1A8VA

Structure of the rna-binding domain of the rho transcription terminator
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
120
structure length
115
Chain Sequence
GHMNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSAAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for terminator recognition by the Rho transcription termination factor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription termination
molecule keywords TRANSCRIPTION TERMINATION FACTOR RHO
total genus 29
structure length 115
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07498 Rho_N Rho termination factor, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.10 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 1a8vA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1a8vA02
3H0GH 4HIKA 3S24A 4A3LG 1FVIA 3J7ZC 1AE2A 1S72A 3PO3H 3J81c 1DGSA 2CWAA 1QZHA 1VQBA 5FJ8H 3KJOA 5GROA 1MJCA 4NXMQ 4GNXA 4HIOA 4C2MH 5DLQE 4DR2L 2NVXH 1N33L 4OO1G 2JEBI 4NXNQ 3CW2C 1RIPA 2E5LL 4L5SA 1EOVA 4P71A 4LF7L 3CF5A 4OX9Q 1WOCA 4A3JH 3KDFB 1XTDA 4JI1Q 3CPWA 1XMQQ 3S14H 4BY7G 3CCLA 4AYBG 3IRBA 2ES2A 3I56A 1FJGQ 4YCVA 4DR6Q 4LF7Q 1SLJA 2KBNA 3GDEA 4LF5Q 1L1OB 4KHPL 1NY4A 3KF6A 3RLNA 1KHIA 5IYDG 1KL9A 4A3MG 1U5KA 4DR5Q 1TXYA 4LW1A 2UXBQ 1A62A 1XPRA 1CSQA 3ULJA 4R4QA 1LTLA 1P8LA 5M3FG 1VQJA 4K0KQ 1BBWA 3T1YQ 2HT1A 1X56A 4GN5A 3PUZA 4B3SL 1KC8C 2VL6A 4P72A 1I50H 5ELOA 1HZ9A 5LMUQ 4AYBE 4JV5L 3PO2H 1PH8A 2N3SA 2UXDQ 4AQYQ 2E5LQ 2Y0SG 1EN7A 2HJQA 5JEAG 3J81i 1VQPA 1VQCA 2JA7G 4A3JG 5HY6A 5C0XG 3KJPA 3F2CA 3PF4A 1CKOA 1XNRQ 3GTJH 1IYJB 1VQAA 2AWNA 3PUYA 4GN4B 4JI5Q 2NVQH 4BXXG 5LMNL 1Q82C 1MIUA 2Q2HA 3LGJA 3RNUA 3I4MG 4JYAL 5HGQA 3S17H 1T9HA 2QNFA 2PNHA 4DAYB 1HH2P 5C3EH 1E7ZA 1Q12A 4GOPA 5IYCH 3AQQA 1EIYB 4B3ML 4A3DH 1MKHA 4A3MH 3FP9A 1VQLA 1GVPA 4Y52H 3ER0A 3PUXA 1L1OA 2F3IA 5IWAL 3J80c 4B3TL 4LF6Q 2IX1A 4GKKL 3PUVA 4JV5Q 2OTJA 4NPSA 3S1MH 1EQRA 2A1AA 2AWOA 2IT1A 2UXDL 2ZJQA 5GAGC 5JJKA 3CAMA 1C7YA 1E7LA 2WB1E 2QA4A 1CKNB 1HR0Q 3T1YL 1UE5A 1Q81C 4LFCQ 1A8VA 2JE6I 4LF9L 1YBYA 1C9OA 3PO2G 3HOWG 1LYLA 4LF4L 3RN5A 2R93G 2PQAA 3S15H 2UUAL 3E0EA 1VQNA 4QJFA 2PI2E 2JA8G 4BBRH 1E1OA 1V1QA 1M90C 4NXML 3G6EA 1UE7A 1VQ7A 3GTQH 3S2HH 3CD6A 4XIGS 4DR1L 3K7AH 3I4MH 1KD1C 1CKNA 1YIJA 4A4IA 4JYAQ 2WB1G 3KOJA 3M9BA 5C3EG 2NZOA 4YWLA 1G291 1PFSA 4OX9L 1QVFA 3JAMi 4DV7Q 2OQ0A 4HJ8A 5JEAJ 4POFA 2RF4A 5IP7G 3SGIA 3D0FA 2AHOB 1RL2A 2VQFL 3PGZA 2A8VA 3K0XA 2HIXA 4LF4Q 1LUZA 4DR2Q 1N33Q 4DAMA 4EQ5A 1JMCA 1KXLA 1CKMA 3DM3A 1XNQQ 4DV7L 3S1NH 3RZDH 1U0LA 1HR0L 1HZBA 4OONA 1NMGA 2JA9A 4GLVB 4IPHA 2EIFA 1Q1BA 4KHZA 2WP8J 1SR3A 1V43A 1Y14B 4NXNL 2AKWB 2JA8H 2PQAB 4QL5A 4DV6L 1IBMQ 3KYHC 2CFMA 1N36L 2ATWA 1X3GA 3TEHB 3F1ZA 4JI7Q 2VQEQ 4PMWA 2NN6G 3W1GA 1JJCB 4JI6Q 2JA6H 2YTYA 5EAYA 4DR3L 3KF8B 4UP9A 4JCVE 4DK3C 4JBJA 5IP7H 2ZM6Q 1J5EL 2VQFQ 4HJ9A 4B3TQ 1N32Q 2UUCQ 3KF6B 2E2IH 2MQHA 2CQOA 3TRZA 1E7DA 3PCOB 1Y1WG 2WFWA 3EN2A 2Z0SA 2E2HH 4A3CH 5LMUL 4LUVA 2DGYA 4GOPC 1YVCA 3FKIH 4IFDI 3S2DH 4A93G 2Q2TA 3HFZB 4K0KL 2Q2UA 4DR7L 1X3EA 2GN5A 4LFBL 3STBC 3A0JA 3HOXH 2VQEL 3B6YA 2I5HA 3HOYG 2JQOA 1R9TH 1I3QH 2F4VL 4DV3Q 1K73C 1TWFH 1Y1VH 4R4OA 2F52A 2K5VA 3PIPA 1PH2A 1J5EQ 1LM0A 2UU9L 1HNZL 4JBWA 1O7IA 4AIMA 4R4CA 5IYBG 1SFOH 2YU9H 4IOAA 3ULLA 4LNQA 3AYHB 5M5WH 5IE8A 3CCEA 3S1RH 3I4OA 2GVBA 4A3CG 2UXBL 4MZ9A 4JI2Q 1TWAH 3TREA 2D0PA 5C4XH 1CSPA 3K8AA 3CC7A 3H0GG 4A3LH 3UE1A 4X64Q 4DV0L 4LF5L 2GVAA 3ULPA 1KIXA 2N78A 2VZAA 4DR7Q 1Q8KA 5GAEC 3UDFA 3HOXG 3GTLH 3DLLA 5LMNW 1HNZQ 2YYZA 2WAQG 4HJAA 4R4IA 3CCRA 1NTGA 1B70B 1XNQL 2EQSA 2KCMA 3UDGA 4HJ5A 1WI5A 2VUMH 3Q8DA 4H02A 4OWTB 4LUOA 3KFUA 3RN2A 1K8GA 2YTVA 5BR8L 4JI8L 1HNXL 1PV4A 2ZJRA 1HZAA 4BY7H 3CCMA 3NEMA 5IP9H 5IYBH 1WJJA 3WWVA 1YHBA 4R4TA 1N34Q 1VQ6A 2IX0A 3HOZG 4A3IG 3A5UA 3OW2A 4GN3B 4P74A 4GNXB 1PYSB 4APVA 3E9HA 1NE3A 3BU2A 4DUYL 3L7ZC 4UY8C 1SROA 2ASBA 3H3VH 3TQYA 3D31A 2R92G 2RCNA 1K83H 1L0WA 3HOVG 1Z47A 5IT9c 1YJ9A 2KCTA 4LFCL 4DV4Q 1J6QA 1VQDA 1I6HH 1S40A 1HZCA 2VW9A 2RHQB 1Q7YC 3I2ZA 1WCMH 2MO0A 3F2BA 1YJWA 1I5FA 2K5NA 1VQKA 1NBWA 4DV6Q 1YHAA 4X65L 1EFWA 1PYBA 4DNIA 4DV2Q 1PH3A 2F4VQ 5IP9G 4DUYQ 4JI0L 4GLAC 2ZTEA 4PG3A 3HOZH 4A3IH 2A19A 4Y7NH 1Q1EA 4GS3A 1VQ8A 1B8AA 3J7A5 4JI5L 1VQHA 4A3DG 5K36G 3M4QA 3H15A 1NJIC 4DR5L 4MTNA 2KHJA 3NENA 3EBEA 1EYGA 1PH7A 4JI4Q 1KAWA 1QUQA 3PV0A 4A3KG 2R92H 5GAHC 4PZ7A 1E1TA 1X6OA 4JBMA 2E2JH 1I94L 2K52A 3G48A 5GQOA 4DV4L 2ID0A 4AH6A 3PF5A 4WJ4A 1B7YB 1PH9A 2UU9Q 4LF8L 1FL0A 3HOWH 4GKJQ 2HIVA 3OTOQ 1N9WA 4X64L 4DV0Q 2IHEA 4DUZL 3RR5A 3UDIA 4BBRG 1N36Q 1YNXA 2NVYH 1G51A 3CP0A 4X65Q 1V9PA 4PZ6A 4DK6C 1IZ6A 3CQZH 2C35B 2JA5G 2QEXA 2NZHA 4X62L 2PMZE 2UUBL 4TVAB 3AFQA 3PIOA 2ZTDA 3OYYA 3T1HQ 1HR0W 1OTCA 2HHHQ 1AH9A 1IL2A 4L5QA 3K7UC 5C44G 4YWMA 2EXDA 1CUKA 2Z6KC 3U50C 3S1QH 4QQBX 5AJ3L 1W2BA 4LF6L 3M7NA 2L15A 2HQLA 4HJ7A 3F8TA 4L5TA 3I7FA 1TWGH 1Q46A 4ALPA 4IFDG 2RHSB 4O0AA 1SN8A 5C0XJ 4YWKA 1YEZA 2MNAA 2Q2IA 2V1CC 4OO1I 1W3SA 1D8LA 3AFPA 2R6GA 4UPAA 3PO3G 4KI0A 1N8RC 1XMOQ 5JJIA 5FJ8G 4BBSG 2ZJPA 3K80C 2BA0A 3CMAA 4DUZQ 2D0OA 2ZTCA 2K50A 2I5LX 4A75A 1Q86C 4DV2L 1VS0A 1E22A 2FXQA 3KDFA 5BR8Q 3CC4A 4B3MQ 2B3GA 2B63H 2MFIA 2Y0SE 3U4VA 4DKAC 1JJGA 1VQMA 2JA5H 1IXRA 4DR4Q 1JT8A 4DV1Q 4DR6L 2JA6G 2PI2A 1N34L 1PH4A 5M3MH 2HHHL 2H5XA 3M4OH 4JOIC 4A3GH 2VY3A 3PSIA 1A63A 2CCZA 1PVOA 4JI4L 1QVCA 1Y1WH 1KRTA 5FLMH 3CCVA 3W1BA 4GLXA 2OTLA 4IOCA 1WYDA 3FKIG 2QNCA 4NB3A 4O2DA 2VNUD 5IYDH 5ELNA 4DV5L 2E8GA 3K81C 1EWIA 4XTCS 4BY1G 5M3FH 1YHQA 2LXKA 1XPOA 1PH1A 3EIVA 1UE6A 4BBSH 4JI3L 3HOYH 3M85A 5JJLA 1HNWL 1KRSA 1BVSA 1I94Q 2AMCB 5IY0A 1X65A 2CWPA 3VDYA 1JE5A 3RLOA 3E9IA 1OXXK 1HNXQ 2B63G 4JI8Q 3KLWA 2UUAQ 1UE1A 3AEVA 3OTOL 5FLXc 4A3EH 4LF8Q 4GKJL 1HJPA 3FHWA 1K0RA 3BJUA 3G71A 1JJ2A 4IJHA 2K14A 5M3MG 1E24A 4P75A 2JA7H 4KLKA 1IBKL 1UWVA 3U58A 3GTKH 4A3GG 4BXXH 2K5HA 2OCEA 1IBLQ 4X6AH 1VCIA 1VQEA 1UEBA 2LXJA 4DV5Q 4OXPA 4C3IH 2XTIA 3CCUA 1L1OC 5FLMG 1YJNA 1X9NA 4X66L 3MXNB 4PZ8A 5IYCG 4YCWA 2CKZB 3M4PA 4L5RC 2KHIA 5C0XI 3CPFA 3BZKA 4OWWB 4YCUA 1PH6A 1VQGA 3L2PA 4LFBQ 2ALYB 3GTMH 4JOIA 4BY1H 1ASYA 2R7DA 3L0OA 2UXCL 1GO3E 3UDXA 5H1SE 3J81j 3ICEA 1G6PA 2N49A 2NVTH 2JEAI 2KENA 2VUMG 4C3HH 1S3OA 4UP8A 1YITA 2R93H 1YZ6A 4R1JA 4RG1A 4RMFA 4A3EG 1ASZA 1QZGA 2BA1A 2VS1A 1SE8A 4A76A 3TS0A 2YV5A 1EIFA 2WAQE 3MEFA 3CCJA 2UUBQ 2MO1A 1BKBA 3PUWA 3T1HL 1VQ9A 1IBLL 1SRUA 4LFAL 3CCSA 4JI7L 5LMNQ 1H95A 1X3FA 3ZJYC 4IPGA 3ERSX 1Z9FA 1C0AA 3JC66 4YHHL 3GTPH 2I5MX 2IHFA 2K4KA 4JI2L 2YTXA 3BZCA 1A0IA 4KHPQ 1SMXA 4X66Q 1PHJA 2R7ZH 1AE3A 3HOVH 3J80i 3GTOH 4HIMA 1N32L 1D7QA 2B29A 2UUCL 2Z6KA 4BA2I 4C3JH 3RLFA 3I55A 3CXCA 1PA6A 1JB7A 4POGA 4B3SQ 4DV1L 2XGTA 4QY7A 3JAMc 3S16H 1WCMG 4IPCA 4GOPB 1YI2A 1X54A 1VQIA 5M5XH 4IO9A 4A3FG 3A5ZB 2NN6I 4DPGA 4DV3L 4YY3L 1VQ4A 2IY5B 3CMEA 4BA1I 2OWOA 4GNXC 1EUJA 3HOUH 3HKSA 4JI3Q 4J15A 4JBKA 3I4NG 1HNWQ 2I0QA 1EQQA 5M5YH 2N8NA 4LFAQ 1GD7A 3H3VI 3M3YH 5GADC 4JI0Q 1OXTA 1TWHH 3NBHB 4DR1Q 1XMQL 4P73A 4A3BG 1NMFA 4JG2A 1FJGL 1XPUA 2D62A 1BBUA 1TWCH 1IBKQ 4DR4L 3W5OA 4WJ3M 1OXSC 3CC2A 2BH8A 4QIWE 5C4JH 4A3KH 2R7ZG 3CCQA 4B3RL 1M1KC 4IPDA 2BH2A 4TQUS 2UXCQ 1L2FA 5J3BA 4UP7A 1E3PA 1QUQB 3HKZE 4JC0A 1K3RA 1XMOL 4A93H 4EX5A 2R7FA 5E7NA 2LSSA 1VQFA 4LWCA 4ME3A 1K9MC 3STBD 1IBML 5IWAQ 3U4ZA 4A3FH 2JJQA 2OQKA 4GKKQ 3NELA 4YY3Q 4OWXB 2QGQA 3HOUG 1Y1VG 1OXUA 3GD7A 3UE0A 3I4NH 1GKHA 4AQYL 3TS2A 3GTGH 4IFDJ 4IJLA 1MJEA 1P16A 4HIDA 1WFQA 4DR3Q 2DUDA 3GO5A 4LF9Q 2K75A 3RZOH 4FDBA 4JI1L 5C44H 1XNRL 4A3BH 4JI6L 4X62Q 3HKZG 1VQOA 4QGUA 1KQSA 1OXVA 1K8AC 4MNOA 1VQ5A 1PH5A 4B3RQ 3G4SA 2ZM6L 3F2DA 1QVGA 4LUZA 1GM5A 2JK8A 1XJVA 1FGUA 5AJ3Q 3A74A 5C4XG 4YHHQ 1X55A
chains in the Genus database with same CATH superfamily
4DXGA 1AP0A 4KD3A 3N52A 1S72A 2CWAA 2RDFA 1QZHA 1MJCA 4NXMQ 1IW7C 4CKEA 4GNXA 4HIOA 2NVXH 4OO1G 5EJWA 3CW2C 1YNJC 4KJOA 1EOVA 4LF7L 3OMGA 4OX9Q 1WOCA 2AUKA 2PZTA 5A35A 1HQRD 1G8ZD 1FJGQ 4AYBG 4ZYSA 3I56A 2KVUA 5L37A 1Y02A 1HFGA 1GXDC 3AB9A 4LF5Q 3SVMA 5CORA 4G7OC 5C4XB 3VR2A 2UXBQ 1A62A 3DHQA 3SHLA 3CKIB 4K0KQ 5CMDA 1X56A 1I4XA 4R8NA 1KC8C 2F0HA 4P72A 1I50H 4FYDA 1PH8A 4AQYQ 2E5LQ 3Q22A 1EN7A 3MTSA 3OIQA 3RMHA 4A3JG 2ZXOA 4KY7A 1XNRQ 1IYJB 4C2MB 4GN4B 5DM73 3K58A 2LD7A 2Q2HA 3RD4A 1CA6A 3I4MG 4J6HA 1H9KA 2R61A 1ILPA 2QNFA 5C3EH 4B3ML 4A3DH 2OF1A 5G3LD 1VQLA 2Z8LA 3ER0A 3PUXA 3J80c 2IX1A 2L55A 5ELDA 4B3TL 2JVWA 3PUVA 4S3SA 4JV5Q 3S1MH 5JJKA 2AWOA 3MEHA 1PTOC 5GAGC 3CAMA 1C7YA 1BNZA 2WB1E 2WV6D 2QA4A 1CM9A 1A8VA 1K3BC 2F4IA 2JE6I 1YBYA 3HS0C 4O42A 3IKJA 3PO2G 3P1HA 3SDZA 2UUAL 3E0EA 5JEAH 4BBRH 1I50B 2O5JC 1M90C 1KDBA 4NXML 3G6EA 1UE7A 2OEOA 4XT1B 3UI2A 2D2CC 4JYAQ 3BDLA 3KOJA 3M9BA 3T51B 1QVFA 2EE1A 4OIKA 2OQ0A 1V1PA 4ZK9B 4DV7Q 3SGIA 2AHOB 2A8VA 1I4PA 4A3IB 1LUZA 1HA5A 2KCCA 1EZ8A 2HD3A 4HTHA 1CKMA 1V66A 4DAMA 1MSGA 2DNEA 4I7ZC 3QIAA 1HR0L 4OONA 2Q8RE 4GLVB 3K5OA 1CTMA 5E4XA 4KHZA 1SR3A 1Y14B 5F2DA 2JA8H 4QL5A 1G6ZA 3KYHC 4IUVA 3W1GA 1JJCB 5C4ZA 2VUMB 5EAYA 3M4OB 4DA2A 1HHVA 1ENCA 4DK3C 4JBJA 1S5CD 4CHTB 4NP5A 2E2IH 3TRZA 2CQOA 3D3RA 5JPNC 2IX3A 1RF2D 2DGYA 2K32A 2Q2TA 3RZOB 3HOVB 4DK1A 2GN5A 1ENAA 3MZ5A 2PYKA 4KJNA 1TT2A 3B6YA 1E0BA 4U68A 1R9TH 2KW9A 4LJZC 4X3KA 3ITPA 4R4OA 2VXWA 2PCFB 2SOBA 4HSVA 2F52A 5I4DA 1LM0A 2UU9L 5EKKA 4JBWA 4R4CA 2X6GA 1X32A 2B2UC 5IE8A 4K6DA 3CCEA 3S1RH 4CJ2C 2MP1A 5D3IB 5C5LA 4JI2Q 3TREA 2D0PA 1I6VC 2M00A 4A3LH 2KCNA 1SNDA 3NTKA 3ULPA 2QCPX 4QMGA 3GTLH 3DLLA 2YYZA 4NKLA 4R4IA 1GJJA 1TS3A 3A8IE 3RUZA 1WI5A 