2DRMA 3PNWC 5GMKj 5KYWA 4HCZA 3TVTA 2EYQA 5LJ3d 1WNLA 3EFSA 1PCXA 1YHQQ 2FRYA 4PJJA 2WSEE 3JCMc 3FC3A 5CKEA 2Z0WA 4C92D 1TUDA 4QQGA 2J6KA 3CC2T 1WGSA 1PD0A 1K4US 1A62A 1IREB 2AK5A 2CT3A 4FYXB 3PT9A 3URGA 4FU6A 4ELYC 4A63B 1BIAA 2EQIA 1ZBHA 1D1AA 2JXBA 5CK9A 4OMPA 3SWNA 1D3BA 2DL7A 2DPPB 1VQMQ 2AT1B 3CBOA 4LDWA 1T3SA 1OU9A 2LQNA 1D0XA 1H1JS 3VYHB 1NJIC 2VXFA 2EBPA 2DK3A 3T9NA 4R0KA 2DL8A 2ZPGB 2SRCA 3PVQA 4EMKB 2LT4A 2EYYA 1IZ6A 1N8RU 1M30A 3QSUA 3CC4A 3BFMA 2NUZA 2CSIA 3JSCA 1SF9A 4NL2A 1FMKA 2DAQA 2QA4A 3OSVA 2P0KA 1VQ7Q 2RHZA 2P0QA 3I56Q 1IGQA 4XAXB 3INZA 3TSZA 1AZGB 2DEQA 4EPCA 1RAIB 1S72A 1YBYA 2HQXA 1MHNA 3M0PA 3CCEQ 5KYNA 4FW1A 2E70A 3JCMW 2JTEA 2JS2A 4AFUC 2YXYA 4VUBA 3HP9A 1AD5A 1UG1A 2OAUA 4BE1A 4J6WA 4MZTA 4AT1B 5KCOA 3OYKA 3CBMA 3G1JA 1HSQA 1QKXA 4F04B 1MUZA 2DL5A 3N5BB 4EMHA 1YCSB 2D8JA 3OYMA 3M0UA 4LDXA 3VUZA 3H8ZA 2FO0A 3A98A 5GAOp 1E7LA 1QVGA 3V8KA 3JB9D 2C0OA 2MAMA 5CKBA 3EG0A 8ATCB 2DIGA 4F7UA 3QJ6A 2E12A 2BZXA 1TU0B 2K3YA 4N0AA 4WF2A 3ZL7C 1W2BS 1TS9A 3RERA 2RJCA 4HVVA 2FZKB 2RF0A 2RHXA 1X75C 1R0CB 4M77A 2AKLA 4J9FA 3CCLT 2EYXA 1UJYA 3PIPA 3CCJA 1VIEA 2LP5A 2ZCFB 4RG2A 3DB4A 2OI3A 1VQ5A 1YI2A 3M0QA 2KRMA 2LMJA 2B8AA 1M1KU 3VV0A 3FB9A 2P4TA 1MV0B 3EG1A 4R55A 4M75A 4KRTA 1HXDA 4PNOA 2EJ9A 1JU5C 4A4KA 2JMCA 1WJRA 3A8LB 4IURA 1VQ9T 1B34A 2IIMA 3QZ9B 2X51A 4M78B 3JCMQ 4DBHA 4OMNA 2JZ2A 1E7OA 1GCPA 2LCSA 1B34B 3VS0A 1Y57A 4IUUA 1SHGA 1UGRB 3RMQA 5GAN6 3M4GA 1X69A 2A7YA 1UGQB 3I9QA 3CCUT 3MCAB 1Y02A 4J9BA 4BI8B 1Q82R 1M2OA 3A8OB 1W6XA 3PFSA 1MNEA 3LH0A 1Y96A 2CP2A 5LJ5d 2QTXA 2YRDA 3LWHA 2DKGA 2DO3A 1ZSZC 2K57A 2MPXC 1XTDA 1YI2Q 1M1GA 3UPUA 4E7JA 4HVWA 1M8MA 3CC7A 2AIRB 5DM7R 1R0BG 1VQ6A 2NYSA 1WX6A 3M0SA 1N27A 4ZTFA 5IXFA 1PNJA 1LPLA 2FRWA 2FZGB 3QUIA 1BI0A 4F7UB 2XD0A 2NLUA 1RAFB 2GFUA 4CRIA 4XTWA 5FLXE 3QIIA 1G5VA 1BI1A 4A4HA 3U23A 3OBYA 4IUPA 2QEXA 3JCMJ 3HSBA 1QP2A 4OVAA 5C6SA 3L2WA 2O9SA 2CYZB 1QCFA 2GQIA 4FSSA 3CMEQ 3TU4K 1UTIA 2PUOB 2V1RA 1NEBA 1WFWA 3TREA 2ZPEB 4BITA 2K2MA 4ANJA 5J39A 1RACB 3OYYA 1KQSA 2QDLA 4LDUA 1A0NB 1R77A 3ZBDA 2QA4T 2H3JA 3HRSA 3VS3A 4F14A 3M4YA 4KUIA 1VQMT 2QI2A 2QASA 3MPUB 5EC7A 4QQ6A 4QT7A 2ROLA 1KHCA 2F2VA 2BTTA 4HT9A 5HKCA 1G2BA 1KFZA 1SEMA 5GANd 1UGPB 1XOVA 2MWPA 1YCYA 1JXMA 2ESWA 4XU0A 1JJ2A 3WVDB 2F1LA 3CEYA 3FDRA 4M77E 4EIKA 2VC8A 2M0OA 4PK4A 3DLMA 4RCBA 3ZFJA 3C4SA 1D3BB 5KH6A 3C95A 2BIVA 4J9CA 4BB7A 3DB3A 1SHFA 2LJ0A 3EFOA 4OGCA 4M7AG 1VQLA 2HBWA 1FYNA 4FL6A 2IPOB 1M3AA 2XHCA 1EX4A 2V1QA 5CQXA 2JM8A 4EDUA 1NYFA 2VXEA 4C8QF 2XU8A 3S3NA 2L5QA 3QPHA 4J9IA 3JCMg 2JVVA 1E7DA 1ZX6A 1KC8U 4OP0A 3X24B 1RI0A 4M7AD 1K8AR 3OYLA 2ABLA 3KUFA 2KGTA 5KYUB 2DBMA 1QKWA 5D7UA 5FRNA 2QGGA 4B9WA 2DZ9A 1UECA 3LLRA 3V7RA 2RNAA 1NPPA 3JRZA 2KVUA 2DBKA 3MEVA 1VQ7T 2PVDB 2KT1A 2AZSA 1YITQ 4PJOD 2X4WA 1X6OA 3MEAA 3P8BB 3JV3A 4PKCC 1VQPT 1SPKA 1NYGA 2LD7A 1YWOA 4KBMB 4C92G 3QDRB 2ZPHB 1VQOQ 3JCMX 5KCHA 2GBQA 1Y0MA 4M7DB 4BACA 1YN8A 3OW2S 2MYSA 1YJWA 1O9SA 1YJ9A 3CC7T 3F70A 5GAOm 4MDXA 2CP3A 2KY9A 5LJ5g 4C5EA 3M57A 4IUTA 1HK9A 5GAN3 1YJNQ 1M2VA 2LVMA 1H9FA 2C0IA 4MMLA 5FU6B 5GAOr 1YIJA 5AT1B 3MO8A 1ZQ1A 3RUXA 1Q82U 5GAOl 1W70A 1AOJA 3G4SA 3A8MB 2LQ8A 4JUVA 2FHDA 4DOVA 2K4YA 3QYHB 3NGPA 5GAMe 2EJGA 1O75A 4C8QA 3L2QA 1XNIA 1SRLA 1M2VB 2L3RA 3G6EA 4HKEA 1OULA 1RADB 5ECAA 2Y4YA 4C8QE 1VQ6T 1UGVA 3A1PA 1MMDA 3CCSQ 3JCMh 3CXCS 4LXCA 4A53A 3BW1A 2G3RA 5CCAA 2CP0A 1KD1C 2JT4A 2QK0A 5LJ3j 3OYNA 3TQ7P 3RIRA 1OZ2A 3E2UA 2QQ9A 2BUDA 4GLMA 1X01A 1QW1A 3OYDA 2EWNA 3C94A 5D6XA 4CC2A 3VS5A 1VQOA 1OV3A 3E9FA 3FEOA 4J8OA 4M75E 3I35A 2GFAA 2F69A 2ODGC 2YT6A 4RTUA 1PSEA 4MZPA 1RAAB 3M5AA 1YJ9Q 2K3XA 4CI0C 1GL5A 3HPWA 1TXQA 4BE2A 4M78D 3G6ET 1PC0A 4RUGA 1UHCA 3G71A 2L3SA 3JB9H 1HYOA 2W10A 3CPWP 2EFIA 3CC4Q 2RN8A 3L2RA 2X3WD 1WHJA 4XU1A 2V26A 5GJVB 2VGNA 2QA4Q 2X4JA 4XTUA 3G6EQ 3HL8A 2OTJT 2F5KA 1WJQA 5GAN5 2RHIA 2L3QA 2XMFA 3CCSA 3QBYA 1TUCA 3KBGA 1S72Q 2CREA 2KXDA 1JJRA 1V29B 2CS7A 2O01E 1YJNT 4FIBA 3CD6T 4LDVA 4RTZA 1Q7YC 4N0AC 2HL3A 2IVWA 2OAWA 4FYVB 3LW5E 4JS5A 2D1XA 2D0NA 4F17A 1ZSGA 2CZ6B 4JLGA 1K76A 1K8AU 1M4ZA 3M54A 4OB2B 3SWNC 2KK4A 4OGEA 1TG0A 3THKA 2BE9B 1OX8A 2XDPA 4WCIA 4E6RA 2HKNA 4N4IA 3EG9B 4M4ZA 5IHIA 3SDZA 4JJBA 2L8DA 4GBQA 1KQ1A 2E5KA 5A0DA 4BDZA 2QQSA 2A08A 2R57A 2FG0A 2RPNA 1K9MC 2XK0A 5L23A 1N9RA 1Y71A 2H8HA 1WHKA 1WLPB 2NUPB 1Y07A 4OMQA 5I22A 1JRIA 1CSKA 2E1HA 4JJNK 3QG1A 2WSCE 3A8HB 1OYXA 4ELZC 2K6DA 3CCUQ 4E2FB 3CXCP 2J6OA 3P8HA 5I2SA 2QNFA 4II1A 2PVOB 1UEBA 3RNJA 4M77C 1IXDA 3QJYA 3VU3C 3CCVA 6AT1B 1KQ2A 4J9GA 5LJ3g 1M3CA 5GANe 2V8KA 4MDWA 5A0LA 5FROA 4IUVA 2ZZDA 3I5SA 2JOYA 2M9UA 1RUWA 1KC8C 4J6YA 1D09B 4ZTJA 1DJ7B 2CP5A 3QYGB 3S3OA 2QXFA 2LJ3A 2O31A 2D0QB 1QMCA 2A37A 2NUTA 3PVLA 2RJFA 3MKDA 3C12A 2EQMA 1TWBA 3NHNA 3WXMB 5LJ5e 5LJ3h 4BUGA 2EGAA 2EPDA 4PJNA 2QEXT 1OOTA 1JXOA 4HT8A 4ORZA 2FEIA 1Q7YR 2LCLA 2QQRA 3O8VA 3HHTB 2AZVA 1ZHIA 2QNCA 2BE7D 2K3BA 1WHMA 1GXIE 3CCMT 4LD6A 3UF4A 1X6GA 3CCUA 1QLYA 4FT2A 4ZN3A 4J6XA 1UE9A 2FPFA 1H3ZA 1A8VA 2LC4A 1BKBA 3PMTA 4ZGEB 3TCJA 1EN7A 2DD4A 2QYZA 2QGFB 2M51A 5HY6A 2HSPA 4Y91A 2B86A 1E6GA 1EZZB 4GY5A 1GFDA 3CC7Q 1ARKA 3RKYA 3EFRA 5IXBA 4OMFB 2FPEA 4ME7A 4PJOG 4M77F 4DBRA 3CMAA 1QVPA 3E1SA 1GRIA 3OS2A 2BKDN 3M0RA 3OW2A 2CSQA 4M7AB 2DETA 3QO3A 2DVEA 3KFVA 4F7UG 4IKFA 2HKQB 1PSFA 3V8JA 3UATA 2MPHA 4FCYA 1TSFA 2PUKB 2DJQA 2EKOA 3VS2A 2I2LA 3CMEA 2LDMA 3CPWA 4RTYA 2G6FX 5CVIA 1KHIA 2E3HA 1UHFA 1BK2A 4JRQA 4J9HA 1M8VA 2KROA 4M7AE 5DY9A 1I5LA 1M27C 1YWPA 1AWJA 1OPLA 4RTWA 1HD3A 4OMOA 4M7DD 1TTHB 4RCCA 3IQLA 2VUBA 1G8XA 1EFNA 4M77B 3QZ5B 2L2PA 4X34A 4EMKC 2L0AA 1WI7A 2LNVA 2OTJA 1TUGB 2RQUA 2JVWA 1Q86U 1JO8A 1BIBA 3PE0A 1SSFA 4A4FA 1M90R 3X25B 2KRSA 2YUOA 1VQ8T 2K2VA 1I1JA 2JMAA 4M78F 2HQEA 2AHJB 1SSHA 4BI4A 4DBFA 1KJWA 4PFOA 4K11A 2DM1A 2JM9A 4WTOB 