3FLGA

The pwwp domain of human dna (cytosine-5-)-methyltransferase 3 beta
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
135
structure length
135
Chain Sequence
b'EYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (cytosine-5)-methyltransferase 3B
publication title Crystal Structure of the PWWP domain of Human DNA (cytosine-5-)-methyltransferase 3 beta
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 33
structure length 135
sequence length 135
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.50 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 PWWP, helical domain 3flgA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3flgA01
5J39A 4QVZA 5KH6A 1RI0A 3E9GA 3MEAA 3PNWC 3OY9A 3H8ZA 3UWNA 4A4FA 3OYKA 4C5EA 3OMCA 4IUVA 2RJDA 2RJFA 4A4EA 5KE3A 2DAQA 2X4WA 3FLGA 3NTIA 3OS0A 3BDLA 2MWOA 3OYFA 1MHNA 2RHZA 3OYIA 4A4HA 2LCCA 2QQRA 3MEVA 3PMTA 3S6WA 5FRNA 2EQJA 2DIGA 3UT1A 2F5KA 3M9QA 3NTHA 3MP1A 2LRQA 5J26A 4L59A 1G5VA 5D6WA 2X35A 3S3NA 3MEWA 3QJ6A 2GF7A 4PLIA 1WJRA 2G3RA 2MWPA 2E5QA 4BACA 5IN1A 2X4XA 3KUFA 2XK0A 3QKJA 5C0MA 3OYLA 2DIQA 3L2RA 4NS5A 2K3YA 3LYIA 3Q1JA 4E7KA 4GY5A 4BE0A 2HQEA 4CRIA 4X34A 3P8DA 1H3ZA 2LTOA 3MEUA 3L42A 2B8AA 4E7IA 3SD4A 4RG2A 4C5HA 3L2WA 5KE2A 4OVAA 3LGFA 3P8HA 3PFSA 2R5AA 3CEYA 3S3OA 3DB4A 3MP6A 5M9OA 3E9FA 1SSFA 1OYXA 3OB9A 2RHUA 5IAYA 2RHYA 5KCOA 4N4GA 2RHXA 3OYCA 4PL6A 2LDMA 1OZ3A 3FC3A 3L2QA 3LLRA 4IKFA 5CIUA 2RJEA 3MP8A 4QQGA 3GOXA 4IUPA 3OYJA 5KCHA 2RJCA 3ZEHA 2RO0A 2BKDN 3LGLA 3META 3OYDA 2D9TA 1OZ2A 1WJQA 2RHIA 3QBYA 1KHCA 3L2UA 2GFUA 4LD6A 4E7LA 3OMGA 2M0OA 2GFAA 2L89A 4IURA 2FHDA 3FEOA 3OQ5A 5C6SA 3OA6A 4BE2A 2WACA 2L8DA 4E7JA 1WGSA 4QW2A 3L2VA 4EDUA 3LH0A 2R57A 4BD3A 2XDPA 2EQMA 2RI5A 3C4SA 2O4XB 3ASKA 4C5GA 2M16A 4PLLA 3OYHA 3PMIA 3O8VA 3OS2A 2CKKA 3DB3A 3H6ZA 3OYGA 4N4HA 2VYTA 3MO8A 2P0KA 4IUQA 4Z02A 2JZ2A 4HCZA 2BIVA 4B9WA 3OYMA 3F70A 1WJSA 3LX7A 2X4YA 3DLMA 2RI2A 4QQDA 2BUDA 2QQSA 5FROA 4BDYA 4FL6A 5D6XA 2HQXA 2LVMA 3NTKA 1N27A 2RI3A 3EAEA 4E7HA 4N4IA 3OYBA 2L3RA 4ZTFA 5FRMA 2R5MA 2JTFA 4A4GA 3OYAA 3S3MA 2EKOA 2NLUA 2EFIA 2YRVA 3QIIA 3ME9A 4FU6A 4IUTA 1OI1A 2E6NA 4BE1A 4UC4A 4ZTJA 3FDRA 3OYNA 1XNIA 4B9XA 3OYEA 4QQ6A 2M1HA 2PQWA 2EQKA 5D6YA 4C5IA 3OS1A 4IUUA 2EQUA 2IG0A 2K3XA 4II1A 4Q5WA 2O4XA 2R58A 4BDZA
chains in the Genus database with same CATH superfamily
1K1ZA 1ZSZA 3RNJA 2OAWA 1UGQB 2KE9A 2ZPBB 3KXTA 3EFOA 1V66A 3H9NA 4AFSC 5CKFA 4OF1A 3CPWS 3UWNA 4J7FA 4A4EA 3NTIA 5CKHA 2KNBB 2LJ0A 2MOXA 1RAEB 1EX4A 2K2MA 4KGZB 3MCAB 2DIGA 2MI6A 2YLCA 3JCMV 4JRPA 1XJWB 5KYWB 4RTTA 1V76A 2XK0A 4XTZA 2AZVA 1YJWQ 1WFWA 1H92A 2L2PA 4M78B 5GAN3 4KH0B 2EGCA 5GAMd 2FZCB 4OVAA 3S3OA 2J6OA 2C0OA 3MP6A 4X9DA 1RAHB 1YP5A 1M1KR 1MGQA 2HMAA 2A08A 3OYJA 3P8BB 2ZAEA 4M77A 1VUBA 1P92A 5GANf 1KHCA 3CCMQ 2CP5A 2A7YA 3VS2A 4DBRA 1VYTA 2JJ9A 1AWWA 3CXCA 4E7JA 1VQPQ 3CBPA 2LCSA 4BI8B 3CCLA 1GL5A 4C92E 2CH4A 2I0NA 2RQRA 1U3OA 1X27A 2KRMA 2O4XB 1BIBA 4OB1B 3CPFA 1W1FA 1BI1A 4M78C 5GMKi 2QQAA 1NYFA 3FJPA 3CCUA 2LP5A 3DLMA 1W2BS 4F04B 2JS0A 4LE9A 2D0NA 3E2UA 4IIMA 3IQLA 1QQJA 1VQ9T 2DD4A 3CCVQ 2WSEE 4E7HA 4M78F 3EG2A 4QVDA 1ZX6A 3VYGA 2JMAA 2NWMA 1GCQA 1WA7A 1Q7YU 2EQKA 4RTYA 5LJ3d 4E7ZA 2IG0A 4C8QG 2DL8A 3AHUA 2LMJA 1GBQA 1M2VB 1S72Q 1YITQ 1KQSA 2IPOB 4C5EA 2KROA 1T3LA 4KGXB 1IREB 1K9AA 2GQVA 1NJIR 2QQRA 2CS7A 3S6WA 4AG1C 1HJDA 3HPWA 4DA4A 1ABQA 2ODGC 1KC8U 1KG1A 1WDXA 4BACA 4PJMA 4PJLA 2KXDA 5LJ5f 2RQVA 3VS0A 2NUPB 4AT1B 2K3YA 4Z88A 1KIKA 5EG2A 1HXDA 5GAOp 2QNFA 2G6FX 2DL7A 1YBYA 1H3ZA 4XU2A 3SHWA 2QI2A 5HCKA 4C92G 4JZ3A 2EYQA 3JB9I 1X6BA 4RMOA 1WHMA 5DM7R 2DKGA 2P0PA 2FZKB 2RHUA 4HXJA 2V8IA 2F2WA 1X43A 2KEAA 3QWXX 5A0GA 3LLRA 4C8QB 3CCJA 2LZ6B 4XQ3A 3RKYA 2DZ9A 3VU3C 2RB6A 3LGLA 1QKXA 2YT6A 3OYDA 1VQ5A 1KD1U 1VQ6T 2LJ1A 1N5ZA 1VQKQ 3FEOA 5C6SA 1ZA2B 2RM4A 5IXFA 3L2VA 2CSQA 3JCMc 5GAN8 1R0CB 2EGAA 2DRMA 1DJ7B 4KH1B 5GANj 2PUOB 3KBGA 1YCYA 3RDVA 1OEBA 5FROA 1PD0A 3ZBDA 4EMKA 2DTIA 1I81A 1PRLC 1PSEA 2ZGWA 3EH1A 1AD5A 2RI3A 1HD3A 3CCST 2ZPHB 3CPWA 2QEXA 5I22A 3S3MA 4R0KA 3G71T 4RG8A 2EYYA 2L3PA 4C8QC 1FMWA 1UGSB 3OYEA 1OPLA 3CCLQ 2K3XA 1SRLA 2DXCA 4QVZA 3N5BB 2VC8A 2VASA 1QCNA 4C8QF 1HSQA 4DOVA 3PVLA 2RJDA 2J6KA 3M0RA 5GAOq 1JQQA 2QK0A 1K73U 2I2LA 4C0ZA 2L3QA 1BI3A 3UA6A 1G5VA 1RACB 1BBZA 1I5OB 3CD6A 3OYLA 1QWFA 1YHQT 4GY5A 2IVWA 2LTOA 1IHVA 5I2SA 2KGTA 1D1BA 3PFSA 2RD1A 2HKNA 3CMAQ 1IGUA 2FPDA 2H3JA 1WLPB 4MZTA 4XAXB 3JCMf 5LJ5j 3NHNA 3JCMb 2HCKA 1BU1A 2KYBA 5GAMe 4DBQA 1Q82U 3CXCP 4OB2B 1WJQA 4FCYA 4QKUA 2GCXA 2L89A 1W2BA 4DQ2A 1VYVA 1QVGS 2BE7D 2H8HA 1WIEA 1C1AA 4KRTA 3OYHA 5HY6A 2KVDA 5L23A 1ZUYA 2NUTA 1OQKA 2D0QB 5I2MA 2HEQA 1ZHIA 3OBWA 1YIJQ 1SRMA 2DJQA 4HT8A 4JS4A 2Y4YA 5A0LA 1Q7YR 5KYNA 2P4RA 2LNVA 1KQSP 3VUZA 5HKCA 2L5QA 3G6EQ 4UZWA 4RCCA 2DVEA 4M7AE 1N8RU 4IUUA 3CC2T 3A8MB 1RI0A 1AZEA 2HSEB 2DTHA 5KYUA 2JM9A 5CVIA 5LJ3e 1KC8R 3MP1A 2LRQA 4M7DB 4R55A 2YRDA 1Q86C 1IRXA 2FEIA 2VXFA 4RCBA 2XG8D 5IN1A 3SWNC 3CCUT 2QEXQ 1IB8A 4PFPA 2DRKA 4XU3A 4FW2A 4X34A 2ROLA 3E19A 2GTJA 5IT9E 1V29B 4JJBA 1E6HA 2R5AA 7AT1B 3X26B 5IHKA 2RHXA 2J7IA 1JB0E 1R8OB 1VYUA 3FC3A 2JM8A 2EJFA 3EGDB 1KD1R 4C92D 4EIKA 1M8MA 1U5SA 3JB9J 5GJVB 1U1SA 1QMCA 1YJ9T 1XTDA 2Y4XA 4JJDA 4LN2A 2AK5A 1WGSA 2YUQA 4M7AG 1E7LA 3M56A 1AEYA 2XDPA 3R6OA 2M16A 1ZSZB 3JV3A 3EFOB 1VQOT 2M51A 3EH2A 4C0DC 3SFMA 2JZ2A 3CPWP 1M1KC 4FSSA 3TSWA 2XICA 4Z8AA 4OMMA 2X9HA 4JS5A 3JCMJ 3QUIA 2QGFB 1G3SA 4N4IA 3RMQA 1I0CA 4M4ZA 4JRIA 4ZTFA 3THKA 2E64A 1VQLA 2JTFA 4XTVA 2NLUA 2ATCB 2RN8A 4CC7A 3CCJT 4FYVB 4L5GA 2WSCE 5CCAA 3I55T 2CDTA 2EQUA 2JUFA 4IURA 5J39A 2DX1A 1X6GA 5IH2A 5IHNA 2L3SA 1KFZA 3OYKA 1K73R 1AVZC 3M53A 3BDLA 2MWOA 3OYFA 2RHZA 1TOVA 4J6WA 1ZSZC 4M77B 1WXUA 3CCRQ 1IXDA 1M27C 1G8XA 2C0TA 2LC4A 2M02A 2QYZA 2ABLA 2RQTA 1BI0A 4C5HA 2XIDA 4VUBA 4P5NA 2ZPEB 1TS9A 1VQ6A 2E12A 2E41A 4M78E 5GAMh 2JVVA 4FW1A 3PVQA 2QQBA 1Q82R 1QVGA 1NJIC 4QQGA 1W2BP 1VQNT 2A37A 2BZYA 3HRSA 4PFZA 1AWXA 3CCET 2HL3A 2DETA 1SSHA 1YCSB 4M7AC 3HFNA 1I07A 1YI2A 3OQ5A 3JB9D 2GBQA 4JRKA 1D3BA 4M77C 3G4SA 4EDUA 2QAZA 3U23A 1LVKA 3CCSA 1O75A 3M0QA 4M75A 4C5GA 3CC7Q 4M7AF 4GLKA 3G71A 1D1AA 1AOJA 1K9MU 3BE3A 1X2KA 3VJPA 1X75C 4BDYA 2V26A 4MZMA 2BZXA 4ZN1A 2JW4A 1YFNA 1GJJA 1WHGA 2AKLA 5EC7A 4PJOA 4UC4A 1N8RR 4NL3A 5D6YA 1WHKA 4TVRA 3VRYA 1VQ9Q 4OMLA 2OTJT 2EKHA 5GAMf 1QVFP 5LJ3h 3CC4A 1N6AA 1Y7XA 5LJ5g 2V1QA 4WTOB 2F5KA 2KVEA 2X35A 5A2QE 4D8DA 1E7DA 3A1PA 3SDZA 1VQ7A 5CKBA 1MNEA 1QP3A 1WHLA 2LX9A 3DB4A 4XK8E 2E3IA 3FRNA 1FWZA 5CIUA 4BI3A 3MP8A 4EMKB 2ENMA 2MYSA 3ZEHA 1JBMA 1U06A 2M0OA 1U1TA 2EYZA 2MCNA 3OA6A 4C8QE 2XHCA 2VB6A 3EHRA 1M5Q1 1AHJB 1AT1B 3MHXA 2QDLA 3HSBA 4DEXA 5LJ3f 1GL9B 1Z9QA 5DY9A 1VQ6Q 2LQNA 4F17A 4IUQA 2DEUA 2BIVA 3EHQA 2BE9B 