2ZXPA 3OSOA 4OWTB 4LUOA 5JPMC 2X6LA 1Q8IA 2KEEA 1J8IA 2D5DA 4JI8L 1HNXL 5KEEA 2ZJRA 4FF2A 3CCMA 3NEMA 5IP9H 3WWVA 2PQEA 1SNOA 4R4TA 2KFVA 1Y8PB 2IX0A 5EBDA 3MFGA 3S1MB 3BS1A 3A5UA 1M4VA 1NE3A 2F0SA 2F0LA 2B2YC 2B2VC 3L7ZC 2ICIA 3A7LA 1SROA 2ASBA 3TQYA 1IYUA 4HAEA 2RCNA 1K83H 2F0TA 5NUCA 1A3UA 2Y0SB 3NTHA 5IT9c 3HOVG 1R4QB 3T16A 4F7XA 4C3JG 5EQ0A 1V8QA 5C44B 2VW9A 2C9OA 2MO0A 2F0QA 1YJWA 4DV6Q 4B08A 3NSWA 1CK1A 3WOFA 4JI0L 1K28A 2L1BA 4GLAC 1BO0A 2KJXA 2F0PA 2ZTEA 2LC3A 3U9OA 5I2XA 3HOZH 4A3IH 4N9PA 4Y7NH 4GS3A 1VQ8A 3C1EA 4JI5L 1RTNA 3VYRA 2FMCA 2A68D 3PIO3 1G91A 3NENA 4DN4M 4JI4Q 2E74C 1H9RA 1BXTA 1E1TA 3PO3B 1NR2A 2A69C 1SYEA 4N9TA 2UU9Q 1TR5A 4LF8L 3HOWH 3MWYW 4GKJQ 3OTOQ 1CI3M 2IHEA 1FNWA 1QNKA 1I6HB 3CP0A 4J8QA 4X65Q 1RCVD 1QILA 3X3NA 3SR1A 2C35B 2WKCA 2QEXA 1SYDA 3AFQA 3T1HQ 2HHHQ 3EVQA 1FR3A 3K7UC 4M8AA 1VF7A 1DOKA 4UDUC 5AFWA 1CUKA 2B2YA 3MXNA 2VB3X 4ALPA 1Y1VB 1EIHA 2HQEA 4O0AA 1SN8A 1ONLA 2Q2IA 4ME5A 2FMMA 1W3SA 4UPAA 1STAA 4RWSC 4ZLTF 4BBSG 2BA0A 5LL6X 4DUZQ 3KBGA 3CC4A 3KDFA 4ZKBB 2F03A 3U4VA 1JJGA 1CQVA 1JT8A 2JA6G 1A15A 4JOIC 1BCPB 1TWGB 2VY3A 2XWBB 2C5CA 1SAPA 1PVOA 4EQNA 3LWUA 1KRTA 3TBIB 1Y1WH 4K8JA 5FLMH 2NVXB 1EY8A 3FKIG 2KOLA 5ELNA 4ZUJA 4C3JB 2RA4A 4DV5L 2E8GA 2KECA 3T53B 5M3FH 4XTCS 2A73B 2LXKA 3H94A 4KY6A 1YNNC 3EIVA 1XPOA 3QOLA 1HNWL 1BVSA 2EYFA 4LAAA 1D6EC 1JE5A 2B2WC 3MXPA 4G7ZC 2UUAQ 3OTOL 3CQZB 3H91A 5FO9B 5FLXE 3G71A 2K14A 4P75A 4KLKA 1JWUD 3DEPA 2K5HA 1VQEA 2LXJA 2F3VA 2K7VA 2XTIA 4C3IH 3Q23A 3CCUA 1YJNA 1X9NA 4H0LC 2CKZB 3M4PA 2XSCA 3A56A 3BVZA 4OWWB 4C1NI 4LFBQ 2WKDA 3NTIA 1HXYD 4JOIA 1JOQA 1RKNA 1GO3E 5H1SE 1G6PA 2N49A 2JEAI 2F0VA 2VUMG 1KNAA 2OT2A 1Q90A 1Y8NB 4XQNA 4HMIA 1QZGA 1EIFA 3MEFA 4HMJA 4PV1C 4JI7L 5LMNQ 5EPKA 2DN8A 1E2VA 1DXMA 3ERSX 5FK9C 3GTPH 4DAVA 4K5VA 1CZGA 5JVH3 1U9RA 1AE3A 3J80i 2B29A 3IFTA 3S1NB 2XGTA 2F0IA 3S16H 1WCMG 1EY7A 4IPCA 4GOPB 1LTGD 4IO9A 2WAQB 4DPGA 2NN6I 1VQ4A 4BA1I 4GNXC 4JI3Q 4J15A 4JBKA 1BCPC 2I0QA 1EQQA 4MN3A 2N8NA 3DM1A 1GD7A 4LFAQ 1SE2A 5GADC 4A3BG 4JG2A 1NNXA 4DNRB 4ZCKA 1BBUA 1TWAB 3W5OA 4IALA 4WJ3M 2RDGA 2VB2X 2BH8A 4IUQA 4QIWE 2R7ZG 3CCQA 2G80A 2BH2A 3NWSA 3DWPA 4TQUS 1QJOA 1B4OA 1QUQB 5KGUA 1XMOL 2LSSA 4CDFC 1K9MC 2NBFA 2A6HC 2CH4W 2EVBA 2CQAA 4OWXB 1XXGA 3I4NH 3GD7A 1GKHA 1U4LA 3KLSX 4KHVA 1H9SB 4IJLA 1MJEA 1P16A 4HIDA 4DR3Q 4F8MA 3GO5A 5CYUA 3GV6A 1ENFA 3LNNA 3PQIA 3NUCA 3RZOH 3HG9A 5C44H 4KKSA 2O2LD 1FYCA 4DAPA 3K59A 1D2BA 1ICWA 3F2DA 2G9HD 4QCLA 3A74A 5C4XG 1VF5C 1X55A 4A3LG 2EY2A 3S24A 1EYCA 3PO2B 1JICA 5FJ8H 1SYFA 1SNQA 2B8FA 2EY5A 1GUNA 4QF4A 1RIPA 1J9OA 3I3CA 2YU9B 5BN5A 1F9RA 4A3JH 5EPLA 4BBSB 1TWHB 4YCVA 2WINB 4DR6Q 1FGBD 4LF7Q 2K1BA 2XRSD 3GDEA 2NVTB 4KHPL 1NY4A 2K01A 2E2JB 1U5KA 4DR5Q 4LW1A 5ELFA 1U4PA 1CSQA 3ULJA 5D14A 3IFDA 1UAPA 1VQJA 2JA5B 1F2MA 4KKUA 4B3SL 2KHSA 2VL6A 4WJWA 3K6OA 4AYBE 4JV5L 3PO2H 2HJQA 5JEAG 1SDFA 5HY6A 5C0XG 3GTJH 2NVQH 2XN9C 4BXXG 1Q82C 4JYAL 3LGJA 3RNUA 2HDMA 1JE4A 3S17H 1T9HA 4DAYB 1HH2P 4AYBB 2HCCA 1IKLA 3AQQA 3N6RA 1MKHA 5ISRA 4A3MH 1L1OA 2QEJC 4LF6Q 1EQRA 2ZJQA 2QDBA 2WQGA 1W6JA 1UE5A 3T1YL 2DJGC 1Q81C 4LFCQ 1ICFB 3VR3A 4EGVA 3HOWG 3I90A 4OELB 3HKZB 4R8IA 4FF4A 2K5DA 2XVSA 3BG3A 2MJ8A 3CD6A 3CRKC 3TZDA 1R4PB 3K7AH 4DR1L 1KD1C 5IGBA 4NW2A 4A4IA 1WCMB 5C3EG 5IT9E 3BZDB 5BN3A 1JC7A 4KN7C 1I4QA 5KNDA 2Q8IB 3D0FA 3KK7A 1RL2A 4ULLA 1KXLA 4EQ5A 1JMCA 1XNQQ 1EWCA 4DV7L 2QDLA 1U0LA 1JQYD 3FPUB 3QG1A 4IZ8A 4IPHA 3HOYB 2E75C 2RSNA 3HGBA 3NPPA 5CIUA 1Q1BA 4HCEA 1V43A 5IGCA 4NXNL 5CBEE 4CBVA 1X3GA 4RGOS 5EKLA 5K5PA 1XYIA 4JI6Q 1VMCA 2YTYA 2B8GA 4KN4C 3K5NA 3H0GB 4XYOA 3J7YW 1VDZA 3KF8B 4UP9A 2ZM6Q 4WFN3 1N32Q 1PYWD 2VQFQ 2UUCQ 2MUYA 4NMZA 2CW0C 2E2HH 4LUVA 3FKIH 3HFZB 2F0WA 3FPPA 4ABNA 2BOSA 3STBC 4QIWB 4QUCA 2JQOA 1I3QH 4RGMA 2H4OA 5DNFA 3TP7A 1C4QA 1E2WA 1ET9A 1SE4A 2JSOA 4J1MA 2NN6H 2P5ZX 3JAME 3OOCA 4LNQA 3AYHB 1CHQD 5M5WH 3QB3A 1GL9B 1EY0A 3SK6A 4C3IG 1SYCA 3QO2A 2K6AA 3F2UA 1TWCB 1S4ZA 1CSPA 4K2KA 4DV0L 1O7LA 4LF5L 1LTID 3CRLC 1X3PA 4DR7Q 1NSNS 1Q8KA 1LTBD 1LT6D 3DMUA 3D4WA 3DWQA 5LMNW 4PMCA 5FKAC 4DNTB 3MXUA 4L6TB 1AZQA 4H02A 3S17B 1HRJA 1SNCA 4BY7H 3K0YA 4G7HC 1N34Q 1VQ6A 3HOZG 5FLXL 3OW2A 1JEIA 1PYSB 2F0OA 2E2DC 4APVA 3BU2A 5C5MA 5C3EB 3H3VH 3D31A 2N55A 1SEBD 4A93B 2KCTA 4DGZA 1SNPA 3J7AV 4L8JA 4DV4Q 4TSSA 1J6QA 3NHHA 1AN8A 3X3MA 2NVYB 3QJYA 3I2ZA 1I5FA 2K5NA 1KLGD 4R9WA 4X65L 1BCPF 4BBRB 1B3AA 1F9SA 1CFMA 3VR5A 2A19A 1IL8A 1Q1EA 1H9JA 3S14B 1VQHA 4A3DG 3TP6A 5K36G 5I6YA 2QW7A 1NJIC 2RBMA 3C2PA 3EBEA 1S5BD 1PH7A 2M9VA 2R92H 4A3KG 1H1JS 3J80L 5CV5A 4IUUA 3MAQA 2K52A 3PF5A 4AH6A 1LTAD 1WTHA 3GTLB 1KABA 1STHA 1ZYRC 2B63B 2HIVA 2SNSA 4X64L 1B50A 4GZYC 3A55A 1N36Q 2NVYH 1CQFA 1EZ6A 4DK6C 1EYAA 1BR9A 3H3VC 4X62L 2UUBL 3GTJB 1HR0W 4YIJA 1FNUA 1GJXA 5C44G 2EXDA 2Z6KC 4ZRZA 2L15A 2HQLA 4HJ7A 3F8TA 3HRZC 4L5TA 4KTAA 3I7FA 1TWGH 4IFDG 2JYOA 5C0XJ 4YWKA 1EQVA 1YEZA 1QG7A 5M5XB 4OO1I 2R6GA 4KI0A 1XMOQ 1V1PB 3I8ZA 5FJ8G 5JJIA 3A8KE 4XDXA 4XYQA 1BOSA 3CMAA 2D0OA 2ZTCA 2IW3A 4DV2L 1VS0A 5BR8Q 1TY2A 3R2TA 2B3GA 2B63H 2JA5H 4U673 2MHVA 2HHHL 3VYTA 2V4DA 2TSSA 4A3GH 1EY5A 2CCZA 5IIFA 3V05A 2EXZA 4GLXA 3I73A 1Z6HA 4NB3A 2TMPA 1JOOA 1TIID 2B2UA 3K81C 1EWIA 4FNFA 4BY1G 5CC4A 5CV6A 1UE6A 4BBSH 3HOYH 3PMFA 1NAPA 1BUVT 5JJLA 5IY0A 4RFBA 4WORA 2CWPA 1TS5A 3VDYA 3RLOA 4C3HG 2CH4A 1OXXK 2LY7A 2F0DA 1HFNA 3HOUB 1K0RA 1JJ2A 4IJHA 4M1UB 5C0XH 3GTKH 2B2TA 1IBKL 1UWVA 2L5TA 3GP7A 2LMCB 3J80E 4BXXH 2OCEA 3KUPA 2R7ZB 2J0TD 4OXPA 1SBBB 1X3QA 2EJGC 5IYCG 4PZ8A 4A3DB 4YCWA 4L5RC 5C0XI 4RCNA 2L4NA 3BZKA 3VA5A 4YCUA 1PH6A 1NR4A 5KIXA 1D5XC 2FJ2A 4RGNA 3GTMH 2XIWA 2ICEC 1ASYA 2NVQB 2UXCL 5G3LF 3J81j 2KENA 4A3FB 1YITA 2R93H 4OL7A 4RG1A 4RMFA 2CVRA 4A3EG 2Z4HA 1ASZA 1SE8A 4HR7B 4JPBW 3CCJA 1S5ED 2MO1A 1IBLL 1AEXA 1JEQA 4IPGA 5M5WB 2N88A 3JC66 3R8BA 4YHHL 2DY7A 2K4KA 3BZCA 1LTTD 1SMXA 1PHJA 2KVMA 2R7ZH 1H9FA 3HOVH 1D7QA 4HIMA 1QOHA 4C3JH 4JVZA 4C3HB 1XTCD 1PTOF 3I55A 1H9MA 4HSPA 4QY7A 4I7AA 1YI2A 2IJ0A 4A3FG 2OWOA 4PMBA 3HKSA 3I4NG 1SYGA 5M5YH 5EKIA 1ESRA 1M8AA 4JI0Q 3VR6A 1OXTA 1PLFA 4MHEA 4DR1Q 3EROA 4P73A 1FJGL 1IBKQ 1Y69U 4DR4L 1OXSC 2AQ3B 4EQOA 4B3RL 1XX8A 2MPMA 2FHTA 1M1KC 1JJRA 4IPDA 4FXGC 5C6AA 4RCOA 4Q5VA 3LX0A 4UP7A 1IKMA 3NQTA 3HKZE 1K3RA 4PNYA 3VYUA 4EX5A 4A93H 4LWCA 4HN7A 3STBD 3Q24A 3GTOB 1IBML 1QE6A 1TQOA 1UUPA 1LT5D 5IGFA 2OQKA 3NELA 1JWSD 1LLRD 2WACA 2H1EA 4AQYL 2EPBA 3GTGH 4IFDJ 1WFQA 4L63B 3NQIA 4LF9Q 3VR4A 4JK1C 2PW7A 3SEBA 1XNRL 4A3BH 2D9UA 5LHY1 4JI6L 2JA8B 1KQSA 2KVEA 2KQ3A 3S1RB 3NXWA 3NBHA 4MNOA 1VQ5A 4FVMA 5IGGA 1GM5A 3S2DB 4YHHQ 3QKJA 2XRQD 2DNCA 3J7ZC 3J81c 1DGSA 3TP5A 5IGDA 3OW7A 4KKTA 5FO7B 1N33L 3WDNA 4C2MH 5DLQE 3S15B 2Z9HA 2JEBI 3MA2B 2E5LL 4L5SA 4P71A 3D4RA 5M3MB 4JI1Q 1XMQQ 4BY7G 4ZKCB 3CCLA 5J1ZA 3QOJA 1BBXC 3C46A 3DUZA 1SLJA 3JAML 2EYJA 1L1OB 2PZWA 3KF6A 3M7GA 5IYDG 1KL9A 2WB1B 3R93A 4A3MG 1TXYA 4X3TA 3NBIA 1WTVA 4DK0A 1K83B 5M3FG 1BBWA 5M9OA 3T1YQ 2HT1A 1JOKA 2K04A 5ELOA 5LMUQ 1FD7D 1A3VA 3SE0A 1F77A 1ET6A 3EQLC 3J81i 2JA7G 3FEWX 2DY8A 3KJPA 1WTQA 3PF4A 3PUYA 2AWNA 5EBCA 4BITA 1MIUA 4KD4A 1DCZA 4N8FA 4GOPA 1E7ZA 1Q12A 2EYLA 5K36H 1KTKA 3FP9A 3I4LA 3IL8A 2IT1A 2A1AA 2UXDL 2G5DA 3W2DA 5KNBA 5CV7A 3PIP3 1CKNB 1HR0Q 2JA7B 2K03A 3OWFA 2L0CA 1HPCA 4LF9L 1C9OA 5D65A 3NWTA 2PQAA 2O4XA 4QJFA 2PI2E 3BVMA 4KV6A 1E1OA 3S2HH 1VQ7A 3GTQH 1A6XA 4XIGS 1YIJA 2AQ2B 5IODA 2WB1G 1ZBHA 2HCIA 2NZOA 1LO5D 4OX9L 3JAMi 4HJ8A 4XT3B 2RF4A 3ZYYX 1EQTA 3PGZA 5DEHA 1TS4A 1T5XD 4LF4Q 1N33Q 1R9TB 4V0BA 2RKSA 4IN3A 4K6LA 3NK9A 2JA9A 2E2HB 2EYOA 5EGTA 1RODA 2SNMA 4G57A 1Y8OB 1F2LA 2WP8J 4F88A 4ID6A 1MI2A 2AKWB 3WOEA 4DV6L 1GUSA 2CFMA 1TS2A 3F1ZA 4JI7Q 2X69A 4PMWA 2NN6G 1LTRD 3K5MA 1EEID 1JB3A 1DOLA 4UHVA 4DR3L 1U4RA 5IP7H 4HJ9A 4B3TQ 1WTPA 2Z0SA 1PRTF 5LMUL 4GOPC 2NUCA 4RA8A 4IFDI 1GHJA 4K0KL 1ZYRD 1PRTB 5I9PA 3VA7A 3HOXH 2VQEL 3KF8A 4FXKC 3HOYG 4A3GB 2PMZB 2F4VL 1K73C 2JXMB 1TWFH 1Y1VH 5JVG3 1YNJD 1PH2A 1J5EQ 5COYA 1O7IA 1O7YA 2NTTA 2L11A 4XQQA 5IYBG 2YU9H 4IOAA 1GUGA 3GTPB 3NE5B 4DAYA 3I4OA 4A3CG 2UXBL 1GUWA 4RHSA 5C4XH 3CC7A 3K8AA 3CU7A 3H0GG 3OWEB 3UE1A 2N78A 2A69D 2VZAA 3S16B 1VMPA 5GAEC 4CJ0B 1HNZQ 4HJAA 3CCRA 1B70B 5ELBA 2EQSA 2KCMA 3UDGA 3RN2A 3BDCA 1K8GA 1DM0B 1KDAA 1PV4A 1WTWA 3W3AA 3HEJA 3EA6A 1WJJA 3EJIA 1HCZA 4P74A 2RNOA 3E9HA 5BN4A 1KHCA 2R92G 2L12A 1L0WA 4C56C 5DAUA 1I6HH 1VQDA 4ODGA 1HZCA 1RHPA 3EFXD 4E6IA 1NBWA 1YHAA 3SXHA 1PYBA 1JORA 2F4VQ 4N8X1 4DUYQ 5A2QL 3HZXA 3J7A5 3HP3A 4DR5L 4MTNA 2KHJA 2PPBC 1KAWA 1QUQA 3MC0B 1PRTC 2AQ1B 1E2ZA 3I4MB 3SK5A 1YNND 4NDXA 3G48A 1I94L 4WJ4A 3BYYB 4RHRA 1PH9A 4OHJA 3FLGA 1STYA 5CV8A 1N9WA 1CHPD 3UDIA 1YNXA 1HUNA 5J39A 4A3JB 5I9OA 1EYDA 2R3ZA 3K5LA 1V9PA 1IZ6A 1TVXA 1B9MA 3TZUA 2JA5G 3DWAA 2NWGA 5CBAE 1AH9A 2ZTDA 3OYYA 4OGQC 1HQMC 1IL2A 4YWMA 5CV9A 1S5FD 1K0SA 3U50C 4QQBX 5AJ3L 4G4KA 1W2BA 3DXJC 4XXEA 4LF6L 1RJTA 2Z6BA 5JJZA 1D1KA 3K57A 1Q46A 4CDEC 2RHSB 4BS9A 2JA6B 4CDCC 2V1CC 1D8LA 3AFPA 4A3KB 4FF1A 3K80C 2KEDA 4A75A 1E22A 1PFMA 2MFIA 2Y0SE 1VQMA 1IXRA 1B53A 4DV1Q 3GTQB 1AZPA 2PI2A 2H5XA 2F0KA 4DU9A 3M4OH 1Z7TA 2PW5A 5DM63 3PSIA 1A63A 4RKLA 4JI4L 4K5WA 3QR8A 2PNRC 5HURA 3CCVA 4IFDH 1AFPA 1WYDA 5IYDH 2QILA 4IURA 1PH1A 4JI3L 1I94Q 2AMCB 5A2QE 1X65A 1PTOB 1KAAA 2B63G 4DFAA 4JI8Q 3V2TA 1UE1A 4CKBA 2FFKB 1DOMA 1EWHA 4A3EH 4LF8Q 4GKJL 1HJPA 2OXPA 3FHWA 2JA7H 2BE5C 5M3MG 3U58A 4A3GG 4RH6A 4X6AH 2KUMA 1UEBA 1SJHD 1C48A 1U4MA 2Z4IA 1ZEQX 1WD0A 1L1OC 3MVVA 1SE3A 3S2HB 4HEDA 3OMCA 2KHIA 1PZID 4IQZA 3V96A 3L2PA 2ALYB 3T4AC 1EY6A 