2WQGA 2ZPBB 3LH5A 5I2MA 1VOMA 2GNCA 1WIEA 3OW2P 1K73U 2H3EB 4O5VA 3X26B 1VQ5T 1RI9A 1PD1A 1VQLQ 1KG1A 2RO0A 4AG1C 2Y4XA 1YIJT 4D8DA 4RTTA 3OYHA 1MNDA 2K7AA 3SFMA 2ATCB 2MCNA 2YDLA 3M9QA 1WXBA 2RI5A 4B9XA 4C0GA 1MGQA 3HKSA 3J80E 3H0IA 4M7AF 1PM3A 2FL7A 1M3BA 3RDVA 5CO7A 2RK2A 3MP8A 1VQ9Q 4F7UF 2NWMA 1X27A 4EMKA 4M7AC 2J06A 2VVKA 1Q82C 3DLLA 4X1VA 3EH2A 5GAMj 2DYIA 3H0HA 4PJOF 4RKUE 2RI2A 2M16A 2DTOA 1HJDA 1WHGA 8AT1B 3OQ5A 2MWOA 1VQ4T 3L1AA 1GFCA 2E41A 1PWTA 4HVUA 3TSWA 1ABOA 4LE9A 4JPBW 1JEQA 3VS7A 1TH7A 4PJOC 4RTXA 1IB8A 2RK1A 2ZPFB 3LYIA 3Q1JA 3CCRT 4KH0B 1IHVA 2E3IA 4M75G 1WQWA 3M56A 2PVGB 5I21A 1UJ0A 2X35A 1YJWQ 5IHKA 1K8AC 4DBQA 1GCQA 2HQHA 3L2UA 1U06A 2RD1A 5KYWB 1ZSZA 4XU3A 5GMKi 1KIKA 1OZ3A 1NLOC 2JJ9A 1FWZA 2ZAEA 2LX9A 4ESRA 2DIQA 1VQ9A 2L89A 2QQAA 4BY6B 1AHJB 4R56A 3V7CA 4JS4A 1Q81R 4J7IA 1WXTA 1G3SA 3P8DA 1W1FA 3M59A 2NUTB 1YITT 2DMOA 1Q81U 3EHQA 1AZEA 1WXUA 1LOJA 5CQYA 5FU7B 2MK5A 3VJPA 3EGDA 1I0CA 5D6WA 2RJEA 1KK7A 2RQVA 3G4ST 1VIFA 3RMSA 5GAMd 1IHWA 4KH1B 2RNOA 2LNHB 1K0SA 1M1KR 1BI3A 4PFPA 4A4EA 2YHTA 3PIOA 2R5AA 3SB2A 2E4HA 4M7DG 2KXCA 2YSQA 4HA8A 3L2ZA 1JQQA 2JS0A 1GBQA 2CH4A 3OYFA 3G71Q 1YP5A 1PKTA 4DQ2A 3HTRA 1KD1U 4P5NA 1K73R 1IGUA 2EYZA 3V8LA 2HAXA 4JLIA 1I81A 1M5Q1 2COZA 2NUPA 1VQKT 4C0DB 4XTYA 3CPWS 3SHWA 5FWCA 4DEXA 3CCQT 1H8KA 2YRVA 3E9GA 2YLBA 1B3QA 2DE0X 1OX9A 5GANf 2QTVA 1WJSA 2Y90A 3EG9A 2K5FA 2LRQA 3AT1B 5GAOn 4QW2A 1PG5B 4JDSA 3VRYA 3OYJA 1QP3A 3OMGA 1NJIU 2C06A 4XU2A 1NJIR 4LNPA 3VS4A 2OTLQ 1RAGB 1ZA2B 2HBPA 3GOXA 1H9EA 2OJ2A 1Q81C 2M0YA 3L0OA 1UDLA 1ZS9A 3GF5A 4RG8A 2XICA 5HCKA 3VS1A 5GMKl 3I55A 2KI7A 4RTVA 3MEWA 3CCMA 1QCOA 2K5IA 2HL5C 5HK0A 5FRMA 4IIOA 2LZ6B 5DLQE
chains in the Genus database with same CATH topology
2E5QA 4M77D 1RL2A 2EJ9A 4II1A 4C92E 4A4KA 2PVOB 1UEBA 1WJRA 4KT0E 3A8LB 1G3WA 2DXCA 4M77C 3UWNA 4IURA 2OTLA 3EAEA 2RHUA 1VQ9T 1B34A 3QZ9B 3QJYA 3S3MA 3VU3C 3CCVA 3GIBA 2EIFA 4M78B 2LT1A 2FB7A 3JCMQ 2LTOA 4OF1A 4NL3A 1KQ2A 2XIDA 4C0ZA 5LJ3g 2RH2A 2JZ2A 3UDCA 4UC4A 2V8KA 5GANe 2QDYB 4MDWA 5A0LA 1FXXA 1B34B 5FROA 4IUUA 2IG0A 4IUVA 2ZZDA 4C8QD 2JN0A 3OYIA 3CCQA 1UGRB 3RMQA 2JOYA 2E6NA 2M9UA 1KC8C 5GAN6 3M4GA 4J6YA 3NTHA 3HSBA 2A7YA 4ZTJA 4BY6C 3E19A 1UGQB 2KDSA 1DJ7B 2VYTA 2EQJA 3MCAB 2XI9A 3QYGB 2QXFA 5LJ5h 3CCUT 1M1FA 3S3OA 3HRTA 5LJ3e 3G7ZA 1H641 4BI8B 4PL6A 1VQPA 2D0QB 2HD0A 2KSSA 1NE8A 2KVQG 3A8OB 2RJFA 4A54A 3PFSA 3C12A 4N4HA 1U8RA 1QVGS 2EQMA 5CIUA 3LH0A 4E7KA 1Y96A 5LJ5d 2QTXA 3PGGA 3WXMB 5LJ5e 4M75D 2DKGA 3LWHA 4C8QG 2DO3A 4XK8E 2K57A 5LJ3h 4MZMA 4BUGA 1UB4A 1BYMA 3FIFA 4PLLA 1XTDA 3MP1A 1M1GA 3UPUA 2QEXT 4E7JA 3CBPA 5CKHA 5EG2A 5CR2A 4HT8A 1YJWT 3CC7A 2VGMA 3DKMA 3A8GB 4M78C 2LCLA 2JNGA 2QQRA 3O8VA 3HHTB 4M78G 4C8QC 5DM7R 1ZBXA 1VQ6A 1ZHIA 3GNGA 4YTLA 4F7UE 1N27A 1GXIE 3CCMT 4LD6A 2MI6A 4M75F 4C0DC 4ZTFA 4QVZA 3RESA 3L2VA 3CCUA 1VQNA 4FT2A 5GAMg 3CPFA 3QUIA 1BI0A 4F7UB 4ZN3A 5GMKh 2CZ0B 3OYBA 5GANj 4J6XA 3SWNB 2XD0A 1H3ZA 4D6WA 2NLUA 3CD6A 2GFUA 1BKBA 2LC4A 2RI3A 3PMTA 4CRIA 4ZGEB 4PJOE 3TCJA 1YI2T 4XTWA 5FLXE 2DD4A 1QVFS 1N6AA 4O6JA 1VQOT 3CCJT 3QIIA 2WSFE 5HY6A 4Y91A 3CCRA 1G5VA 1BI1A 4A4HA 4GY5A 2PU9B 1NZ9A 5LJ5f 1JB0E 3M53A 3OBYA 4IUPA 4A4GA 2QEXA 3JCMJ 1QP2A 4OVAA 3EFRA 3QXEB 3RKYA 5C6SA 3L2WA 4E7LA 4OMFB 3QHSA 4ME7A 2CYZB 4PJOG 4M77F 5CKDA 4L5GA 5GAN4 1QVPA 3CMAA 3E1SA 3OS2A 3TU4K 2EQKA 5A2QE 3JCMP 1VQ4A 2BKDN 2PUOB 5C0MA 3OW2A 4M7AB 5DLOA 3QO3A 2DVEA 3UT1A 2ZPIB 1K73C 4F7UG 3TREA 4IKFA 1PSFA 4Z02A 2ZPEB 4TVRA 1S72T 2RB6A 3OS0A 3V8JA 3FLGA 4M7DA 5KE2A 3S6WA 4C0FA 5J39A 2E6ZA 4PLIA 3OYYA 1KQSA 4PJOD 3PTAA 3OYGA 4LDUA 2PUKB 2EKOA 2JTMA 2GCXA 3OS1A 4XQ3A 3OBWA 4IUQA 2I2LA 3ZBDA 4XTZA 2X4XA 2QA4T 3CMEA 2LDMA 4PJOB 5FU6C 3CPWA 2H3JA 3CXCA 2RJDA 3HRSA 1WPYA 1KHIA 5CVIA 3NTKA 3M4YA 5GAOq 4JRQA 4OB0B 3ME9A 1M8VA 4KUIA 1VQMT 4M7AE 5DY9A 2QI2A 2OTLT 5IN1A 1I5LA 3BDLA 4QQ6A 3PMIA 5GAN2 3VYGA 4M7DC 3H6ZA 4KULA 3JB9J 1KHCA 4M7DD 3OS5A 2R5MA 4RCCA 4L59A 4BI3A 3X28B 2MMPA 3ER0A 4HT9A 5HKCA 2QQBA 3WVEB 2VUBA 2A3LA 5GANd 1UGPB 4M77G 1XOVA 2VV5A 1M9SA 3OYCA 2MWPA 3CMET 1YCYA 2PQWA 4XU0A 4BE0A 4M77B 1JJ2A 3WVDB 3QZ5B 3CEYA 1BI2A 3LGFA 2GQVA 3FDRA 4X34A 5GAMh 3J7AF 4M77E 3JCMf 2VC8A 4EMKC 2M0OA 2LNVA 3CCST 2MF2A 4JRIA 2DTHA 3DLMA 4JRKA 4RCBA 3CCLA 1R8OB 2D9TA 5J26A 3ZFJA 2OTJA 3C4SA 1D3BB 1UGSB 2CKKA 1Q86U 5KH6A 1BIBA 5IAYA 2K5LA 4FM4B 3C95A 2BIVA 1SSFA 4M78E 4A4FA 5AYFA 4BB7A 3JCMb 4Q5WA 4C8QB 3X20B 4ATOA 4RMOA 5CAIA 1VQ8A 3X25B 3DB3A 1M90C 2M1HA 4X9DA 2JTFA 1VQ8T 2HNIA 2K2VA 1Y96B 4OGCA 4C5IA 4M7AG 1VQLA 4M78F 3J81E 2HQEA 3AHUA 4FL6A 3MEUA 2AHJB 2XHCA 3TEEA 5CQXA 4BI4A 3I55T 2RM4A 2DJZA 4EDUA 3G71T 3LGLA 3MHXA 1YHQA 2VXEA 5J3BA 2ZPBB 4C8QF 3BDUA 5I2MA 2XU8A 3S3NA 2L5QA 3QPHA 3JCMg 3JB9I 3FRNA 2JVVA 4OB1B 1KC8U 1YITA 4C5HA 2DTIA 4OP0A 1K73U 3X24B 4GLKA 3VUBA 3CC2A 5D6YA 1RI0A 4DOWA 4M7AD 3M55A 4O5VA 3RKXA 3X26B 1VQ5T 5CKFA 5FU7C 3OYLA 2RO0A 4ZGDB 5M9OA 3M58A 3KUFA 2EAYA 3CC4T 3CCET 1KG1A 3JCMd 1Q7YU 2Y4XA 1YIJT 4MMKA 4XTVA 3OYHA 5KE3A 2D6FA 3SFMA 5FRNA 3HFOA 4Y28E 1M1KC 4B9WA 2DZ9A 2XDDA 3ASKA 2X4YA 3CMAT 4HCCA 3M9QA 3VKIA 2RI5A 3LLRA 3V7RA 4B9XA 4C0GA 1MGQA 1NPPA 3HKSA 3JRZA 4C92A 3J80E 2LCCA 4M7AF 2F5TX 3MEVA 1VQ7T 2PVDB 4LD9K 3OY9A 3SD4A 2FL7A 1YJ9T 4QVCA 2X4WA 1JBMA 1X6OA 3MEAA 3OSSC 3P8BB 5CO7A 2RK2A 5A0GA 1W2BA 5GANg 3BY7A 3MP8A 1YJNA 3QKJA 1XQHA 4BD3A 4PKCC 4ZN1A 1VQPT 4E47A 4PJOA 1I8FA 2O4XB 2RHYA 4F7UF 3GP8A 3OYEA 1EIFA 4KBMB 4DA4A 2E65A 4M75C 4C92G 3QDRB 2ZPHB 3JB9G 4EMKA 4M7AC 2KMTA 1M90U 1Q82C 3DLLA 1FX7A 4ZGJB 3JCMX 1P92A 5KCHA 5GAMj 3LWIA 1LJOA 3OYAA 1VUBA 3OA6A 5LL6S 4PJOF 4RKUE 1QVFA 2RI2A 2E64A 2CZ7B 4XTXA 4BACA 4M7DB 2M16A 2DTOA 3OW2S 2CGHA 1YJWA 5L8RE 1O9SA 5GANh 5GAN8 1YJ9A 3OQ5A 3CC7T 1I4K1 2MWOA 3F70A 3PNWC 5GMKj 1N9SA 5GAOm 1VQ4T 4MDXA 4HCZA 3L1AA 2KY9A 