3DKMA 3KFVA 1RLPC 1VQMQ 4K11A 1WPYA 1PC0A 1Y07A 4OMQA 4YTLA 3CC2A 1M90U 2F1LA 4IIOA 3V8KA 4A4GA 2EKOA 1WHJA 1SEMA 3QHSA 3CCQT 1T0HA 4EMKC 2B86A 2CZ7B 4KGVB 2LQWA 2PQWA 2DM1A 3QO3A 3I56Q 2K79A 1D0XA 3CCSQ 3VS7A 2RNAA 2DZCA 3O5ZA 1OU8A 4ZGDB 4A4HA 4CC3A 4LDWA 3CMEA 1H9FA 3VS4A 2E5QA 2P0QA 1VQ4A 2X4XA 5GAN5 3QZ9B 2DXUA 3X20B 4QVCA 1Q7YC 1ZS9A 3VYHB 2E5KA 4HT9A 2XD0A 3MEUA 2EW3A 1QVGP 1VQLT 2SEMA 1M9SA 3M5AA 3JCMg 5IAYA 5AT1B 1WHHA 1YJ9A 2NUTB 1D1CA 1YHQQ 2HD0A 1X01A 2LDMA 1AWOA 4LNPA 4ZN3A 3PE0A 5CKEA 1OULA 2RJCA 1KC8C 2DJZA 5FWCA 2EQIA 1SHFA 6AT1B 2LJ3A 3GPLA 1VQOA 1M3CA 1W70A 4XU1A 1NM7A 3X28B 5GMKe 2E65A 3OBYA 1SG5A 4NOYA 2XU8A 1H1JS 1QVFS 4Y91A 2A28A 3MJXA 3PIOA 3ASKA 2E10A 3VKIA 1K9MR 3PMIA 2PZ1A 3TQ7P 4J9BA 3REAB 4N4HA 2FB7A 1PG5B 4Z02A 4B9WA 1NE8A 1QCOA 3I55A 1RI9A 1JJRA 2QGGA 2GQIA 4FL6A 2K57A 3TU4K 3JCMP 1KD1C 1YJWT 3URGA 2YRVA 3GIBA 5LJ3j 2HBWA 2X4JA 4V2SA 4LXCA 1FX7A 1M30A 5GJWB 1HYOA 4C5IA 5CKDA 4EMHA 5IXBA 1VA7A 3MEAA 2LX7A 1YI2T 2KMTA 2C06A 2K3BA 1A8VA 1HK9A 3G4ST 3RESA 2X4WA 4J7IA 4CC4B 3MKDA 3EG9A 2LCCA 2CSIA 3PMTA 1MMGA 3UT1A 1GRIA 3NTHA 3CC2Q 1LCKA 4KBMB 3M54A 4C0GA 2DYBA 5LJ5d 5I11A 5KYWA 1QKWA 2O9VA 2HQEA 5I21A 4M78D 4M7DE 1C0MA 2FL7A 3NFCA 3TVTA 3GP8A 1VQNA 3L2WA 3ZFJA 4M78A 3LGFA 1ZQ1A 3CEYA 3CCEA 3CCUQ 1K0XA 1K73C 1RL2A 3OYCA 1QWEA 2RJEA 1A0NB 3GOXA 1JEGA 1UHCA 2P84A 1OV3A 2LD7A 2CT4A 2KRSA 3PT9A 4LD6A 1EN7A 3CC4T 1WYXA 4HKEA 4LDVA 2AZSA 4AFZC 4J6XA 1YJNA 3PIPA 9ATCB 3M0TA 4OMOA 1E6GA 1XOVA 3DB3A 4J6YA 4JUVA 1VQ7T 1YJ9Q 3FJ5A 1M1GA 1Q82C 1GFCA 2RI2A 4QQDA 1KSWA 1M90R 1PNJA 2HSPA 5D6XA 2OTJA 3INZA 2Z0WA 1PM3A 3NTKA 4J9DA 3EAEA 1D0YA 4F7UA 2JTEA 2QNCA 3HFOA 1LJOA 4M75G 5AYFA 1VQOQ 1KQ2A 1KQ1A 2KW9A 1EZZB 2O01E 5CK9A 1H3HA 4FYYB 2K5IA 5L8RE 4M7DG 5KYXA 2KT8A 2R58A 1UGVA 3CBMA 1SKUB 3UF4A 2PVOB 4DBHA 2PUKB 3CCJQ 2COZA 2VXEA 1VIEA 2OTLA 1ZUUA 3I55Q 5FRNA 2KFVA 3QWYA 1VOMA 3PTAA 2SRCA 2FZGB 1VQ5Q 1VQKT 3S3NA 3MEWA 2MWPA 2RMOA 3C0CA 2RQUA 3Q1JA 1MV0B 1N9SA 1N8RC 2PVDB 3RR6A 2NUPA 2MK5A 1D3BB 4M77E 2DL4A 2MPHA 3EG1A 3P8HA 2DBMA 3JRZA 4M75B 1VQ8A 1N9RA 3GLXA 1JXOA 5KCOA 1M3BA 1OZ3A 3L2QA 2C0IA 5DLQE 2LNHB 1W6XA 4FYXB 1QVFA 2KSSA 2MIOA 4C8QD 2CH4W 2KDSA 5GMKh 2EYXA 4HVWA 2V8JA 2CP7A 2A8VA 4PJOB 2WSFE 3CMET 2DO3A 1VIFA 1VQ4T 1VQNQ 3UA7A 5GANe 4ORZA 4ELZC 3CCEQ 3EG3A 3V8JA 1TH7A 3CCQA 3F70A 1W4SA 1B34A 3I9QA 2E6ZA 4M75C 3CD6Q 4C92A 2DPPB 2EWNA 4NL2A 2KYMA 4LDXA 2OX7A 2H3EB 3TREA 4BUGA 3I5RA 4M7DC 1M8VA 4PKCC 4XU0A 4JDSA 2E1HA 3QIIA 4HVVA 2E6NA 4BE1A 2VVKA 2RH2A 4M75F 3HTRA 5CQXA 2NUZA 4M77G 1YWOA 3QJYA 1SPKA 4Q5WA 2FG0A 4M7DF 4WCIA 1QCFA 4PJOC 5CQYA 2RQWA 3OMCA 4RTUA 2XKOC 5GAN2 2JN0A 4J8OA 3NPFA 3RIRA 1M3AA 5A0DA 1CKAA 2E3HA 4L59A 2FRYA 2O31A 3QJ6A 3TCJA 1Y96A 4R56A 2QA4T 2LCLA 2KBTA 3V7CA 5ECAA 3L42A 3SD4A 3VS6A 2DFUA 2EYWA 5GMKm 1T3SA 2K9GA 2HAXA 2KQWA 2FVUA 2E4HA 5LJ5e 3HRTA 3X24B 1JO8A 3QPHA 3A8GB 4O6JA 1KJWA 2YDLA 3UDCA 1ZA1B 3FB9A 2D9TA 5FLXE 1G83A 3CQTA 3QBYA 1LPLA 4PJJA 3G6ET 1UGPB 4MZPA 3VUBA 4DBFA 4E7LA 1NLOC 3OMGA 1G2BA 1ARKA 4BE2A 1Y02A 2DE0X 1RABB 4RTZA 2AKKA 1YJWA 3VRZA 2RI5A 2XDBA 3C4SA 5GANg 2W0ZA 3O8VA 5GAN4 1SHGA 1GKUB 2A3LA 2KVUA 2AIRB 3EFRA 2O9SA 1X69A 3SWNA 1WXTA 3I35A 3A8LB 1RLQC 1WZOA 1K8AU 2PNIA 1I4K1 8AT1B 5FRMA 1H8KA 1MNDA 3LH5A 5KYYA 3ME9A 4JLIA 1TUCA 2DA9A 3BY7A 2XMFA 2YRCA 1H641 4M77F 1VQPA 3BW1A 3V8LA 4A54A 4DEYA 1K9MC 3E9GA 1H9EA 4WF2A 4ZNXA 2QQ9A 3CCQQ 1ZBHA 1CSKA 4EMGA 1YJNT 3OYIA 5J3BA 4OMNA 1WX6A 3SEMA 3BFMA 4M7DD 3HL8A 2L0AA 1QLYA 4XTXA 3QKJA 2X3WD 5C0MA 2DIQA 2X3XD 4Z89A 3L2RA 3LYIA 4E7KA 1LOJA 2HDAA 4BE0A 1Q81U 4CRIA 3P8DA 2COYA 1G3WA 2RK1A 4OMFB 2F5TX 4BI4A 1PCXA 1GCQC 3FIFA 3E9FA 1S72A 1RAIB 2AT1B 1M1FA 3H0HA 1VQLQ 2VV5A 2JVWA 1R77A 1FYNA 3L2UA 2JMCA 2RHIA 4LUEA 1NEBA 2OTLT 3L1AA 2D8HA 3JCMe 1BKBA 2WACA 2ROTA 5GANh 2V8KA 2W10A 2ZPIB 2QASA 1MUZA 4J5YA 3GF5A 2RA2A 1TG0A 3JAME 2X4YA 4ZGEB 2W51A 3EG9B 2DLPA 3VS3A 1VQ8T 1OU9A 1OX8A 2LQKA 1N27A 2DK3A 1TTHB 1MMDA 4ME7A 2EBPA 2COWA 1UECA 4E2FB 3G7ZA 4IUTA 2PTKA 1OI1A 1XNIA 1JXMA 2M1HA 3A98A 3C12A 1J3TA 5GAOr 1VQKA 1NBEB 4BDZA 3M59A 3SB2A 2E70A 3LW5E 3H8ZA 4N0AA 4A4FA 4F7UG 2HZYA 2DK4A 2O88A 2DAQA 1MHNA 4M7AD 1U8RA 1M90C 3MEVA 3BDUA 3TSZA 1WXBA 4M7AA 4M77D 2YLBA 1B07A 1YI2Q 2VGMA 1WQWA 1Z9ZA 4FM4B 4J9CA 3G4SQ 1I8FA 2DF6A 3CC7T 1M4ZA 1YNSA 2JT4A 4KT0E 1FMKA 3RKWA 5GAN7 1Q95G 3M58A 5LJ5h 3G71Q 4BY6B 1B3QA 1AZGB 2QTXA 2DL5A 1QP2A 4J9FA 4PNOA 2NYSA 1X6OA 1SF9A 4HVUA 2DBKA 5CR2A 2XDDA 2CGHA 5GAMj 4J9HA 4GLMA 4F7UB 2MAMA 3JCMQ 4ZGJB 5DLOA 3EGXA 1JU5C 2ED1A 2YHTA 3JSCA 4QW2A 4GBQA 4HCBA 2KRNA 4OMPA 5KYXB 4PLLA 2A36A 5D7UA 4E7SA 4FSXA 3CC4Q 1G3YA 1JJ2P 2VKNA 2P0KA 1ABOA 3M0SA 3OYMA 2YXYA 3CMAA 4OB0B 5FWBA 5GANd 1K8AR 3M55A 3UATA 1QW1A 4BY6C 1F1BB 4ATOA 2LVMA 1EFNA 1PKSA 3LWHA 3OYAA 1NLPC 3DLLA 1VQ7Q 4RUGA 2K6DA 4O5VA 4HA8A 4AFQC 2LT1A 1RUWA 1PHTA 1UB4A 4B6MA 2DL3A 5KYUB 1GBRA 2ZCFB 2OJ2A 4PK4A 2QA4A 3NMZC 4J83A 3FLGA 1YWPA 1GXIE 4F7UF 1BIAA 5FW9A 1Y0MA 3M9QA 5J26A 5GAOm 1Q81R 2K7AA 1YIJA 4NS5A 5GMKl 2KXCA 2HJQA 4A4KA 2B8AA 4E7IA 4RG2A 3OYYA 1ZBJA 5KE2A 2KY9A 3OW2A 1UEBA 3G6EA 1VQMT 2KR3A 3OB9A 3CCMT 1E7OA 2HL5C 4LDUA 1NG2A 1WQ7A 4FT4A 1OOTA 4Y92A 4MMKA 2HKQB 2V1RA 2YWWA 1VQPT 1B34B 2GNCA 4M75E 1PWTA 4OB3B 1GFDA 4C92B 1MV3A 3JCMh 4BB7A 2M9UA 4RTWA 2ZPGB 2Y90A 3VV0A 4LD9K 3I56T 2GFAA 2LQ8A 2DYIA 5CAIA 4BITA 1XQHA 2VWFA 2CP0A 1IGQA 3WVEB 2ZZDA 4BD3A 1NZ9A 2CP3A 4HCKA 3CCVT 4F16A 3M4GA 2FPFA 4PJOE 4HCZA 1D09B 2VGNA 2CZ0B 3JCMW 3CMEQ 2QQSA 2CREA 1VQ4Q 3X25B 2MMPA 1Y57A 1UDLA 4X1VA 1S72T 1NYGA 2JXBA 1YITT 4FU6A 1Y96B 2WQGA 1NPPA 3QYHB 2QDYB 1BK2A 1UG1A 3GNFB 4C92C 1O9SA 1K4US 4AMCA 3OS1A 3E1SA 2O4XA 3OS5A 3TEEA 1RADB 3PNWC 3OY9A 1V1CA 4IUVA 5KE3A 2YSQA 1UHFA 4C92F 1RAAB 4PJNA 4DOWA 1UUEA 3JB9G 2KAFA 2KVQG 4F14A 4KUIA 3WXMB 4RKUE 4PLIA 2LC3A 2DXBA 1WJRA 2JTMA 3M0UA 1RAGB 1C6VX 2K2VA 1K76A 4J9EA 1UFFA 3MPUB 3HRUA 3NGPA 1JJ2S 2G80A 4L6V5 4MDXA 1QVPA 1IHWA 1M2VA 1TSFA 2ZPFB 1R0BG 5IHIA 1UGRB 2AHJB 1OYXA 1YN8A 4PJOG 1S1NA 4HCCA 3EG0A 2QA4Q 4ELYC 4KUDK 1RAFB 1T0JA 4Y28E 2HBPA 1JEQA 3SWNB 4C0FA 2GTOA 2BKDN 1KHIA 3C95A 1ZBXA 5HK3A 1A63A 3CCRA 4KULA 5KYYB 2D8JA 1IZ6A 2EVRA 2FHDA 4LUDA 1MMNA 2DVJA 2A0FB 3LH0A 2GGRA 3RBBB 2HNIA 3JB9H 1OX9A 3JCMd 3OS2A 3L0OA 2CKKA 1UE9A 4A53A 2ODCI 2VYTA 4FIBA 3MO8A 2RNOA 2YUNA 2RF0A 4QT7A 3REBB 4C8QA 2K5LA 2CZ6B 4JJNK 2DILA 3QDFA 3CCLT 5LL6S 4EPCA 2R5MA 1BCMA 3QG1A 1Q86U 1TUDA 2JNGA 4MDWA 2JOYA 4OGCA 3A8OB 4LDYA 1KK7A 4ANJA 2HQHA 2DEQA 3D7SB 3QYGB 2ED0A 4II1A 4RTXA 5M9OA 3EFSA 2DXTA 4C0DB 1OPKA 2RNNA 1ZUKA 2FO0A 3RMSA 3CC7A 4CC2A 5GAN6 2RJFA 1PKTA 2KI7A 3QXEB 3LWIA 3RUXA 2FYKA 4D8KA 2M0YA 5D6WA 3JB9F 4D6WA 3L2ZA 2GF7A 2G3RA 4J9GA 2DTOA 3KUFA 2CYZB 3ZL7C 5GAMg 3OW2P 3CMAT 5FU7B 1YJNQ 