2A6HD 2BDOA 4BY1H 1CT1D 1KNEA 2R7DA 3Q6SA 3UDXA 1B2TA 3ICEA 1JR0D 1SSOA 2AUJD 2NVTH 1PTOD 4Y7NB 1GUOA 4C3HH 4UP8A 1YZ6A 2A6EC 3G7LA 4A76A 3TS0A 4B9WA 2YV5A 1A3TA 1RTOA 4B3MQ 2O5IC 1O80A 1BKBA 3PUWA 3T1HL 3CCSA 1H95A 5E3FA 2IPKD 5CR3A 1L0XB 1Z9FA 3AMUA 3TN2A 2I5MX 2IHFA 3BYTB 3C1FA 2YTXA 1A0IA 4KHPQ 1STGA 4H13C 5T1GA 4X66Q 1K8MA 1UEAB 1AW7A 1B1ZA 2Z6KA 4BA2I 3FMCA 3GQBA 3URYA 4H44C 3CXCA 2DK4A 1I3QB 4B3SQ 4DV1L 3TMEA 1EU4A 3TDQA 4BY1B 1X54A 2NB0A 5M5XH 3I72A 3A5ZB 4YY3L 2IY5B 1EUJA 3HOUH 1HNWQ 3P75A 1I4HA 1WTOA 3ND8A 3H3VI 3M3YH 1TWFB 4KK7A 1TWCH 1G2SA 3T13A 5IT9L 5C4JH 4A3KH 3CC2A 1TY0A 4ZUIA 2EOTA 1ILQA 1L2FA 2NTSA 4XQJA 5J3BA 3GTMB 1DZ1A 1ZS9A 3FDTA 1B9NA 1VQFA 5IWAQ 3U4ZA 4A3FH 2JJQA 3IAYA 4GKKQ 1I4GA 2PZUA 1LV9A 2QGQA 1Y1VG 3TS2A 2DUDA 4Q0FA 4FDBA 4X62Q 3HKZG 1VQOA 1OXVA 1EL0A 2MGSA 1PH5A 4B3RQ 2ZM6L 1QVGA 2F0GA 3S9WA 1RD9D 1KRSA 1IYVA 3H0GH 5KYIA 4HIKA 1FVIA 1AE2A 3PO3H 1C8CA 5J22A 1VQBA 1HUMA 3KJOA 5GROA 2FINB 2Q8TA 4DR2L 2I07B 5D3DA 1BF4A 4NXNQ 3E5SA 2G9DA 1RDPD 3ERQA 3CF5A 1DJRD 2K5WA 3KDFB 1XTDA 3CPWA 1CA5A 4K14A 3S14H 2ES2A 3IRBA 3O13A 1BCPD 2E2IB 1HTLD 1LACA 4X3UA 2XNAC 2HUGA 2KBNA 3RLNA 1KHIA 3FVQA 4V190 1XPRA 4R4QA 1LTLA 1P8LA 3A54A 5M3FB 2LS01 4GN5A 3PUZA 4PQXA 1O78A 1HZ9A 5C3WA 4OO1H 2N3SA 2UXDQ 5I2YA 3S1QB 1MHWC 2Y0SG 3M4YA 1VQPA 5I6WA 1VQCA 3F2CA 1SYBA 1CKOA 3H6MA 1VQAA 4JI5Q 3P20A 5LMNL 4QB4A 2J7ZA 5HGQA 2PNHA 1T5EA 1EY4A 5IYCH 1EIYB 1MD2D 5ELCA 1GVPA 1STNA 3A7AB 3U9SA 4Y52H 1LT3D 2F3IA 5IWAL 3J7AF 2OTJA 2JN4A 4GKKL 4NPSA 2GA4B 2F0NA 5CGKA 1E7LA 2M2LA 2QF7A 5JOBA 5C3XA 1LYLA 4RAUC 3ONAB 5T1IA 3RN5A 4LF4L 2R93G 3S15H 1JCKB 1VQNA 1MSHA 2JA8G 1V1QA 2BCOA 5C4HA 2A5HA 5C4JB 3I4MH 1CKNA 2Z1CA 1SMYD 1KLUD 2F0MA 1KDCA 1G291 1PFSA 4YWLA 1K8OA 5JEAJ 1XWEA 4POFA 4QUFA 5IP7G 2K5QA 2VQFL 3K0XA 2R92B 2HIXA 4DR2Q 3DM3A 2QKIC 3S1NH 3RZDH 2ENBA 1HZBA 1NMGA 1B44D 2EIFA 2RNNA 1GUTA 1HTPA 1GOZA 2PQAB 1IBMQ 1N36L 2ATWA 3HOXB 2NYZD 3P7JA 3TEHB 2VQEQ 4RGTA 5FOBB 3GTGB 2JA6H 5E1FA 1ML0D 4JCVE 2F0EA 1J5EL 4TKOB 3KF6B 2MQHA 1E7DA 3PCOB 1Y1WG 2WFWA 1FNVA 3A8JE 3EN2A 4A3CH 3SK4A 1ZXTA 1LTSD 1NCVA 1YVCA 2SEBD 3MFYA 3S2DH 3OHXC 4A93G 2Q2UA 4DR7L 1X3EA 1QB5D 4LFBL 2B2TC 3A0JA 2F1MA 3LWEA 2I5HA 2L9HA 4BWGB 1UNSA 1F9QA 4K5XA 3T56B 4DV3Q 2KA7A 2ODCI 5CV4A 1Q3LA 2K28A 2RSOA 2K5VA 3PIPA 3MXGA 1ZKOA 1HNZL 4WRDA 4O1NA 4AIMA 2BE5D 2KVDA 3GTKB 1SFOH 4MIUA 3ULLA 1STBA 3M3YB 1Y1WB 3TP8A 2EYPA 5KNCA 2GVBA 1PZKD 2PO4A 1PTOH 5E4WC 1B3QA 2F0FA 1TWAH 4MZ9A 1SJED 1D5ZC 4X64Q 2GVAA 1KIXA 5FO8B 3UDFA 3HOXG 3NP8A 2HDLA 2WAQG 1NTGA 1XNQL 4RKBA 4C1NK 4HJ5A 2VUMH 3KFUA 3Q8DA 1IW7D 1IHZA 1EEFD 2A6ED 2YTVA 5BR8L 2EY1A 1HZAA 5IYBH 1YHBA 1HA6A 2DJFC 1F2YA 4LMQD 5TSSA 4A3IG 4GN3B 4GNXB 3DEOA 3L3OC 1SFOB 4DUYL 1WTRA 1PFBA 4UY8C 4EVOA 1WD1A 2CHBD 1JWMD 1Z47A 4OIJA 1YJ9A 2EJFC 1BQQT 4X3SA 4LFCL 1LT4D 2WIIB 2F3WA 1S40A 4CDDC 2RHQB 1Q7YC 3F2BA 1TU2B 1WCMH 5ELEA 1VQKA 2R93B 2EZVA 4LK1C 1EFWA 3D4DA 4OEMB 4DNIA 1PH3A 4DV2Q 5KRUA 5IP9G 3K7AB 4PG3A 5M5YB 3MHBA 1F2ZA 2ZXRA 1II3A 3GV3A 1B8AA 2ODGC 3RZDB 3M4QA 1O7ZA 3H15A 4IUPA 1G2TA 1D1IA 2F0UA 2RQXA 1EOTA 1BDOA 3TSSA 3SK8A 1EYGA 2I46A 3PV0A 2XWJB 5GAHC 2A74C 4PZ7A 1X6OA 4JBMA 2E2JH 3LLRA 2RDHA 4UZWA 1H9SA 5GQOA 4DV4L 2ID0A 1B7YB 1OO9B 4FF3A 1FL0A 4DV0Q 4DUZL 3RR5A 1MGSA 4BBRG 1EY9A 1G51A 2B2WA 2IL8A 4PZ6A 3CQZH 3D8GA 3Q0AA 2NZHA 2PMZE 3BDOA 4TVAB 3PIOA 3FKIB 1OTCA 4B9XA 4L5QA 4ZQ3A 2LKVA 3S1QH 3M7NA 1F9PA 2RCFA 1GHKA 2EYMA 2CW0D 1EU3A 4A3MB 4P2CB 2J4XA 2MNAA 4ILWA 3QWNA 1PDQA 3D6CA 4CGYB 4UAIA 3PO3G 2W51A 1N8RC 2ZJPA 3HOZB 1S5DD 2NZ1D 2E76C 2K50A 2I5LX 1Q86C 4H7BA 2FXQA 1PFNA 4DKAC 5HGTA 2MPHA 1NUCA 1W6KA 4DR6L 1N34L 3ND9A 4IUTA 1PH4A 5M3MH 3J81E 3KLRA 1GKUB 1QVCA 4DF7A 2EYHA 3W1BA 2OTLA 4CJ1B 4IOCA 5IGEA 2QNCA 2VNUD 4O2DA 1SNMA 3L9AX 1YHQA 3M85A 3D6WA 4FO2A 3R3OA 1DYQA 4CKCA 3E9IA 1HNXQ 3KLWA 3I70A 2F0JA 3AEVA 5FLXc 1ESFA 4BY7B 3BJUA 4DR4Q 1E24A 1IBLQ 1QNUA 1VCIA 1QCBD 4DV5Q 4Z9CB 5FLMG 4X66L 3MXNB 1WTXA 2K05A 1PMRA 1QWYA 3CPFA 4DXFA 1VQGA 1SXTA 4K2LA 2ZT9C 3L0OA 1I4RA 1D5MC 1EIGA 1S3OA 1V1OA 4R1JA 1STEA 1MBYA 3I4NB 1L0YB 2BA1A 3CHBD 2VS1A 2LFNA 4C3IB 2WAQE 2UUBQ 2EJMA 1EFID 4LFAL 5EPJA 1VQ9A 1SRUA 1SMYC 1X3FA 3ZJYC 1A2UA 3E3XA 1PXUA 1C0AA 4JI2L 2K33A 3KBXA 4KMUC 2B2VA 2BDNA 3VYSA 1N32L 3GTOH 1TKWB 2UUCL 2EDGA 4K8IA 2RVLA 5JAVA 3RLFA 1PA6A 1JB7A 4POGA 3JAMc 1CZWA 2IWHA 1VQIA 2EY6A 3J81L 2JP1A 3C3LA 4DV3L 4A3BB 3CMEA 4A3EB 4FP5D 5KYLA 3G6JB 1DONA 3HOWB 1TWHH 3NBHB 1XMQL 1NMFA 1XPUA 2D62A 3E0JA 3OPOA 2A68C 2SDFA 3I91A 4HCSA 2UXCQ 1E3PA 4JC0A 3H09A 1WVLA 3AU7A 2R7FA 5E7NA 4ME3A 4TRDA 1H9EA 1A2TA 1PRTD 4KY5A 2B39A 1LABA 4YY3Q 3BVGA 3HOUG 1OXUA 3UE0A 4I65A 3KLSA 4IUNA 1YNSA 4FXDA 2K75A 3OIPA 1DD2A 4JI1L 4MTKA 4JW0A 4QGUA 1K8AC 4EQPA 4F87A 3E6ZX 5LL6S 4ZAIA 3G4SA 3FRPB 4LUZA 1PZJD 2JK8A 1XJVA 1FGUA 5AJ3Q 3R2IA 5IOCA
chains in the Genus database with same CATH topology
3H0GH 4HIKA 3S24A 4A3LG 1FVIA 3J7ZC 1AE2A 1S72A 3PO3H 3J81c 1DGSA 2CWAA 1QZHA 1VQBA 5FJ8H 3KJOA 5GROA 1MJCA 4NXMQ 4GNXA 4HIOA 4C2MH 5DLQE 4DR2L 2NVXH 1N33L 4OO1G 2JEBI 4NXNQ 3CW2C 1RIPA 2E5LL 4L5SA 1EOVA 4P71A 4LF7L 3CF5A 4OX9Q 1WOCA 4A3JH 3KDFB 1XTDA 4JI1Q 3CPWA 1XMQQ 3S14H 4BY7G 3CCLA 4AYBG 3IRBA 2ES2A 3I56A 1FJGQ 4YCVA 4DR6Q 1Y02A 4LF7Q 1SLJA 2KBNA 3GDEA 4LF5Q 1L1OB 4KHPL 1NY4A 3KF6A 3RLNA 1KHIA 5IYDG 1KL9A 4A3MG 1U5KA 4DR5Q 1TXYA 4LW1A 2UXBQ 1A62A 1XPRA 1CSQA 3ULJA 4R4QA 1LTLA 1P8LA 5M3FG 1VQJA 4K0KQ 1BBWA 3T1YQ 2HT1A 1X56A 4GN5A 3PUZA 4B3SL 1KC8C 2VL6A 4P72A 1I50H 5ELOA 1HZ9A 5LMUQ 4AYBE 4JV5L 3PO2H 1PH8A 2N3SA 2UXDQ 4AQYQ 2E5LQ 2Y0SG 1EN7A 2HJQA 5JEAG 3J81i 1VQPA 1VQCA 2JA7G 4A3JG 5HY6A 5C0XG 3KJPA 3F2CA 3PF4A 1CKOA 1XNRQ 3GTJH 1IYJB 1VQAA 2AWNA 3PUYA 4GN4B 4JI5Q 2NVQH 4BXXG 5LMNL 1Q82C 2LD7A 1MIUA 2Q2HA 3LGJA 3RNUA 3I4MG 4JYAL 5HGQA 3S17H 1T9HA 2QNFA 2PNHA 4DAYB 1HH2P 5C3EH 1E7ZA 1Q12A 4GOPA 5IYCH 3AQQA 1EIYB 4B3ML 4A3DH 1MKHA 4A3MH 3FP9A 1VQLA 1GVPA 4Y52H 3ER0A 3PUXA 1L1OA 2F3IA 5IWAL 3J80c 4B3TL 4LF6Q 2IX1A 4GKKL 3PUVA 4JV5Q 2OTJA 4NPSA 3S1MH 2IT1A 1EQRA 2A1AA 2AWOA 2UXDL 2ZJQA 5GAGC 5JJKA 3CAMA 1C7YA 1E7LA 2WB1E 2QA4A 1CKNB 1HR0Q 3T1YL 1UE5A 1Q81C 4LFCQ 1A8VA 2JE6I 4LF9L 1YBYA 1C9OA 3PO2G 3HOWG 1LYLA 4LF4L 3RN5A 2R93G 2PQAA 3S15H 2UUAL 3E0EA 1VQNA 4QJFA 2PI2E 2JA8G 4BBRH 1E1OA 1V1QA 1M90C 4NXML 3G6EA 1UE7A 1VQ7A 3GTQH 3S2HH 3CD6A 4XIGS 4DR1L 3K7AH 3I4MH 1KD1C 1CKNA 1YIJA 4A4IA 4JYAQ 2WB1G 3KOJA 3M9BA 5C3EG 2NZOA 4YWLA 1G291 1PFSA 4OX9L 1QVFA 3JAMi 4DV7Q 2OQ0A 4HJ8A 5JEAJ 4POFA 2RF4A 5IP7G 3SGIA 3D0FA 2AHOB 1RL2A 2VQFL 3PGZA 2A8VA 3K0XA 2HIXA 4LF4Q 1LUZA 4DR2Q 1N33Q 4DAMA 4EQ5A 1JMCA 1KXLA 1CKMA 3DM3A 1XNQQ 4DV7L 3S1NH 3RZDH 1U0LA 1HR0L 1HZBA 4OONA 1NMGA 2JA9A 4GLVB 4IPHA 2EIFA 1Q1BA 4KHZA 2WP8J 1SR3A 1V43A 1Y14B 4NXNL 2AKWB 2JA8H 2PQAB 4QL5A 4DV6L 1IBMQ 3KYHC 2CFMA 1N36L 2ATWA 1X3GA 3TEHB 3F1ZA 4JI7Q 2VQEQ 4PMWA 2NN6G 3W1GA 1JJCB 4JI6Q 2JA6H 2YTYA 5EAYA 4DR3L 3KF8B 4UP9A 4JCVE 4DK3C 4JBJA 5IP7H 2ZM6Q 1J5EL 2VQFQ 4HJ9A 4B3TQ 1N32Q 2UUCQ 3KF6B 2E2IH 2MQHA 2CQOA 3TRZA 1E7DA 3PCOB 1Y1WG 2WFWA 3EN2A 2Z0SA 2E2HH 4A3CH 5LMUL 4LUVA 2DGYA 4GOPC 1YVCA 3FKIH 4IFDI 3S2DH 4A93G 2Q2TA 3HFZB 4K0KL 2Q2UA 4DR7L 1X3EA 2GN5A 4LFBL 3STBC 3A0JA 3HOXH 2VQEL 3B6YA 2I5HA 3HOYG 2JQOA 1R9TH 1I3QH 2F4VL 4DV3Q 1K73C 1TWFH 2ODCI 1Y1VH 4R4OA 2F52A 2K5VA 3PIPA 1PH2A 1J5EQ 1LM0A 2UU9L 1HNZL 4JBWA 1O7IA 4AIMA 4R4CA 5IYBG 1SFOH 2YU9H 4IOAA 3ULLA 4LNQA 3AYHB 5M5WH 5IE8A 3CCEA 3S1RH 3I4OA 1GL9B 2GVBA 4A3CG 2UXBL 4MZ9A 4JI2Q 1TWAH 3TREA 2D0PA 5C4XH 1CSPA 3K8AA 3CC7A 3H0GG 4A3LH 3UE1A 4X64Q 4DV0L 4LF5L 2GVAA 3ULPA 1KIXA 2N78A 2VZAA 4DR7Q 1Q8KA 5GAEC 3UDFA 3HOXG 3GTLH 3DLLA 5LMNW 1HNZQ 2YYZA 2WAQG 4HJAA 4R4IA 3CCRA 1NTGA 1B70B 1XNQL 1GJJA 2EQSA 2KCMA 3UDGA 4HJ5A 1WI5A 2VUMH 3Q8DA 4H02A 4OWTB 4LUOA 3KFUA 3RN2A 1K8GA 2YTVA 5BR8L 4JI8L 1HNXL 1PV4A 2ZJRA 1HZAA 4BY7H 3CCMA 3NEMA 5IP9H 5IYBH 1WJJA 3WWVA 1YHBA 4R4TA 1N34Q 1VQ6A 2KFVA 2IX0A 3HOZG 4A3IG 3A5UA 3OW2A 4GN3B 4P74A 4GNXB 1JEIA 1PYSB 4APVA 3E9HA 1NE3A 3BU2A 4DUYL 3L7ZC 4UY8C 1SROA 2ASBA 3H3VH 3TQYA 3D31A 2R92G 2RCNA 1K83H 1L0WA 3HOVG 1Z47A 5IT9c 1YJ9A 2KCTA 4LFCL 4DV4Q 1J6QA 1VQDA 1I6HH 1S40A 1HZCA 2VW9A 2RHQB 1Q7YC 3I2ZA 1WCMH 2MO0A 3F2BA 1YJWA 1I5FA 2K5NA 1VQKA 1NBWA 4DV6Q 1YHAA 4X65L 1EFWA 1PYBA 4DNIA 4DV2Q 1PH3A 2F4VQ 5IP9G 4DUYQ 4JI0L 4GLAC 2ZTEA 2LC3A 4PG3A 3HOZH 4A3IH 2A19A 4Y7NH 1Q1EA 4GS3A 1VQ8A 1B8AA 3J7A5 4JI5L 2ODGC 1VQHA 4A3DG 5K36G 3M4QA 3H15A 1NJIC 4DR5L 4MTNA 2KHJA 3NENA 3EBEA 1EYGA 1PH7A 4JI4Q 1KAWA 1QUQA 3PV0A 4A3KG 2R92H 5GAHC 4PZ7A 1E1TA 1X6OA 4JBMA 2E2JH 1I94L 2K52A 3G48A 5GQOA 4DV4L 2ID0A 4AH6A 3PF5A 4WJ4A 1B7YB 1PH9A 2UU9Q 4LF8L 1FL0A 3HOWH 4GKJQ 2HIVA 3OTOQ 1N9WA 4X64L 4DV0Q 2IHEA 4DUZL 3RR5A 3UDIA 4BBRG 1N36Q 1YNXA 2NVYH 1G51A 3CP0A 4X65Q 1V9PA 4PZ6A 4DK6C 1IZ6A 3CQZH 2C35B 2JA5G 2QEXA 2NZHA 4X62L 2PMZE 2UUBL 4TVAB 3AFQA 3PIOA 2ZTDA 3OYYA 3T1HQ 1HR0W 1OTCA 2HHHQ 1AH9A 1IL2A 4L5QA 3K7UC 5C44G 4YWMA 2EXDA 1CUKA 2Z6KC 3U50C 3S1QH 4QQBX 5AJ3L 1W2BA 4LF6L 3M7NA 2L15A 2HQLA 4HJ7A 3F8TA 4L5TA 3I7FA 1TWGH 1Q46A 4ALPA 4IFDG 2RHSB 4O0AA 1SN8A 5C0XJ 4YWKA 1YEZA 2MNAA 2Q2IA 2V1CC 4OO1I 1W3SA 1D8LA 3AFPA 2W51A 2R6GA 4UPAA 4KI0A 1N8RC 3PO3G 1XMOQ 5JJIA 5FJ8G 4BBSG 2ZJPA 3K80C 2BA0A 3CMAA 4DUZQ 2D0OA 2ZTCA 2K50A 2I5LX 4A75A 1Q86C 4DV2L 1VS0A 1E22A 2FXQA 3KDFA 5BR8Q 3CC4A 4B3MQ 2B3GA 2B63H 2MFIA 2Y0SE 3U4VA 4DKAC 1JJGA 1VQMA 2JA5H 1IXRA 4DR4Q 1JT8A 4DV1Q 2MPHA 4DR6L 2JA6G 2PI2A 1N34L 1PH4A 5M3MH 2HHHL 2H5XA 3M4OH 4JOIC 4A3GH 2VY3A 3PSIA 1A63A 