5LJ5g 2E41A 2EYQA 5LJ3d 3M57A 1WNLA 1HK9A 3EFSA 4IUTA 1W4SA 4C5EA 1VQMA 5GAN3 2LVMA 5GAN7 1TH7A 2WSEE 3A5ZB 3OB9A 4MMLA 3JCMc 4PJOC 5FU6B 5GMKe 3FJPA 3FC3A 5GAOr 2E10A 5CKEA 1YIJA 2RK1A 2ZPFB 3LYIA 3MO8A 3Q1JA 3CCRT 1ZQ1A 2KQWA 2DXUA 3RUXA 2EQUA 4C92D 1Q82U 5GAOl 2JUFA 4QQGA 3G4SA 3A8MB 2LQ8A 4JUVA 4M75G 4C92C 2FHDA 4DOVA 1WGSA 1WQWA 2K4YA 2ZGWA 3QYHB 5GAMe 3CC2T 2EJGA 3M56A 1O75A 1IREB 2PVGB 4FT4A 5I21A 2X35A 3PT9A 3URGA 2DZCA 4FU6A 4ELYC 4C8QA 4L6V5 1BIAA 3L2QA 1K8AC 3HFNA 3JCMV 1KQSS 2EJFA 1XNIA 5CK9A 3SWNA 5LJ3f 3L2UA 2L3RA 3G6EA 2DD5A 4HKEA 1D3BA 2DPPB 4X9CA 2FYKA 2Y4YA 4C8QE 1VQ6T 2R58A 3CBOA 2RD1A 4V2SA 4LDWA 3JCMh 3CXCS 4XU3A 5GMKi 3OMCA 1OZ3A 4A53A 2GF7A 1Y7XA 3BW1A 3CCVT 2G3RA 2DXBA 1VQ7A 5CCAA 1FWZA 1KD1C 5LJ3j 3I56A 3OYNA 3VYHB 1NJIC 2LX9A 3RIRA 3GPLA 2DIQA 1VQ9A 2VXFA 3I56T 2L89A 1OZ2A 2DK3A 3T9NA 2QQ9A 2QQAA 4BY6B 5IT9E 1AHJB 2BUDA 4R56A 2ZPGB 1X01A 3V7CA 4JS4A 4J7IA 4EMKB 1QW1A 1G3SA 2LT4A 2EWNA 1IZ6A 3C94A 5D6XA 3OYDA 1N8RU 3P8DA 4J83A 1VQOA 3QSUA 3CCEA 3CC4A 3E9FA 3FEOA 3BFMA 4J8OA 4M75E 4M7DF 2GFAA 2F69A 3JSCA 1U1SA 1G3YA 3M59A 5GAMf 4NOYA 2LQKA 4EMGA 1PSEA 4NL2A 3GNFB 4MZPA 3M5AA 1YITT 2DAQA 1Q81U 1K9MU 2QA4A 2K3XA 3OSVA 4CI0C 3HPWA 5HK3A 3R6OA 2P0KA 4BE2A 2RHZA 2P0QA 4M78D 1LOJA 5CQYA 5FU7B 3G6ET 1OI1A 4E7HA 3ZEHA 3VJPA 3GLXA 4XAXB 1U1TA 3INZA 3G71A 3NTIA 3JB9H 5D6WA 2DEQA 4EPCA 2RJEA 1S72A 1NPRA 1YBYA 2KAFA 2HQXA 1MHNA 2EFIA 3LX7A 3G4ST 1VIFA 3RMSA 5GAMd 3L2RA 2E70A 4KUDK 1VQLT 4N4GA 3JCMW 1BI3A 4A4EA 4M78A 2YHTA 4XU1A 2DXTA 3PIOA 2R5AA 4VUBA 3HP9A 3SB2A 2VGNA 4M7DG 2OAUA 4BE1A 4J6WA 4MZTA 2X4JA 4XTUA 5KCOA 3OYKA 1N8RC 3CBMA 4HA8A 3L2ZA 3HL8A 2XG8D 2OTJT 3N5BB 3JB9F 4M7AA 2F5KA 1WJQA 4M75B 5GAN5 2RHIA 4C92F 4EMHA 2XKOC 3OYFA 3CCSA 3QBYA 3OYMA 3KBGA 4FSXA 4LDXA 3VUZA 4DQ2A 1KD1U 4P5NA 2FVUA 3H8ZA 3HRUA 2CZ1B 1V29B 3V8LA 2CS7A 2O01E 5GAOp 4FIBA 1YJNT 3CD6T 4LDVA 2HAXA 4JLIA 1I81A 1M5Q1 1VQKT 4J5YA 3NFCA 4N0AC 1Q7YC 2IVWA 5LJ5j 3JCMe 4JS5A 3LW5E 4C0DB 4XTYA 3V8KA 4QVDA 3CPWS 1QVGA 3JB9D 2WACA 2CZ6B 4JLGA 2MAMA 5CKBA 3CCQT 1K8AU 1M4ZA 3MP6A 3M54A 2YRVA 4OB2B 3SWNC 2KK4A 1LNXA 2DIGA 3E9GA 4OGEA 2V8IA 4F7UA 3QJ6A 2YLBA 2E12A 2K3YA 2XDPA 4N0AA 5GANf 2Y90A 1WJSA 4LDYA 4WF2A 1W2BS 3L42A 4J7FA 2K5FA 2LRQA 3RERA 4QQDA 3V7SA 4N4IA 2RJCA 4QW2A 5GAOn 3KXTA 4HCBA 4E7IA 2RHXA 1X75C 4JDSA 3SDZA 3OYJA 1QP3A 3OMGA 4M77A 2L8DA 4JRPA 5GMKm 1KQ1A 2RA2A 1NJIU 1WQ7A 4XU2A 3CCLT 2C06A 2XDBA 4C5GA 3PIPA 1G3TA 5A0DA 3CCJA 1VIEA 2ZCFB 4RG2A 4BDZA 2QQSA 2R57A 3DB4A 1VQKA 1VQNT 4BDYA 2HBPA 3GOXA 1JJ2S 1VQ5A 1Q81C 1YI2A 1K9MC 2XK0A 2O4XA 1N9RA 3JAME 1Y71A 4M7DE 3GF5A 2P0PA 5I2SA 1Y07A 4OB3B 4RG8A 2B8AA 1JRIA 1M1KU 2V8JA 2XICA 2E1HA 5GMKl 3I55A 3RKWA 4JJNK 1Q86C 3QG1A 2WSCE 3MEWA 3FB9A 3A8HB 3VV0A 3CCMA 1YHQT 1OYXA 2P4TA 4NS5A 2K5IA 4ELZC 4C92B 5HK0A 4R55A 4M75A 5FRMA 2YLCA 3P8HA 3META 5DLQE 1HXDA 4PNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5Q A;  2DAQ A;  3S6W A;  4II1 A;  5FRN A;  2K3X A;  5J39 A;  1WJR A;  4PLI A;  4B9W A;  2P0K A;  3ASK A;  3UWN A;  2X4Y A;  2RHZ A;  3OYG A;  4IUR A;  4BE2 A;  3M9Q A;  2EKO A;  2RI5 A;  3LLR A;  1OI1 A;  2RHU A;  3EAE A;  3ZEH A;  4B9X A;  3OS1 A;  4E7H A;  3S3M A;  4IUQ A;  2LCC A;  2X4X A;  3MEV A;  2LDM A;  2LTO A;  3NTI A;  5D6W A;  3OY9 A;  3SD4 A;  2RJD A;  2JZ2 A;  2RJE A;  4UC4 A;  2X4W A;  3MEA A;  2HQX A;  1MHN A;  2EFI A;  3LX7 A;  5FRO A;  3NTK A;  4IUU A;  2IG0 A;  4IUV A;  3MP8 A;  3OYI A;  3QKJ A;  4BD3 A;  3ME9 A;  3L2R A;  2E6N A;  4N4G A;  2O4X B;  5IN1 A;  2RHY A;  3NTH A;  4A4E A;  3OYE A;  3BDL A;  4ZTJ A;  4QQ6 A;  3PMI A;  2VYT A;  2EQJ A;  2R5A A;  3S3O A;  3H6Z A;  4BE1 A;  1KHC A;  5KCH A;  5KCO A;  4PL6 A;  2R5M A;  3OYA A;  3OYK A;  4L59 A;  3OA6 A;  2RI2 A;  4BAC A;  2RJF A;  2M16 A;  2F5K A;  1WJQ A;  3OYF A;  3PFS A;  2RHI A;  4N4H A;  2EQM A;  5CIU A;  3LH0 A;  3OQ5 A;  3QBY A;  2MWO A;  3F70 A;  3PNW C;  3OYM A;  3OYC A;  2MWP A;  4HCZ A;  2PQW A;  4BE0 A;  3H8Z A;  4C5E A;  4IUT A;  4PLL A;  3MP1 A;  3CEY A;  2LVM A;  3LGF A;  4E7J A;  3FDR A;  4X34 A;  3OB9 A;  4E7K A;  2M0O A;  3FC3 A;  3DLM A;  3Q1J A;  3LYI A;  3MO8 A;  2D9T A;  5J26 A;  2QQR A;  2WAC A;  3O8V A;  2EQU A;  3C4S A;  2CKK A;  4QQG A;  5KH6 A;  5IAY A;  3MP6 A;  1N27 A;  2YRV A;  2FHD A;  4LD6 A;  1WGS A;  1SSF A;  2BIV A;  4QVZ A;  4A4F A;  3L2V A;  4ZTF A;  2DIG A;  3E9G A;  4Q5W A;  3QJ6 A;  2X35 A;  2K3Y A;  2XDP A;  4FU6 A;  1WJS A;  3DB3 A;  2M1H A;  3OYB A;  2JTF A;  3L42 A;  3L2Q A;  1H3Z A;  2LRQ A;  1XNI A;  2NLU A;  4QQD A;  4N4I A;  2RJC A;  4QW2 A;  4C5I A;  2GFU A;  2RI3 A;  2L3R A;  3PMT A;  4CRI A;  3L2U A;  2HQE A;  4E7I A;  2RHX A;  3OYJ A;  3OMG A;  4FL6 A;  3MEU A;  2R58 A;  2L8D A;  3QII A;  1G5V A;  4A4H A;  4C5G A;  3OMC A;  1OZ3 A;  4GY5 A;  2GF7 A;  4RG2 A;  4EDU A;  4BDZ A;  2G3R A;  2QQS A;  2R57 A;  3DB4 A;  3LGL A;  4IUP A;  4A4G A;  4BDY A;  3GOX A;  3OYN A;  4OVA A;  5C6S A;  4E7L A;  3L2W A;  2XK0 A;  2DIQ A;  2O4X A;  2L89 A;  3S3N A;  1OZ2 A;  3OS2 A;  2EQK A;  2BUD A;  4C5H A;  2BKD N;  5C0M A;  2B8A A;  3OYD A;  5D6X A;  3P8D A;  5D6Y A;  1RI0 A;  3E9F A;  3FEO A;  3UT1 A;  3MEW A;  1OYX A;  3OYL A;  2RO0 A;  4NS5 A;  2GFA A;  5M9O A;  3KUF A;  4IKF A;  4Z02 A;  5FRM A;  3OS0 A;  3P8H A;  3FLG A;  3MET A;  3OYH A;  5KE3 A;  5KE2 A; 
#chains in the Genus database with same CATH topology