1TWBA 2EAYA 1WNLA 1TU0B 2EIFA 1D0ZA 3J81E 2K5FA 4MMLA 3M4YA 1FMVA 3QSUA 2MPXC 2DMOA 1SSFA 5GAOn 1VQ9A 1ZLMA 2DD5A 1NEGA 3VS1A 4PL6A 1PD1A 2CZ1B 2OTJQ 2JS2A 2MF2A 4PJOF 3G1JA 3QZ5B 1FXXA 1PRMC 1M1KU 1IO6A 5KCHA 2CUBA 4FYWB 2F2VA 2RO0A 1ZSGA 3META 1A62A 3QDRB 1OZ2A 2OI3A 3EGUA 3A5ZB 4J9IA 3OSVA 4XTWA 1ACMB 3J7AF 1UTIA 2LT4A 3AT1B 2P4TA 4JLGA 2CP6A 2EQMA 1B7TA 5FU7C 1YIJT 2F2XA 2QXFA 2OTLQ 1GCPA 2QG9B 1VQ5T 1WJSA 3LX7A 2J6FA 3CXCS 2HQXA 3JCMX 4M7AB 1UJ0A 3OYBA 2EJGA 2RPNA 3UPUA 5LJ3g 1JRIA 4JJCA 2QTVA 3M0PA 4ZTJA 4FT2A 2KT1A 3RKXA 2ESWA 3CBOA 3J80E 1VQ8Q 8ATCB 2VUBA 2RHYA 3OYNA 2EJ9A 2YUOA 5KH6A 2EGEA 1UJYA 2BTTA 3RERA 1BB9A 3GNGA 5CO7A 2QEXT 1K0SA 3OS0A 5GAOl 1JJ2A 1M2OA 2XI9A 4JRQA 1K8AC 3GBQA 2J06A 2EQJA 2BZ8A 1WI7A 2CUDA 1NJIU 2DERA 1NPRA 1VQMA 2K4YA 3CCMA 2EPDA 4N0AC 1YNZA 3ER0A 1LNXA 2PU9B 1KQSS 4OP0A 3V7RA 3EGXB 2RK2A 1PSFA 2DNUA 1AWJA 2FRWA 3WVDB 1JEIA 1TXQA 1X2QA 4JZ4A 3OSSC 3R6NA 4M75D 3PGGA 1BCOA 4AFUC 1MMAA 3I56A 4N4GA 3CD6T 3I5SA 4CI0C 4RTVA 1BI2A 5FU6B 4IKFA 4IUPA 3V7SA 4M7DA 2D1XA 3CCVA 5HK0A 2OAUA 4A63B 3M57A 3H41A 2GFUA 1Q81C 4JPBW 1Y71A 4PJOD 5GMKj 2L8DA 2F69A 3HHTB 1TUGB 4OGEA 2J05A 2R57A 4PFOA 4E47A 2X51A 4F7UE 1G3TA 1YITA 2ECZA 1CKBA 3H6ZA 3OYGA 2CP2A 1I5LA 1BYMA 4X9CA 4XTYA 2BUDA 2YUPA 3OW2S 2FPEA 3H0FA 4M78G 1YHQA 2PVGB 3EGDA 2CT3A 4E6RA 3H0IA 1Q86R 3HP9A 4AG2C 2L3RA 3VS5A 2EFIA 5FU6C 2D6FA 3HKSA 3ULRB 2KK4A 3FDRA 4B9XA 4QQ6A 3T9NA 2O2OA 3A8HB 4ESRA 1EIFA 1I1JA 2IIMA 3C94A 4XTUA 3CCRT
chains in the Genus database with same CATH topology
5J39A 1UB4A 1UGQB 2ZCFB 2ZPBB 3KXTA 3CBMA 5CKFA 4OF1A 3CPWS 2QA4A 3UWNA 4J7FA 2PVOB 3OYKA 4A4EA 2PUKB 4J83A 2VXEA 1VIEA 3M53A 3FLGA 3NTIA 2OTLA 3BDLA 2MWOA 3OYFA 2RHZA 5CKHA 1GXIE 4F7UF 1BIAA 5FRNA 3MCAB 2DIGA 3PTAA 4J6WA 2MI6A 3M9QA 2YLCA 4M77B 3JCMV 4JRPA 5J26A 1VQKT 3S3NA 3MEWA 5GAOm 2MWPA 2LC4A 2XK0A 4XTZA 1YIJA 4NS5A 3Q1JA 5GMKl 4M78B 1N9SA 5GAN3 1N8RC 2PVDB 1BI0A 1D3BB 4M77E 4A4KA 2B8AA 4E7IA 4RG2A 4C5HA 3OYYA 5GAMd 2XIDA 5KE2A 4OVAA 4VUBA 2KY9A 3P8HA 3OW2A 1UEBA 3G6EA 3S3OA 3JRZA 4P5NA 4M75B 2ZPEB 1VQ8A 3MP6A 1VQMT 3CCMT 3OB9A 1N9RA 1VQ6A 2E12A 4X9DA 2E41A 3GLXA 5KCOA 4LDUA 1WQ7A 4FT4A 4M78E 2JVVA 5GAMh 2QQBA 1OZ3A 3L2QA 4MMKA 1QVGA 1MGQA 5DLQE 1QVFA 2KSSA 1NJIC 4QQGA 1VQPT 4XTUA 1B34B 4C8QD 3OYJA 3P8BB 4M77A 2KDSA 1VQNT 4M75E 4OB3B 5GMKh 3HRSA 1VUBA 4C92B 1P92A 5GANf 2V8JA 3JCMh 1KHCA 4BB7A 2M9UA 3CCET 2ZPGB 2A7YA 2Y90A 3VV0A 4LD9K 4M7AC 3HFNA 3I56T 2GFAA 2LQ8A 1YI2A 3OQ5A 4PJOB 2WSFE 3JB9D 5CAIA 3CXCA 4E7JA 4JRKA 1D3BA 4M77C 1XQHA 3CMET 3G4SA 3CBPA 4BI8B 2DO3A 4EDUA 3CCLA 1VIFA 4C92E 3WVEB 1VQ4T 2ZZDA 4BD3A 1NZ9A 3CCSA 1O75A 4M75A 4C5GA 2O4XB 5GANe 3CCVT 4M7AF 1BIBA 4ELZC 4GLKA 4OB1B 3CPFA 3M4GA 3G71A 3V8JA 1BI1A 1TH7A 4M78C 3CCQA 4PJOE 1K9MU 5GMKi 2QQAA 3FJPA 4HCZA 3CCUA 3F70A 1W4SA 2VGNA 3VJPA 2CZ0B 3DLMA 3JCMW 1W2BS 2QQSA 1B34A 1X75C 4BDYA 2E6ZA 4M75C 3X25B 2MMPA 4C92A 2DPPB 4MZMA 1VQ9T 2EWNA 2DD4A 4E7HA 2WSEE 4NL2A 4M78F 4LDXA 4ZN1A 1S72T 3TREA 4BUGA 4QVDA 1YITT 4M7DC 1M8VA 4PKCC 4XU0A 4JDSA 3VYGA 2E1HA 3QIIA 4FU6A 1Y96B 2E6NA 4PJOA 1NPPA 3QYHB 4BE1A 2RH2A 4UC4A 2QDYB 4M75F 4NL3A 3GNFB 5CQXA 4M77G 1Q7YU 3QJYA 5D6YA 2EQKA 4C92C 1O9SA 5LJ3d 4TVRA 3OS1A 2IG0A 4Q5WA 4C8QG 3E1SA 2OTJT 2O4XA 3AHUA 3OS5A 3TEEA 4M7DF 3PNWC 5GAMf 3OY9A 1KQSA 2HAXA 4PJOC 5CQYA 4C5EA 3OMCA 4IUVA 5LJ3h 5KE3A 2XKOC 4C92F 2JN0A 5GAN2 1IREB 4DOWA 2GQVA 4J8OA 3CC4A 3RIRA 1N6AA 1Y7XA 2QQRA 2KAFA 2KVQG 2CS7A 3S6WA 5A0DA 5LJ5g 3JB9G 4KUIA 2F5KA 3HPWA 4L59A 3WXMB 4DA4A 2X35A 4RKUE 3QJ6A 2DXBA 2JTMA 1WJRA 4PLIA 5A2QE 1KC8U 4BACA 1KG1A 5LJ5f 2K2VA 3TCJA 1Y96A 3SDZA 4R56A 2K3YA 2QA4T 2LCLA 5EG2A 1HXDA 5GAOp 3V7CA 1YBYA 1H3ZA 1VQ7A 3HRUA 5CKBA 4XU2A 2QI2A 3L42A 1JJ2S 4C92G 3SD4A 5GMKm 4L6V5 4MDXA 1QP3A 1QVPA 2EYQA 3JB9I 2LX9A 2ZPFB 4RMOA 2KQWA 3DB4A 4XK8E 5DM7R 2DKGA 1UGRB 2AHJB 1OYXA 2FVUA 2P0PA 2RHUA 5LJ5e 4PJOG 4HCCA 3HRTA 3X24B 2V8IA 3FRNA 4ELYC 4KUDK 3QPHA 5A0GA 1FWZA 3LLRA 3A8GB 5CIUA 4O6JA 3MP8A 4BI3A 4C8QB 4Y28E 2HBPA 3CCJA 4EMKB 4XQ3A 3RKYA 3SWNB 2DZ9A 3ZEHA 4C0FA 3VU3C 2BKDN 2RB6A 3LGLA 3UDCA 1JBMA 5FLXE 1KHIA 2D9TA 3FB9A 3OYDA 3QBYA 3C95A 3G6ET 1UGPB 1ZBXA 4MZPA 3VUBA 5HK3A 1KD1U 1VQ5A 4E7LA 3CCRA 1VQ6T 3OMGA 4KULA 2M0OA 1U1TA 1IZ6A 2FHDA 3FEOA 5C6SA 3OA6A 4C8QE 4BE2A 2XHCA 2RM4A 3L2VA 1M5Q1 1AHJB 3LH0A 1YJWA 2HNIA 2RI5A 3JCMc 3C4SA 5GAN8 2XDBA 3MHXA 3JB9H 3JCMd 5GANg 3O8VA 3OS2A 3HSBA 5GAN4 5LJ3f 2CKKA 4A53A 5DY9A 1DJ7B 2VYTA 4FIBA 3MO8A 5GANj 4IUQA 2PUOB 2A3LA 2BIVA 3KBGA 1YCYA 3DKMA 3EFRA 5FROA 4C8QA 3ZBDA 4EMKA 3SWNA 1WPYA 1Y07A 2DTIA 2K5LA 2CZ6B 3A8LB 1I81A 1PSEA 2ZGWA 4YTLA 3CCLT 4JJNK 3CC2A 1M90U 1K8AU 2RI3A 5LL6S 1I4K1 3V8KA 4EPCA 3CCST 5FRMA 2ZPHB 3CPWA 2R5MA 2QEXA 3S3MA 4A4GA 2EKOA 3QG1A 1Q86U 3G71T 2JNGA 3ME9A 4JLIA 3QHSA 2JOYA 4MDWA 4RG8A 3CCQT 4C8QC 4OGCA 4EMKC 3A8OB 4LDYA 2CZ7B 1UGSB 3OYEA 3BY7A 2PQWA 2DEQA 3QYGB 3QO3A 2K3XA 4II1A 1H641 3EFSA 5M9OA 2DXTA 4M77F 1VQPA 4C0DB 3BW1A 2DXCA 4QVZA 3V8LA 3N5BB 4A54A 2VC8A 3E9GA 1K9MC 2DZCA 4C8QF 3RMSA 4DOVA 4WF2A 3CC7A 2QQ9A 5GAN6 2RJDA 2RJFA 4EMGA 1YJNT 4ZGDB 3OYIA 5J3BA 5GAOq 3QXEB 4A4HA 1K73U 3LWIA 2I2LA 3RUXA 2FYKA 4LDWA 3BFMA 4C0ZA 1BI3A 1G5VA 4M7DD 5D6WA 3CMEA 3JB9F 4D6WA 3L2ZA 2GF7A 2G3RA 3HL8A 2E5QA 2P0QA 1VQ4A 2X4XA 5GAN5 4XTXA 2DTOA 3KUFA 2CYZB 3QKJA 5C0MA 5GAMg 3OYLA 2DIQA 3QZ9B 5FU7B 3CMAT 3L2RA 2DXUA 3LYIA 3X20B 4QVCA 1Q7YC 4E7KA 1LOJA 4GY5A 3VYHB 1YHQT 4BE0A 2IVWA 2EAYA 1Q81U 4HT9A 4CRIA 1WNLA 3P8DA 2XD0A 2EIFA 2LTOA 3MEUA 3J81E 2K5FA 1G3WA 2RK1A 4OMFB 5I2SA 2F5TX 4MMLA 3M4YA 4BI4A 1VQLT 1M9SA 3M5AA 3JCMg 3PFSA 3QSUA 3FIFA 2RD1A 3E9FA 1SSFA 5GAOn 5IAYA 1VQ9A 1YJ9A 2DD5A 2H3JA 4MZTA 4XAXB 2HD0A 4PL6A 1X01A 2CZ1B 2LDMA 3JCMf 5LJ5j 1S72A 2MF2A 4PJOF 3JCMb 4ZN3A 3QZ5B 1FXXA 1M1FA 5CKEA 1M1KU 5GAMe 2RJCA 5KCHA 1Q82U 1KC8C 2VV5A 2RO0A 2DJZA 3META 4OB2B 1OZ2A 3QDRB 1WJQA 2RHIA 3L2UA 3GPLA 1VQOA 3A5ZB 4XU1A 2OTLT 3X28B 5GMKe 2GCXA 3L1AA 2E65A 2L89A 3CD6A 3JCMe 1W2BA 1BKBA 4DQ2A 3OBYA 2WACA 3OSVA 4XTWA 5GANh 4NOYA 1QVGS 2XU8A 3J7AF 2V8KA 1QVFS 2LT4A 4Y91A 2P4TA 4JLGA 2ZPIB 3PIOA 2EQMA 3OYHA 5FU7C 3ASKA 2E10A 5HY6A 3VKIA 1YIJT 2QXFA 3PMIA 4J5YA 4N4HA 2FB7A 1VQ5T 3GF5A 2RA2A 4Z02A 4B9WA 1NE8A 3JAME 1WJSA 3LX7A 2X4YA 2D0QB 3I55A 4ZGEB 3CXCS 5I2MA 4FL6A 1VQ8T 2HQXA 2K57A 3TU4K 1ZHIA 1N27A 2DK3A 2LQKA 3OBWA 3JCMP 1YJWT 3JCMX 4M7AB 1KD1C 4ME7A 3OYBA 2EJGA 3UPUA 3URGA 5LJ3g 4HT8A 4JS4A 2Y4YA 1JRIA 5A0LA 2YRVA 3G7ZA 4IUTA 3GIBA 1OI1A 2LNVA 5LJ3j 3VUZA 2X4JA 4ZTJA 5HKCA 4V2SA 4FT2A 2L5QA 1FX7A 1XNIA 3RKXA 3CBOA 3J80E 2M1HA 3C12A 4RCCA 2DVEA 5GAOr 1VQKA 4C5IA 4M7AE 5CKDA 4IUUA 1N8RU 2VUBA 2RHYA 4EMHA 3CC2T 3OYNA 4BDZA 2EJ9A 3A8MB 5KH6A 1RI0A 3M59A 3MEAA 1YI2T 3SB2A 2E70A 2KMTA 3LW5E 2C06A 3RERA 3GNGA 