2CCZA 1GKUB 1PVOA 4JI4L 1QVCA 1Y1WH 1KRTA 5FLMH 3CCVA 3W1BA 4GLXA 2OTLA 4IOCA 1WYDA 3FKIG 2QNCA 4NB3A 4O2DA 2VNUD 5IYDH 5ELNA 4DV5L 2E8GA 3K81C 1EWIA 4XTCS 4BY1G 5M3FH 1YHQA 2LXKA 1XPOA 1PH1A 3EIVA 1UE6A 4BBSH 4JI3L 3HOYH 3M85A 5JJLA 1HNWL 1KRSA 1BVSA 1I94Q 2AMCB 5IY0A 1X65A 2CWPA 3VDYA 1JE5A 3RLOA 3E9IA 1OXXK 1HNXQ 2B63G 4JI8Q 3KLWA 2UUAQ 1UE1A 3AEVA 3OTOL 5FLXc 4A3EH 4LF8Q 4GKJL 1HJPA 3FHWA 1K0RA 3BJUA 3G71A 1JJ2A 4IJHA 2K14A 5M3MG 1E24A 4P75A 2JA7H 4KLKA 1IBKL 1UWVA 3U58A 3GTKH 4A3GG 4BXXH 2K5HA 2OCEA 1IBLQ 4X6AH 1VCIA 1VQEA 1UEBA 2LXJA 4DV5Q 4OXPA 4C3IH 2XTIA 3CCUA 1L1OC 5FLMG 1YJNA 1X9NA 4X66L 3MXNB 4PZ8A 5IYCG 4YCWA 2CKZB 3M4PA 4L5RC 2KHIA 5C0XI 3CPFA 3BZKA 4OWWB 4YCUA 1PH6A 1VQGA 3L2PA 4LFBQ 2ALYB 3GTMH 4JOIA 4BY1H 1ASYA 2R7DA 3L0OA 2UXCL 1GO3E 3UDXA 5H1SE 3J81j 3ICEA 1G6PA 2N49A 2NVTH 2JEAI 2KENA 2VUMG 4C3HH 1S3OA 4UP8A 1YITA 2R93H 1YZ6A 4R1JA 4RG1A 4RMFA 4A3EG 1ASZA 1QZGA 2BA1A 2VS1A 1SE8A 4A76A 3TS0A 2YV5A 1EIFA 2WAQE 3MEFA 3CCJA 2UUBQ 2MO1A 1BKBA 3PUWA 3T1HL 1VQ9A 1IBLL 1SRUA 4LFAL 3CCSA 4JI7L 5LMNQ 1H95A 1X3FA 3ZJYC 4IPGA 3ERSX 1Z9FA 1C0AA 3JC66 4YHHL 3GTPH 2I5MX 2IHFA 2K4KA 4JI2L 2YTXA 3BZCA 1A0IA 4KHPQ 1SMXA 4X66Q 1PHJA 2R7ZH 1H9FA 1AE3A 3HOVH 3J80i 3GTOH 4HIMA 1N32L 1D7QA 2B29A 2UUCL 2Z6KA 4BA2I 4C3JH 3RLFA 3I55A 3CXCA 1PA6A 1JB7A 2DK4A 4POGA 4B3SQ 4DV1L 2XGTA 4QY7A 3JAMc 3S16H 1WCMG 4IPCA 4GOPB 1YI2A 1X54A 1VQIA 5M5XH 4IO9A 4A3FG 3A5ZB 2NN6I 4DPGA 4DV3L 4YY3L 1VQ4A 2IY5B 3CMEA 4BA1I 2OWOA 4GNXC 1EUJA 3HOUH 3HKSA 4JI3Q 4J15A 4JBKA 3I4NG 1HNWQ 2I0QA 1EQQA 5M5YH 2N8NA 4LFAQ 1GD7A 3H3VI 3M3YH 5GADC 4JI0Q 1OXTA 1TWHH 3NBHB 4DR1Q 1XMQL 4P73A 4A3BG 1NMFA 4JG2A 1FJGL 1XPUA 2D62A 1BBUA 1TWCH 1IBKQ 4DR4L 3W5OA 4WJ3M 1OXSC 3CC2A 2BH8A 4QIWE 5C4JH 4A3KH 2R7ZG 3CCQA 4B3RL 1M1KC 2G80A 4IPDA 2BH2A 4TQUS 2UXCQ 1L2FA 5J3BA 4UP7A 1E3PA 1QUQB 3HKZE 4JC0A 1K3RA 1XMOL 4A93H 4EX5A 1ZS9A 2R7FA 5E7NA 2LSSA 1VQFA 4LWCA 4ME3A 1H9EA 3STBD 1K9MC 1IBML 5IWAQ 3U4ZA 4A3FH 2JJQA 2OQKA 4GKKQ 3NELA 4YY3Q 4OWXB 2QGQA 3HOUG 1Y1VG 1OXUA 3GD7A 3UE0A 3I4NH 1GKHA 4AQYL 3TS2A 3GTGH 4IFDJ 4IJLA 1MJEA 1P16A 4HIDA 1WFQA 4DR3Q 2DUDA 1YNSA 3GO5A 4LF9Q 2K75A 3RZOH 4FDBA 4JI1L 5C44H 1XNRL 4A3BH 4JI6L 4X62Q 3HKZG 1VQOA 4QGUA 1KQSA 1OXVA 1K8AC 4MNOA 1VQ5A 1PH5A 4B3RQ 3G4SA 2ZM6L 3F2DA 1QVGA 4LUZA 1GM5A 2JK8A 1XJVA 1FGUA 5AJ3Q 3A74A 5C4XG 4YHHQ 1X55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0G H;  4HIK A;  3S24 A;  4A3L G;  1FVI A;  3J7Z C;  1AE2 A;  1S72 A;  3PO3 H;  3J81 c;  1DGS A;  2CWA A;  1QZH A;  1VQB A;  5FJ8 H;  3KJO A;  5GRO A;  1MJC A;  4NXM Q;  4GNX A;  4HIO A;  4C2M H;  5DLQ E;  4DR2 L;  2NVX H;  1N33 L;  4OO1 G;  2JEB I;  4NXN Q;  3CW2 C;  1RIP A;  2E5L L;  4L5S A;  1EOV A;  4P71 A;  4LF7 L;  3CF5 A;  4OX9 Q;  1WOC A;  4A3J H;  3KDF B;  1XTD A;  4JI1 Q;  3CPW A;  1XMQ Q;  3S14 H;  4BY7 G;  3CCL A;  4AYB G;  3IRB A;  2ES2 A;  3I56 A;  1FJG Q;  4YCV A;  4DR6 Q;  4LF7 Q;  1SLJ A;  2KBN A;  3GDE A;  4LF5 Q;  1L1O B;  4KHP L;  1NY4 A;  3KF6 A;  3RLN A;  1KHI A;  5IYD G;  1KL9 A;  4A3M G;  1U5K A;  4DR5 Q;  1TXY A;  4LW1 A;  2UXB Q;  1A62 A;  1XPR A;  1CSQ A;  3ULJ A;  4R4Q A;  1LTL A;  1P8L A;  5M3F G;  1VQJ A;  4K0K Q;  1BBW A;  3T1Y Q;  2HT1 A;  1X56 A;  4GN5 A;  3PUZ A;  4B3S L;  1KC8 C;  2VL6 A;  4P72 A;  1I50 H;  5ELO A;  1HZ9 A;  5LMU Q;  4AYB E;  4JV5 L;  3PO2 H;  1PH8 A;  2N3S A;  2UXD Q;  4AQY Q;  2E5L Q;  2Y0S G;  1EN7 A;  2HJQ A;  5JEA G;  3J81 i;  1VQP A;  1VQC A;  2JA7 G;  4A3J G;  5HY6 A;  5C0X G;  3KJP A;  3F2C A;  3PF4 A;  1CKO A;  1XNR Q;  3GTJ H;  1IYJ B;  1VQA A;  2AWN A;  3PUY A;  4GN4 B;  4JI5 Q;  2NVQ H;  4BXX G;  5LMN L;  1Q82 C;  1MIU A;  2Q2H A;  3LGJ A;  3RNU A;  3I4M G;  4JYA L;  5HGQ A;  3S17 H;  1T9H A;  2QNF A;  2PNH A;  4DAY B;  1HH2 P;  5C3E H;  1E7Z A;  1Q12 A;  4GOP A;  5IYC H;  3AQQ A;  1EIY B;  4B3M L;  4A3D H;  1MKH A;  4A3M H;  3FP9 A;  1VQL A;  1GVP A;  4Y52 H;  3ER0 A;  3PUX A;  1L1O A;  2F3I A;  5IWA L;  3J80 c;  4B3T L;  4LF6 Q;  2IX1 A;  4GKK L;  3PUV A;  4JV5 Q;  2OTJ A;  4NPS A;  3S1M H;  1EQR A;  2A1A A;  2AWO A;  2IT1 A;  2UXD L;  2ZJQ A;  5GAG C;  5JJK A;  3CAM A;  1C7Y A;  1E7L A;  2WB1 E;  2QA4 A;  1CKN B;  1HR0 Q;  3T1Y L;  1UE5 A;  1Q81 C;  4LFC Q;  1A8V A;  2JE6 I;  4LF9 L;  1YBY A;  1C9O A;  3PO2 G;  3HOW G;  1LYL A;  4LF4 L;  3RN5 A;  2R93 G;  2PQA A;  3S15 H;  2UUA L;  3E0E A;  1VQN A;  4QJF A;  2PI2 E;  2JA8 G;  4BBR H;  1E1O A;  1V1Q A;  1M90 C;  4NXM L;  3G6E A;  1UE7 A;  1VQ7 A;  3GTQ H;  3S2H H;  3CD6 A;  4XIG S;  4DR1 L;  3K7A H;  3I4M H;  1KD1 C;  1CKN A;  1YIJ A;  4A4I A;  4JYA Q;  2WB1 G;  3KOJ A;  3M9B A;  5C3E G;  2NZO A;  4YWL A;  1G29 1;  1PFS A;  4OX9 L;  1QVF A;  3JAM i;  4DV7 Q;  2OQ0 A;  4HJ8 A;  5JEA J;  4POF A;  2RF4 A;  5IP7 G;  3SGI A;  3D0F A;  2AHO B;  1RL2 A;  2VQF L;  3PGZ A;  2A8V A;  3K0X A;  2HIX A;  4LF4 Q;  1LUZ A;  4DR2 Q;  1N33 Q;  4DAM A;  4EQ5 A;  1JMC A;  1KXL A;  1CKM A;  3DM3 A;  1XNQ Q;  4DV7 L;  3S1N H;  3RZD H;  1U0L A;  1HR0 L;  1HZB A;  4OON A;  1NMG A;  2JA9 A;  4GLV B;  4IPH A;  2EIF A;  1Q1B A;  4KHZ A;  2WP8 J;  1SR3 A;  1V43 A;  1Y14 B;  4NXN L;  2AKW B;  2JA8 H;  2PQA B;  4QL5 A;  4DV6 L;  1IBM Q;  3KYH C;  2CFM A;  1N36 L;  2ATW A;  1X3G A;  3TEH B;  3F1Z A;  4JI7 Q;  2VQE Q;  4PMW A;  2NN6 G;  3W1G A;  1JJC B;  4JI6 Q;  2JA6 H;  2YTY A;  5EAY A;  4DR3 L;  3KF8 B;  4UP9 A;  4JCV E;  4DK3 C;  4JBJ A;  5IP7 H;  2ZM6 Q;  1J5E L;  2VQF Q;  4HJ9 A;  4B3T Q;  1N32 Q;  2UUC Q;  3KF6 B;  2E2I H;  2MQH A;  2CQO A;  3TRZ A;  1E7D A;  3PCO B;  1Y1W G;  2WFW A;  3EN2 A;  2Z0S A;  2E2H H;  4A3C H;  5LMU L;  4LUV A;  2DGY A;  4GOP C;  1YVC A;  3FKI H;  4IFD I;  3S2D H;  4A93 G;  2Q2T A;  3HFZ B;  4K0K L;  2Q2U A;  4DR7 L;  1X3E A;  2GN5 A;  4LFB L;  3STB C;  3A0J A;  3HOX H;  2VQE L;  3B6Y A;  2I5H A;  3HOY G;  2JQO A;  1R9T H;  1I3Q H;  2F4V L;  4DV3 Q;  1K73 C;  1TWF H;  1Y1V H;  4R4O A;  2F52 A;  2K5V A;  3PIP A;  1PH2 A;  1J5E Q;  1LM0 A;  2UU9 L;  1HNZ L;  4JBW A;  1O7I A;  4AIM A;  4R4C A;  5IYB G;  1SFO H;  2YU9 H;  4IOA A;  3ULL A;  4LNQ A;  3AYH B;  5M5W H;  5IE8 A;  3CCE A;  3S1R H;  3I4O A;  2GVB A;  4A3C G;  2UXB L;  4MZ9 A;  4JI2 Q;  1TWA H;  3TRE A;  2D0P A;  5C4X H;  1CSP A;  3K8A A;  3CC7 A;  3H0G G;  4A3L H;  3UE1 A;  4X64 Q;  4DV0 L;  4LF5 L;  2GVA A;  3ULP A;  1KIX A;  2N78 A;  2VZA A;  4DR7 Q;  1Q8K A;  5GAE C;  3UDF A;  3HOX G;  3GTL H;  3DLL A;  5LMN W;  1HNZ Q;  2YYZ A;  2WAQ G;  4HJA A;  4R4I A;  3CCR A;  1NTG A;  1B70 B;  1XNQ L;  2EQS A;  2KCM A;  3UDG A;  4HJ5 A;  1WI5 A;  2VUM H;  3Q8D A;  4H02 A;  4OWT B;  4LUO A;  3KFU A;  3RN2 A;  1K8G A;  2YTV A;  5BR8 L;  4JI8 L;  1HNX L;  1PV4 A;  2ZJR A;  1HZA A;  4BY7 H;  3CCM A;  3NEM A;  5IP9 H;  5IYB H;  1WJJ A;  3WWV A;  1YHB A;  4R4T A;  1N34 Q;  1VQ6 A;  2IX0 A;  3HOZ G;  4A3I G;  3A5U A;  3OW2 A;  4GN3 B;  4P74 A;  4GNX B;  1PYS B;  4APV A;  3E9H A;  1NE3 A;  3BU2 A;  4DUY L;  3L7Z C;  4UY8 C;  1SRO A;  2ASB A;  3H3V H;  3TQY A;  3D31 A;  2R92 G;  2RCN A;  1K83 H;  1L0W A;  3HOV G;  1Z47 A;  5IT9 c;  1YJ9 A;  2KCT A;  4LFC L;  4DV4 Q;  1J6Q A;  1VQD A;  1I6H H;  1S40 A;  1HZC A;  2VW9 A;  2RHQ B;  1Q7Y C;  3I2Z A;  1WCM H;  2MO0 A;  3F2B A;  1YJW A;  1I5F A;  2K5N A;  1VQK A;  1NBW A;  4DV6 Q;  1YHA A;  4X65 L;  1EFW A;  1PYB A;  4DNI A;  4DV2 Q;  1PH3 A;  2F4V Q;  5IP9 G;  4DUY Q;  4JI0 L;  4GLA C;  2ZTE A;  4PG3 A;  3HOZ H;  4A3I H;  2A19 A;  4Y7N H;  1Q1E A;  4GS3 A;  1VQ8 A;  1B8A A;  3J7A 5;  4JI5 L;  1VQH A;  4A3D G;  5K36 G;  3M4Q A;  3H15 A;  1NJI C;  4DR5 L;  4MTN A;  2KHJ A;  3NEN A;  3EBE A;  1EYG A;  1PH7 A;  4JI4 Q;  1KAW A;  1QUQ A;  3PV0 A;  4A3K G;  2R92 H;  5GAH C;  4PZ7 A;  1E1T A;  1X6O A;  4JBM A;  2E2J H;  1I94 L;  2K52 A;  3G48 A;  5GQO A;  4DV4 L;  2ID0 A;  4AH6 A;  3PF5 A;  4WJ4 A;  1B7Y B;  1PH9 A;  2UU9 Q;  4LF8 L;  1FL0 A;  3HOW H;  4GKJ Q;  2HIV A;  3OTO Q;  1N9W A;  4X64 L;  4DV0 Q;  2IHE A;  4DUZ L;  3RR5 A;  3UDI A;  4BBR G;  1N36 Q;  1YNX A;  2NVY H;  1G51 A;  3CP0 A;  4X65 Q;  1V9P A;  4PZ6 A;  4DK6 C;  1IZ6 A;  3CQZ H;  2C35 B;  2JA5 G;  2QEX A;  2NZH A;  4X62 L;  2PMZ E;  2UUB L;  4TVA B;  3AFQ A;  3PIO A;  2ZTD A;  3OYY A;  3T1H Q;  1HR0 W;  1OTC A;  2HHH Q;  1AH9 A;  1IL2 A;  4L5Q A;  3K7U C;  5C44 G;  4YWM A;  2EXD A;  1CUK A;  2Z6K C;  3U50 C;  3S1Q H;  4QQB X;  5AJ3 L;  1W2B A;  4LF6 L;  3M7N A;  2L15 A;  2HQL A;  4HJ7 A;  3F8T A;  4L5T A;  3I7F A;  1TWG H;  1Q46 A;  4ALP A;  4IFD G;  2RHS B;  4O0A A;  1SN8 A;  5C0X J;  4YWK A;  1YEZ A;  2MNA A;  2Q2I A;  2V1C C;  4OO1 I;  1W3S A;  1D8L A;  3AFP A;  2R6G A;  4UPA A;  3PO3 G;  4KI0 A;  1N8R C;  1XMO Q;  5JJI A;  5FJ8 G;  4BBS G;  2ZJP A;  3K80 C;  2BA0 A;  3CMA A;  4DUZ Q;  2D0O A;  2ZTC A;  2K50 A;  2I5L X;  4A75 A;  1Q86 C;  4DV2 L;  1VS0 A;  1E22 A;  2FXQ A;  3KDF A;  5BR8 Q;  3CC4 A;  4B3M Q;  2B3G A;  2B63 H;  2MFI A;  2Y0S E;  3U4V A;  4DKA C;  1JJG A;  1VQM A;  2JA5 H;  1IXR A;  4DR4 Q;  1JT8 A;  4DV1 Q;  4DR6 L;  2JA6 G;  2PI2 A;  1N34 L;  1PH4 A;  5M3M H;  2HHH L;  2H5X A;  3M4O H;  4JOI C;  4A3G H;  2VY3 A;  3PSI A;  1A63 A;  2CCZ A;  1PVO A;  4JI4 L;  1QVC A;  1Y1W H;  1KRT A;  5FLM H;  3CCV A;  3W1B A;  4GLX A;  2OTL A;  4IOC A;  1WYD A;  3FKI G;  2QNC A;  4NB3 A;  4O2D A;  2VNU D;  5IYD H;  5ELN A;  4DV5 L;  2E8G A;  3K81 C;  1EWI A;  4XTC S;  4BY1 G;  5M3F H;  1YHQ A;  2LXK A;  1XPO A;  