 1WHL A;  2E5Q A;  4M77 D;  4C92 E;  4KT0 E;  1G3W A;  2DXC A;  2P84 A;  1YNS A;  2EIF A;  3GIB A;  3EHR A;  2ENM A;  2LTO A;  2XID A;  4C0Z A;  2RH2 A;  3UDC A;  3VRZ A;  3OYI A;  4C8Q D;  1X2Q A;  2E6N A;  2COY A;  2O2O A;  3NTH A;  4BY6 C;  4QKU A;  1VQN T;  2D8H A;  2XI9 A;  1NBE B;  5LJ5 h;  1M1F A;  3HRT A;  3G7Z A;  2CDT A;  1VQP A;  1WA7 A;  1D0Y A;  3ULR B;  2KSS A;  1NE8 A;  1PRM C;  2KVQ G;  3CCV Q;  4N4H A;  1U8R A;  4C8Q G;  2CUD A;  4MZM A;  2KFV A;  1BYM A;  4PLL A;  1Q95 G;  3H41 A;  1JEI A;  2KNB B;  3CCR Q;  3CBP A;  5CKH A;  5EG2 A;  1MV3 A;  1IO6 A;  1YJW T;  3DKM A;  4M78 C;  2JNG A;  3GNG A;  2X3X D;  3CCM Q;  2MI6 A;  4C0D C;  3RES A;  1U3O A;  5GAM g;  2CZ0 B;  1FMW A;  3OYB A;  4D6W A;  2EW3 A;  1GBR A;  1E6H A;  1RLP C;  1N6A A;  4ZNX A;  1WYX A;  1VQO T;  2WSF E;  2DIL A;  2PU9 B;  1NZ9 A;  5LJ5 f;  1JB0 E;  2ED1 A;  3QXE B;  1T0J A;  2KT8 A;  5CKD A;  4L5G A;  5GAN 4;  2J05 A;  1LCK A;  2EQK A;  5A2Q E;  3UT1 A;  2ZPI B;  5KYX B;  2EGC A;  1K73 C;  1X2K A;  1UFF A;  1VQP Q;  3GBQ A;  2RB6 A;  1AWX A;  3OS0 A;  3FLG A;  4JJC A;  4M7D A;  2HJQ A;  3S6W A;  2PZ1 A;  4C0F A;  4PLI A;  2VWF A;  1PRL C;  3PTA A;  2JTM A;  4CC3 A;  3OBW A;  1H3H A;  4IUQ A;  4XTZ A;  2X4X A;  3CMA Q;  1I5O B;  2CH4 W;  5FU6 C;  3UA7 A;  3EGD B;  3CXC A;  2SEM A;  1Z9Q A;  4E7Z A;  1PKS A;  1XJW B;  5GAO q;  3H0F A;  3FJ5 A;  2OTL T;  4Z8A A;  5IN1 A;  2DER A;  1OEB A;  5GAN 2;  3VYG A;  4M7D C;  1AWW A;  3H6Z A;  3OS5 A;  4KGZ B;  4BI3 A;  3X28 B;  1GKU B;  2O9V A;  2EYW A;  1SG5 A;  3ER0 A;  1C0M A;  3WVE B;  5KYU A;  4AFS C;  2DX1 A;  2A3L A;  1M9S A;  2DL4 A;  2PQW A;  3R6N A;  1BI2 A;  4CC4 B;  2A0F B;  3J7A F;  1ZSZ B;  3JCM f;  3CCS T;  2MF2 A;  2RMO A;  2DTH A;  3CCL A;  1K0X A;  1UGS B;  2CKK A;  2J7I A;  4Z88 A;  5IAY A;  4FM4 B;  4M78 E;  3JCM b;  5AYF A;  3EGU A;  3X20 B;  4ATO A;  4RMO A;  5CAI A;  4OML A;  1B07 A;  1NM7 A;  1M90 C;  2M1H A;  3CC2 Q;  2HNI A;  1Y96 B;  1CKB A;  3EFO B;  4C5I A;  3REA B;  2CP6 A;  2LX7 A;  3H9N A;  2RM4 A;  2OTJ Q;  3G71 T;  5IH2 A;  3MHX A;  4J9D A;  5J3B A;  3BDU A;  5GJW B;  1KD1 R;  4OB1 B;  1SKU B;  4C5H A;  2DNU A;  2CT4 A;  1N5Z A;  4HCK A;  1ZUY A;  5D6Y A;  3M55 A;  4JZ3 A;  5FU7 C;  3CC4 T;  5M9O A;  2EVR A;  2EAY A;  3BE3 A;  4XTV A;  5KE3 A;  2D6F A;  2RQT A;  1M1K C;  3ASK A;  2X4Y A;  3QDF A;  3VKI A;  2DFU A;  2F5T X;  5KYY B;  3D7S B;  4LD9 K;  3OY9 A;  3SD4 A;  4QVC A;  1JBM A;  5A0G A;  3CCL Q;  5GAN g;  3BY7 A;  3QKJ A;  1XQH A;  4BD3 A;  1QWE A;  1X43 A;  1BCM A;  4E47 A;  4PJM A;  5FW9 A;  3OYE A;  1EIF A;  4DA4 A;  2YRC A;  3JB9 G;  1RAH B;  1M90 U;  1FX7 A;  3LWI A;  1LJO A;  1F1B B;  1VUB A;  4KGX B;  5LL6 S;  1I07 A;  1QVF A;  3QWX X;  2E64 A;  2CZ7 B;  2ODC I;  5GAN 8;  1N9S A;  1OU8 A;  4PFZ A;  1VQM A;  2KVD A;  3SEM A;  1W4S A;  5GAN 7;  2K79 A;  3A5Z B;  3OB9 A;  5GMK e;  3FJP A;  2E10 A;  2KQW A;  2DXU A;  2CP7 A;  2EQU A;  3EH1 A;  2JUF A;  4C92 C;  1RLQ C;  2ZGW A;  4LN2 A;  4J9E A;  4FT4 A;  4D8K A;  4AMC A;  4HXJ A;  2DZC A;  2KEA A;  4L6V 5;  3HFN A;  3JCM V;  1KQS S;  2EJF A;  5LJ3 f;  2DD5 A;  4X9C A;  2FYK A;  2R58 A;  5IHN A;  2LQW A;  2AKK A;  4V2S A;  2DYB A;  3OMC A;  2GF7 A;  1Y7X A;  3CCV T;  1VQ7 A;  2DXB A;  3I56 A;  3GPL A;  3RBB B;  2LC3 A;  4F16 A;  1RAB B;  3I56 T;  1RAE B;  2HSE B;  2A8V A;  5IT9 E;  1K9M R;  4J83 A;  3CCE A;  2X9H A;  4M7D F;  2DVJ A;  1VYT A;  1U1S A;  1G3Y A;  5GAM f;  2QG9 B;  4NOY A;  2LQK A;  4EMG A;  3GNF B;  1K9M U;  1K1Z A;  2KW9 A;  2EGE A;  5KYY A;  5HK3 A;  2DRK A;  1PHT A;  3R6O A;  1Z9Z A;  4E7H A;  1OI1 A;  3ZEH A;  3VS6 A;  3GLX A;  1U1T A;  1VYU A;  1X6B A;  1D1C A;  3NTI A;  4UZW A;  2VKN A;  2ECZ A;  1NPR A;  2KAF A;  3LX7 A;  4KUD K;  1VQL T;  4N4G A;  1ZBJ A;  4M78 A;  2DXT A;  2FPD A;  4JZ4 A;  1N8R C;  2XG8 D;  4KGV B;  3JB9 F;  4M7A A;  4M75 B;  4C92 F;  2XKO C;  4FSX A;  1SRM A;  2FVU A;  2MOX A;  3HRU A;  2CZ1 B;  4IIM A;  1C6V X;  4J5Y A;  2YUN A;  3NFC A;  5LJ5 j;  3CCJ Q;  1QVF P;  3MJX A;  3JCM e;  2KVE A;  4QVD A;  2WAC A;  1VQ5 Q;  1V76 A;  3MP6 A;  1GCQ C;  1LNX A;  2V8I A;  4DEY A;  2ROT A;  4LDY A;  3L42 A;  4J7F A;  4QQD A;  3V7S A;  3KXT A;  4HCB A;  1ZA1 B;  4E7I A;  1YNZ A;  1Q86 R;  1B7T A;  1AT1 B;  4JRP A;  5GMK m;  2RA2 A;  2XDB A;  1QWF A;  1WQ7 A;  1V66 A;  4C5G A;  1G3T A;  1T0H A;  2F2W A;  1VQK A;  4BDY A;  1JJ2 S;  1WDX A;  2O4X A;  3JAM E;  4M7D E;  2P0P A;  4OB3 B;  4AG2 C;  2V8J A;  3RKW A;  2DK4 A;  1Q86 C;  1GL9 B;  2F2X A;  1YHQ T;  4NS5 A;  1VQN Q;  4C92 B;  4LUE A;  1OPK A;  2YLC A;  1NG2 A;  1WHH A;  3MET A;  3UWN A;  1D1B A;  1MMA A;  1RL2 A;  1KC8 R;  2KR3 A;  3CD6 Q;  1ZLM A;  2OTL A;  2EKH A;  3EAE A;  2KE9 A;  2RHU A;  1S1N A;  1ZUK A;  1KQS P;  1BBZ A;  1QQJ A;  3S3M A;  1TOV A;  2RQW A;  2LT1 A;  2FB7 A;  2RQR A;  4OF1 A;  4NL3 A;  4OMM A;  2O88 A;  2HMA A;  4UC4 A;  2QDY B;  1FXX A;  3I55 Q;  2IG0 A;  3CCQ A;  4Z89 A;  2JN0 A;  3EG2 A;  5KYX A;  1LVK A;  1ACM B;  3E19 A;  2KDS A;  2VYT A;  2EQJ A;  1AWO A;  1VQ6 Q;  5LJ3 e;  1H64 1;  4PL6 A;  2HD0 A;  3I5R A;  4A54 A;  1A63 A;  1QVG S;  1AVZ C;  2VAS A;  5CIU A;  2GTJ A;  4E7K A;  3PGG A;  4M75 D;  1JJ2 P;  4XK8 E;  1UB4 A;  1VQK Q;  3FIF A;  3MP1 A;  2GGR A;  4FYY B;  1BCO A;  4AFQ C;  5CR2 A;  2A36 A;  2VGM A;  3A8G B;  1MMG A;  4C8Q C;  2QEX Q;  4M78 G;  1ZBX A;  4YTL A;  1W2B P;  4F7U E;  2YUQ A;  2VB6 A;  4M75 F;  4QVZ A;  3L2V A;  1JEG A;  1VQN A;  2C0T A;  2PNI A;  3CPF A;  5GMK h;  3NPF A;  1H92 A;  5GAN j;  3SWN B;  3CD6 A;  2RI3 A;  4PJO E;  1YI2 T;  1G83 A;  1QVF S;  4O6J A;  3CCJ T;  3CCR A;  1OQK A;  2KRN A;  3M53 A;  4A4G A;  2I0N A;  2OX7 A;  4E7L A;  3CCQ Q;  3QHS A;  1QCN A;  2BZ8 A;  3JCM P;  4CC7 A;  1VQ4 A;  4Y92 A;  5C0M A;  5DLO A;  1V1C A;  1NEG A;  2KBT A;  2W0Z A;  2G80 A;  3EGX A;  2MIO A;  4FYW B;  4Z02 A;  4TVR A;  1S72 T;  1BB9 A;  1MMN A;  5KE2 A;  2E6Z A;  1FMV A;  3OYG A;  2GCX A;  3OS1 A;  4XQ3 A;  4B6M A;  4PJO B;  3EGX B;  2RJD A;  1WPY A;  2KYB A;  2DEU A;  3NTK A;  4OB0 B;  3ME9 A;  1WZO A;  3CQT A;  