1A8VA

Structure of the rna-binding domain of the rho transcription terminator
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
120
structure length
115
Chain Sequence
b'GHMNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSAAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION TERMINATION FACTOR RHO
publication title The structural basis for terminator recognition by the Rho transcription termination factor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription termination
total genus 29
structure length 115
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07498 Rho_N Rho termination factor, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.10 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 1a8vA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1a8vA02
4JV5L 4A3KG 3FHWA 3ULJA 4YY3L 2QA4A 1K73C 3K8AA 4GNXB 4DR2L 4JI7L 3EBEA 3K80C 3CW2C 4X62Q 3ICEA 3S1QH 4BY7G 1UE5A 4QGUA 3T1HL 1I6HH 1XNRQ 4KHPQ 4DR5Q 1WCMH 5M3FG 3I7FA 3A0JA 2JA8H 4GNXA 1PH2A 4DUYQ 3J81j 4JI4L 1Q86C 1V1QA 3CPWA 1B7YB 1I3QH 2V1CC 2UXDL 4JG2A 4JCVE 4HJ5A 4LF6L 1IXRA 3HOVG 4GOPC 3M9BA 1L2FA 2A8VA 4NXML 4AYBG 1E7ZA 1NTGA 2CWPA 3UDIA 4JI0L 4OX9L 2UUBL 3TRZA 4DV0Q 1U0LA 2QNFA 4A3EG 5IYBH 1PHJA 1OTCA 3HOZG 4K0KL 4IFDJ 4LUVA 4PZ8A 2VNUD 2WFWA 1NBWA 1UEBA 3KLWA 4FDBA 3NEMA 3CMEA 4UP9A 4DV5Q 1YBYA 1YJ9A 2ATWA 4A3EH 3TS2A 1YEZA 1JT8A 2GN5A 3VDYA 3M7NA 5C0XJ 1E1OA 3RLNA 4BBRG 2XTIA 3CC2A 3A5UA 1SE8A 1PH8A 4IPCA 2VQEL 1KL9A 1HZBA 1X3EA 1Z9FA 2IX1A 1XMOL 2IY5B 3PGZA 3CXCA 2UXCL 1XTDA 3GO5A 1IBLL 5IWAL 1E7DA 1QUQB 1IL2A 2HJQA 3I4OA 3S15H 4AQYL 3UDGA 3JAMi 1ASZA 2BH8A 2EQSA 1EN7A 4H02A 4DV4L 2UU9L 1QUQA 1YITA 2JA6G 4GS3A 4A75A 5FJ8H 1TXYA 1MKHA 3STBC 2ZJQA 2Z0SA 1LYLA 1GD7A 1SLJA 1PH9A 3Q8DA 1UE1A 1PA6A 4A93G 4DKAC 3MEFA 4DAMA 1YNXA 2K4KA 3KF6B 2N8NA 1SROA 4QL5A 4LF4Q 4A3FH 4BBSG 4DR7Q 1YVCA 1VCIA 1A8VA 1KRTA 3F2DA 1I94Q 4OO1I 2VY3A 4JI2Q 1HR0L 3KF6A 2R6GA 2B63G 4A93H 3KYHC 4B3ML 2R7DA 4DK6C 4DV6L 4RG1A 4BBSH 2OTJA 4P75A 2WB1G 2K50A 3U50C 5IYCG 1YJWA 1X55A 5IYDH 4LF9Q 4A76A 4DV3L 3GTKH 4GKKQ 2NZOA 2XGTA 3OYYA 4OONA 4P71A 4DV2Q 1EYGA 2NVQH 2A1AA 2FXQA 4IOAA 4LWCA 1KRSA 1L0WA 1G6PA 3TQYA 3J81i 4HJ8A 2E2JH 3U4ZA 4JBJA 4YY3Q 1AE2A 4TQUS 3CAMA 4A3BG 4BA2I 1BBUA 1YHBA 4YCWA 4DR2Q 4JI7Q 4LFAL 4PZ6A 3HOWH 1WI5A 1SRUA 3T1HQ 1O7IA 1EWIA 2YTVA 1OXUA 2VS1A 2ZTCA 5ELOA 3TEHB 3UE1A 4OWTB 4J15A 4C3JH 2R92H 1X9NA 3HOUH 3I4NG 