1PH1 A;  3EIV A;  1UE6 A;  4BBS H;  4JI3 L;  3HOY H;  3M85 A;  5JJL A;  1HNW L;  1KRS A;  1BVS A;  1I94 Q;  2AMC B;  5IY0 A;  1X65 A;  2CWP A;  3VDY A;  1JE5 A;  3RLO A;  3E9I A;  1OXX K;  1HNX Q;  2B63 G;  4JI8 Q;  3KLW A;  2UUA Q;  1UE1 A;  3AEV A;  3OTO L;  5FLX c;  4A3E H;  4LF8 Q;  4GKJ L;  1HJP A;  3FHW A;  1K0R A;  3BJU A;  3G71 A;  1JJ2 A;  4IJH A;  2K14 A;  5M3M G;  1E24 A;  4P75 A;  2JA7 H;  4KLK A;  1IBK L;  1UWV A;  3U58 A;  3GTK H;  4A3G G;  4BXX H;  2K5H A;  2OCE A;  1IBL Q;  4X6A H;  1VCI A;  1VQE A;  1UEB A;  2LXJ A;  4DV5 Q;  4OXP A;  4C3I H;  2XTI A;  3CCU A;  1L1O C;  5FLM G;  1YJN A;  1X9N A;  4X66 L;  3MXN B;  4PZ8 A;  5IYC G;  4YCW A;  2CKZ B;  3M4P A;  4L5R C;  2KHI A;  5C0X I;  3CPF A;  3BZK A;  4OWW B;  4YCU A;  1PH6 A;  1VQG A;  3L2P A;  4LFB Q;  2ALY B;  3GTM H;  4JOI A;  4BY1 H;  1ASY A;  2R7D A;  3L0O A;  2UXC L;  1GO3 E;  3UDX A;  5H1S E;  3J81 j;  3ICE A;  1G6P A;  2N49 A;  2NVT H;  2JEA I;  2KEN A;  2VUM G;  4C3H H;  1S3O A;  4UP8 A;  1YIT A;  2R93 H;  1YZ6 A;  4R1J A;  4RG1 A;  4RMF A;  4A3E G;  1ASZ A;  1QZG A;  2BA1 A;  2VS1 A;  1SE8 A;  4A76 A;  3TS0 A;  2YV5 A;  1EIF A;  2WAQ E;  3MEF A;  3CCJ A;  2UUB Q;  2MO1 A;  1BKB A;  3PUW A;  3T1H L;  1VQ9 A;  1IBL L;  1SRU A;  4LFA L;  3CCS A;  4JI7 L;  5LMN Q;  1H95 A;  1X3F A;  3ZJY C;  4IPG A;  3ERS X;  1Z9F A;  1C0A A;  3JC6 6;  4YHH L;  3GTP H;  2I5M X;  2IHF A;  2K4K A;  4JI2 L;  2YTX A;  3BZC A;  1A0I A;  4KHP Q;  1SMX A;  4X66 Q;  1PHJ A;  2R7Z H;  1AE3 A;  3HOV H;  3J80 i;  3GTO H;  4HIM A;  1N32 L;  1D7Q A;  2B29 A;  2UUC L;  2Z6K A;  4BA2 I;  4C3J H;  3RLF A;  3I55 A;  3CXC A;  1PA6 A;  1JB7 A;  4POG A;  4B3S Q;  4DV1 L;  2XGT A;  4QY7 A;  3JAM c;  3S16 H;  1WCM G;  4IPC A;  4GOP B;  1YI2 A;  1X54 A;  1VQI A;  5M5X H;  4IO9 A;  4A3F G;  3A5Z B;  2NN6 I;  4DPG A;  4DV3 L;  4YY3 L;  1VQ4 A;  2IY5 B;  3CME A;  4BA1 I;  2OWO A;  4GNX C;  1EUJ A;  3HOU H;  3HKS A;  4JI3 Q;  4J15 A;  4JBK A;  3I4N G;  1HNW Q;  2I0Q A;  1EQQ A;  5M5Y H;  2N8N A;  4LFA Q;  1GD7 A;  3H3V I;  3M3Y H;  5GAD C;  4JI0 Q;  1OXT A;  1TWH H;  3NBH B;  4DR1 Q;  1XMQ L;  4P73 A;  4A3B G;  1NMF A;  4JG2 A;  1FJG L;  1XPU A;  2D62 A;  1BBU A;  1TWC H;  1IBK Q;  4DR4 L;  3W5O A;  4WJ3 M;  1OXS C;  3CC2 A;  2BH8 A;  4QIW E;  5C4J H;  4A3K H;  2R7Z G;  3CCQ A;  4B3R L;  1M1K C;  4IPD A;  2BH2 A;  4TQU S;  2UXC Q;  1L2F A;  5J3B A;  4UP7 A;  1E3P A;  1QUQ B;  3HKZ E;  4JC0 A;  1K3R A;  1XMO L;  4A93 H;  4EX5 A;  2R7F A;  5E7N A;  2LSS A;  1VQF A;  4LWC A;  4ME3 A;  1K9M C;  3STB D;  1IBM L;  5IWA Q;  3U4Z A;  4A3F H;  2JJQ A;  2OQK A;  4GKK Q;  3NEL A;  4YY3 Q;  4OWX B;  2QGQ A;  3HOU G;  1Y1V G;  1OXU A;  3GD7 A;  3UE0 A;  3I4N H;  1GKH A;  4AQY L;  3TS2 A;  3GTG H;  4IFD J;  4IJL A;  1MJE A;  1P16 A;  4HID A;  1WFQ A;  4DR3 Q;  2DUD A;  3GO5 A;  4LF9 Q;  2K75 A;  3RZO H;  4FDB A;  4JI1 L;  5C44 H;  1XNR L;  4A3B H;  4JI6 L;  4X62 Q;  3HKZ G;  1VQO A;  4QGU A;  1KQS A;  1OXV A;  1K8A C;  4MNO A;  1VQ5 A;  1PH5 A;  4B3R Q;  3G4S A;  2ZM6 L;  3F2D A;  1QVG A;  4LUZ A;  1GM5 A;  2JK8 A;  1XJV A;  1FGU A;  5AJ3 Q;  3A74 A;  5C4X G;  4YHH Q;  1X55 A; 
#chains in the Genus database with same CATH topology
 4DXG A;  1AP0 A;  4KD3 A;  3N52 A;  1S72 A;  2CWA A;  2RDF A;  1QZH A;  1MJC A;  4NXM Q;  1IW7 C;  4CKE A;  4GNX A;  4HIO A;  2NVX H;  4OO1 G;  5EJW A;  3CW2 C;  1YNJ C;  4KJO A;  1EOV A;  4LF7 L;  3OMG A;  4OX9 Q;  1WOC A;  2AUK A;  2PZT A;  5A35 A;  1HQR D;  1G8Z D;  1FJG Q;  4AYB G;  4ZYS A;  3I56 A;  2KVU A;  5L37 A;  1Y02 A;  1HFG A;  1GXD C;  3AB9 A;  4LF5 Q;  3SVM A;  5COR A;  4G7O C;  5C4X B;  3VR2 A;  2UXB Q;  1A62 A;  3DHQ A;  3SHL A;  3CKI B;  4K0K Q;  5CMD A;  1X56 A;  1I4X A;  4R8N A;  1KC8 C;  2F0H A;  4P72 A;  1I50 H;  4FYD A;  1PH8 A;  4AQY Q;  2E5L Q;  3Q22 A;  1EN7 A;  3MTS A;  3OIQ A;  3RMH A;  4A3J G;  2ZXO A;  4KY7 A;  1XNR Q;  1IYJ B;  4C2M B;  4GN4 B;  5DM7 3;  3K58 A;  2LD7 A;  2Q2H A;  3RD4 A;  1CA6 A;  3I4M G;  4J6H A;  1H9K A;  2R61 A;  1ILP A;  2QNF A;  5C3E H;  4B3M L;  4A3D H;  2OF1 A;  5G3L D;  1VQL A;  2Z8L A;  3ER0 A;  3PUX A;  3J80 c;  2IX1 A;  2L55 A;  5ELD A;  4B3T L;  2JVW A;  3PUV A;  4S3S A;  4JV5 Q;  3S1M H;  5JJK A;  2AWO A;  3MEH A;  1PTO C;  5GAG C;  3CAM A;  1C7Y A;  1BNZ A;  2WB1 E;  2WV6 D;  2QA4 A;  1CM9 A;  1A8V A;  1K3B C;  2F4I A;  2JE6 I;  1YBY A;  3HS0 C;  4O42 A;  3IKJ A;  3PO2 G;  3P1H A;  3SDZ A;  2UUA L;  3E0E A;  5JEA H;  4BBR H;  1I50 B;  2O5J C;  1M90 C;  1KDB A;  4NXM L;  3G6E A;  1UE7 A;  2OEO A;  4XT1 B;  3UI2 A;  2D2C C;  4JYA Q;  3BDL A;  3KOJ A;  3M9B A;  3T51 B;  1QVF A;  2EE1 A;  4OIK A;  2OQ0 A;  1V1P A;  4ZK9 B;  4DV7 Q;  3SGI A;  2AHO B;  2A8V A;  1I4P A;  4A3I B;  1LUZ A;  1HA5 A;  2KCC A;  1EZ8 A;  2HD3 A;  4HTH A;  1CKM A;  1V66 A;  4DAM A;  1MSG A;  2DNE A;  4I7Z C;  3QIA A;  1HR0 L;  4OON A;  2Q8R E;  4GLV B;  3K5O A;  1CTM A;  5E4X A;  4KHZ A;  1SR3 A;  1Y14 B;  5F2D A;  2JA8 H;  4QL5 A;  1G6Z A;  3KYH C;  4IUV A;  3W1G A;  1JJC B;  5C4Z A;  2VUM B;  5EAY A;  3M4O B;  4DA2 A;  1HHV A;  1ENC A;  4DK3 C;  4JBJ A;  1S5C D;  4CHT B;  4NP5 A;  2E2I H;  3TRZ A;  2CQO A;  3D3R A;  5JPN C;  2IX3 A;  1RF2 D;  2DGY A;  2K32 A;  2Q2T A;  3RZO B;  3HOV B;  4DK1 A;  2GN5 A;  1ENA A;  3MZ5 A;  2PYK A;  4KJN A;  1TT2 A;  3B6Y A;  1E0B A;  4U68 A;  1R9T H;  2KW9 A;  4LJZ C;  4X3K A;  3ITP A;  4R4O A;  2VXW A;  2PCF B;  2SOB A;  4HSV A;  2F52 A;  5I4D A;  1LM0 A;  2UU9 L;  5EKK A;  4JBW A;  4R4C A;  2X6G A;  1X32 A;  2B2U C;  5IE8 A;  4K6D A;  3CCE A;  3S1R H;  4CJ2 C;  2MP1 A;  5D3I B;  5C5L A;  4JI2 Q;  3TRE A;  2D0P A;  1I6V C;  2M00 A;  4A3L H;  2KCN A;  1SND A;  3NTK A;  3ULP A;  2QCP X;  4QMG A;  3GTL H;  3DLL A;  2YYZ A;  4NKL A;  4R4I A;  1GJJ A;  1TS3 A;  3A8I E;  3RUZ A;  1WI5 A;  2ZXP A;  3OSO A;  4OWT B;  4LUO A;  5JPM C;  2X6L A;  1Q8I A;  2KEE A;  1J8I A;  2D5D A;  4JI8 L;  1HNX L;  5KEE A;  2ZJR A;  4FF2 A;  3CCM A;  3NEM A;  5IP9 H;  3WWV A;  2PQE A;  1SNO A;  4R4T A;  2KFV A;  1Y8P B;  2IX0 A;  5EBD A;  3MFG A;  3S1M B;  3BS1 A;  3A5U A;  1M4V A;  1NE3 A;  2F0S A;  2F0L A;  2B2Y C;  2B2V C;  3L7Z C;  2ICI A;  3A7L A;  1SRO A;  2ASB A;  3TQY A;  1IYU A;  4HAE A;  2RCN A;  1K83 H;  2F0T A;  5NUC A;  1A3U A;  2Y0S B;  3NTH A;  5IT9 c;  3HOV G;  1R4Q B;  3T16 A;  4F7X A;  4C3J G;  5EQ0 A;  1V8Q A;  5C44 B;  2VW9 A;  2C9O A;  2MO0 A;  2F0Q A;  1YJW A;  4DV6 Q;  4B08 A;  3NSW A;  1CK1 A;  3WOF A;  4JI0 L;  1K28 A;  2L1B A;  4GLA C;  1BO0 A;  2KJX A;  2F0P A;  2ZTE A;  2LC3 A;  3U9O A;  5I2X A;  3HOZ H;  4A3I H;  4N9P A;  4Y7N H;  4GS3 A;  1VQ8 A;  3C1E A;  4JI5 L;  1RTN A;  3VYR A;  2FMC A;  2A68 D;  3PIO 3;  1G91 A;  3NEN A;  4DN4 M;  4JI4 Q;  2E74 C;  1H9R A;  1BXT A;  1E1T A;  3PO3 B;  1NR2 A;  2A69 C;  1SYE A;  4N9T A;  2UU9 Q;  1TR5 A;  4LF8 L;  3HOW H;  3MWY W;  4GKJ Q;  3OTO Q;  1CI3 M;  2IHE A;  1FNW A;  1QNK A;  1I6H B;  3CP0 A;  4J8Q A;  4X65 Q;  1RCV D;  1QIL A;  3X3N A;  3SR1 A;  2C35 B;  2WKC A;  2QEX A;  1SYD A;  3AFQ A;  3T1H Q;  2HHH Q;  3EVQ A;  1FR3 A;  3K7U C;  4M8A A;  1VF7 A;  1DOK A;  4UDU C;  5AFW A;  1CUK A;  2B2Y A;  3MXN A;  2VB3 X;  4ALP A;  1Y1V B;  1EIH A;  2HQE A;  4O0A A;  1SN8 A;  1ONL A;  2Q2I A;  4ME5 A;  2FMM A;  1W3S A;  4UPA A;  1STA A;  4RWS C;  4ZLT F;  4BBS G;  2BA0 A;  5LL6 X;  4DUZ Q;  3KBG A;  3CC4 A;  3KDF A;  4ZKB B;  2F03 A;  3U4V A;  1JJG A;  1CQV A;  1JT8 A;  2JA6 G;  1A15 A;  4JOI C;  1BCP B;  1TWG B;  2VY3 A;  2XWB B;  2C5C A;  1SAP A;  1PVO A;  4EQN A;  3LWU A;  1KRT A;  3TBI B;  1Y1W H;  4K8J A;  5FLM H;  2NVX B;  1EY8 A;  3FKI G;  2KOL A;  5ELN A;  4ZUJ A;  4C3J B;  2RA4 A;  4DV5 L;  2E8G A;  2KEC A;  3T53 B;  5M3F H;  4XTC S;  2A73 B;  2LXK A;  3H94 A;  4KY6 A;  1YNN C;  3EIV A;  1XPO A;  3QOL A;  1HNW L;  1BVS A;  2EYF A;  4LAA A;  1D6E C;  1JE5 A;  2B2W C;  3MXP A;  4G7Z C;  2UUA Q;  3OTO L;  3CQZ B;  3H91 A;  5FO9 B;  5FLX E;  3G71 A;  2K14 A;  4P75 A;  4KLK A;  1JWU D;  3DEP A;  2K5H A;  1VQE A;  2LXJ A;  2F3V A;  2K7V A;  2XTI A;  4C3I H;  3Q23 A;  3CCU A;  1YJN A;  1X9N A;  4H0L C;  2CKZ B;  3M4P A;  2XSC A;  3A56 A;  3BVZ A;  4OWW B;  4C1N I;  4LFB Q;  2WKD A;  3NTI A;  1HXY D;  4JOI A;  1JOQ A;  1RKN A;  1GO3 E;  5H1S E;  1G6P A;  2N49 A;  2JEA I;  2F0V A;  2VUM G;  1KNA A;  2OT2 A;  1Q90 A;  1Y8N B;  4XQN A;  4HMI A;  1QZG A;  1EIF A;  3MEF A;  4HMJ A;  4PV1 C;  4JI7 L;  5LMN Q;  5EPK A;  2DN8 A;  1E2V A;  1DXM A;  3ERS X;  5FK9 C;  3GTP H;  4DAV A;  4K5V A;  1CZG A;  5JVH 3;  1U9R A;  1AE3 A;  3J80 i;  2B29 A;  3IFT A;  3S1N B;  2XGT A;  2F0I A;  3S16 H;  1WCM G;  1EY7 A;  4IPC A;  4GOP B;  1LTG D;  4IO9 A;  2WAQ B;  4DPG A;  2NN6 I;  1VQ4 A;  4BA1 I;  4GNX C;  4JI3 Q;  4J15 A;  4JBK A;  1BCP C;  2I0Q A;  1EQQ A;  4MN3 A;  2N8N A;  3DM1 A;  1GD7 A;  4LFA Q;  1SE2 A;  5GAD C;  4A3B G;  4JG2 A;  1NNX A;  4DNR B;  4ZCK A;  1BBU A;  1TWA B;  3W5O A;  4IAL A;  4WJ3 M;  2RDG A;  2VB2 X;  2BH8 A;  4IUQ A;  4QIW E;  2R7Z G;  3CCQ A;  2G80 A;  2BH2 A;  3NWS A;  3DWP A;  4TQU S;  1QJO A;  1B4O A;  1QUQ B;  5KGU A;  1XMO L;  2LSS A;  4CDF C;  1K9M C;  2NBF A;  2A6H C;  2CH4 W;  2EVB A;  2CQA A;  4OWX B;  1XXG A;  3I4N H;  3GD7 A;  1GKH A;  1U4L A;  3KLS X;  4KHV A;  1H9S B;  4IJL A;  1MJE A;  1P16 A;  4HID A;  4DR3 Q;  4F8M A;  3GO5 A;  5CYU A;  3GV6 A;  1ENF A;  3LNN A;  