3H8ZA 1HK9A 5CO7A 2QEXT 4N0AA 4A4FA 4F7UG 2DTHA 3G4ST 3RESA 2DAQA 2X4WA 4J7IA 3OS0A 1MHNA 4M7AD 5GAOl 1JJ2A 1U8RA 1M90C 2XI9A 2LCCA 3MEVA 3PMTA 4JRQA 3BDUA 1K8AC 2EQJA 5CVIA 3UT1A 5LJ3e 3NTHA 3MP1A 2LRQA 1NJIU 4M77D 4R55A 4M7AA 4M7DB 2YLBA 1NPRA 1VQMA 4KBMB 2K4YA 3CCMA 1Q86C 3M54A 1VQNA 2VXFA 4RCBA 2XG8D 4N0AC 5IN1A 3SWNC 4C0GA 3CCUT 2VGMA 1WQWA 3ER0A 5LJ5d 1LNXA 2PU9B 4FM4B 1KQSS 1I8FA 4OP0A 3V7RA 3CC7T 1M4ZA 2RK2A 1PSFA 2HQEA 4XU3A 5I21A 4X34A 3E19A 4M78D 4KT0E 5IT9E 4M7DE 2FL7A 3NFCA 1V29B 3RKWA 3WVDB 5GAN7 3GP8A 3M58A 5LJ5h 3ZFJA 3L2WA 4M78A 3LGFA 1ZQ1A 4BY6B 2R5AA 3CEYA 3CCEA 3OSSC 4M75D 3X26B 2QTXA 3PGGA 3I56A 1QP2A 4N4GA 3CD6T 2RHXA 1K73C 1RL2A 3OYCA 1JB0E 1R8OB 4PNOA 4CI0C 1X6OA 3FC3A 1BI2A 5FU6B 4IKFA 2RJEA 3GOXA 4IUPA 2EJFA 3V7SA 5CR2A 4M7DA 2XDDA 3CCVA 5HK0A 2CGHA 4C92D 2OAUA 5GAMj 3M57A 4F7UB 3JB9J 2MAMA 3PT9A 2GFUA 4LD6A 3JCMQ 4ZGJB 5DLOA 3CC4T 1Q81C 4HKEA 4LDVA 1U1SA 2YHTA 3JSCA 1YJ9T 1XTDA 2Y4XA 1Y71A 4PJOD 5GMKj 2L8DA 2F69A 1WGSA 3HHTB 4QW2A 4J6XA 4OGEA 1YJNA 3PIPA 4M7AG 2R57A 3M56A 4E47A 4HCBA 2XDPA 3R6OA 4F7UE 1G3TA 1XOVA 2M16A 4PLLA 1YITA 3DB3A 3H6ZA 4FSXA 3OYGA 4J6YA 1VQOT 4JUVA 1VQ7T 1G3YA 4C0DC 1I5LA 2P0KA 3SFMA 2JZ2A 1M1KC 3OYMA 1BYMA 3CMAA 1M1GA 4X9CA 1Q82C 4OB0B 2RI2A 4QQDA 4XTYA 2BUDA 5GANd 2XICA 3OW2S 3M55A 1QW1A 4M78G 4BY6C 1YHQA 2PVGB 5D6XA 4ATOA 2OTJA 2LVMA 3INZA 3NTKA 4JS5A 3JCMJ 3EAEA 3QUIA 1G3SA 4N4IA 3RMQA 3LWHA 3HP9A 4F7UA 4JRIA 2L3RA 4ZTFA 2E64A 1VQLA 2JTFA 3HFOA 4XTVA 1LJOA 2NLUA 4M75G 5AYFA 3OYAA 2EFIA 3DLLA 1KQ2A 5FU6C 1KQ1A 2D6FA 3CCJT 4O5VA 3HKSA 2O01E 2KK4A 3FDRA 4L5GA 2WSCE 5CCAA 2K5IA 4HA8A 4B9XA 5L8RE 4QQ6A 5CK9A 3I55T 3T9NA 4M7DG 2LT1A 3A8HB 1EIFA 2EQUA 2JUFA 3C94A 4IURA 2R58A 3CCRT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J39 A;  4QVZ A;  5KH6 A;  1RI0 A;  3E9G A;  3MEA A;  3PNW C;  3OY9 A;  3H8Z A;  3UWN A;  4A4F A;  3OYK A;  4C5E A;  3OMC A;  4IUV A;  2RJD A;  2RJF A;  4A4E A;  5KE3 A;  2DAQ A;  2X4W A;  3FLG A;  3NTI A;  3OS0 A;  3BDL A;  2MWO A;  3OYF A;  1MHN A;  2RHZ A;  3OYI A;  4A4H A;  2LCC A;  2QQR A;  3MEV A;  3PMT A;  3S6W A;  5FRN A;  2EQJ A;  2DIG A;  3UT1 A;  2F5K A;  3M9Q A;  3NTH A;  3MP1 A;  2LRQ A;  5J26 A;  4L59 A;  1G5V A;  5D6W A;  2X35 A;  3S3N A;  3MEW A;  3QJ6 A;  2GF7 A;  4PLI A;  1WJR A;  2G3R A;  2MWP A;  2E5Q A;  4BAC A;  5IN1 A;  2X4X A;  3KUF A;  2XK0 A;  3QKJ A;  5C0M A;  3OYL A;  2DIQ A;  3L2R A;  4NS5 A;  2K3Y A;  3LYI A;  3Q1J A;  4E7K A;  4GY5 A;  4BE0 A;  2HQE A;  4CRI A;  4X34 A;  3P8D A;  1H3Z A;  2LTO A;  3MEU A;  3L42 A;  2B8A A;  4E7I A;  3SD4 A;  4RG2 A;  4C5H A;  3L2W A;  5KE2 A;  4OVA A;  3LGF A;  3P8H A;  3PFS A;  2R5A A;  3CEY A;  3S3O A;  3DB4 A;  3MP6 A;  5M9O A;  3E9F A;  1SSF A;  1OYX A;  3OB9 A;  2RHU A;  5IAY A;  2RHY A;  5KCO A;  4N4G A;  2RHX A;  3OYC A;  4PL6 A;  2LDM A;  1OZ3 A;  3FC3 A;  3L2Q A;  3LLR A;  4IKF A;  5CIU A;  2RJE A;  3MP8 A;  4QQG A;  3GOX A;  4IUP A;  3OYJ A;  5KCH A;  2RJC A;  3ZEH A;  2RO0 A;  2BKD N;  3LGL A;  3MET A;  3OYD A;  2D9T A;  1OZ2 A;  1WJQ A;  2RHI A;  3QBY A;  1KHC A;  3L2U A;  2GFU A;  4LD6 A;  4E7L A;  3OMG A;  2M0O A;  2GFA A;  2L89 A;  4IUR A;  2FHD A;  3FEO A;  3OQ5 A;  5C6S A;  3OA6 A;  4BE2 A;  2WAC A;  2L8D A;  4E7J A;  1WGS A;  4QW2 A;  3L2V A;  4EDU A;  3LH0 A;  2R57 A;  4BD3 A;  2XDP A;  2EQM A;  2RI5 A;  3C4S A;  2O4X B;  3ASK A;  4C5G A;  2M16 A;  4PLL A;  3OYH A;  3PMI A;  3O8V A;  3OS2 A;  2CKK A;  3DB3 A;  3H6Z A;  3OYG A;  4N4H A;  2VYT A;  3MO8 A;  2P0K A;  4IUQ A;  4Z02 A;  2JZ2 A;  4HCZ A;  2BIV A;  4B9W A;  3OYM A;  3F70 A;  1WJS A;  3LX7 A;  2X4Y A;  3DLM A;  2RI2 A;  4QQD A;  2BUD A;  2QQS A;  5FRO A;  4BDY A;  4FL6 A;  5D6X A;  2HQX A;  2LVM A;  3NTK A;  1N27 A;  2RI3 A;  3EAE A;  4E7H A;  4N4I A;  3OYB A;  2L3R A;  4ZTF A;  5FRM A;  2R5M A;  2JTF A;  4A4G A;  3OYA A;  3S3M A;  2EKO A;  2NLU A;  2EFI A;  2YRV A;  3QII A;  3ME9 A;  4FU6 A;  4IUT A;  1OI1 A;  2E6N A;  4BE1 A;  4UC4 A;  4ZTJ A;  3FDR A;  3OYN A;  1XNI A;  4B9X A;  3OYE A;  4QQ6 A;  2M1H A;  2PQW A;  2EQK A;  5D6Y A;  4C5I A;  3OS1 A;  4IUU A;  2EQU A;  2IG0 A;  2K3X A;  4II1 A;  4Q5W A;  2O4X A;  2R58 A;  4BDZ A; 
#chains in the Genus database with same CATH topology
 1K1Z A;  1ZSZ A;  3RNJ A;  2OAW A;  1UGQ B;  2KE9 A;  2ZPB B;  3KXT A;  3EFO A;  1V66 A;  3H9N A;  4AFS C;  5CKF A;  4OF1 A;  3CPW S;  3UWN A;  4J7F A;  4A4E A;  3NTI A;  5CKH A;  2KNB B;  2LJ0 A;  2MOX A;  1RAE B;  1EX4 A;  2K2M A;  4KGZ B;  3MCA B;  2DIG A;  2MI6 A;  2YLC A;  3JCM V;  4JRP A;  1XJW B;  5KYW B;  4RTT A;  1V76 A;  2XK0 A;  4XTZ A;  2AZV A;  1YJW Q;  1WFW A;  1H92 A;  2L2P A;  4M78 B;  5GAN 3;  4KH0 B;  2EGC A;  5GAM d;  2FZC B;  4OVA A;  3S3O A;  2J6O A;  2C0O A;  3MP6 A;  4X9D A;  1RAH B;  1YP5 A;  1M1K R;  1MGQ A;  2HMA A;  2A08 A;  3OYJ A;  3P8B B;  2ZAE A;  4M77 A;  1VUB A;  1P92 A;  5GAN f;  1KHC A;  3CCM Q;  2CP5 A;  2A7Y A;  3VS2 A;  4DBR A;  1VYT A;  2JJ9 A;  1AWW A;  3CXC A;  4E7J A;  1VQP Q;  3CBP A;  2LCS A;  4BI8 B;  3CCL A;  1GL5 A;  4C92 E;  2CH4 A;  2I0N A;  2RQR A;  1U3O A;  1X27 A;  2KRM A;  2O4X B;  1BIB A;  4OB1 B;  3CPF A;  1W1F A;  1BI1 A;  4M78 C;  5GMK i;  2QQA A;  1NYF A;  3FJP A;  3CCU A;  2LP5 A;  3DLM A;  1W2B S;  4F04 B;  2JS0 A;  4LE9 A;  2D0N A;  3E2U A;  4IIM A;  3IQL A;  1QQJ A;  1VQ9 T;  2DD4 A;  3CCV Q;  2WSE E;  4E7H A;  4M78 F;  3EG2 A;  4QVD A;  1ZX6 A;  3VYG A;  2JMA A;  2NWM A;  1GCQ A;  1WA7 A;  1Q7Y U;  2EQK A;  4RTY A;  5LJ3 d;  4E7Z A;  2IG0 A;  4C8Q G;  2DL8 A;  3AHU A;  2LMJ A;  1GBQ A;  1M2V B;  1S72 Q;  1YIT Q;  1KQS A;  2IPO B;  4C5E A;  2KRO A;  1T3L A;  4KGX B;  1IRE B;  1K9A A;  2GQV A;  1NJI R;  2QQR A;  2CS7 A;  3S6W A;  4AG1 C;  1HJD A;  3HPW A;  4DA4 A;  1ABQ A;  2ODG C;  1KC8 U;  1KG1 A;  1WDX A;  4BAC A;  4PJM A;  4PJL A;  2KXD A;  5LJ5 f;  2RQV A;  3VS0 A;  2NUP B;  4AT1 B;  2K3Y A;  4Z88 A;  1KIK A;  5EG2 A;  1HXD A;  5GAO p;  2QNF A;  2G6F X;  2DL7 A;  1YBY A;  1H3Z A;  4XU2 A;  3SHW A;  2QI2 A;  5HCK A;  4C92 G;  4JZ3 A;  2EYQ A;  3JB9 I;  1X6B A;  4RMO A;  1WHM A;  5DM7 R;  2DKG A;  2P0P A;  2FZK B;  2RHU A;  4HXJ A;  2V8I A;  2F2W A;  1X43 A;  2KEA A;  3QWX X;  5A0G A;  3LLR A;  4C8Q B;  3CCJ A;  2LZ6 B;  4XQ3 A;  3RKY A;  2DZ9 A;  3VU3 C;  2RB6 A;  3LGL A;  1QKX A;  2YT6 A;  3OYD A;  1VQ5 A;  1KD1 U;  1VQ6 T;  2LJ1 A;  1N5Z A;  1VQK Q;  3FEO A;  5C6S A;  1ZA2 B;  2RM4 A;  5IXF A;  3L2V A;  2CSQ A;  3JCM c;  5GAN 8;  1R0C B;  2EGA A;  2DRM A;  1DJ7 B;  4KH1 B;  5GAN j;  2PUO B;  3KBG A;  1YCY A;  3RDV A;  1OEB A;  5FRO A;  1PD0 A;  3ZBD A;  4EMK A;  2DTI A;  1I81 A;  1PRL C;  1PSE A;  2ZGW A;  3EH1 A;  1AD5 