2QAZ A;  2A28 A;  3BDL A;  4JJD A;  3PMI A;  4PJL A;  2FZC B;  4KUL A;  3JB9 J;  2R5M A;  4L59 A;  2DA9 A;  2MMP A;  1U5S A;  2QQB A;  1N8R R;  1CKA A;  3CME T;  4M77 G;  3OYC A;  2VV5 A;  1D0Z A;  4BE0 A;  2GTO A;  2HZY A;  1C1A A;  2L3P A;  3LGF A;  2GQV A;  5GAM h;  2HDA A;  1UUE A;  2M02 A;  1VQ4 Q;  2K9G A;  4JRI A;  4JRK A;  1R8O B;  2D9T A;  3QWY A;  5J26 A;  5I11 A;  2RNN A;  1VYV A;  2K5L A;  9ATC B;  4FW2 A;  1J3T A;  4Q5W A;  4C8Q B;  1VQ8 A;  4X9D A;  2JTF A;  2ED0 A;  1NLP C;  2J6F A;  2LJ1 A;  1T3L A;  3J81 E;  3AHU A;  1KSW A;  3MEU A;  7AT1 B;  3TEE A;  3I55 T;  1GJJ A;  2BZY A;  2PTK A;  2DJZ A;  3M0T A;  1AEY A;  1BU1 A;  3LGL A;  1YHQ A;  4LUD A;  3NMZ C;  4E7S A;  2JW4 A;  5FWB A;  3UA6 A;  3JB9 I;  2DL3 A;  3FRN A;  1K9A A;  1YIT A;  2DTI A;  2CUB A;  2HEQ A;  4GLK A;  2COW A;  1IRX A;  2DLP A;  3VUB A;  3CC2 A;  1YFN A;  4DOW A;  3RKX A;  5CKF A;  3CCE T;  4ZGD B;  3M58 A;  3JCM d;  1ZUU A;  1Q7Y U;  4MMK A;  2W51 A;  2P4R A;  3O5Z A;  3HFO A;  4Y28 E;  2XDD A;  3CMA T;  4HCC A;  4C92 A;  2LCC A;  2YWW A;  1YJ9 T;  3OSS C;  1W2B A;  3REB B;  2DF6 A;  3C0C A;  1YJN A;  4ZN1 A;  4PJO A;  1I8F A;  2O4X B;  2RHY A;  4AFZ C;  3GP8 A;  2E65 A;  4M75 C;  1YIJ Q;  1VQ8 Q;  3RR6 A;  2KMT A;  2YUP A;  1ABQ A;  4ZGJ B;  3G4S Q;  1P92 A;  2HCK A;  1VA7 A;  3OYA A;  3OA6 A;  3EG3 A;  1QVG P;  4XTX A;  2KYM A;  2CGH A;  5L8R E;  5GAN h;  1I4K 1;  2DRM A;  3PNW C;  5GMK j;  5KYW A;  4HCZ A;  3TVT A;  2EYQ A;  5LJ3 d;  1WNL A;  3EFS A;  1PCX A;  1YHQ Q;  2FRY A;  4PJJ A;  2WSE E;  3JCM c;  3FC3 A;  5CKE A;  2Z0W A;  4C92 D;  1TUD A;  4QQG A;  2J6K A;  3CC2 T;  1WGS A;  1PD0 A;  1K4U S;  1A62 A;  1IRE B;  2AK5 A;  2CT3 A;  4FYX B;  3PT9 A;  3URG A;  4FU6 A;  4ELY C;  4A63 B;  1BIA A;  2EQI A;  1ZBH A;  1D1A A;  2JXB A;  5CK9 A;  4OMP A;  3SWN A;  1D3B A;  2DL7 A;  2DPP B;  1VQM Q;  2AT1 B;  3CBO A;  4LDW A;  1T3S A;  1OU9 A;  2LQN A;  1D0X A;  1H1J S;  3VYH B;  1NJI C;  2VXF A;  2EBP A;  2DK3 A;  3T9N A;  4R0K A;  2DL8 A;  2ZPG B;  2SRC A;  3PVQ A;  4EMK B;  2LT4 A;  2EYY A;  1IZ6 A;  1N8R U;  1M30 A;  3QSU A;  3CC4 A;  3BFM A;  2NUZ A;  2CSI A;  3JSC A;  1SF9 A;  4NL2 A;  1FMK A;  2DAQ A;  2QA4 A;  3OSV A;  2P0K A;  1VQ7 Q;  2RHZ A;  2P0Q A;  3I56 Q;  1IGQ A;  4XAX B;  3INZ A;  3TSZ A;  1AZG B;  2DEQ A;  4EPC A;  1RAI B;  1S72 A;  1YBY A;  2HQX A;  1MHN A;  3M0P A;  3CCE Q;  5KYN A;  4FW1 A;  2E70 A;  3JCM W;  2JTE A;  2JS2 A;  4AFU C;  2YXY A;  4VUB A;  3HP9 A;  1AD5 A;  1UG1 A;  2OAU A;  4BE1 A;  4J6W A;  4MZT A;  4AT1 B;  5KCO A;  3OYK A;  3CBM A;  3G1J A;  1HSQ A;  1QKX A;  4F04 B;  1MUZ A;  2DL5 A;  3N5B B;  4EMH A;  1YCS B;  2D8J A;  3OYM A;  3M0U A;  4LDX A;  3VUZ A;  3H8Z A;  2FO0 A;  3A98 A;  5GAO p;  1E7L A;  1QVG A;  3V8K A;  3JB9 D;  2C0O A;  2MAM A;  5CKB A;  3EG0 A;  8ATC B;  2DIG A;  4F7U A;  3QJ6 A;  2E12 A;  2BZX A;  1TU0 B;  2K3Y A;  4N0A A;  4WF2 A;  3ZL7 C;  1W2B S;  1TS9 A;  3RER A;  2RJC A;  4HVV A;  2FZK B;  2RF0 A;  2RHX A;  1X75 C;  1R0C B;  4M77 A;  2AKL A;  4J9F A;  3CCL T;  2EYX A;  1UJY A;  3PIP A;  3CCJ A;  1VIE A;  2LP5 A;  2ZCF B;  4RG2 A;  3DB4 A;  2OI3 A;  1VQ5 A;  1YI2 A;  3M0Q A;  2KRM A;  2LMJ A;  2B8A A;  1M1K U;  3VV0 A;  3FB9 A;  2P4T A;  1MV0 B;  3EG1 A;  4R55 A;  4M75 A;  4KRT A;  1HXD A;  4PNO A;  2EJ9 A;  1JU5 C;  4A4K A;  2JMC A;  1WJR A;  3A8L B;  4IUR A;  1VQ9 T;  1B34 A;  2IIM A;  3QZ9 B;  2X51 A;  4M78 B;  3JCM Q;  4DBH A;  4OMN A;  2JZ2 A;  1E7O A;  1GCP A;  2LCS A;  1B34 B;  3VS0 A;  1Y57 A;  4IUU A;  1SHG A;  1UGR B;  3RMQ A;  5GAN 6;  3M4G A;  1X69 A;  2A7Y A;  1UGQ B;  3I9Q A;  3CCU T;  3MCA B;  1Y02 A;  4J9B A;  4BI8 B;  1Q82 R;  1M2O A;  3A8O B;  1W6X A;  3PFS A;  1MNE A;  3LH0 A;  1Y96 A;  2CP2 A;  5LJ5 d;  2QTX A;  2YRD A;  3LWH A;  2DKG A;  2DO3 A;  1ZSZ C;  2K57 A;  2MPX C;  1XTD A;  1YI2 Q;  1M1G A;  3UPU A;  4E7J A;  4HVW A;  1M8M A;  3CC7 A;  2AIR B;  5DM7 R;  1R0B G;  1VQ6 A;  2NYS A;  1WX6 A;  3M0S A;  1N27 A;  4ZTF A;  5IXF A;  1PNJ A;  1LPL A;  2FRW A;  2FZG B;  3QUI A;  1BI0 A;  4F7U B;  2XD0 A;  2NLU A;  1RAF B;  2GFU A;  4CRI A;  4XTW A;  5FLX E;  3QII A;  1G5V A;  1BI1 A;  4A4H A;  3U23 A;  3OBY A;  4IUP A;  2QEX A;  3JCM J;  3HSB A;  1QP2 A;  4OVA A;  5C6S A;  3L2W A;  2O9S A;  2CYZ B;  1QCF A;  2GQI A;  4FSS A;  3CME Q;  3TU4 K;  1UTI A;  2PUO B;  2V1R A;  1NEB A;  1WFW A;  3TRE A;  2ZPE B;  4BIT A;  2K2M A;  4ANJ A;  5J39 A;  1RAC B;  3OYY A;  1KQS A;  2QDL A;  4LDU A;  1A0N B;  1R77 A;  3ZBD A;  2QA4 T;  2H3J A;  3HRS A;  3VS3 A;  4F14 A;  3M4Y A;  4KUI A;  1VQM T;  2QI2 A;  2QAS A;  3MPU B;  5EC7 A;  4QQ6 A;  4QT7 A;  2ROL A;  1KHC A;  2F2V A;  2BTT A;  4HT9 A;  5HKC A;  1G2B A;  1KFZ A;  1SEM A;  5GAN d;  1UGP B;  1XOV A;  2MWP A;  1YCY A;  1JXM A;  2ESW A;  4XU0 A;  1JJ2 A;  3WVD B;  2F1L A;  3CEY A;  3FDR A;  4M77 E;  4EIK A;  2VC8 A;  2M0O A;  4PK4 A;  3DLM A;  4RCB A;  3ZFJ A;  3C4S A;  1D3B B;  5KH6 A;  3C95 A;  2BIV A;  4J9C A;  4BB7 A;  3DB3 A;  1SHF A;  2LJ0 A;  3EFO A;  4OGC A;  4M7A G;  1VQL A;  2HBW A;  1FYN A;  4FL6 A;  2IPO B;  1M3A A;  2XHC A;  1EX4 A;  2V1Q A;  5CQX A;  2JM8 A;  4EDU A;  1NYF A;  2VXE A;  4C8Q F;  2XU8 A;  3S3N A;  2L5Q A;  3QPH A;  4J9I A;  3JCM g;  2JVV A;  1E7D A;  1ZX6 A;  1KC8 U;  4OP0 A;  3X24 B;  1RI0 A;  4M7A D;  1K8A R;  3OYL A;  2ABL A;  3KUF A;  2KGT A;  5KYU B;  2DBM A;  1QKW A;  5D7U A;  5FRN A;  2QGG A;  4B9W A;  2DZ9 A;  1UEC A;  3LLR A;  3V7R A;  2RNA A;  1NPP A;  3JRZ A;  2KVU A;  2DBK A;  3MEV A;  1VQ7 T;  2PVD B;  2KT1 A;  2AZS A;  1YIT Q;  4PJO D;  2X4W A;  1X6O A;  3MEA A;  3P8B B;  3JV3 A;  4PKC C;  1VQP T;  1SPK A;  1NYG A;  2LD7 A;  1YWO A;  4KBM B;  4C92 G;  3QDR B;  2ZPH B;  