3PQI A;  3NUC A;  3RZO H;  3HG9 A;  5C44 H;  4KKS A;  2O2L D;  1FYC A;  4DAP A;  3K59 A;  1D2B A;  1ICW A;  3F2D A;  2G9H D;  4QCL A;  3A74 A;  5C4X G;  1VF5 C;  1X55 A;  4A3L G;  2EY2 A;  3S24 A;  1EYC A;  3PO2 B;  1JIC A;  5FJ8 H;  1SYF A;  1SNQ A;  2B8F A;  2EY5 A;  1GUN A;  4QF4 A;  1RIP A;  1J9O A;  3I3C A;  2YU9 B;  5BN5 A;  1F9R A;  4A3J H;  5EPL A;  4BBS B;  1TWH B;  4YCV A;  2WIN B;  4DR6 Q;  1FGB D;  4LF7 Q;  2K1B A;  2XRS D;  3GDE A;  2NVT B;  4KHP L;  1NY4 A;  2K01 A;  2E2J B;  1U5K A;  4DR5 Q;  4LW1 A;  5ELF A;  1U4P A;  1CSQ A;  3ULJ A;  5D14 A;  3IFD A;  1UAP A;  1VQJ A;  2JA5 B;  1F2M A;  4KKU A;  4B3S L;  2KHS A;  2VL6 A;  4WJW A;  3K6O A;  4AYB E;  4JV5 L;  3PO2 H;  2HJQ A;  5JEA G;  1SDF A;  5HY6 A;  5C0X G;  3GTJ H;  2NVQ H;  2XN9 C;  4BXX G;  1Q82 C;  4JYA L;  3LGJ A;  3RNU A;  2HDM A;  1JE4 A;  3S17 H;  1T9H A;  4DAY B;  1HH2 P;  4AYB B;  2HCC A;  1IKL A;  3AQQ A;  3N6R A;  1MKH A;  5ISR A;  4A3M H;  1L1O A;  2QEJ C;  4LF6 Q;  1EQR A;  2ZJQ A;  2QDB A;  2WQG A;  1W6J A;  1UE5 A;  3T1Y L;  2DJG C;  1Q81 C;  4LFC Q;  1ICF B;  3VR3 A;  4EGV A;  3HOW G;  3I90 A;  4OEL B;  3HKZ B;  4R8I A;  4FF4 A;  2K5D A;  2XVS A;  3BG3 A;  2MJ8 A;  3CD6 A;  3CRK C;  3TZD A;  1R4P B;  3K7A H;  4DR1 L;  1KD1 C;  5IGB A;  4NW2 A;  4A4I A;  1WCM B;  5C3E G;  5IT9 E;  3BZD B;  5BN3 A;  1JC7 A;  4KN7 C;  1I4Q A;  5KND A;  2Q8I B;  3D0F A;  3KK7 A;  1RL2 A;  4ULL A;  1KXL A;  4EQ5 A;  1JMC A;  1XNQ Q;  1EWC A;  4DV7 L;  2QDL A;  1U0L A;  1JQY D;  3FPU B;  3QG1 A;  4IZ8 A;  4IPH A;  3HOY B;  2E75 C;  2RSN A;  3HGB A;  3NPP A;  5CIU A;  1Q1B A;  4HCE A;  1V43 A;  5IGC A;  4NXN L;  5CBE E;  4CBV A;  1X3G A;  4RGO S;  5EKL A;  5K5P A;  1XYI A;  4JI6 Q;  1VMC A;  2YTY A;  2B8G A;  4KN4 C;  3K5N A;  3H0G B;  4XYO A;  3J7Y W;  1VDZ A;  3KF8 B;  4UP9 A;  2ZM6 Q;  4WFN 3;  1N32 Q;  1PYW D;  2VQF Q;  2UUC Q;  2MUY A;  4NMZ A;  2CW0 C;  2E2H H;  4LUV A;  3FKI H;  3HFZ B;  2F0W A;  3FPP A;  4ABN A;  2BOS A;  3STB C;  4QIW B;  4QUC A;  2JQO A;  1I3Q H;  4RGM A;  2H4O A;  5DNF A;  3TP7 A;  1C4Q A;  1E2W A;  1ET9 A;  1SE4 A;  2JSO A;  4J1M A;  2NN6 H;  2P5Z X;  3JAM E;  3OOC A;  4LNQ A;  3AYH B;  1CHQ D;  5M5W H;  3QB3 A;  1GL9 B;  1EY0 A;  3SK6 A;  4C3I G;  1SYC A;  3QO2 A;  2K6A A;  3F2U A;  1TWC B;  1S4Z A;  1CSP A;  4K2K A;  4DV0 L;  1O7L A;  4LF5 L;  1LTI D;  3CRL C;  1X3P A;  4DR7 Q;  1NSN S;  1Q8K A;  1LTB D;  1LT6 D;  3DMU A;  3D4W A;  3DWQ A;  5LMN W;  4PMC A;  5FKA C;  4DNT B;  3MXU A;  4L6T B;  1AZQ A;  4H02 A;  3S17 B;  1HRJ A;  1SNC A;  4BY7 H;  3K0Y A;  4G7H C;  1N34 Q;  1VQ6 A;  3HOZ G;  5FLX L;  3OW2 A;  1JEI A;  1PYS B;  2F0O A;  2E2D C;  4APV A;  3BU2 A;  5C5M A;  5C3E B;  3H3V H;  3D31 A;  2N55 A;  1SEB D;  4A93 B;  2KCT A;  4DGZ A;  1SNP A;  3J7A V;  4L8J A;  4DV4 Q;  4TSS A;  1J6Q A;  3NHH A;  1AN8 A;  3X3M A;  2NVY B;  3QJY A;  3I2Z A;  1I5F A;  2K5N A;  1KLG D;  4R9W A;  4X65 L;  1BCP F;  4BBR B;  1B3A A;  1F9S A;  1CFM A;  3VR5 A;  2A19 A;  1IL8 A;  1Q1E A;  1H9J A;  3S14 B;  1VQH A;  4A3D G;  3TP6 A;  5K36 G;  5I6Y A;  2QW7 A;  1NJI C;  2RBM A;  3C2P A;  3EBE A;  1S5B D;  1PH7 A;  2M9V A;  2R92 H;  4A3K G;  1H1J S;  3J80 L;  5CV5 A;  4IUU A;  3MAQ A;  2K52 A;  3PF5 A;  4AH6 A;  1LTA D;  1WTH A;  3GTL B;  1KAB A;  1STH A;  1ZYR C;  2B63 B;  2HIV A;  2SNS A;  4X64 L;  1B50 A;  4GZY C;  3A55 A;  1N36 Q;  2NVY H;  1CQF A;  1EZ6 A;  4DK6 C;  1EYA A;  1BR9 A;  3H3V C;  4X62 L;  2UUB L;  3GTJ B;  1HR0 W;  4YIJ A;  1FNU A;  1GJX A;  5C44 G;  2EXD A;  2Z6K C;  4ZRZ A;  2L15 A;  2HQL A;  4HJ7 A;  3F8T A;  3HRZ C;  4L5T A;  4KTA A;  3I7F A;  1TWG H;  4IFD G;  2JYO A;  5C0X J;  4YWK A;  1EQV A;  1YEZ A;  1QG7 A;  5M5X B;  4OO1 I;  2R6G A;  4KI0 A;  1XMO Q;  1V1P B;  3I8Z A;  5FJ8 G;  5JJI A;  3A8K E;  4XDX A;  4XYQ A;  1BOS A;  3CMA A;  2D0O A;  2ZTC A;  2IW3 A;  4DV2 L;  1VS0 A;  5BR8 Q;  1TY2 A;  3R2T A;  2B3G A;  2B63 H;  2JA5 H;  4U67 3;  2MHV A;  2HHH L;  3VYT A;  2V4D A;  2TSS A;  4A3G H;  1EY5 A;  2CCZ A;  5IIF A;  3V05 A;  2EXZ A;  4GLX A;  3I73 A;  1Z6H A;  4NB3 A;  2TMP A;  1JOO A;  1TII D;  2B2U A;  3K81 C;  1EWI A;  4FNF A;  4BY1 G;  5CC4 A;  5CV6 A;  1UE6 A;  4BBS H;  3HOY H;  3PMF A;  1NAP A;  1BUV T;  5JJL A;  5IY0 A;  4RFB A;  4WOR A;  2CWP A;  1TS5 A;  3VDY A;  3RLO A;  4C3H G;  2CH4 A;  1OXX K;  2LY7 A;  2F0D A;  1HFN A;  3HOU B;  1K0R A;  1JJ2 A;  4IJH A;  4M1U B;  5C0X H;  3GTK H;  2B2T A;  1IBK L;  1UWV A;  2L5T A;  3GP7 A;  2LMC B;  3J80 E;  4BXX H;  2OCE A;  3KUP A;  2R7Z B;  2J0T D;  4OXP A;  1SBB B;  1X3Q A;  2EJG C;  5IYC G;  4PZ8 A;  4A3D B;  4YCW A;  4L5R C;  5C0X I;  4RCN A;  2L4N A;  3BZK A;  3VA5 A;  4YCU A;  1PH6 A;  1NR4 A;  5KIX A;  1D5X C;  2FJ2 A;  4RGN A;  3GTM H;  2XIW A;  2ICE C;  1ASY A;  2NVQ B;  2UXC L;  5G3L F;  3J81 j;  2KEN A;  4A3F B;  1YIT A;  2R93 H;  4OL7 A;  4RG1 A;  4RMF A;  2CVR A;  4A3E G;  2Z4H A;  1ASZ A;  1SE8 A;  4HR7 B;  4JPB W;  3CCJ A;  1S5E D;  2MO1 A;  1IBL L;  1AEX A;  1JEQ A;  4IPG A;  5M5W B;  2N88 A;  3JC6 6;  3R8B A;  4YHH L;  2DY7 A;  2K4K A;  3BZC A;  1LTT D;  1SMX A;  1PHJ A;  2KVM A;  2R7Z H;  1H9F A;  3HOV H;  1D7Q A;  4HIM A;  1QOH A;  4C3J H;  4JVZ A;  4C3H B;  1XTC D;  1PTO F;  3I55 A;  1H9M A;  4HSP A;  4QY7 A;  4I7A A;  1YI2 A;  2IJ0 A;  4A3F G;  2OWO A;  4PMB A;  3HKS A;  3I4N G;  1SYG A;  5M5Y H;  5EKI A;  1ESR A;  1M8A A;  4JI0 Q;  3VR6 A;  1OXT A;  1PLF A;  4MHE A;  4DR1 Q;  3ERO A;  4P73 A;  1FJG L;  1IBK Q;  1Y69 U;  4DR4 L;  1OXS C;  2AQ3 B;  4EQO A;  4B3R L;  1XX8 A;  2MPM A;  2FHT A;  1M1K C;  1JJR A;  4IPD A;  4FXG C;  5C6A A;  4RCO A;  4Q5V A;  3LX0 A;  4UP7 A;  1IKM A;  3NQT A;  3HKZ E;  1K3R A;  4PNY A;  3VYU A;  4EX5 A;  4A93 H;  4LWC A;  4HN7 A;  3STB D;  3Q24 A;  3GTO B;  1IBM L;  1QE6 A;  1TQO A;  1UUP A;  1LT5 D;  5IGF A;  2OQK A;  3NEL A;  1JWS D;  1LLR D;  2WAC A;  2H1E A;  4AQY L;  2EPB A;  3GTG H;  4IFD J;  1WFQ A;  4L63 B;  3NQI A;  4LF9 Q;  3VR4 A;  4JK1 C;  2PW7 A;  3SEB A;  1XNR L;  4A3B H;  2D9U A;  5LHY 1;  4JI6 L;  2JA8 B;  1KQS A;  2KVE A;  2KQ3 A;  3S1R B;  3NXW A;  3NBH A;  4MNO A;  1VQ5 A;  4FVM A;  5IGG A;  1GM5 A;  3S2D B;  4YHH Q;  3QKJ A;  2XRQ D;  2DNC A;  3J7Z C;  3J81 c;  1DGS A;  3TP5 A;  5IGD A;  3OW7 A;  4KKT A;  5FO7 B;  1N33 L;  3WDN A;  4C2M H;  5DLQ E;  3S15 B;  2Z9H A;  2JEB I;  3MA2 B;  2E5L L;  4L5S A;  4P71 A;  3D4R A;  5M3M B;  4JI1 Q;  1XMQ Q;  4BY7 G;  4ZKC B;  3CCL A;  5J1Z A;  3QOJ A;  1BBX C;  3C46 A;  3DUZ A;  1SLJ A;  3JAM L;  2EYJ A;  1L1O B;  2PZW A;  3KF6 A;  3M7G A;  5IYD G;  1KL9 A;  2WB1 B;  3R93 A;  4A3M G;  1TXY A;  4X3T A;  3NBI A;  1WTV A;  4DK0 A;  1K83 B;  5M3F G;  1BBW A;  5M9O A;  3T1Y Q;  2HT1 A;  1JOK A;  2K04 A;  5ELO A;  5LMU Q;  1FD7 D;  1A3V A;  3SE0 A;  1F77 A;  1ET6 A;  3EQL C;  3J81 i;  2JA7 G;  3FEW X;  2DY8 A;  3KJP A;  1WTQ A;  3PF4 A;  3PUY A;  2AWN A;  5EBC A;  4BIT A;  1MIU A;  4KD4 A;  1DCZ A;  4N8F A;  4GOP A;  1E7Z A;  1Q12 A;  2EYL A;  5K36 H;  1KTK A;  3FP9 A;  3I4L A;  3IL8 A;  2IT1 A;  2A1A A;  2UXD L;  2G5D A;  3W2D A;  5KNB A;  5CV7 A;  3PIP 3;  1CKN B;  1HR0 Q;  2JA7 B;  2K03 A;  3OWF A;  2L0C A;  1HPC A;  4LF9 L;  1C9O A;  5D65 A;  3NWT A;  2PQA A;  2O4X A;  4QJF A;  2PI2 E;  3BVM A;  4KV6 A;  1E1O A;  3S2H H;  1VQ7 A;  3GTQ H;  1A6X A;  4XIG S;  1YIJ A;  2AQ2 B;  5IOD A;  2WB1 G;  1ZBH A;  2HCI A;  2NZO A;  1LO5 D;  4OX9 L;  3JAM i;  4HJ8 A;  4XT3 B;  2RF4 A;  3ZYY X;  1EQT A;  3PGZ A;  5DEH A;  1TS4 A;  1T5X D;  4LF4 Q;  1N33 Q;  1R9T B;  4V0B A;  2RKS A;  4IN3 A;  4K6L A;  3NK9 A;  2JA9 A;  2E2H B;  2EYO A;  5EGT A;  1ROD A;  2SNM A;  4G57 A;  1Y8O B;  1F2L A;  2WP8 J;  4F88 A;  4ID6 A;  1MI2 A;  2AKW B;  3WOE A;  4DV6 L;  1GUS A;  2CFM A;  1TS2 A;  3F1Z A;  4JI7 Q;  2X69 A;  4PMW A;  2NN6 G;  1LTR D;  3K5M A;  1EEI D;  1JB3 A;  1DOL A;  4UHV A;  4DR3 L;  1U4R A;  5IP7 H;  4HJ9 A;  4B3T Q;  1WTP A;  2Z0S A;  1PRT F;  5LMU L;  4GOP C;  2NUC A;  4RA8 A;  4IFD I;  1GHJ A;  4K0K L;  1ZYR D;  1PRT B;  5I9P A;  3VA7 A;  3HOX H;  2VQE L;  3KF8 A;  4FXK C;  3HOY G;  4A3G B;  2PMZ B;  2F4V L;  1K73 C;  2JXM B;  1TWF H;  1Y1V H;  5JVG 3;  1YNJ D;  1PH2 A;  1J5E Q;  5COY A;  1O7I A;  1O7Y A;  2NTT A;  2L11 A;  4XQQ A;  5IYB G;  2YU9 H;  4IOA A;  1GUG A;  3GTP B;  3NE5 B;  4DAY A;  3I4O A;  4A3C G;  2UXB L;  1GUW A;  4RHS A;  5C4X H;  3CC7 A;  3K8A A;  3CU7 A;  3H0G G;  3OWE B;  3UE1 A;  2N78 A;  2A69 D;  2VZA A;  3S16 B;  1VMP A;  5GAE C;  4CJ0 B;  1HNZ Q;  4HJA A;  3CCR A;  1B70 B;  5ELB A;  2EQS A;  2KCM A;  3UDG A;  3RN2 A;  3BDC A;  1K8G A;  1DM0 B;  1KDA A;  1PV4 A;  1WTW A;  3W3A A;  3HEJ A;  3EA6 A;  1WJJ A;  3EJI A;  1HCZ A;  4P74 A;  2RNO A;  3E9H A;  5BN4 A;  1KHC A;  2R92 G;  2L12 A;  1L0W A;  4C56 C;  5DAU A;  1I6H H;  1VQD A;  4ODG A;  1HZC A;  1RHP A;  3EFX D;  4E6I A;  1NBW A;  1YHA A;  3SXH A;  1PYB A;  1JOR A;  2F4V Q;  4N8X 1;  4DUY Q;  5A2Q L;  3HZX A;  3J7A 5;  3HP3 A;  4DR5 L;  4MTN A;  2KHJ A;  2PPB C;  1KAW A;  1QUQ A;  3MC0 B;  1PRT C;  2AQ1 B;  1E2Z A;  3I4M B;  3SK5 A;  1YNN D;  4NDX A;  3G48 A;  1I94 L;  4WJ4 A;  3BYY B;  4RHR A;  1PH9 A;  4OHJ A;  3FLG A;  1STY A;  5CV8 A;  1N9W A;  1CHP D;  3UDI A;  1YNX A;  1HUN A;  5J39 A;  4A3J B;  5I9O A;  1EYD A;  2R3Z A;  3K5L A;  1V9P A;  1IZ6 A;  1TVX A;  1B9M A;  3TZU A;  2JA5 G;  3DWA A;  2NWG A;  5CBA E;  