A;  2RI3 A;  1HD3 A;  3CCS T;  2ZPH B;  3CPW A;  2QEX A;  5I22 A;  3S3M A;  4R0K A;  3G71 T;  4RG8 A;  2EYY A;  2L3P A;  4C8Q C;  1FMW A;  1UGS B;  3OYE A;  1OPL A;  3CCL Q;  2K3X A;  1SRL A;  2DXC A;  4QVZ A;  3N5B B;  2VC8 A;  2VAS A;  1QCN A;  4C8Q F;  1HSQ A;  4DOV A;  3PVL A;  2RJD A;  2J6K A;  3M0R A;  5GAO q;  1JQQ A;  2QK0 A;  1K73 U;  2I2L A;  4C0Z A;  2L3Q A;  1BI3 A;  3UA6 A;  1G5V A;  1RAC B;  1BBZ A;  1I5O B;  3CD6 A;  3OYL A;  1QWF A;  1YHQ T;  4GY5 A;  2IVW A;  2LTO A;  1IHV A;  5I2S A;  2KGT A;  1D1B A;  3PFS A;  2RD1 A;  2HKN A;  3CMA Q;  1IGU A;  2FPD A;  2H3J A;  1WLP B;  4MZT A;  4XAX B;  3JCM f;  5LJ5 j;  3NHN A;  3JCM b;  2HCK A;  1BU1 A;  2KYB A;  5GAM e;  4DBQ A;  1Q82 U;  3CXC P;  4OB2 B;  1WJQ A;  4FCY A;  4QKU A;  2GCX A;  2L89 A;  1W2B A;  4DQ2 A;  1VYV A;  1QVG S;  2BE7 D;  2H8H A;  1WIE A;  1C1A A;  4KRT A;  3OYH A;  5HY6 A;  2KVD A;  5L23 A;  1ZUY A;  2NUT A;  1OQK A;  2D0Q B;  5I2M A;  2HEQ A;  1ZHI A;  3OBW A;  1YIJ Q;  1SRM A;  2DJQ A;  4HT8 A;  4JS4 A;  2Y4Y A;  5A0L A;  1Q7Y R;  5KYN A;  2P4R A;  2LNV A;  1KQS P;  3VUZ A;  5HKC A;  2L5Q A;  3G6E Q;  4UZW A;  4RCC A;  2DVE A;  4M7A E;  1N8R U;  4IUU A;  3CC2 T;  3A8M B;  1RI0 A;  1AZE A;  2HSE B;  2DTH A;  5KYU A;  2JM9 A;  5CVI A;  5LJ3 e;  1KC8 R;  3MP1 A;  2LRQ A;  4M7D B;  4R55 A;  2YRD A;  1Q86 C;  1IRX A;  2FEI A;  2VXF A;  4RCB A;  2XG8 D;  5IN1 A;  3SWN C;  3CCU T;  2QEX Q;  1IB8 A;  4PFP A;  2DRK A;  4XU3 A;  4FW2 A;  4X34 A;  2ROL A;  3E19 A;  2GTJ A;  5IT9 E;  1V29 B;  4JJB A;  1E6H A;  2R5A A;  7AT1 B;  3X26 B;  5IHK A;  2RHX A;  2J7I A;  1JB0 E;  1R8O B;  1VYU A;  3FC3 A;  2JM8 A;  2EJF A;  3EGD B;  1KD1 R;  4C92 D;  4EIK A;  1M8M A;  1U5S A;  3JB9 J;  5GJV B;  1U1S A;  1QMC A;  1YJ9 T;  1XTD A;  2Y4X A;  4JJD A;  4LN2 A;  2AK5 A;  1WGS A;  2YUQ A;  4M7A G;  1E7L A;  3M56 A;  1AEY A;  2XDP A;  3R6O A;  2M16 A;  1ZSZ B;  3JV3 A;  3EFO B;  1VQO T;  2M51 A;  3EH2 A;  4C0D C;  3SFM A;  2JZ2 A;  3CPW P;  1M1K C;  4FSS A;  3TSW A;  2XIC A;  4Z8A A;  4OMM A;  2X9H A;  4JS5 A;  3JCM J;  3QUI A;  2QGF B;  1G3S A;  4N4I A;  3RMQ A;  1I0C A;  4M4Z A;  4JRI A;  4ZTF A;  3THK A;  2E64 A;  1VQL A;  2JTF A;  4XTV A;  2NLU A;  2ATC B;  2RN8 A;  4CC7 A;  3CCJ T;  4FYV B;  4L5G A;  2WSC E;  5CCA A;  3I55 T;  2CDT A;  2EQU A;  2JUF A;  4IUR A;  5J39 A;  2DX1 A;  1X6G A;  5IH2 A;  5IHN A;  2L3S A;  1KFZ A;  3OYK A;  1K73 R;  1AVZ C;  3M53 A;  3BDL A;  2MWO A;  3OYF A;  2RHZ A;  1TOV A;  4J6W A;  1ZSZ C;  4M77 B;  1WXU A;  3CCR Q;  1IXD A;  1M27 C;  1G8X A;  2C0T A;  2LC4 A;  2M02 A;  2QYZ A;  2ABL A;  2RQT A;  1BI0 A;  4C5H A;  2XID A;  4VUB A;  4P5N A;  2ZPE B;  1TS9 A;  1VQ6 A;  2E12 A;  2E41 A;  4M78 E;  5GAM h;  2JVV A;  4FW1 A;  3PVQ A;  2QQB A;  1Q82 R;  1QVG A;  1NJI C;  4QQG A;  1W2B P;  1VQN T;  2A37 A;  2BZY A;  3HRS A;  4PFZ A;  1AWX A;  3CCE T;  2HL3 A;  2DET A;  1SSH A;  1YCS B;  4M7A C;  3HFN A;  1I07 A;  1YI2 A;  3OQ5 A;  3JB9 D;  2GBQ A;  4JRK A;  1D3B A;  4M77 C;  3G4S A;  4EDU A;  2QAZ A;  3U23 A;  1LVK A;  3CCS A;  1O75 A;  3M0Q A;  4M75 A;  4C5G A;  3CC7 Q;  4M7A F;  4GLK A;  3G71 A;  1D1A A;  1AOJ A;  1K9M U;  3BE3 A;  1X2K A;  3VJP A;  1X75 C;  4BDY A;  2V26 A;  4MZM A;  2BZX A;  4ZN1 A;  2JW4 A;  1YFN A;  1GJJ A;  1WHG A;  2AKL A;  5EC7 A;  4PJO A;  4UC4 A;  1N8R R;  4NL3 A;  5D6Y A;  1WHK A;  4TVR A;  3VRY A;  1VQ9 Q;  4OML A;  2OTJ T;  2EKH A;  5GAM f;  1QVF P;  5LJ3 h;  3CC4 A;  1N6A A;  1Y7X A;  5LJ5 g;  2V1Q A;  4WTO B;  2F5K A;  2KVE A;  2X35 A;  5A2Q E;  4D8D A;  1E7D A;  3A1P A;  3SDZ A;  1VQ7 A;  5CKB A;  1MNE A;  1QP3 A;  1WHL A;  2LX9 A;  3DB4 A;  4XK8 E;  2E3I A;  3FRN A;  1FWZ A;  5CIU A;  4BI3 A;  3MP8 A;  4EMK B;  2ENM A;  2MYS A;  3ZEH A;  1JBM A;  1U06 A;  2M0O A;  1U1T A;  2EYZ A;  2MCN A;  3OA6 A;  4C8Q E;  2XHC A;  2VB6 A;  3EHR A;  1M5Q 1;  1AHJ B;  1AT1 B;  3MHX A;  2QDL A;  3HSB A;  4DEX A;  5LJ3 f;  1GL9 B;  1Z9Q A;  5DY9 A;  1VQ6 Q;  2LQN A;  4F17 A;  4IUQ A;  2DEU A;  2BIV A;  3EHQ A;  2BE9 B;  3DKM A;  3KFV A;  1RLP C;  1VQM Q;  4K11 A;  1WPY A;  1PC0 A;  1Y07 A;  4OMQ A;  4YTL A;  3CC2 A;  1M90 U;  2F1L A;  4IIO A;  3V8K A;  4A4G A;  2EKO A;  1WHJ A;  1SEM A;  3QHS A;  3CCQ T;  1T0H A;  4EMK C;  2B86 A;  2CZ7 B;  4KGV B;  2LQW A;  2PQW A;  2DM1 A;  3QO3 A;  3I56 Q;  2K79 A;  1D0X A;  3CCS Q;  3VS7 A;  2RNA A;  2DZC A;  3O5Z A;  1OU8 A;  4ZGD B;  4A4H A;  4CC3 A;  4LDW A;  3CME A;  1H9F A;  3VS4 A;  2E5Q A;  2P0Q A;  1VQ4 A;  2X4X A;  5GAN 5;  3QZ9 B;  2DXU A;  3X20 B;  4QVC A;  1Q7Y C;  1ZS9 A;  3VYH B;  2E5K A;  4HT9 A;  2XD0 A;  3MEU A;  2EW3 A;  1QVG P;  1VQL T;  2SEM A;  1M9S A;  3M5A A;  3JCM g;  5IAY A;  5AT1 B;  1WHH A;  1YJ9 A;  2NUT B;  1D1C A;  1YHQ Q;  2HD0 A;  1X01 A;  2LDM A;  1AWO A;  4LNP A;  4ZN3 A;  3PE0 A;  5CKE A;  1OUL A;  2RJC A;  1KC8 C;  2DJZ A;  5FWC A;  2EQI A;  1SHF A;  6AT1 B;  2LJ3 A;  3GPL A;  1VQO A;  1M3C A;  1W70 A;  4XU1 A;  1NM7 A;  3X28 B;  5GMK e;  2E65 A;  3OBY A;  1SG5 A;  4NOY A;  2XU8 A;  1H1J S;  1QVF S;  4Y91 A;  2A28 A;  3MJX A;  3PIO A;  3ASK A;  2E10 A;  3VKI A;  1K9M R;  3PMI A;  2PZ1 A;  3TQ7 P;  4J9B A;  3REA B;  4N4H A;  2FB7 A;  1PG5 B;  4Z02 A;  4B9W A;  1NE8 A;  1QCO A;  3I55 A;  1RI9 A;  1JJR A;  2QGG A;  2GQI A;  4FL6 A;  2K57 A;  3TU4 K;  3JCM P;  1KD1 C;  1YJW T;  3URG A;  2YRV A;  3GIB A;  5LJ3 j;  2HBW A;  2X4J A;  4V2S A;  4LXC A;  1FX7 A;  1M30 A;  5GJW B;  1HYO A;  4C5I A;  5CKD A;  4EMH A;  5IXB A;  1VA7 A;  3MEA A;  2LX7 A;  1YI2 T;  2KMT A;  2C06 A;  2K3B A;  1A8V A;  1HK9 A;  3G4S T;  3RES A;  2X4W A;  4J7I A;  4CC4 B;  3MKD A;  3EG9 A;  2LCC A;  2CSI A;  3PMT A;  1MMG A;  3UT1 A;  1GRI A;  3NTH A;  3CC2 Q;  1LCK A;  4KBM B;  3M54 A;  4C0G A;  2DYB A;  5LJ5 d;  5I11 A;  5KYW A;  1QKW A;  2O9V A;  2HQE A;  5I21 A;  4M78 D;  4M7D E;  1C0M A;  2FL7 A;  3NFC A;  3TVT A;  3GP8 A;  1VQN A;  3L2W A;  3ZFJ A;  4M78 A;  3LGF A;  1ZQ1 A;  3CEY A;  3CCE A;  3CCU Q;  1K0X A;  1K73 C;  1RL2 A;  3OYC A;  1QWE A;  2RJE A;  1A0N B;  3GOX A;  1JEG A;  1UHC A;  2P84 A;  1OV3 A;  2LD7 A;  2CT4 A;  2KRS A;  3PT9 A;  4LD6 A;  1EN7 A;  3CC4 T;  1WYX A;  4HKE A;  4LDV A;  2AZS A;  4AFZ C;  4J6X A;  1YJN A;  3PIP A;  9ATC B;  3M0T A;  4OMO A;  1E6G A;  1XOV A;  3DB3 A;  4J6Y A;  4JUV A;  1VQ7 T;  1YJ9 Q;  3FJ5 A;  1M1G A;  1Q82 C;  1GFC A;  2RI2 A;  4QQD A;  1KSW A;  1M90 R;  1PNJ A;  2HSP A;  5D6X A;  2OTJ A;  3INZ A;  2Z0W A;  1PM3 A;  3NTK A;  4J9D A;  3EAE A;  1D0Y A;  4F7U A;  2JTE A;  2QNC A;  3HFO A;  1LJO A;  4M75 G;  5AYF A;  1VQO Q;  1KQ2 A;  1KQ1 A;  2KW9 A;  1EZZ B;  2O01 E;  5CK9 A;  1H3H A;  4FYY B;  