1VQO Q;  3JCM X;  5KCH A;  2GBQ A;  1Y0M A;  4M7D B;  4BAC A;  1YN8 A;  3OW2 S;  2MYS A;  1YJW A;  1O9S A;  1YJ9 A;  3CC7 T;  3F70 A;  5GAO m;  4MDX A;  2CP3 A;  2KY9 A;  5LJ5 g;  4C5E A;  3M57 A;  4IUT A;  1HK9 A;  5GAN 3;  1YJN Q;  1M2V A;  2LVM A;  1H9F A;  2C0I A;  4MML A;  5FU6 B;  5GAO r;  1YIJ A;  5AT1 B;  3MO8 A;  1ZQ1 A;  3RUX A;  1Q82 U;  5GAO l;  1W70 A;  1AOJ A;  3G4S A;  3A8M B;  2LQ8 A;  4JUV A;  2FHD A;  4DOV A;  2K4Y A;  3QYH B;  3NGP A;  5GAM e;  2EJG A;  1O75 A;  4C8Q A;  3L2Q A;  1XNI A;  1SRL A;  1M2V B;  2L3R A;  3G6E A;  4HKE A;  1OUL A;  1RAD B;  5ECA A;  2Y4Y A;  4C8Q E;  1VQ6 T;  1UGV A;  3A1P A;  1MMD A;  3CCS Q;  3JCM h;  3CXC S;  4LXC A;  4A53 A;  3BW1 A;  2G3R A;  5CCA A;  2CP0 A;  1KD1 C;  2JT4 A;  2QK0 A;  5LJ3 j;  3OYN A;  3TQ7 P;  3RIR A;  1OZ2 A;  3E2U A;  2QQ9 A;  2BUD A;  4GLM A;  1X01 A;  1QW1 A;  3OYD A;  2EWN A;  3C94 A;  5D6X A;  4CC2 A;  3VS5 A;  1VQO A;  1OV3 A;  3E9F A;  3FEO A;  4J8O A;  4M75 E;  3I35 A;  2GFA A;  2F69 A;  2ODG C;  2YT6 A;  4RTU A;  1PSE A;  4MZP A;  1RAA B;  3M5A A;  1YJ9 Q;  2K3X A;  4CI0 C;  1GL5 A;  3HPW A;  1TXQ A;  4BE2 A;  4M78 D;  3G6E T;  1PC0 A;  4RUG A;  1UHC A;  3G71 A;  2L3S A;  3JB9 H;  1HYO A;  2W10 A;  3CPW P;  2EFI A;  3CC4 Q;  2RN8 A;  3L2R A;  2X3W D;  1WHJ A;  4XU1 A;  2V26 A;  5GJV B;  2VGN A;  2QA4 Q;  2X4J A;  4XTU A;  3G6E Q;  3HL8 A;  2OTJ T;  2F5K A;  1WJQ A;  5GAN 5;  2RHI A;  2L3Q A;  2XMF A;  3CCS A;  3QBY A;  1TUC A;  3KBG A;  1S72 Q;  2CRE A;  2KXD A;  1JJR A;  1V29 B;  2CS7 A;  2O01 E;  1YJN T;  4FIB A;  3CD6 T;  4LDV A;  4RTZ A;  1Q7Y C;  4N0A C;  2HL3 A;  2IVW A;  2OAW A;  4FYV B;  3LW5 E;  4JS5 A;  2D1X A;  2D0N A;  4F17 A;  1ZSG A;  2CZ6 B;  4JLG A;  1K76 A;  1K8A U;  1M4Z A;  3M54 A;  4OB2 B;  3SWN C;  2KK4 A;  4OGE A;  1TG0 A;  3THK A;  2BE9 B;  1OX8 A;  2XDP A;  4WCI A;  4E6R A;  2HKN A;  4N4I A;  3EG9 B;  4M4Z A;  5IHI A;  3SDZ A;  4JJB A;  2L8D A;  4GBQ A;  1KQ1 A;  2E5K A;  5A0D A;  4BDZ A;  2QQS A;  2A08 A;  2R57 A;  2FG0 A;  2RPN A;  1K9M C;  2XK0 A;  5L23 A;  1N9R A;  1Y71 A;  2H8H A;  1WHK A;  1WLP B;  2NUP B;  1Y07 A;  4OMQ A;  5I22 A;  1JRI A;  1CSK A;  2E1H A;  4JJN K;  3QG1 A;  2WSC E;  3A8H B;  1OYX A;  4ELZ C;  2K6D A;  3CCU Q;  4E2F B;  3CXC P;  2J6O A;  3P8H A;  5I2S A;  2QNF A;  4II1 A;  2PVO B;  1UEB A;  3RNJ A;  4M77 C;  1IXD A;  3QJY A;  3VU3 C;  3CCV A;  6AT1 B;  1KQ2 A;  4J9G A;  5LJ3 g;  1M3C A;  5GAN e;  2V8K A;  4MDW A;  5A0L A;  5FRO A;  4IUV A;  2ZZD A;  3I5S A;  2JOY A;  2M9U A;  1RUW A;  1KC8 C;  4J6Y A;  1D09 B;  4ZTJ A;  1DJ7 B;  2CP5 A;  3QYG B;  3S3O A;  2QXF A;  2LJ3 A;  2O31 A;  2D0Q B;  1QMC A;  2A37 A;  2NUT A;  3PVL A;  2RJF A;  3MKD A;  3C12 A;  2EQM A;  1TWB A;  3NHN A;  3WXM B;  5LJ5 e;  5LJ3 h;  4BUG A;  2EGA A;  2EPD A;  4PJN A;  2QEX T;  1OOT A;  1JXO A;  4HT8 A;  4ORZ A;  2FEI A;  1Q7Y R;  2LCL A;  2QQR A;  3O8V A;  3HHT B;  2AZV A;  1ZHI A;  2QNC A;  2BE7 D;  2K3B A;  1WHM A;  1GXI E;  3CCM T;  4LD6 A;  3UF4 A;  1X6G A;  3CCU A;  1QLY A;  4FT2 A;  4ZN3 A;  4J6X A;  1UE9 A;  2FPF A;  1H3Z A;  1A8V A;  2LC4 A;  1BKB A;  3PMT A;  4ZGE B;  3TCJ A;  1EN7 A;  2DD4 A;  2QYZ A;  2QGF B;  2M51 A;  5HY6 A;  2HSP A;  4Y91 A;  2B86 A;  1E6G A;  1EZZ B;  4GY5 A;  1GFD A;  3CC7 Q;  1ARK A;  3RKY A;  3EFR A;  5IXB A;  4OMF B;  2FPE A;  4ME7 A;  4PJO G;  4M77 F;  4DBR A;  3CMA A;  1QVP A;  3E1S A;  1GRI A;  3OS2 A;  2BKD N;  3M0R A;  3OW2 A;  2CSQ A;  4M7A B;  2DET A;  3QO3 A;  2DVE A;  3KFV A;  4F7U G;  4IKF A;  2HKQ B;  1PSF A;  3V8J A;  3UAT A;  2MPH A;  4FCY A;  1TSF A;  2PUK B;  2DJQ A;  2EKO A;  3VS2 A;  2I2L A;  3CME A;  2LDM A;  3CPW A;  4RTY A;  2G6F X;  5CVI A;  1KHI A;  2E3H A;  1UHF A;  1BK2 A;  4JRQ A;  4J9H A;  1M8V A;  2KRO A;  4M7A E;  5DY9 A;  1I5L A;  1M27 C;  1YWP A;  1AWJ A;  1OPL A;  4RTW A;  1HD3 A;  4OMO A;  4M7D D;  1TTH B;  4RCC A;  3IQL A;  2VUB A;  1G8X A;  1EFN A;  4M77 B;  3QZ5 B;  2L2P A;  4X34 A;  4EMK C;  2L0A A;  1WI7 A;  2LNV A;  2OTJ A;  1TUG B;  2RQU A;  2JVW A;  1Q86 U;  1JO8 A;  1BIB A;  3PE0 A;  1SSF A;  4A4F A;  1M90 R;  3X25 B;  2KRS A;  2YUO A;  1VQ8 T;  2K2V A;  1I1J A;  2JMA A;  4M78 F;  2HQE A;  2AHJ B;  1SSH A;  4BI4 A;  4DBF A;  1KJW A;  4PFO A;  4K11 A;  2DM1 A;  2JM9 A;  4WTO B;  2WQG A;  2ZPB B;  3LH5 A;  5I2M A;  1VOM A;  2GNC A;  1WIE A;  3OW2 P;  1K73 U;  2H3E B;  4O5V A;  3X26 B;  1VQ5 T;  1RI9 A;  1PD1 A;  1VQL Q;  1KG1 A;  2RO0 A;  4AG1 C;  2Y4X A;  1YIJ T;  4D8D A;  4RTT A;  3OYH A;  1MND A;  2K7A A;  3SFM A;  2ATC B;  2MCN A;  2YDL A;  3M9Q A;  1WXB A;  2RI5 A;  4B9X A;  4C0G A;  1MGQ A;  3HKS A;  3J80 E;  3H0I A;  4M7A F;  1PM3 A;  2FL7 A;  1M3B A;  3RDV A;  5CO7 A;  2RK2 A;  3MP8 A;  1VQ9 Q;  4F7U F;  2NWM A;  1X27 A;  4EMK A;  4M7A C;  2J06 A;  2VVK A;  1Q82 C;  3DLL A;  4X1V A;  3EH2 A;  5GAM j;  2DYI A;  3H0H A;  4PJO F;  4RKU E;  2RI2 A;  2M16 A;  2DTO A;  1HJD A;  1WHG A;  8AT1 B;  3OQ5 A;  2MWO A;  1VQ4 T;  3L1A A;  1GFC A;  2E41 A;  1PWT A;  4HVU A;  3TSW A;  1ABO A;  4LE9 A;  4JPB W;  1JEQ A;  3VS7 A;  1TH7 A;  4PJO C;  4RTX A;  1IB8 A;  2RK1 A;  2ZPF B;  3LYI A;  3Q1J A;  3CCR T;  4KH0 B;  1IHV A;  2E3I A;  4M75 G;  1WQW A;  3M56 A;  2PVG B;  5I21 A;  1UJ0 A;  2X35 A;  1YJW Q;  5IHK A;  1K8A C;  4DBQ A;  1GCQ A;  2HQH A;  3L2U A;  1U06 A;  2RD1 A;  5KYW B;  1ZSZ A;  4XU3 A;  5GMK i;  1KIK A;  1OZ3 A;  1NLO C;  2JJ9 A;  1FWZ A;  2ZAE A;  2LX9 A;  4ESR A;  2DIQ A;  1VQ9 A;  2L89 A;  2QQA A;  4BY6 B;  1AHJ B;  4R56 A;  3V7C A;  4JS4 A;  1Q81 R;  4J7I A;  1WXT A;  1G3S A;  3P8D A;  1W1F A;  3M59 A;  2NUT B;  1YIT T;  2DMO A;  1Q81 U;  3EHQ A;  1AZE A;  1WXU A;  1LOJ A;  5CQY A;  5FU7 B;  2MK5 A;  3VJP A;  3EGD A;  1I0C