The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
16
|
sequence length |
94
|
structure length |
94
|
Chain Sequence |
SNAGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFKSIPVNEKDTLTCFIYSVRNDKNKSDLKADSGVH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of the 30-kDa Sin3-associated protein (SAP30) in complex with the mammalian Sin3A corepressor and its role in nucleic acid binding.
pubmed doi rcsb |
| molecule tags |
Transcription
|
| source organism |
Mus musculus
|
| molecule keywords |
Histone deacetylase complex subunit SAP30
|
| total genus |
16
|
| structure length |
94
|
| sequence length |
94
|
| ec nomenclature | |
| pdb deposition date | 2011-05-16 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF13867 | SAP30_Sin3_bdg | Sin3 binding region of histone deacetylase complex subunit SAP30 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 | Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 |
#chains in the Genus database with same CATH superfamily 2LD7 A; #chains in the Genus database with same CATH topology 1A62 A; 2ODG C; 3FLG A; 2LD7 A; 1A8V A; 1EN7 A; 1ZS9 A; 4BIT A; 1V66 A; 2LC3 A; 2MPH A; 5CIU A; 1GJJ A; 1E7D A; 2KVD A; 2HJQ A; 3QKJ A; 2A8V A; 2KFV A; 2WQG A; 1GKU B; 3LLR A; 2KVE A; 4UZW A; 2DK4 A; 2W51 A; 3L0O A; 2ODC I; 1H9E A; 1Y02 A; 2QNC A; 2RNO A; 1YNS A; 2JVW A; 1GL9 B; 1JJR A; 1H9F A; 1A63 A; 1E7L A; 1JEQ A; 1KHC A; 2KW9 A; 1H1J S; 2RNN A; 1JEI A; 1ZBH A; 2QNF A; 2G80 A; 2KVU A; #chains in the Genus database with same CATH homology 1A62 A; 2ODG C; 2LD7 A; 1A8V A; 1EN7 A; 1ZS9 A; 2LC3 A; 2MPH A; 1GJJ A; 1E7D A; 2HJQ A; 2A8V A; 2KFV A; 1GKU B; 2DK4 A; 2W51 A; 3L0O A; 2ODC I; 1H9E A; 1Y02 A; 2QNC A; 1YNS A; 1GL9 B; 1H9F A; 1A63 A; 1E7L A; 1JEI A; 2QNF A; 2G80 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