2K5I A;  5L8R E;  4M7D G;  5KYX A;  2KT8 A;  2R58 A;  1UGV A;  3CBM A;  1SKU B;  3UF4 A;  2PVO B;  4DBH A;  2PUK B;  3CCJ Q;  2COZ A;  2VXE A;  1VIE A;  2OTL A;  1ZUU A;  3I55 Q;  5FRN A;  2KFV A;  3QWY A;  1VOM A;  3PTA A;  2SRC A;  2FZG B;  1VQ5 Q;  1VQK T;  3S3N A;  3MEW A;  2MWP A;  2RMO A;  3C0C A;  2RQU A;  3Q1J A;  1MV0 B;  1N9S A;  1N8R C;  2PVD B;  3RR6 A;  2NUP A;  2MK5 A;  1D3B B;  4M77 E;  2DL4 A;  2MPH A;  3EG1 A;  3P8H A;  2DBM A;  3JRZ A;  4M75 B;  1VQ8 A;  1N9R A;  3GLX A;  1JXO A;  5KCO A;  1M3B A;  1OZ3 A;  3L2Q A;  2C0I A;  5DLQ E;  2LNH B;  1W6X A;  4FYX B;  1QVF A;  2KSS A;  2MIO A;  4C8Q D;  2CH4 W;  2KDS A;  5GMK h;  2EYX A;  4HVW A;  2V8J A;  2CP7 A;  2A8V A;  4PJO B;  2WSF E;  3CME T;  2DO3 A;  1VIF A;  1VQ4 T;  1VQN Q;  3UA7 A;  5GAN e;  4ORZ A;  4ELZ C;  3CCE Q;  3EG3 A;  3V8J A;  1TH7 A;  3CCQ A;  3F70 A;  1W4S A;  1B34 A;  3I9Q A;  2E6Z A;  4M75 C;  3CD6 Q;  4C92 A;  2DPP B;  2EWN A;  4NL2 A;  2KYM A;  4LDX A;  2OX7 A;  2H3E B;  3TRE A;  4BUG A;  3I5R A;  4M7D C;  1M8V A;  4PKC C;  4XU0 A;  4JDS A;  2E1H A;  3QII A;  4HVV A;  2E6N A;  4BE1 A;  2VVK A;  2RH2 A;  4M75 F;  3HTR A;  5CQX A;  2NUZ A;  4M77 G;  1YWO A;  3QJY A;  1SPK A;  4Q5W A;  2FG0 A;  4M7D F;  4WCI A;  1QCF A;  4PJO C;  5CQY A;  2RQW A;  3OMC A;  4RTU A;  2XKO C;  5GAN 2;  2JN0 A;  4J8O A;  3NPF A;  3RIR A;  1M3A A;  5A0D A;  1CKA A;  2E3H A;  4L59 A;  2FRY A;  2O31 A;  3QJ6 A;  3TCJ A;  1Y96 A;  4R56 A;  2QA4 T;  2LCL A;  2KBT A;  3V7C A;  5ECA A;  3L42 A;  3SD4 A;  3VS6 A;  2DFU A;  2EYW A;  5GMK m;  1T3S A;  2K9G A;  2HAX A;  2KQW A;  2FVU A;  2E4H A;  5LJ5 e;  3HRT A;  3X24 B;  1JO8 A;  3QPH A;  3A8G B;  4O6J A;  1KJW A;  2YDL A;  3UDC A;  1ZA1 B;  3FB9 A;  2D9T A;  5FLX E;  1G83 A;  3CQT A;  3QBY A;  1LPL A;  4PJJ A;  3G6E T;  1UGP B;  4MZP A;  3VUB A;  4DBF A;  4E7L A;  1NLO C;  3OMG A;  1G2B A;  1ARK A;  4BE2 A;  1Y02 A;  2DE0 X;  1RAB B;  4RTZ A;  2AKK A;  1YJW A;  3VRZ A;  2RI5 A;  2XDB A;  3C4S A;  5GAN g;  2W0Z A;  3O8V A;  5GAN 4;  1SHG A;  1GKU B;  2A3L A;  2KVU A;  2AIR B;  3EFR A;  2O9S A;  1X69 A;  3SWN A;  1WXT A;  3I35 A;  3A8L B;  1RLQ C;  1WZO A;  1K8A U;  2PNI A;  1I4K 1;  8AT1 B;  5FRM A;  1H8K A;  1MND A;  3LH5 A;  5KYY A;  3ME9 A;  4JLI A;  1TUC A;  2DA9 A;  3BY7 A;  2XMF A;  2YRC A;  1H64 1;  4M77 F;  1VQP A;  3BW1 A;  3V8L A;  4A54 A;  4DEY A;  1K9M C;  3E9G A;  1H9E A;  4WF2 A;  4ZNX A;  2QQ9 A;  3CCQ Q;  1ZBH A;  1CSK A;  4EMG A;  1YJN T;  3OYI A;  5J3B A;  4OMN A;  1WX6 A;  3SEM A;  3BFM A;  4M7D D;  3HL8 A;  2L0A A;  1QLY A;  4XTX A;  3QKJ A;  2X3W D;  5C0M A;  2DIQ A;  2X3X D;  4Z89 A;  3L2R A;  3LYI A;  4E7K A;  1LOJ A;  2HDA A;  4BE0 A;  1Q81 U;  4CRI A;  3P8D A;  2COY A;  1G3W A;  2RK1 A;  4OMF B;  2F5T X;  4BI4 A;  1PCX A;  1GCQ C;  3FIF A;  3E9F A;  1S72 A;  1RAI B;  2AT1 B;  1M1F A;  3H0H A;  1VQL Q;  2VV5 A;  2JVW A;  1R77 A;  1FYN A;  3L2U A;  2JMC A;  2RHI A;  4LUE A;  1NEB A;  2OTL T;  3L1A A;  2D8H A;  3JCM e;  1BKB A;  2WAC A;  2ROT A;  5GAN h;  2V8K A;  2W10 A;  2ZPI B;  2QAS A;  1MUZ A;  4J5Y A;  3GF5 A;  2RA2 A;  1TG0 A;  3JAM E;  2X4Y A;  4ZGE B;  2W51 A;  3EG9 B;  2DLP A;  3VS3 A;  1VQ8 T;  1OU9 A;  1OX8 A;  2LQK A;  1N27 A;  2DK3 A;  1TTH B;  1MMD A;  4ME7 A;  2EBP A;  2COW A;  1UEC A;  4E2F B;  3G7Z A;  4IUT A;  2PTK A;  1OI1 A;  1XNI A;  1JXM A;  2M1H A;  3A98 A;  3C12 A;  1J3T A;  5GAO r;  1VQK A;  1NBE B;  4BDZ A;  3M59 A;  3SB2 A;  2E70 A;  3LW5 E;  3H8Z A;  4N0A A;  4A4F A;  4F7U G;  2HZY A;  2DK4 A;  2O88 A;  2DAQ A;  1MHN A;  4M7A D;  1U8R A;  1M90 C;  3MEV A;  3BDU A;  3TSZ A;  1WXB A;  4M7A A;  4M77 D;  2YLB A;  1B07 A;  1YI2 Q;  2VGM A;  1WQW A;  1Z9Z A;  4FM4 B;  4J9C A;  3G4S Q;  1I8F A;  2DF6 A;  3CC7 T;  1M4Z A;  1YNS A;  2JT4 A;  4KT0 E;  1FMK A;  3RKW A;  5GAN 7;  1Q95 G;  3M58 A;  5LJ5 h;  3G71 Q;  4BY6 B;  1B3Q A;  1AZG B;  2QTX A;  2DL5 A;  1QP2 A;  4J9F A;  4PNO A;  2NYS A;  1X6O A;  1SF9 A;  4HVU A;  2DBK A;  5CR2 A;  2XDD A;  2CGH A;  5GAM j;  4J9H A;  4GLM A;  4F7U B;  2MAM A;  3JCM Q;  4ZGJ B;  5DLO A;  3EGX A;  1JU5 C;  2ED1 A;  2YHT A;  3JSC A;  4QW2 A;  4GBQ A;  4HCB A;  2KRN A;  4OMP A;  5KYX B;  4PLL A;  2A36 A;  5D7U A;  4E7S A;  4FSX A;  3CC4 Q;  1G3Y A;  1JJ2 P;  2VKN A;  2P0K A;  1ABO A;  3M0S A;  3OYM A;  2YXY A;  3CMA A;  4OB0 B;  5FWB A;  5GAN d;  1K8A R;  3M55 A;  3UAT A;  1QW1 A;  4BY6 C;  1F1B B;  4ATO A;  2LVM A;  1EFN A;  1PKS A;  3LWH A;  3OYA A;  1NLP C;  3DLL A;  1VQ7 Q;  4RUG A;  2K6D A;  4O5V A;  4HA8 A;  4AFQ C;  2LT1 A;  1RUW A;  1PHT A;  1UB4 A;  4B6M A;  2DL3 A;  5KYU B;  1GBR A;  2ZCF B;  2OJ2 A;  4PK4 A;  2QA4 A;  3NMZ C;  4J83 A;  3FLG A;  1YWP A;  1GXI E;  4F7U F;  1BIA A;  5FW9 A;  1Y0M A;  3M9Q A;  5J26 A;  5GAO m;  1Q81 R;  2K7A A;  1YIJ A;  4NS5 A;  5GMK l;  2KXC A;  2HJQ A;  4A4K A;  2B8A A;  4E7I A;  4RG2 A;  3OYY A;  1ZBJ A;  5KE2 A;  2KY9 A;  3OW2 A;  1UEB A;  3G6E A;  1VQM T;  2KR3 A;  3OB9 A;  3CCM T;  1E7O A;  2HL5 C;  4LDU A;  1NG2 A;  1WQ7 A;  4FT4 A;  1OOT A;  4Y92 A;  4MMK A;  2HKQ B;  2V1R A;  2YWW A;  1VQP T;  1B34 B;  2GNC A;  4M75 E;  1PWT A;  4OB3 B;  1GFD A;  4C92 B;  1MV3 A;  3JCM h;  4BB7 A;  2M9U A;  4RTW A;  2ZPG B;  2Y90 A;  3VV0 A;  4LD9 K;  3I56 T;  2GFA A;  2LQ8 A;  2DYI A;  5CAI A;  4BIT A;  1XQH A;  2VWF A;  2CP0 A;  1IGQ A;  3WVE B;  2ZZD A;  4BD3 A;  1NZ9 A;  2CP3 A;  4HCK A;  3CCV T;  4F16 A;  3M4G A;  2FPF A;  4PJO E;  4HCZ A;  1D09 B;  2VGN A;  2CZ0 B;  3JCM W;  3CME Q;  2QQS A;  2CRE A;  1VQ4 Q;  3X25 B;  2MMP A;  1Y57 A;  1UDL A;  4X1V A;  1S72 T;  1NYG A;  2JXB A;  1YIT T;  4FU6 A;  1Y96 B;  2WQG A;  1NPP A;  3QYH B;  2QDY B;  1BK2 A;  1UG1 A;  3GNF B;  4C92 C;  1O9S A;  1K4U S;  4AMC A;  3OS1 A;  3E1S A;  2O4X A;  3OS5 A;  3TEE A;  1RAD B;  3PNW C;  3OY9 A;  1V1C A;  4IUV A;  5KE3 A;  2YSQ A;  1UHF A;  4C92 F;  1RAA B;  4PJN A;  4DOW A;  1UUE A;  3JB9 G;  2KAF A;  2KVQ G;  4F14 A;  4KUI A;  3WXM B;  4RKU E;  4PLI A;  2LC3 A;  2DXB A;  1WJR A;  2JTM A;  3M0U A;  1RAG B;  1C6V X;  2K2V A;  1K76 A;  4J9E A;  1UFF A;  3MPU B;  3HRU A;  3NGP A;  1JJ2 S;  2G80 A;  4L6V 5;  4MDX A;  1QVP A;  1IHW A;  1M2V A;  1TSF A;  2ZPF B;  1R0B G;  5IHI A;  1UGR B;  2AHJ B;  1OYX A;  1YN8 A;  4PJO G;  1S1N A;  4HCC A;  3EG0 A;  2QA4 Q;  4ELY C;  4KUD K;  1RAF B;  1T0J A;  4Y28 E;  2HBP A;  1JEQ A;  3SWN B;  4C0F A;  2GTO A;  2BKD N;  1KHI A;  3C95 A;  1ZBX A;  5HK3 A;  1A63 A;  3CCR A;  4KUL A;  5KYY B;  2D8J A;  1IZ6 A;  2EVR A;  2FHD A;  4LUD A;  1MMN A;  2DVJ A;  2A0F B;  3LH0 A;  2GGR A;  3RBB B;  2HNI A;  3JB9 H;  1OX9 A;  3JCM d;  3OS2 A;  3L0O A;  2CKK A;  1UE9 