A;  5D6W A;  2RJE A;  1KK7 A;  2RQV A;  3G4S T;  1VIF A;  3RMS A;  5GAM d;  1IHW A;  4KH1 B;  2RNO A;  2LNH B;  1K0S A;  1M1K R;  1BI3 A;  4PFP A;  4A4E A;  2YHT A;  3PIO A;  2R5A A;  3SB2 A;  2E4H A;  4M7D G;  2KXC A;  2YSQ A;  4HA8 A;  3L2Z A;  1JQQ A;  2JS0 A;  1GBQ A;  2CH4 A;  3OYF A;  3G71 Q;  1YP5 A;  1PKT A;  4DQ2 A;  3HTR A;  1KD1 U;  4P5N A;  1K73 R;  1IGU A;  2EYZ A;  3V8L A;  2HAX A;  4JLI A;  1I81 A;  1M5Q 1;  2COZ A;  2NUP A;  1VQK T;  4C0D B;  4XTY A;  3CPW S;  3SHW A;  5FWC A;  4DEX A;  3CCQ T;  1H8K A;  2YRV A;  3E9G A;  2YLB A;  1B3Q A;  2DE0 X;  1OX9 A;  5GAN f;  2QTV A;  1WJS A;  2Y90 A;  3EG9 A;  2K5F A;  2LRQ A;  3AT1 B;  5GAO n;  4QW2 A;  1PG5 B;  4JDS A;  3VRY A;  3OYJ A;  1QP3 A;  3OMG A;  1NJI U;  2C06 A;  4XU2 A;  1NJI R;  4LNP A;  3VS4 A;  2OTL Q;  1RAG B;  1ZA2 B;  2HBP A;  3GOX A;  1H9E A;  2OJ2 A;  1Q81 C;  2M0Y A;  3L0O A;  1UDL A;  1ZS9 A;  3GF5 A;  4RG8 A;  2XIC A;  5HCK A;  3VS1 A;  5GMK l;  3I55 A;  2KI7 A;  4RTV A;  3MEW A;  3CCM A;  1QCO A;  2K5I A;  2HL5 C;  5HK0 A;  5FRM A;  4IIO A;  2LZ6 B;  5DLQ E; 
#chains in the Genus database with same CATH homology
 2E5Q A;  4M77 D;  1RL2 A;  2EJ9 A;  4II1 A;  4C92 E;  4A4K A;  2PVO B;  1UEB A;  1WJR A;  4KT0 E;  3A8L B;  1G3W A;  2DXC A;  4M77 C;  3UWN A;  4IUR A;  2OTL A;  3EAE A;  2RHU A;  1VQ9 T;  1B34 A;  3QZ9 B;  3QJY A;  3S3M A;  3VU3 C;  3CCV A;  3GIB A;  2EIF A;  4M78 B;  2LT1 A;  2FB7 A;  3JCM Q;  2LTO A;  4OF1 A;  4NL3 A;  1KQ2 A;  2XID A;  4C0Z A;  5LJ3 g;  2RH2 A;  2JZ2 A;  3UDC A;  4UC4 A;  2V8K A;  5GAN e;  2QDY B;  4MDW A;  5A0L A;  1FXX A;  1B34 B;  5FRO A;  4IUU A;  2IG0 A;  4IUV A;  2ZZD A;  4C8Q D;  2JN0 A;  3OYI A;  3CCQ A;  1UGR B;  3RMQ A;  2JOY A;  2E6N A;  2M9U A;  1KC8 C;  5GAN 6;  3M4G A;  4J6Y A;  3NTH A;  3HSB A;  2A7Y A;  4ZTJ A;  4BY6 C;  3E19 A;  1UGQ B;  2KDS A;  1DJ7 B;  2VYT A;  2EQJ A;  3MCA B;  2XI9 A;  3QYG B;  2QXF A;  5LJ5 h;  3CCU T;  1M1F A;  3S3O A;  3HRT A;  5LJ3 e;  3G7Z A;  1H64 1;  4BI8 B;  4PL6 A;  1VQP A;  2D0Q B;  2HD0 A;  2KSS A;  1NE8 A;  2KVQ G;  3A8O B;  2RJF A;  4A54 A;  3PFS A;  3C12 A;  4N4H A;  1U8R A;  1QVG S;  2EQM A;  5CIU A;  3LH0 A;  4E7K A;  1Y96 A;  5LJ5 d;  2QTX A;  3PGG A;  3WXM B;  5LJ5 e;  4M75 D;  2DKG A;  3LWH A;  4C8Q G;  2DO3 A;  4XK8 E;  2K57 A;  5LJ3 h;  4MZM A;  4BUG A;  1UB4 A;  1BYM A;  3FIF A;  4PLL A;  1XTD A;  3MP1 A;  1M1G A;  3UPU A;  2QEX T;  4E7J A;  3CBP A;  5CKH A;  5EG2 A;  5CR2 A;  4HT8 A;  1YJW T;  3CC7 A;  2VGM A;  3DKM A;  3A8G B;  4M78 C;  2LCL A;  2JNG A;  2QQR A;  3O8V A;  3HHT B;  4M78 G;  4C8Q C;  5DM7 R;  1ZBX A;  1VQ6 A;  1ZHI A;  3GNG A;  4YTL A;  4F7U E;  1N27 A;  1GXI E;  3CCM T;  4LD6 A;  2MI6 A;  4M75 F;  4C0D C;  4ZTF A;  4QVZ A;  3RES A;  3L2V A;  3CCU A;  1VQN A;  4FT2 A;  5GAM g;  3CPF A;  3QUI A;  1BI0 A;  4F7U B;  4ZN3 A;  5GMK h;  2CZ0 B;  3OYB A;  5GAN j;  4J6X A;  3SWN B;  2XD0 A;  1H3Z A;  4D6W A;  2NLU A;  3CD6 A;  2GFU A;  1BKB A;  2LC4 A;  2RI3 A;  3PMT A;  4CRI A;  4ZGE B;  4PJO E;  3TCJ A;  1YI2 T;  4XTW A;  5FLX E;  2DD4 A;  1QVF S;  1N6A A;  4O6J A;  1VQO T;  3CCJ T;  3QII A;  2WSF E;  5HY6 A;  4Y91 A;  3CCR A;  1G5V A;  1BI1 A;  4A4H A;  4GY5 A;  2PU9 B;  1NZ9 A;  5LJ5 f;  1JB0 E;  3M53 A;  3OBY A;  4IUP A;  4A4G A;  2QEX A;  3JCM J;  1QP2 A;  4OVA A;  3EFR A;  3QXE B;  3RKY A;  5C6S A;  3L2W A;  4E7L A;  4OMF B;  3QHS A;  4ME7 A;  2CYZ B;  4PJO G;  4M77 F;  5CKD A;  4L5G A;  5GAN 4;  1QVP A;  3CMA A;  3E1S A;  3OS2 A;  3TU4 K;  2EQK A;  5A2Q E;  3JCM P;  1VQ4 A;  2BKD N;  2PUO B;  5C0M A;  3OW2 A;  4M7A B;  5DLO A;  3QO3 A;  2DVE A;  3UT1 A;  2ZPI B;  1K73 C;  4F7U G;  3TRE A;  4IKF A;  1PSF A;  4Z02 A;  2ZPE B;  4TVR A;  1S72 T;  2RB6 A;  3OS0 A;  3V8J A;  3FLG A;  4M7D A;  5KE2 A;  3S6W A;  4C0F A;  5J39 A;  2E6Z A;  4PLI A;  3OYY A;  1KQS A;  4PJO D;  3PTA A;  3OYG A;  4LDU A;  2PUK B;  2EKO A;  2JTM A;  2GCX A;  3OS1 A;  4XQ3 A;  3OBW A;  4IUQ A;  2I2L A;  3ZBD A;  4XTZ A;  2X4X A;  2QA4 T;  3CME A;  2LDM A;  4PJO B;  5FU6 C;  3CPW A;  2H3J A;  3CXC A;  2RJD A;  3HRS A;  1WPY A;  1KHI A;  5CVI A;  3NTK A;  3M4Y A;  5GAO q;  4JRQ A;  4OB0 B;  3ME9 A;  1M8V A;  4KUI A;  1VQM T;  4M7A E;  5DY9 A;  2QI2 A;  2OTL T;  5IN1 A;  1I5L A;  3BDL A;  4QQ6 A;  3PMI A;  5GAN 2;  3VYG A;  4M7D C;  3H6Z A;  4KUL A;  3JB9 J;  1KHC A;  4M7D D;  3OS5 A;  2R5M A;  4RCC A;  4L59 A;  4BI3 A;  3X28 B;  2MMP A;  3ER0 A;  4HT9 A;  5HKC A;  2QQB A;  3WVE B;  2VUB A;  2A3L A;  5GAN d;  1UGP B;  4M77 G;  1XOV A;  2VV5 A;  1M9S A;  3OYC A;  2MWP A;  3CME T;  1YCY A;  2PQW A;  4XU0 A;  4BE0 A;  4M77 B;  1JJ2 A;  3WVD B;  3QZ5 B;  3CEY A;  1BI2 A;  3LGF A;  2GQV A;  3FDR A;  4X34 A;  5GAM h;  3J7A F;  4M77 E;  3JCM f;  2VC8 A;  4EMK C;  2M0O A;  2LNV A;  3CCS T;  2MF2 A;  4JRI A;  2DTH A;  3DLM A;  4JRK A;  4RCB A;  3CCL A;  1R8O B;  2D9T A;  5J26 A;  3ZFJ A;  2OTJ A;  3C4S A;  1D3B B;  1UGS B;  2CKK A;  1Q86 U;  5KH6 A;  1BIB A;  5IAY A;  2K5L A;  4FM4 B;  3C95 A;  2BIV A;  1SSF A;  4M78 E;  4A4F A;  5AYF A;  4BB7 A;  3JCM b;  4Q5W A;  4C8Q B;  3X20 B;  4ATO A;  4RMO A;  5CAI A;  1VQ8 A;  3X25 B;  3DB3 A;  1M90 C;  2M1H A;  4X9D A;  2JTF A;  1VQ8 T;  2HNI A;  2K2V A;  1Y96 B;  4OGC A;  4C5I A;  4M7A G;  1VQL A;  4M78 F;  3J81 E;  2HQE A;  3AHU A;  4FL6 A;  3MEU A;  2AHJ B;  2XHC A;  3TEE A;  5CQX A;  4BI4 A;  3I55 T;  2RM4 A;  2DJZ A;  4EDU A;  3G71 T;  3LGL A;  3MHX A;  1YHQ A;  2VXE A;  5J3B A;  2ZPB B;  4C8Q F;  3BDU A;  5I2M A;  2XU8 A;  3S3N A;  2L5Q A;  3QPH A;  3JCM g;  3JB9 I;  3FRN A;  2JVV A;  4OB1 B;  1KC8 U;  1YIT A;  4C5H A;  2DTI A;  4OP0 A;  1K73 U;  3X24 B;  4GLK A;  3VUB A;  3CC2 A;  5D6Y A;  1RI0 A;  4DOW A;  4M7A D;  3M55 