1AH9 A;  2ZTD A;  3OYY A;  4OGQ C;  1HQM C;  1IL2 A;  4YWM A;  5CV9 A;  1S5F D;  1K0S A;  3U50 C;  4QQB X;  5AJ3 L;  4G4K A;  1W2B A;  3DXJ C;  4XXE A;  4LF6 L;  1RJT A;  2Z6B A;  5JJZ A;  1D1K A;  3K57 A;  1Q46 A;  4CDE C;  2RHS B;  4BS9 A;  2JA6 B;  4CDC C;  2V1C C;  1D8L A;  3AFP A;  4A3K B;  4FF1 A;  3K80 C;  2KED A;  4A75 A;  1E22 A;  1PFM A;  2MFI A;  2Y0S E;  1VQM A;  1IXR A;  1B53 A;  4DV1 Q;  3GTQ B;  1AZP A;  2PI2 A;  2H5X A;  2F0K A;  4DU9 A;  3M4O H;  1Z7T A;  2PW5 A;  5DM6 3;  3PSI A;  1A63 A;  4RKL A;  4JI4 L;  4K5W A;  3QR8 A;  2PNR C;  5HUR A;  3CCV A;  4IFD H;  1AFP A;  1WYD A;  5IYD H;  2QIL A;  4IUR A;  1PH1 A;  4JI3 L;  1I94 Q;  2AMC B;  5A2Q E;  1X65 A;  1PTO B;  1KAA A;  2B63 G;  4DFA A;  4JI8 Q;  3V2T A;  1UE1 A;  4CKB A;  2FFK B;  1DOM A;  1EWH A;  4A3E H;  4LF8 Q;  4GKJ L;  1HJP A;  2OXP A;  3FHW A;  2JA7 H;  2BE5 C;  5M3M G;  3U58 A;  4A3G G;  4RH6 A;  4X6A H;  2KUM A;  1UEB A;  1SJH D;  1C48 A;  1U4M A;  2Z4I A;  1ZEQ X;  1WD0 A;  1L1O C;  3MVV A;  1SE3 A;  3S2H B;  4HED A;  3OMC A;  2KHI A;  1PZI D;  4IQZ A;  3V96 A;  3L2P A;  2ALY B;  3T4A C;  1EY6 A;  2A6H D;  2BDO A;  4BY1 H;  1CT1 D;  1KNE A;  2R7D A;  3Q6S A;  3UDX A;  1B2T A;  3ICE A;  1JR0 D;  1SSO A;  2AUJ D;  2NVT H;  1PTO D;  4Y7N B;  1GUO A;  4C3H H;  4UP8 A;  1YZ6 A;  2A6E C;  3G7L A;  4A76 A;  3TS0 A;  4B9W A;  2YV5 A;  1A3T A;  1RTO A;  4B3M Q;  2O5I C;  1O80 A;  1BKB A;  3PUW A;  3T1H L;  3CCS A;  1H95 A;  5E3F A;  2IPK D;  5CR3 A;  1L0X B;  1Z9F A;  3AMU A;  3TN2 A;  2I5M X;  2IHF A;  3BYT B;  3C1F A;  2YTX A;  1A0I A;  4KHP Q;  1STG A;  4H13 C;  5T1G A;  4X66 Q;  1K8M A;  1UEA B;  1AW7 A;  1B1Z A;  2Z6K A;  4BA2 I;  3FMC A;  3GQB A;  3URY A;  4H44 C;  3CXC A;  2DK4 A;  1I3Q B;  4B3S Q;  4DV1 L;  3TME A;  1EU4 A;  3TDQ A;  4BY1 B;  1X54 A;  2NB0 A;  5M5X H;  3I72 A;  3A5Z B;  4YY3 L;  2IY5 B;  1EUJ A;  3HOU H;  1HNW Q;  3P75 A;  1I4H A;  1WTO A;  3ND8 A;  3H3V I;  3M3Y H;  1TWF B;  4KK7 A;  1TWC H;  1G2S A;  3T13 A;  5IT9 L;  5C4J H;  4A3K H;  3CC2 A;  1TY0 A;  4ZUI A;  2EOT A;  1ILQ A;  1L2F A;  2NTS A;  4XQJ A;  5J3B A;  3GTM B;  1DZ1 A;  1ZS9 A;  3FDT A;  1B9N A;  1VQF A;  5IWA Q;  3U4Z A;  4A3F H;  2JJQ A;  3IAY A;  4GKK Q;  1I4G A;  2PZU A;  1LV9 A;  2QGQ A;  1Y1V G;  3TS2 A;  2DUD A;  4Q0F A;  4FDB A;  4X62 Q;  3HKZ G;  1VQO A;  1OXV A;  1EL0 A;  2MGS A;  1PH5 A;  4B3R Q;  2ZM6 L;  1QVG A;  2F0G A;  3S9W A;  1RD9 D;  1KRS A;  1IYV A;  3H0G H;  5KYI A;  4HIK A;  1FVI A;  1AE2 A;  3PO3 H;  1C8C A;  5J22 A;  1VQB A;  1HUM A;  3KJO A;  5GRO A;  2FIN B;  2Q8T A;  4DR2 L;  2I07 B;  5D3D A;  1BF4 A;  4NXN Q;  3E5S A;  2G9D A;  1RDP D;  3ERQ A;  3CF5 A;  1DJR D;  2K5W A;  3KDF B;  1XTD A;  3CPW A;  1CA5 A;  4K14 A;  3S14 H;  2ES2 A;  3IRB A;  3O13 A;  1BCP D;  2E2I B;  1HTL D;  1LAC A;  4X3U A;  2XNA C;  2HUG A;  2KBN A;  3RLN A;  1KHI A;  3FVQ A;  4V19 0;  1XPR A;  4R4Q A;  1LTL A;  1P8L A;  3A54 A;  5M3F B;  2LS0 1;  4GN5 A;  3PUZ A;  4PQX A;  1O78 A;  1HZ9 A;  5C3W A;  4OO1 H;  2N3S A;  2UXD Q;  5I2Y A;  3S1Q B;  1MHW C;  2Y0S G;  3M4Y A;  1VQP A;  5I6W A;  1VQC A;  3F2C A;  1SYB A;  1CKO A;  3H6M A;  1VQA A;  4JI5 Q;  3P20 A;  5LMN L;  4QB4 A;  2J7Z A;  5HGQ A;  2PNH A;  1T5E A;  1EY4 A;  5IYC H;  1EIY B;  1MD2 D;  5ELC A;  1GVP A;  1STN A;  3A7A B;  3U9S A;  4Y52 H;  1LT3 D;  2F3I A;  5IWA L;  3J7A F;  2OTJ A;  2JN4 A;  4GKK L;  4NPS A;  2GA4 B;  2F0N A;  5CGK A;  1E7L A;  2M2L A;  2QF7 A;  5JOB A;  5C3X A;  1LYL A;  4RAU C;  3ONA B;  5T1I A;  3RN5 A;  4LF4 L;  2R93 G;  3S15 H;  1JCK B;  1VQN A;  1MSH A;  2JA8 G;  1V1Q A;  2BCO A;  5C4H A;  2A5H A;  5C4J B;  3I4M H;  1CKN A;  2Z1C A;  1SMY D;  1KLU D;  2F0M A;  1KDC A;  1G29 1;  1PFS A;  4YWL A;  1K8O A;  5JEA J;  1XWE A;  4POF A;  4QUF A;  5IP7 G;  2K5Q A;  2VQF L;  3K0X A;  2R92 B;  2HIX A;  4DR2 Q;  3DM3 A;  2QKI C;  3S1N H;  3RZD H;  2ENB A;  1HZB A;  1NMG A;  1B44 D;  2EIF A;  2RNN A;  1GUT A;  1HTP A;  1GOZ A;  2PQA B;  1IBM Q;  1N36 L;  2ATW A;  3HOX B;  2NYZ D;  3P7J A;  3TEH B;  2VQE Q;  4RGT A;  5FOB B;  3GTG B;  2JA6 H;  5E1F A;  1ML0 D;  4JCV E;  2F0E A;  1J5E L;  4TKO B;  3KF6 B;  2MQH A;  1E7D A;  3PCO B;  1Y1W G;  2WFW A;  1FNV A;  3A8J E;  3EN2 A;  4A3C H;  3SK4 A;  1ZXT A;  1LTS D;  1NCV A;  1YVC A;  2SEB D;  3MFY A;  3S2D H;  3OHX C;  4A93 G;  2Q2U A;  4DR7 L;  1X3E A;  1QB5 D;  4LFB L;  2B2T C;  3A0J A;  2F1M A;  3LWE A;  2I5H A;  2L9H A;  4BWG B;  1UNS A;  1F9Q A;  4K5X A;  3T56 B;  4DV3 Q;  2KA7 A;  2ODC I;  5CV4 A;  1Q3L A;  2K28 A;  2RSO A;  2K5V A;  3PIP A;  3MXG A;  1ZKO A;  1HNZ L;  4WRD A;  4O1N A;  4AIM A;  2BE5 D;  2KVD A;  3GTK B;  1SFO H;  4MIU A;  3ULL A;  1STB A;  3M3Y B;  1Y1W B;  3TP8 A;  2EYP A;  5KNC A;  2GVB A;  1PZK D;  2PO4 A;  1PTO H;  5E4W C;  1B3Q A;  2F0F A;  1TWA H;  4MZ9 A;  1SJE D;  1D5Z C;  4X64 Q;  2GVA A;  1KIX A;  5FO8 B;  3UDF A;  3HOX G;  3NP8 A;  2HDL A;  2WAQ G;  1NTG A;  1XNQ L;  4RKB A;  4C1N K;  4HJ5 A;  2VUM H;  3KFU A;  3Q8D A;  1IW7 D;  1IHZ A;  1EEF D;  2A6E D;  2YTV A;  5BR8 L;  2EY1 A;  1HZA A;  5IYB H;  1YHB A;  1HA6 A;  2DJF C;  1F2Y A;  4LMQ D;  5TSS A;  4A3I G;  4GN3 B;  4GNX B;  3DEO A;  3L3O C;  1SFO B;  4DUY L;  1WTR A;  1PFB A;  4UY8 C;  4EVO A;  1WD1 A;  2CHB D;  1JWM D;  1Z47 A;  4OIJ A;  1YJ9 A;  2EJF C;  1BQQ T;  4X3S A;  4LFC L;  1LT4 D;  2WII B;  2F3W A;  1S40 A;  4CDD C;  2RHQ B;  1Q7Y C;  3F2B A;  1TU2 B;  1WCM H;  5ELE A;  1VQK A;  2R93 B;  2EZV A;  4LK1 C;  1EFW A;  3D4D A;  4OEM B;  4DNI A;  1PH3 A;  4DV2 Q;  5KRU A;  5IP9 G;  3K7A B;  4PG3 A;  5M5Y B;  3MHB A;  1F2Z A;  2ZXR A;  1II3 A;  3GV3 A;  1B8A A;  2ODG C;  3RZD B;  3M4Q A;  1O7Z A;  3H15 A;  4IUP A;  1G2T A;  1D1I A;  2F0U A;  2RQX A;  1EOT A;  1BDO A;  3TSS A;  3SK8 A;  1EYG A;  2I46 A;  3PV0 A;  2XWJ B;  5GAH C;  2A74 C;  4PZ7 A;  1X6O A;  4JBM A;  2E2J H;  3LLR A;  2RDH A;  4UZW A;  1H9S A;  5GQO A;  4DV4 L;  2ID0 A;  1B7Y B;  1OO9 B;  4FF3 A;  1FL0 A;  4DV0 Q;  4DUZ L;  3RR5 A;  1MGS A;  4BBR G;  1EY9 A;  1G51 A;  2B2W A;  2IL8 A;  4PZ6 A;  3CQZ H;  3D8G A;  3Q0A A;  2NZH A;  2PMZ E;  3BDO A;  4TVA B;  3PIO A;  3FKI B;  1OTC A;  4B9X A;  4L5Q A;  4ZQ3 A;  2LKV A;  3S1Q H;  3M7N A;  1F9P A;  2RCF A;  1GHK A;  2EYM A;  2CW0 D;  1EU3 A;  4A3M B;  4P2C B;  2J4X A;  2MNA A;  4ILW A;  3QWN A;  1PDQ A;  3D6C A;  4CGY B;  4UAI A;  3PO3 G;  2W51 A;  1N8R C;  2ZJP A;  3HOZ B;  1S5D D;  2NZ1 D;  2E76 C;  2K50 A;  2I5L X;  1Q86 C;  4H7B A;  2FXQ A;  1PFN A;  4DKA C;  5HGT A;  2MPH A;  1NUC A;  1W6K A;  4DR6 L;  1N34 L;  3ND9 A;  4IUT A;  1PH4 A;  5M3M H;  3J81 E;  3KLR A;  1GKU B;  1QVC A;  4DF7 A;  2EYH A;  3W1B A;  2OTL A;  4CJ1 B;  4IOC A;  5IGE A;  2QNC A;  2VNU D;  4O2D A;  1SNM A;  3L9A X;  1YHQ A;  3M85 A;  3D6W A;  4FO2 A;  3R3O A;  1DYQ A;  4CKC A;  3E9I A;  1HNX Q;  3KLW A;  3I70 A;  2F0J A;  3AEV A;  5FLX c;  1ESF A;  4BY7 B;  3BJU A;  4DR4 Q;  1E24 A;  1IBL Q;  1QNU A;  1VCI A;  1QCB D;  4DV5 Q;  4Z9C B;  5FLM G;  4X66 L;  3MXN B;  1WTX A;  2K05 A;  1PMR A;  1QWY A;  3CPF A;  4DXF A;  1VQG A;  1SXT A;  4K2L A;  2ZT9 C;  3L0O A;  1I4R A;  1D5M C;  1EIG A;  1S3O A;  1V1O A;  4R1J A;  1STE A;  1MBY A;  3I4N B;  1L0Y B;  2BA1 A;  3CHB D;  2VS1 A;  2LFN A;  4C3I B;  2WAQ E;  2UUB Q;  2EJM A;  1EFI D;  4LFA L;  5EPJ A;  1VQ9 A;  1SRU A;  1SMY C;  1X3F A;  3ZJY C;  1A2U A;  3E3X A;  1PXU A;  1C0A A;  4JI2 L;  2K33 A;  3KBX A;  4KMU C;  2B2V A;  2BDN A;  3VYS A;  1N32 L;  3GTO H;  1TKW B;  2UUC L;  2EDG A;  4K8I A;  2RVL A;  5JAV A;  3RLF A;  1PA6 A;  1JB7 A;  4POG A;  3JAM c;  1CZW A;  2IWH A;  1VQI A;  2EY6 A;  3J81 L;  2JP1 A;  3C3L A;  4DV3 L;  4A3B B;  3CME A;  4A3E B;  4FP5 D;  5KYL A;  3G6J B;  1DON A;  3HOW B;  1TWH H;  3NBH B;  1XMQ L;  1NMF A;  1XPU A;  2D62 A;  3E0J A;  3OPO A;  2A68 C;  2SDF A;  3I91 A;  4HCS A;  2UXC Q;  1E3P A;  4JC0 A;  3H09 A;  1WVL A;  3AU7 A;  2R7F A;  5E7N A;  4ME3 A;  4TRD A;  1H9E A;  1A2T A;  1PRT D;  4KY5 A;  2B39 A;  1LAB A;  4YY3 Q;  3BVG A;  3HOU G;  1OXU A;  3UE0 A;  4I65 A;  3KLS A;  4IUN A;  1YNS A;  4FXD A;  2K75 A;  3OIP A;  1DD2 A;  4JI1 L;  4MTK A;  4JW0 A;  4QGU A;  1K8A C;  4EQP A;  4F87 A;  3E6Z X;  5LL6 S;  4ZAI A;  3G4S A;  3FRP B;  4LUZ A;  1PZJ D;  2JK8 A;  1XJV A;  1FGU A;  5AJ3 Q;  3R2I A;  5IOC A; 
#chains in the Genus database with same CATH homology