A;  4A53 A;  2ODC I;  2VYT A;  4FIB A;  3MO8 A;  2RNO A;  2YUN A;  2RF0 A;  4QT7 A;  3REB B;  4C8Q A;  2K5L A;  2CZ6 B;  4JJN K;  2DIL A;  3QDF A;  3CCL T;  5LL6 S;  4EPC A;  2R5M A;  1BCM A;  3QG1 A;  1Q86 U;  1TUD A;  2JNG A;  4MDW A;  2JOY A;  4OGC A;  3A8O B;  4LDY A;  1KK7 A;  4ANJ A;  2HQH A;  2DEQ A;  3D7S B;  3QYG B;  2ED0 A;  4II1 A;  4RTX A;  5M9O A;  3EFS A;  2DXT A;  4C0D B;  1OPK A;  2RNN A;  1ZUK A;  2FO0 A;  3RMS A;  3CC7 A;  4CC2 A;  5GAN 6;  2RJF A;  1PKT A;  2KI7 A;  3QXE B;  3LWI A;  3RUX A;  2FYK A;  4D8K A;  2M0Y A;  5D6W A;  3JB9 F;  4D6W A;  3L2Z A;  2GF7 A;  2G3R A;  4J9G A;  2DTO A;  3KUF A;  2CYZ B;  3ZL7 C;  5GAM g;  3OW2 P;  3CMA T;  5FU7 B;  1YJN Q;  1TWB A;  2EAY A;  1WNL A;  1TU0 B;  2EIF A;  1D0Z A;  3J81 E;  2K5F A;  4MML A;  3M4Y A;  1FMV A;  3QSU A;  2MPX C;  2DMO A;  1SSF A;  5GAO n;  1VQ9 A;  1ZLM A;  2DD5 A;  1NEG A;  3VS1 A;  4PL6 A;  1PD1 A;  2CZ1 B;  2OTJ Q;  2JS2 A;  2MF2 A;  4PJO F;  3G1J A;  3QZ5 B;  1FXX A;  1PRM C;  1M1K U;  1IO6 A;  5KCH A;  2CUB A;  4FYW B;  2F2V A;  2RO0 A;  1ZSG A;  3MET A;  1A62 A;  3QDR B;  1OZ2 A;  2OI3 A;  3EGU A;  3A5Z B;  4J9I A;  3OSV A;  4XTW A;  1ACM B;  3J7A F;  1UTI A;  2LT4 A;  3AT1 B;  2P4T A;  4JLG A;  2CP6 A;  2EQM A;  1B7T A;  5FU7 C;  1YIJ T;  2F2X A;  2QXF A;  2OTL Q;  1GCP A;  2QG9 B;  1VQ5 T;  1WJS A;  3LX7 A;  2J6F A;  3CXC S;  2HQX A;  3JCM X;  4M7A B;  1UJ0 A;  3OYB A;  2EJG A;  2RPN A;  3UPU A;  5LJ3 g;  1JRI A;  4JJC A;  2QTV A;  3M0P A;  4ZTJ A;  4FT2 A;  2KT1 A;  3RKX A;  2ESW A;  3CBO A;  3J80 E;  1VQ8 Q;  8ATC B;  2VUB A;  2RHY A;  3OYN A;  2EJ9 A;  2YUO A;  5KH6 A;  2EGE A;  1UJY A;  2BTT A;  3RER A;  1BB9 A;  3GNG A;  5CO7 A;  2QEX T;  1K0S A;  3OS0 A;  5GAO l;  1JJ2 A;  1M2O A;  2XI9 A;  4JRQ A;  1K8A C;  3GBQ A;  2J06 A;  2EQJ A;  2BZ8 A;  1WI7 A;  2CUD A;  1NJI U;  2DER A;  1NPR A;  1VQM A;  2K4Y A;  3CCM A;  2EPD A;  4N0A C;  1YNZ A;  3ER0 A;  1LNX A;  2PU9 B;  1KQS S;  4OP0 A;  3V7R A;  3EGX B;  2RK2 A;  1PSF A;  2DNU A;  1AWJ A;  2FRW A;  3WVD B;  1JEI A;  1TXQ A;  1X2Q A;  4JZ4 A;  3OSS C;  3R6N A;  4M75 D;  3PGG A;  1BCO A;  4AFU C;  1MMA A;  3I56 A;  4N4G A;  3CD6 T;  3I5S A;  4CI0 C;  4RTV A;  1BI2 A;  5FU6 B;  4IKF A;  4IUP A;  3V7S A;  4M7D A;  2D1X A;  3CCV A;  5HK0 A;  2OAU A;  4A63 B;  3M57 A;  3H41 A;  2GFU A;  1Q81 C;  4JPB W;  1Y71 A;  4PJO D;  5GMK j;  2L8D A;  2F69 A;  3HHT B;  1TUG B;  4OGE A;  2J05 A;  2R57 A;  4PFO A;  4E47 A;  2X51 A;  4F7U E;  1G3T A;  1YIT A;  2ECZ A;  1CKB A;  3H6Z A;  3OYG A;  2CP2 A;  1I5L A;  1BYM A;  4X9C A;  4XTY A;  2BUD A;  2YUP A;  3OW2 S;  2FPE A;  3H0F A;  4M78 G;  1YHQ A;  2PVG B;  3EGD A;  2CT3 A;  4E6R A;  3H0I A;  1Q86 R;  3HP9 A;  4AG2 C;  2L3R A;  3VS5 A;  2EFI A;  5FU6 C;  2D6F A;  3HKS A;  3ULR B;  2KK4 A;  3FDR A;  4B9X A;  4QQ6 A;  3T9N A;  2O2O A;  3A8H B;  4ESR A;  1EIF A;  1I1J A;  2IIM A;  3C94 A;  4XTU A;  3CCR T; 
#chains in the Genus database with same CATH homology
 5J39 A;  1UB4 A;  1UGQ B;  2ZCF B;  2ZPB B;  3KXT A;  3CBM A;  5CKF A;  4OF1 A;  3CPW S;  2QA4 A;  3UWN A;  4J7F A;  2PVO B;  3OYK A;  4A4E A;  2PUK B;  4J83 A;  2VXE A;  1VIE A;  3M53 A;  3FLG A;  3NTI A;  2OTL A;  3BDL A;  2MWO A;  3OYF A;  2RHZ A;  5CKH A;  1GXI E;  4F7U F;  1BIA A;  5FRN A;  3MCA B;  2DIG A;  3PTA A;  4J6W A;  2MI6 A;  3M9Q A;  2YLC A;  4M77 B;  3JCM V;  4JRP A;  5J26 A;  1VQK T;  3S3N A;  3MEW A;  5GAO m;  2MWP A;  2LC4 A;  2XK0 A;  4XTZ A;  1YIJ A;  4NS5 A;  3Q1J A;  5GMK l;  4M78 B;  1N9S A;  5GAN 3;  1N8R C;  2PVD B;  1BI0 A;  1D3B B;  4M77 E;  4A4K A;  2B8A A;  4E7I A;  4RG2 A;  4C5H A;  3OYY A;  5GAM d;  2XID A;  5KE2 A;  4OVA A;  4VUB A;  2KY9 A;  3P8H A;  3OW2 A;  1UEB A;  3G6E A;  3S3O A;  3JRZ A;  4P5N A;  4M75 B;  2ZPE B;  1VQ8 A;  3MP6 A;  1VQM T;  3CCM T;  3OB9 A;  1N9R A;  1VQ6 A;  2E12 A;  4X9D A;  2E41 A;  3GLX A;  5KCO A;  4LDU A;  1WQ7 A;  4FT4 A;  4M78 E;  2JVV A;  5GAM h;  2QQB A;  1OZ3 A;  3L2Q A;  4MMK A;  1QVG A;  1MGQ A;  5DLQ E;  1QVF A;  2KSS A;  1NJI C;  4QQG A;  1VQP T;  4XTU A;  1B34 B;  4C8Q D;  3OYJ A;  3P8B B;  4M77 A;  2KDS A;  1VQN T;  4M75 E;  4OB3 B;  5GMK h;  3HRS A;  1VUB A;  4C92 B;  1P92 A;  5GAN f;  2V8J A;  3JCM h;  1KHC A;  4BB7 A;  2M9U A;  3CCE T;  2ZPG B;  2A7Y A;  2Y90 A;  3VV0 A;  4LD9 K;  4M7A C;  3HFN A;  3I56 T;  2GFA A;  2LQ8 A;  1YI2 A;  3OQ5 A;  4PJO B;  2WSF E;  3JB9 D;  5CAI A;  3CXC A;  4E7J A;  4JRK A;  1D3B A;  4M77 C;  1XQH A;  3CME T;  3G4S A;  3CBP A;  4BI8 B;  2DO3 A;  4EDU A;  3CCL A;  1VIF A;  4C92 E;  3WVE B;  1VQ4 T;  2ZZD A;  4BD3 A;  1NZ9 A;  3CCS A;  1O75 A;  4M75 A;  4C5G A;  2O4X B;  5GAN e;  3CCV T;  4M7A F;  1BIB A;  4ELZ C;  4GLK A;  4OB1 B;  3CPF A;  3M4G A;  3G71 A;  3V8J A;  1BI1 A;  1TH7 A;  4M78 C;  3CCQ A;  4PJO E;  1K9M U;  5GMK i;  2QQA A;  3FJP A;  4HCZ A;  3CCU A;  3F70 A;  1W4S A;  2VGN A;  3VJP A;  2CZ0 B;  3DLM A;  3JCM W;  1W2B S;  2QQS A;  1B34 A;  1X75 C;  4BDY A;  2E6Z A;  4M75 C;  3X25 B;  2MMP A;  4C92 A;  2DPP B;  4MZM A;  1VQ9 T;  2EWN A;  2DD4 A;  4E7H A;  2WSE E;  4NL2 A;  4M78 F;  4LDX A;  4ZN1 A;  1S72 T;  3TRE A;  4BUG A;  4QVD A;  1YIT T;  4M7D C;  1M8V A;  4PKC C;  4XU0 A;  4JDS A;  3VYG A;  2E1H A;  3QII A;  4FU6 A;  1Y96 B;  2E6N A;  4PJO A;  1NPP A;  3QYH B;  4BE1 A;  2RH2 A;  4UC4 A;  2QDY B;  4M75 F;  4NL3 A;  3GNF B;  5CQX A;  4M77 G;  1Q7Y U;  3QJY A;  5D6Y A;  2EQK A;  4C92 C;  1O9S A;  5LJ3 d;  4TVR A;  3OS1 A;  2IG0 A;  4Q5W A;  4C8Q G;  3E1S A;  2OTJ T;  2O4X A;  3AHU A;  3OS5 A;  3TEE A;  4M7D F;  3PNW C;  5GAM f;  3OY9 A;  1KQS A;  2HAX A;  4PJO C;  5CQY A;  4C5E A;  3OMC A;  4IUV A;  5LJ3 h;  5KE3 A;  2XKO C;  4C92 F;  2JN0 A;  5GAN 2;  1IRE B;  4DOW A;  2GQV A;  4J8O A;  3CC4 A;  3RIR A;  1N6A A;  1Y7X A;  2QQR A;  2KAF A;  2KVQ G;  2CS7 A;  3S6W A;  5A0D A;  5LJ5 g;  3JB9 G;  4KUI A;  2F5K A;  3HPW A;  4L59 A;  3WXM B;  4DA4 A;  2X35 A;  4RKU E;  3QJ6 A;  2DXB A;  2JTM A;  1WJR A;  4PLI A;  5A2Q E;  1KC8 U;  4BAC A;  1KG1 A;  5LJ5 f;  2K2V A;  3TCJ A;  1Y96 A;  3SDZ A;  4R56 A;  2K3Y A;  2QA4 T;  2LCL A;  5EG2 A;  1HXD A;  5GAO p;  3V7C A;  1YBY A;  1H3Z A;  1VQ7 A;  3HRU A;  5CKB A;  4XU2 A;  2QI2 A;  3L42 A;  1JJ2 S;  4C92 G;  3SD4 A;  5GMK m;  4L6V 5;  4MDX A;  1QP3 A;  1QVP A;  2EYQ A;  3JB9 I;  2LX9 A;  2ZPF B;  4RMO A;  2KQW A;  3DB4 A;  4XK8 E;  5DM7 R;  2DKG A;  1UGR B;  2AHJ B;  1OYX A;  2FVU A;  2P0P A;  2RHU A;  5LJ5 e;  4PJO G;  4HCC A;  3HRT A;  3X24 B;  2V8I A;  3FRN A;  4ELY C;  4KUD K;  3QPH A;  5A0G A;  1FWZ A;  3LLR A;  3A8G B;  5CIU A;  4O6J A;  3MP8 A;  4BI3 A;  4C8Q B;  4Y28 E;  2HBP A;  3CCJ A;  