A;  4O5V A;  3RKX A;  3X26 B;  1VQ5 T;  5CKF A;  5FU7 C;  3OYL A;  2RO0 A;  4ZGD B;  5M9O A;  3M58 A;  3KUF A;  2EAY A;  3CC4 T;  3CCE T;  1KG1 A;  3JCM d;  1Q7Y U;  2Y4X A;  1YIJ T;  4MMK A;  4XTV A;  3OYH A;  5KE3 A;  2D6F A;  3SFM A;  5FRN A;  3HFO A;  4Y28 E;  1M1K C;  4B9W A;  2DZ9 A;  2XDD A;  3ASK A;  2X4Y A;  3CMA T;  4HCC A;  3M9Q A;  3VKI A;  2RI5 A;  3LLR A;  3V7R A;  4B9X A;  4C0G A;  1MGQ A;  1NPP A;  3HKS A;  3JRZ A;  4C92 A;  3J80 E;  2LCC A;  4M7A F;  2F5T X;  3MEV A;  1VQ7 T;  2PVD B;  4LD9 K;  3OY9 A;  3SD4 A;  2FL7 A;  1YJ9 T;  4QVC A;  2X4W A;  1JBM A;  1X6O A;  3MEA A;  3OSS C;  3P8B B;  5CO7 A;  2RK2 A;  5A0G A;  1W2B A;  5GAN g;  3BY7 A;  3MP8 A;  1YJN A;  3QKJ A;  1XQH A;  4BD3 A;  4PKC C;  4ZN1 A;  1VQP T;  4E47 A;  4PJO A;  1I8F A;  2O4X B;  2RHY A;  4F7U F;  3GP8 A;  3OYE A;  1EIF A;  4KBM B;  4DA4 A;  2E65 A;  4M75 C;  4C92 G;  3QDR B;  2ZPH B;  3JB9 G;  4EMK A;  4M7A C;  2KMT A;  1M90 U;  1Q82 C;  3DLL A;  1FX7 A;  4ZGJ B;  3JCM X;  1P92 A;  5KCH A;  5GAM j;  3LWI A;  1LJO A;  3OYA A;  1VUB A;  3OA6 A;  5LL6 S;  4PJO F;  4RKU E;  1QVF A;  2RI2 A;  2E64 A;  2CZ7 B;  4XTX A;  4BAC A;  4M7D B;  2M16 A;  2DTO A;  3OW2 S;  2CGH A;  1YJW A;  5L8R E;  1O9S A;  5GAN h;  5GAN 8;  1YJ9 A;  3OQ5 A;  3CC7 T;  1I4K 1;  2MWO A;  3F70 A;  3PNW C;  5GMK j;  1N9S A;  5GAO m;  1VQ4 T;  4MDX A;  4HCZ A;  3L1A A;  2KY9 A;  5LJ5 g;  2E41 A;  2EYQ A;  5LJ3 d;  3M57 A;  1WNL A;  1HK9 A;  3EFS A;  4IUT A;  1W4S A;  4C5E A;  1VQM A;  5GAN 3;  2LVM A;  5GAN 7;  1TH7 A;  2WSE E;  3A5Z B;  3OB9 A;  4MML A;  3JCM c;  4PJO C;  5FU6 B;  5GMK e;  3FJP A;  3FC3 A;  5GAO r;  2E10 A;  5CKE A;  1YIJ A;  2RK1 A;  2ZPF B;  3LYI A;  3MO8 A;  3Q1J A;  3CCR T;  1ZQ1 A;  2KQW A;  2DXU A;  3RUX A;  2EQU A;  4C92 D;  1Q82 U;  5GAO l;  2JUF A;  4QQG A;  3G4S A;  3A8M B;  2LQ8 A;  4JUV A;  4M75 G;  4C92 C;  2FHD A;  4DOV A;  1WGS A;  1WQW A;  2K4Y A;  2ZGW A;  3QYH B;  5GAM e;  3CC2 T;  2EJG A;  3M56 A;  1O75 A;  1IRE B;  2PVG B;  4FT4 A;  5I21 A;  2X35 A;  3PT9 A;  3URG A;  2DZC A;  4FU6 A;  4ELY C;  4C8Q A;  4L6V 5;  1BIA A;  3L2Q A;  1K8A C;  3HFN A;  3JCM V;  1KQS S;  2EJF A;  1XNI A;  5CK9 A;  3SWN A;  5LJ3 f;  3L2U A;  2L3R A;  3G6E A;  2DD5 A;  4HKE A;  1D3B A;  2DPP B;  4X9C A;  2FYK A;  2Y4Y A;  4C8Q E;  1VQ6 T;  2R58 A;  3CBO A;  2RD1 A;  4V2S A;  4LDW A;  3JCM h;  3CXC S;  4XU3 A;  5GMK i;  3OMC A;  1OZ3 A;  4A53 A;  2GF7 A;  1Y7X A;  3BW1 A;  3CCV T;  2G3R A;  2DXB A;  1VQ7 A;  5CCA A;  1FWZ A;  1KD1 C;  5LJ3 j;  3I56 A;  3OYN A;  3VYH B;  1NJI C;  2LX9 A;  3RIR A;  3GPL A;  2DIQ A;  1VQ9 A;  2VXF A;  3I56 T;  2L89 A;  1OZ2 A;  2DK3 A;  3T9N A;  2QQ9 A;  2QQA A;  4BY6 B;  5IT9 E;  1AHJ B;  2BUD A;  4R56 A;  2ZPG B;  1X01 A;  3V7C A;  4JS4 A;  4J7I A;  4EMK B;  1QW1 A;  1G3S A;  2LT4 A;  2EWN A;  1IZ6 A;  3C94 A;  5D6X A;  3OYD A;  1N8R U;  3P8D A;  4J83 A;  1VQO A;  3QSU A;  3CCE A;  3CC4 A;  3E9F A;  3FEO A;  3BFM A;  4J8O A;  4M75 E;  4M7D F;  2GFA A;  2F69 A;  3JSC A;  1U1S A;  1G3Y A;  3M59 A;  5GAM f;  4NOY A;  2LQK A;  4EMG A;  1PSE A;  4NL2 A;  3GNF B;  4MZP A;  3M5A A;  1YIT T;  2DAQ A;  1Q81 U;  1K9M U;  2QA4 A;  2K3X A;  3OSV A;  4CI0 C;  3HPW A;  5HK3 A;  3R6O A;  2P0K A;  4BE2 A;  2RHZ A;  2P0Q A;  4M78 D;  1LOJ A;  5CQY A;  5FU7 B;  3G6E T;  1OI1 A;  4E7H A;  3ZEH A;  3VJP A;  3GLX A;  4XAX B;  1U1T A;  3INZ A;  3G71 A;  3NTI A;  3JB9 H;  5D6W A;  2DEQ A;  4EPC A;  2RJE A;  1S72 A;  1NPR A;  1YBY A;  2KAF A;  2HQX A;  1MHN A;  2EFI A;  3LX7 A;  3G4S T;  1VIF A;  3RMS A;  5GAM d;  3L2R A;  2E70 A;  4KUD K;  1VQL T;  4N4G A;  3JCM W;  1BI3 A;  4A4E A;  4M78 A;  2YHT A;  4XU1 A;  2DXT A;  3PIO A;  2R5A A;  4VUB A;  3HP9 A;  3SB2 A;  2VGN A;  4M7D G;  2OAU A;  4BE1 A;  4J6W A;  4MZT A;  2X4J A;  4XTU A;  5KCO A;  3OYK A;  1N8R C;  3CBM A;  4HA8 A;  3L2Z A;  3HL8 A;  2XG8 D;  2OTJ T;  3N5B B;  3JB9 F;  4M7A A;  2F5K A;  1WJQ A;  4M75 B;  5GAN 5;  2RHI A;  4C92 F;  4EMH A;  2XKO C;  3OYF A;  3CCS A;  3QBY A;  3OYM A;  3KBG A;  4FSX A;  4LDX A;  3VUZ A;  4DQ2 A;  1KD1 U;  4P5N A;  2FVU A;  3H8Z A;  3HRU A;  2CZ1 B;  1V29 B;  3V8L A;  2CS7 A;  2O01 E;  5GAO p;  4FIB A;  1YJN T;  3CD6 T;  4LDV A;  2HAX A;  4JLI A;  1I81 A;  1M5Q 1;  1VQK T;  4J5Y A;  3NFC A;  4N0A C;  1Q7Y C;  2IVW A;  5LJ5 j;  3JCM e;  4JS5 A;  3LW5 E;  4C0D B;  4XTY A;  3V8K A;  4QVD A;  3CPW S;  1QVG A;  3JB9 D;  2WAC A;  2CZ6 B;  4JLG A;  2MAM A;  5CKB A;  3CCQ T;  1K8A U;  1M4Z A;  3MP6 A;  3M54 A;  2YRV A;  4OB2 B;  3SWN C;  2KK4 A;  1LNX A;  2DIG A;  3E9G A;  4OGE A;  2V8I A;  4F7U A;  3QJ6 A;  2YLB A;  2E12 A;  2K3Y A;  2XDP A;  4N0A A;  5GAN f;  2Y90 A;  1WJS A;  4LDY A;  4WF2 A;  1W2B S;  3L42 A;  4J7F A;  2K5F A;  2LRQ A;  3RER A;  4QQD A;  3V7S A;  4N4I A;  2RJC A;  4QW2 A;  5GAO n;  3KXT A;  4HCB A;  4E7I A;  2RHX A;  1X75 C;  4JDS A;  3SDZ A;  3OYJ A;  1QP3 A;  3OMG A;  4M77 A;  2L8D A;  4JRP A;  5GMK m;  1KQ1 A;  2RA2 A;  1NJI U;  1WQ7 A;  4XU2 A;  3CCL T;  2C06 A;  2XDB A;  4C5G A;  3PIP A;  1G3T A;  5A0D A;  3CCJ A;  1VIE A;  2ZCF B;  4RG2 A;  4BDZ A;  2QQS A;  2R57 A;  3DB4 A;  1VQK A;  1VQN T;  4BDY A;  2HBP A;  3GOX A;  1JJ2 S;  1VQ5 A;  1Q81 C;  1YI2 A;  1K9M C;  2XK0 A;  2O4X A;  1N9R A;  3JAM E;  1Y71 A;  4M7D E;  3GF5 A;  2P0P A;  5I2S A;  1Y07 A;  4OB3 B;  4RG8 A;  2B8A A;  1JRI A;  1M1K U;  2V8J A;  2XIC A;  2E1H A;  5GMK l;  3I55 A;  3RKW A;  4JJN K;  1Q86 C;  3QG1 A;  2WSC E;  3MEW A;  3FB9 A;  3A8H B;  3VV0 A;  3CCM A;  1YHQ T;  1OYX A;  2P4T A;  4NS5 A;  2K5I A;  4ELZ C;  4C92 B;  5HK0 A;  4R55 A;  4M75 A;  5FRM A;  2YLC A;  3P8H A;  3MET A;  5DLQ E;  1HXD A;  4PNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...