 3H0G H;  4HIK A;  3S24 A;  4A3L G;  1FVI A;  3J7Z C;  1AE2 A;  1S72 A;  3PO3 H;  3J81 c;  1DGS A;  2CWA A;  1QZH A;  1VQB A;  5FJ8 H;  3KJO A;  5GRO A;  1MJC A;  4NXM Q;  4GNX A;  4HIO A;  4C2M H;  5DLQ E;  4DR2 L;  2NVX H;  1N33 L;  4OO1 G;  2JEB I;  4NXN Q;  3CW2 C;  1RIP A;  2E5L L;  4L5S A;  1EOV A;  4P71 A;  4LF7 L;  3CF5 A;  4OX9 Q;  1WOC A;  4A3J H;  3KDF B;  1XTD A;  4JI1 Q;  3CPW A;  1XMQ Q;  3S14 H;  4BY7 G;  3CCL A;  4AYB G;  3IRB A;  2ES2 A;  3I56 A;  1FJG Q;  4YCV A;  4DR6 Q;  1Y02 A;  4LF7 Q;  1SLJ A;  2KBN A;  3GDE A;  4LF5 Q;  1L1O B;  4KHP L;  1NY4 A;  3KF6 A;  3RLN A;  1KHI A;  5IYD G;  1KL9 A;  4A3M G;  1U5K A;  4DR5 Q;  1TXY A;  4LW1 A;  2UXB Q;  1A62 A;  1XPR A;  1CSQ A;  3ULJ A;  4R4Q A;  1LTL A;  1P8L A;  5M3F G;  1VQJ A;  4K0K Q;  1BBW A;  3T1Y Q;  2HT1 A;  1X56 A;  4GN5 A;  3PUZ A;  4B3S L;  1KC8 C;  2VL6 A;  4P72 A;  1I50 H;  5ELO A;  1HZ9 A;  5LMU Q;  4AYB E;  4JV5 L;  3PO2 H;  1PH8 A;  2N3S A;  2UXD Q;  4AQY Q;  2E5L Q;  2Y0S G;  1EN7 A;  2HJQ A;  5JEA G;  3J81 i;  1VQP A;  1VQC A;  2JA7 G;  4A3J G;  5HY6 A;  5C0X G;  3KJP A;  3F2C A;  3PF4 A;  1CKO A;  1XNR Q;  3GTJ H;  1IYJ B;  1VQA A;  2AWN A;  3PUY A;  4GN4 B;  4JI5 Q;  2NVQ H;  4BXX G;  5LMN L;  1Q82 C;  2LD7 A;  1MIU A;  2Q2H A;  3LGJ A;  3RNU A;  3I4M G;  4JYA L;  5HGQ A;  3S17 H;  1T9H A;  2QNF A;  2PNH A;  4DAY B;  1HH2 P;  5C3E H;  1E7Z A;  1Q12 A;  4GOP A;  5IYC H;  3AQQ A;  1EIY B;  4B3M L;  4A3D H;  1MKH A;  4A3M H;  3FP9 A;  1VQL A;  1GVP A;  4Y52 H;  3ER0 A;  3PUX A;  1L1O A;  2F3I A;  5IWA L;  3J80 c;  4B3T L;  4LF6 Q;  2IX1 A;  4GKK L;  3PUV A;  4JV5 Q;  2OTJ A;  4NPS A;  3S1M H;  2IT1 A;  1EQR A;  2A1A A;  2AWO A;  2UXD L;  2ZJQ A;  5GAG C;  5JJK A;  3CAM A;  1C7Y A;  1E7L A;  2WB1 E;  2QA4 A;  1CKN B;  1HR0 Q;  3T1Y L;  1UE5 A;  1Q81 C;  4LFC Q;  1A8V A;  2JE6 I;  4LF9 L;  1YBY A;  1C9O A;  3PO2 G;  3HOW G;  1LYL A;  4LF4 L;  3RN5 A;  2R93 G;  2PQA A;  3S15 H;  2UUA L;  3E0E A;  1VQN A;  4QJF A;  2PI2 E;  2JA8 G;  4BBR H;  1E1O A;  1V1Q A;  1M90 C;  4NXM L;  3G6E A;  1UE7 A;  1VQ7 A;  3GTQ H;  3S2H H;  3CD6 A;  4XIG S;  4DR1 L;  3K7A H;  3I4M H;  1KD1 C;  1CKN A;  1YIJ A;  4A4I A;  4JYA Q;  2WB1 G;  3KOJ A;  3M9B A;  5C3E G;  2NZO A;  4YWL A;  1G29 1;  1PFS A;  4OX9 L;  1QVF A;  3JAM i;  4DV7 Q;  2OQ0 A;  4HJ8 A;  5JEA J;  4POF A;  2RF4 A;  5IP7 G;  3SGI A;  3D0F A;  2AHO B;  1RL2 A;  2VQF L;  3PGZ A;  2A8V A;  3K0X A;  2HIX A;  4LF4 Q;  1LUZ A;  4DR2 Q;  1N33 Q;  4DAM A;  4EQ5 A;  1JMC A;  1KXL A;  1CKM A;  3DM3 A;  1XNQ Q;  4DV7 L;  3S1N H;  3RZD H;  1U0L A;  1HR0 L;  1HZB A;  4OON A;  1NMG A;  2JA9 A;  4GLV B;  4IPH A;  2EIF A;  1Q1B A;  4KHZ A;  2WP8 J;  1SR3 A;  1V43 A;  1Y14 B;  4NXN L;  2AKW B;  2JA8 H;  2PQA B;  4QL5 A;  4DV6 L;  1IBM Q;  3KYH C;  2CFM A;  1N36 L;  2ATW A;  1X3G A;  3TEH B;  3F1Z A;  4JI7 Q;  2VQE Q;  4PMW A;  2NN6 G;  3W1G A;  1JJC B;  4JI6 Q;  2JA6 H;  2YTY A;  5EAY A;  4DR3 L;  3KF8 B;  4UP9 A;  4JCV E;  4DK3 C;  4JBJ A;  5IP7 H;  2ZM6 Q;  1J5E L;  2VQF Q;  4HJ9 A;  4B3T Q;  1N32 Q;  2UUC Q;  3KF6 B;  2E2I H;  2MQH A;  2CQO A;  3TRZ A;  1E7D A;  3PCO B;  1Y1W G;  2WFW A;  3EN2 A;  2Z0S A;  2E2H H;  4A3C H;  5LMU L;  4LUV A;  2DGY A;  4GOP C;  1YVC A;  3FKI H;  4IFD I;  3S2D H;  4A93 G;  2Q2T A;  3HFZ B;  4K0K L;  2Q2U A;  4DR7 L;  1X3E A;  2GN5 A;  4LFB L;  3STB C;  3A0J A;  3HOX H;  2VQE L;  3B6Y A;  2I5H A;  3HOY G;  2JQO A;  1R9T H;  1I3Q H;  2F4V L;  4DV3 Q;  1K73 C;  1TWF H;  2ODC I;  1Y1V H;  4R4O A;  2F52 A;  2K5V A;  3PIP A;  1PH2 A;  1J5E Q;  1LM0 A;  2UU9 L;  1HNZ L;  4JBW A;  1O7I A;  4AIM A;  4R4C A;  5IYB G;  1SFO H;  2YU9 H;  4IOA A;  3ULL A;  4LNQ A;  3AYH B;  5M5W H;  5IE8 A;  3CCE A;  3S1R H;  3I4O A;  1GL9 B;  2GVB A;  4A3C G;  2UXB L;  4MZ9 A;  4JI2 Q;  1TWA H;  3TRE A;  2D0P A;  5C4X H;  1CSP A;  3K8A A;  3CC7 A;  3H0G G;  4A3L H;  3UE1 A;  4X64 Q;  4DV0 L;  4LF5 L;  2GVA A;  3ULP A;  1KIX A;  2N78 A;  2VZA A;  4DR7 Q;  1Q8K A;  5GAE C;  3UDF A;  3HOX G;  3GTL H;  3DLL A;  5LMN W;  1HNZ Q;  2YYZ A;  2WAQ G;  4HJA A;  4R4I A;  3CCR A;  1NTG A;  1B70 B;  1XNQ L;  1GJJ A;  2EQS A;  2KCM A;  3UDG A;  4HJ5 A;  1WI5 A;  2VUM H;  3Q8D A;  4H02 A;  4OWT B;  4LUO A;  3KFU A;  3RN2 A;  1K8G A;  2YTV A;  5BR8 L;  4JI8 L;  1HNX L;  1PV4 A;  2ZJR A;  1HZA A;  4BY7 H;  3CCM A;  3NEM A;  5IP9 H;  5IYB H;  1WJJ A;  3WWV A;  1YHB A;  4R4T A;  1N34 Q;  1VQ6 A;  2KFV A;  2IX0 A;  3HOZ G;  4A3I G;  3A5U A;  3OW2 A;  4GN3 B;  4P74 A;  4GNX B;  1JEI A;  1PYS B;  4APV A;  3E9H A;  1NE3 A;  3BU2 A;  4DUY L;  3L7Z C;  4UY8 C;  1SRO A;  2ASB A;  3H3V H;  3TQY A;  3D31 A;  2R92 G;  2RCN A;  1K83 H;  1L0W A;  3HOV G;  1Z47 A;  5IT9 c;  1YJ9 A;  2KCT A;  4LFC L;  4DV4 Q;  1J6Q A;  1VQD A;  1I6H H;  1S40 A;  1HZC A;  2VW9 A;  2RHQ B;  1Q7Y C;  3I2Z A;  1WCM H;  2MO0 A;  3F2B A;  1YJW A;  1I5F A;  2K5N A;  1VQK A;  1NBW A;  4DV6 Q;  1YHA A;  4X65 L;  1EFW A;  1PYB A;  4DNI A;  4DV2 Q;  1PH3 A;  2F4V Q;  5IP9 G;  4DUY Q;  4JI0 L;  4GLA C;  2ZTE A;  2LC3 A;  4PG3 A;  3HOZ H;  4A3I H;  2A19 A;  4Y7N H;  1Q1E A;  4GS3 A;  1VQ8 A;  1B8A A;  3J7A 5;  4JI5 L;  2ODG C;  1VQH A;  4A3D G;  5K36 G;  3M4Q A;  3H15 A;  1NJI C;  4DR5 L;  4MTN A;  2KHJ A;  3NEN A;  3EBE A;  1EYG A;  1PH7 A;  4JI4 Q;  1KAW A;  1QUQ A;  3PV0 A;  4A3K G;  2R92 H;  5GAH C;  4PZ7 A;  1E1T A;  1X6O A;  4JBM A;  2E2J H;  1I94 L;  2K52 A;  3G48 A;  5GQO A;  4DV4 L;  2ID0 A;  4AH6 A;  3PF5 A;  4WJ4 A;  1B7Y B;  1PH9 A;  2UU9 Q;  4LF8 L;  1FL0 A;  3HOW H;  4GKJ Q;  2HIV A;  3OTO Q;  1N9W A;  4X64 L;  4DV0 Q;  2IHE A;  4DUZ L;  3RR5 A;  3UDI A;  4BBR G;  1N36 Q;  1YNX A;  2NVY H;  1G51 A;  3CP0 A;  4X65 Q;  1V9P A;  4PZ6 A;  4DK6 C;  1IZ6 A;  3CQZ H;  2C35 B;  2JA5 G;  2QEX A;  2NZH A;  4X62 L;  2PMZ E;  2UUB L;  4TVA B;  3AFQ A;  3PIO A;  2ZTD A;  3OYY A;  3T1H Q;  1HR0 W;  1OTC A;  2HHH Q;  1AH9 A;  1IL2 A;  4L5Q A;  3K7U C;  5C44 G;  4YWM A;  2EXD A;  1CUK A;  2Z6K C;  3U50 C;  3S1Q H;  4QQB X;  5AJ3 L;  1W2B A;  4LF6 L;  3M7N A;  2L15 A;  2HQL A;  4HJ7 A;  3F8T A;  4L5T A;  3I7F A;  1TWG H;  1Q46 A;  4ALP A;  4IFD G;  2RHS B;  4O0A A;  1SN8 A;  5C0X J;  4YWK A;  1YEZ A;  2MNA A;  2Q2I A;  2V1C C;  4OO1 I;  1W3S A;  1D8L A;  3AFP A;  2W51 A;  2R6G A;  4UPA A;  4KI0 A;  1N8R C;  3PO3 G;  1XMO Q;  5JJI A;  5FJ8 G;  4BBS G;  2ZJP A;  3K80 C;  2BA0 A;  3CMA A;  4DUZ Q;  2D0O A;  2ZTC A;  2K50 A;  2I5L X;  4A75 A;  1Q86 C;  4DV2 L;  1VS0 A;  1E22 A;  2FXQ A;  3KDF A;  5BR8 Q;  3CC4 A;  4B3M Q;  2B3G A;  2B63 H;  2MFI A;  2Y0S E;  3U4V A;  4DKA C;  1JJG A;  1VQM A;  2JA5 H;  1IXR A;  4DR4 Q;  1JT8 A;  4DV1 Q;  2MPH A;  4DR6 L;  2JA6 G;  2PI2 A;  1N34 L;  1PH4 A;  5M3M H;  2HHH L;  2H5X A;  3M4O H;  4JOI C;  4A3G H;  2VY3 A;  3PSI A;  1A63 A;  2CCZ A;  1GKU B;  1PVO A;  4JI4 L;  1QVC A;  1Y1W H;  1KRT A;  5FLM H;  3CCV A;  3W1B A;  4GLX A;  2OTL A;  4IOC A;  1WYD A;  3FKI G;  2QNC A;  4NB3 A;  4O2D A;  2VNU D;  5IYD H;  5ELN A;  4DV5 L;  2E8G A;  3K81 C;  1EWI A;  4XTC S;  4BY1 G;  5M3F H;  1YHQ A;  2LXK A;  1XPO A;  1PH1 A;  3EIV A;  1UE6 A;  4BBS H;  4JI3 L;  3HOY H;  3M85 A;  5JJL A;  1HNW L;  1KRS A;  1BVS A;  1I94 Q;  2AMC B;  5IY0 A;  1X65 A;  2CWP A;  3VDY A;  1JE5 A;  3RLO A;  3E9I A;  1OXX K;  1HNX Q;  2B63 G;  4JI8 Q;  3KLW A;  2UUA Q;  1UE1 A;  3AEV A;  3OTO L;  5FLX c;  4A3E H;  4LF8 Q;  4GKJ L;  1HJP A;  3FHW A;  1K0R A;  3BJU A;  3G71 A;  1JJ2 A;  4IJH A;  2K14 A;  5M3M G;  1E24 A;  4P75 A;  2JA7 H;  4KLK A;  1IBK L;  1UWV A;  3U58 A;  3GTK H;  4A3G G;  4BXX H;  2K5H A;  2OCE A;  1IBL Q;  4X6A H;  1VCI A;  1VQE A;  1UEB A;  2LXJ A;  4DV5 Q;  4OXP A;  4C3I H;  2XTI A;  3CCU A;  1L1O C;  5FLM G;  1YJN A;  1X9N A;  4X66 L;  3MXN B;  4PZ8 A;  5IYC G;  4YCW A;  2CKZ B;  3M4P A;  4L5R C;  2KHI A;  5C0X I;  3CPF A;  3BZK A;  4OWW B;  4YCU A;  1PH6 A;  1VQG A;  3L2P A;  4LFB Q;  2ALY B;  3GTM H;  4JOI A;  4BY1 H;  1ASY A;  2R7D A;  3L0O A;  2UXC L;  1GO3 E;  3UDX A;  5H1S E;  3J81 j;  3ICE A;  1G6P A;  2N49 A;  2NVT H;  2JEA I;  2KEN A;  2VUM G;  4C3H H;  1S3O A;  4UP8 A;  1YIT A;  2R93 H;  1YZ6 A;  4R1J A;  4RG1 A;  4RMF A;  4A3E G;  1ASZ A;  1QZG A;  2BA1 A;  2VS1 A;  1SE8 A;  4A76 A;  3TS0 A;  2YV5 A;  1EIF A;  2WAQ E;  3MEF A;  3CCJ A;  2UUB Q;  2MO1 A;  1BKB A;  3PUW A;  3T1H L;  1VQ9 A;  1IBL L;  1SRU A;  4LFA L;  3CCS A;  4JI7 L;  5LMN Q;  1H95 A;  1X3F A;  3ZJY C;  4IPG A;  3ERS X;  1Z9F A;  1C0A A;  3JC6 6;  4YHH L;  3GTP H;  2I5M X;  2IHF A;  2K4K A;  4JI2 L;  2YTX A;  3BZC A;  1A0I A;  4KHP Q;  1SMX A;  4X66 Q;  1PHJ A;  2R7Z H;  1H9F A;  1AE3 A;  3HOV H;  3J80 i;  3GTO H;  4HIM A;  1N32 L;  1D7Q A;  2B29 A;  2UUC L;  2Z6K A;  4BA2 I;  4C3J H;  3RLF A;  3I55 A;  3CXC A;  1PA6 A;  1JB7 A;  2DK4 A;  4POG A;  4B3S Q;  4DV1 L;  2XGT A;  4QY7 A;  3JAM c;  3S16 H;  1WCM G;  4IPC A;  4GOP B;  1YI2 A;  1X54 A;  1VQI A;  5M5X H;  4IO9 A;  4A3F G;  3A5Z B;  2NN6 I;  4DPG A;  4DV3 L;  4YY3 L;  1VQ4 A;  2IY5 B;  3CME A;  4BA1 I;  2OWO A;  4GNX C;  1EUJ A;  3HOU H;  3HKS A;  4JI3 Q;  4J15 A;  4JBK A;  3I4N G;  1HNW Q;  2I0Q A;  1EQQ A;  5M5Y H;  2N8N A;  4LFA Q;  1GD7 A;  3H3V I;  3M3Y H;  5GAD C;  4JI0 Q;  1OXT A;  1TWH H;  3NBH B;  4DR1 Q;  1XMQ L;  4P73 A;  4A3B G;  1NMF A;  4JG2 A;  1FJG L;  1XPU A;  2D62 A;  1BBU A;  1TWC H;  1IBK Q;  4DR4 L;  3W5O A;  4WJ3 M;  1OXS C;  3CC2 A;  2BH8 A;  4QIW E;  5C4J H;  4A3K H;  2R7Z G;  3CCQ A;  4B3R L;  1M1K C;  2G80 A;  4IPD A;  2BH2 A;  4TQU S;  2UXC Q;  1L2F A;  5J3B A;  4UP7 A;  1E3P A;  1QUQ B;  3HKZ E;  4JC0 A;  1K3R A;  1XMO L;  4A93 H;  4EX5 A;  1ZS9 A;  2R7F A;  5E7N A;  2LSS A;  1VQF A;  4LWC A;  4ME3 A;  1H9E A;  3STB D;  1K9M C;  1IBM L;  5IWA Q;  3U4Z A;  4A3F H;  2JJQ A;  2OQK A;  4GKK Q;  3NEL A;  4YY3 Q;  4OWX B;  2QGQ A;  3HOU G;  1Y1V G;  1OXU A;  3GD7 A;  3UE0 A;  3I4N H;  1GKH A;  4AQY L;  3TS2 A;  3GTG H;  4IFD J;  4IJL A;  1MJE A;  1P16 A;  4HID A;  1WFQ A;  4DR3 Q;  2DUD A;  1YNS A;  3GO5 A;  4LF9 Q;  2K75 A;  3RZO H;  4FDB A;  4JI1 L;  5C44 H;  1XNR L;  4A3B H;  4JI6 L;  4X62 Q;  3HKZ G;  1VQO A;  4QGU A;  1KQS A;  1OXV A;  1K8A C;  4MNO A;  1VQ5 A;  1PH5 A;  4B3R Q;  3G4S A;  2ZM6 L;  3F2D A;  1QVG A;  4LUZ A;  1GM5 A;  2JK8 A;  1XJV A;  1FGU A;  5AJ3 Q;  3A74 A;  5C4X G;  4YHH Q;  1X55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...