4EMK B;  4XQ3 A;  3RKY A;  3SWN B;  2DZ9 A;  3ZEH A;  4C0F A;  3VU3 C;  2BKD N;  2RB6 A;  3LGL A;  3UDC A;  1JBM A;  5FLX E;  1KHI A;  2D9T A;  3FB9 A;  3OYD A;  3QBY A;  3C95 A;  3G6E T;  1UGP B;  1ZBX A;  4MZP A;  3VUB A;  5HK3 A;  1KD1 U;  1VQ5 A;  4E7L A;  3CCR A;  1VQ6 T;  3OMG A;  4KUL A;  2M0O A;  1U1T A;  1IZ6 A;  2FHD A;  3FEO A;  5C6S A;  3OA6 A;  4C8Q E;  4BE2 A;  2XHC A;  2RM4 A;  3L2V A;  1M5Q 1;  1AHJ B;  3LH0 A;  1YJW A;  2HNI A;  2RI5 A;  3JCM c;  3C4S A;  5GAN 8;  2XDB A;  3MHX A;  3JB9 H;  3JCM d;  5GAN g;  3O8V A;  3OS2 A;  3HSB A;  5GAN 4;  5LJ3 f;  2CKK A;  4A53 A;  5DY9 A;  1DJ7 B;  2VYT A;  4FIB A;  3MO8 A;  5GAN j;  4IUQ A;  2PUO B;  2A3L A;  2BIV A;  3KBG A;  1YCY A;  3DKM A;  3EFR A;  5FRO A;  4C8Q A;  3ZBD A;  4EMK A;  3SWN A;  1WPY A;  1Y07 A;  2DTI A;  2K5L A;  2CZ6 B;  3A8L B;  1I81 A;  1PSE A;  2ZGW A;  4YTL A;  3CCL T;  4JJN K;  3CC2 A;  1M90 U;  1K8A U;  2RI3 A;  5LL6 S;  1I4K 1;  3V8K A;  4EPC A;  3CCS T;  5FRM A;  2ZPH B;  3CPW A;  2R5M A;  2QEX A;  3S3M A;  4A4G A;  2EKO A;  3QG1 A;  1Q86 U;  3G71 T;  2JNG A;  3ME9 A;  4JLI A;  3QHS A;  2JOY A;  4MDW A;  4RG8 A;  3CCQ T;  4C8Q C;  4OGC A;  4EMK C;  3A8O B;  4LDY A;  2CZ7 B;  1UGS B;  3OYE A;  3BY7 A;  2PQW A;  2DEQ A;  3QYG B;  3QO3 A;  2K3X A;  4II1 A;  1H64 1;  3EFS A;  5M9O A;  2DXT A;  4M77 F;  1VQP A;  4C0D B;  3BW1 A;  2DXC A;  4QVZ A;  3V8L A;  3N5B B;  4A54 A;  2VC8 A;  3E9G A;  1K9M C;  2DZC A;  4C8Q F;  3RMS A;  4DOV A;  4WF2 A;  3CC7 A;  2QQ9 A;  5GAN 6;  2RJD A;  2RJF A;  4EMG A;  1YJN T;  4ZGD B;  3OYI A;  5J3B A;  5GAO q;  3QXE B;  4A4H A;  1K73 U;  3LWI A;  2I2L A;  3RUX A;  2FYK A;  4LDW A;  3BFM A;  4C0Z A;  1BI3 A;  1G5V A;  4M7D D;  5D6W A;  3CME A;  3JB9 F;  4D6W A;  3L2Z A;  2GF7 A;  2G3R A;  3HL8 A;  2E5Q A;  2P0Q A;  1VQ4 A;  2X4X A;  5GAN 5;  4XTX A;  2DTO A;  3KUF A;  2CYZ B;  3QKJ A;  5C0M A;  5GAM g;  3OYL A;  2DIQ A;  3QZ9 B;  5FU7 B;  3CMA T;  3L2R A;  2DXU A;  3LYI A;  3X20 B;  4QVC A;  1Q7Y C;  4E7K A;  1LOJ A;  4GY5 A;  3VYH B;  1YHQ T;  4BE0 A;  2IVW A;  2EAY A;  1Q81 U;  4HT9 A;  4CRI A;  1WNL A;  3P8D A;  2XD0 A;  2EIF A;  2LTO A;  3MEU A;  3J81 E;  2K5F A;  1G3W A;  2RK1 A;  4OMF B;  5I2S A;  2F5T X;  4MML A;  3M4Y A;  4BI4 A;  1VQL T;  1M9S A;  3M5A A;  3JCM g;  3PFS A;  3QSU A;  3FIF A;  2RD1 A;  3E9F A;  1SSF A;  5GAO n;  5IAY A;  1VQ9 A;  1YJ9 A;  2DD5 A;  2H3J A;  4MZT A;  4XAX B;  2HD0 A;  4PL6 A;  1X01 A;  2CZ1 B;  2LDM A;  3JCM f;  5LJ5 j;  1S72 A;  2MF2 A;  4PJO F;  3JCM b;  4ZN3 A;  3QZ5 B;  1FXX A;  1M1F A;  5CKE A;  1M1K U;  5GAM e;  2RJC A;  5KCH A;  1Q82 U;  1KC8 C;  2VV5 A;  2RO0 A;  2DJZ A;  3MET A;  4OB2 B;  1OZ2 A;  3QDR B;  1WJQ A;  2RHI A;  3L2U A;  3GPL A;  1VQO A;  3A5Z B;  4XU1 A;  2OTL T;  3X28 B;  5GMK e;  2GCX A;  3L1A A;  2E65 A;  2L89 A;  3CD6 A;  3JCM e;  1W2B A;  1BKB A;  4DQ2 A;  3OBY A;  2WAC A;  3OSV A;  4XTW A;  5GAN h;  4NOY A;  1QVG S;  2XU8 A;  3J7A F;  2V8K A;  1QVF S;  2LT4 A;  4Y91 A;  2P4T A;  4JLG A;  2ZPI B;  3PIO A;  2EQM A;  3OYH A;  5FU7 C;  3ASK A;  2E10 A;  5HY6 A;  3VKI A;  1YIJ T;  2QXF A;  3PMI A;  4J5Y A;  4N4H A;  2FB7 A;  1VQ5 T;  3GF5 A;  2RA2 A;  4Z02 A;  4B9W A;  1NE8 A;  3JAM E;  1WJS A;  3LX7 A;  2X4Y A;  2D0Q B;  3I55 A;  4ZGE B;  3CXC S;  5I2M A;  4FL6 A;  1VQ8 T;  2HQX A;  2K57 A;  3TU4 K;  1ZHI A;  1N27 A;  2DK3 A;  2LQK A;  3OBW A;  3JCM P;  1YJW T;  3JCM X;  4M7A B;  1KD1 C;  4ME7 A;  3OYB A;  2EJG A;  3UPU A;  3URG A;  5LJ3 g;  4HT8 A;  4JS4 A;  2Y4Y A;  1JRI A;  5A0L A;  2YRV A;  3G7Z A;  4IUT A;  3GIB A;  1OI1 A;  2LNV A;  5LJ3 j;  3VUZ A;  2X4J A;  4ZTJ A;  5HKC A;  4V2S A;  4FT2 A;  2L5Q A;  1FX7 A;  1XNI A;  3RKX A;  3CBO A;  3J80 E;  2M1H A;  3C12 A;  4RCC A;  2DVE A;  5GAO r;  1VQK A;  4C5I A;  4M7A E;  5CKD A;  4IUU A;  1N8R U;  2VUB A;  2RHY A;  4EMH A;  3CC2 T;  3OYN A;  4BDZ A;  2EJ9 A;  3A8M B;  5KH6 A;  1RI0 A;  3M59 A;  3MEA A;  1YI2 T;  3SB2 A;  2E70 A;  2KMT A;  3LW5 E;  2C06 A;  3RER A;  3GNG A;  3H8Z A;  1HK9 A;  5CO7 A;  2QEX T;  4N0A A;  4A4F A;  4F7U G;  2DTH A;  3G4S T;  3RES A;  2DAQ A;  2X4W A;  4J7I A;  3OS0 A;  1MHN A;  4M7A D;  5GAO l;  1JJ2 A;  1U8R A;  1M90 C;  2XI9 A;  2LCC A;  3MEV A;  3PMT A;  4JRQ A;  3BDU A;  1K8A C;  2EQJ A;  5CVI A;  3UT1 A;  5LJ3 e;  3NTH A;  3MP1 A;  2LRQ A;  1NJI U;  4M77 D;  4R55 A;  4M7A A;  4M7D B;  2YLB A;  1NPR A;  1VQM A;  4KBM B;  2K4Y A;  3CCM A;  1Q86 C;  3M54 A;  1VQN A;  2VXF A;  4RCB A;  2XG8 D;  4N0A C;  5IN1 A;  3SWN C;  4C0G A;  3CCU T;  2VGM A;  1WQW A;  3ER0 A;  5LJ5 d;  1LNX A;  2PU9 B;  4FM4 B;  1KQS S;  1I8F A;  4OP0 A;  3V7R A;  3CC7 T;  1M4Z A;  2RK2 A;  1PSF A;  2HQE A;  4XU3 A;  5I21 A;  4X34 A;  3E19 A;  4M78 D;  4KT0 E;  5IT9 E;  4M7D E;  2FL7 A;  3NFC A;  1V29 B;  3RKW A;  3WVD B;  5GAN 7;  3GP8 A;  3M58 A;  5LJ5 h;  3ZFJ A;  3L2W A;  4M78 A;  3LGF A;  1ZQ1 A;  4BY6 B;  2R5A A;  3CEY A;  3CCE A;  3OSS C;  4M75 D;  3X26 B;  2QTX A;  3PGG A;  3I56 A;  1QP2 A;  4N4G A;  3CD6 T;  2RHX A;  1K73 C;  1RL2 A;  3OYC A;  1JB0 E;  1R8O B;  4PNO A;  4CI0 C;  1X6O A;  3FC3 A;  1BI2 A;  5FU6 B;  4IKF A;  2RJE A;  3GOX A;  4IUP A;  2EJF A;  3V7S A;  5CR2 A;  4M7D A;  2XDD A;  3CCV A;  5HK0 A;  2CGH A;  4C92 D;  2OAU A;  5GAM j;  3M57 A;  4F7U B;  3JB9 J;  2MAM A;  3PT9 A;  2GFU A;  4LD6 A;  3JCM Q;  4ZGJ B;  5DLO A;  3CC4 T;  1Q81 C;  4HKE A;  4LDV A;  1U1S A;  2YHT A;  3JSC A;  1YJ9 T;  1XTD A;  2Y4X A;  1Y71 A;  4PJO D;  5GMK j;  2L8D A;  2F69 A;  1WGS A;  3HHT B;  4QW2 A;  4J6X A;  4OGE A;  1YJN A;  3PIP A;  4M7A G;  2R57 A;  3M56 A;  4E47 A;  4HCB A;  2XDP A;  3R6O A;  4F7U E;  1G3T A;  1XOV A;  2M16 A;  4PLL A;  1YIT A;  3DB3 A;  3H6Z A;  4FSX A;  3OYG A;  4J6Y A;  1VQO T;  4JUV A;  1VQ7 T;  1G3Y A;  4C0D C;  1I5L A;  2P0K A;  3SFM A;  2JZ2 A;  1M1K C;  3OYM A;  1BYM A;  3CMA A;  1M1G A;  4X9C A;  1Q82 C;  4OB0 B;  2RI2 A;  4QQD A;  4XTY A;  2BUD A;  5GAN d;  2XIC A;  3OW2 S;  3M55 A;  1QW1 A;  4M78 G;  4BY6 C;  1YHQ A;  2PVG B;  5D6X A;  4ATO A;  2OTJ A;  2LVM A;  3INZ A;  3NTK A;  4JS5 A;  3JCM J;  3EAE A;  3QUI A;  1G3S A;  4N4I A;  3RMQ A;  3LWH A;  3HP9 A;  4F7U A;  4JRI A;  2L3R A;  4ZTF A;  2E64 A;  1VQL A;  2JTF A;  3HFO A;  4XTV A;  1LJO A;  2NLU A;  4M75 G;  5AYF A;  3OYA A;  2EFI A;  3DLL A;  1KQ2 A;  5FU6 C;  1KQ1 A;  2D6F A;  3CCJ T;  4O5V A;  3HKS A;  2O01 E;  2KK4 A;  3FDR A;  4L5G A;  2WSC E;  5CCA A;  2K5I A;  4HA8 A;  4B9X A;  5L8R E;  4QQ6 A;  5CK9 A;  3I55 T;  3T9N A;  4M7D G;  2LT1 A;  3A8H B;  1EIF A;  2EQU A;  2JUF A;  3C94 A;  4IUR A;  2R58 A;  3CCR T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...