3I4MH 3S17H 4GKJL 2K5NA 1D7QA 5HGQA 4JI4Q 2YYZA 1E3PA 1TWAH 4OO1G 3OTOL 5LMNW 2PMZE 4YCUA 3J7ZC 3U58A 1NJIC 4LF6Q 2UXDQ 5AJ3L 3AEVA 4GN5A 2OWOA 4NXMQ 2E5LQ 5C4XH 3CC4A 3KFUA 4BY1H 1C9OA 2UUBQ 4OX9Q 3PF5A 2R93H 5IP7H 2ID0A 2N3SA 2JA7G 5IE8A 5HY6A 2F4VL 3GTJH 1D8LA 1EQRA 1NY4A 3E9HA 1QZGA 4QJFA 3S1MH 1OXTA 4R4QA 1FJGL 5GROA 2Q2UA 1VQ6A 3W5OA 1X65A 2I5HA 1SMXA 2VQFL 2JE6I 1EIYB 4DR4L 3PUWA 1VQDA 5FLXc 2BH2A 3CF5A 1X6OA 1V43A 3PUVA 5BR8Q 3PO3G 2RF4A 2RHSB 3PUXA 3HOXH 3PUZA 1XMOQ 2K14A 4IFDI 3G4SA 3HKZE 1N34L 3JC66 2WB1E 1K8AC 2HHHQ 1WCMG 2UXCQ 5IWAQ 3KOJA 3CCVA 4IPHA 2JA8G 3PO3H 3PO2H 1JMCA 4IJHA 2OQ0A 2Y0SG 5LMNL 2NVXH 4JC0A 4YHHL 4DV4Q 2UU9Q 5C0XI 2AHOB 2CFMA 3CCRA 4PG3A 1IBKL 1NMFA 2DUDA 3CQZH 3NBHB 5JJKA 3S2HH 2UUCL 1Q8KA 4C3HH 2AKWB 2DGYA 2Q2HA 1JE5A 5IYBG 3I55A 3RN2A 3GTMH 3AQQA 4KI0A 4LUZA 3OW2A 2NZHA 4HIKA 1X3FA 2PNHA 3LGJA 2VW9A 3KJOA 4X66Q 3EIVA 2D62A 4B3MQ 4IFDG 4UP8A 1GO3E 1K0RA 4DV6Q 3ULPA 2KBNA 2RHQB 4AH6A 4HJ7A 4DV3Q 1P16A 4BA1I 1TWHH 2CCZA 4DR6L 2N78A 1KHIA 2B29A 1C7YA 1HR0W 1VQHA 4WJ3M 1JJCB 4PMWA 4X6AH 4HIMA 1VQOA 3CC7A 3IRBA 5C0XG 4HJAA 4LF5L 4DR3L 2JEAI 2IHFA 2WP8J 2R7ZG 2VL6A 1HNZL 4POFA 4JI8L 3CMAA 1LM0A 4R1JA 1Y1WH 4LFAQ 2ZM6L 2K5VA 2GVAA 4JI3L 3BZCA 4X65L 2E8GA 1VQ8A 1V9PA 2ZTDA 5FJ8G 5M3MH 4GKJQ 1Q82C 5C3EH 4R4TA 4A3IG 2R7ZH 5JEAJ 2L15A 4JBWA 4JOIA 4NXNL 1UWVA 3CP0A 1PYBA 1WJJA 4BXXH 1TWCH 2UXBL 3PUYA 4RMFA 3OTOQ 3CCJA 1MJEA 4QQBX 1ASYA 4A3FG 3M4OH 5AJ3Q 5K36G 4L5SA 2Y0SE 3D31A 1VQIA 3MXNB 4DV1L 4A3IH 2K52A 4LF8L 1E7LA 4OWWB 1NE3A 1H95A 3T1YL 2JA5G 1N8RC 4R4CA 2ZJPA 5IY0A 1XNQL 1XPUA 3HFZB 1OXXK 4YCVA 4DR1L 2F4VQ 4DV7L 5IYDG 4KLKA 5GQOA 1W2BA 1T9HA 2VUMH 5J3BA 3S1RH 5GAGC 1YI2A 3F1ZA 2JA5H 1K3RA 2VZAA 3D0FA 2N49A 3W1BA 4X62L 1U5KA 3M4QA 1EUJA 2ZTEA 2VQFQ 4GNXC 1XMQL 2KCTA 1G51A 2B3GA 2IHEA 4P72A 2HIVA 4AYBE 3AFQA 1PV4A 4B3RL 2Z6KA 4DUYL 3PIOA 3HOWG 1VQ9A 1N34Q 3I2ZA 1XJVA 1VQCA 3A74A 5GAEC 1VQPA 4JV5Q 3H0GH 2R92G 2GVBA 4ME3A 1S72A 3I4MG 4A3CH 5EAYA 3HOUG 3S24A 2JA9A 3H15A 3RZDH 3CCQA 5LMNQ 1E1TA 3K0XA 3JAMc 1K8GA 3KJPA 3RN5A 4A3MH 4GKKL 1SFOH 4LF7L 1Q46A 2I5LX 4DUZL 1IBKQ 3UDXA 1IBML 3ERSX 2MO0A 4UY8C 3K7UC 4JI5L 2UUCQ 2RCNA 3TREA 3F2BA 3I56A 2ASBA 5C4XG 4YWLA 2JQOA 4BY1G 4P73A 2KENA 2R93G 4JI6L 5IP7G 5C44H 4APVA 1EQQA 3HOYH 1CUKA 3GD7A 3W1GA 2D0PA 1KAWA 3CCEA 2PQAB 4JI0Q 1VQNA 1K9MC 2LXJA 1QZHA 4K0KQ 3GTPH 3G71A 1LTLA 4JOIC 2R7FA 3CCSA 3K7AH 1WYDA 2PQAA 1J6QA 2KHIA 4GN4B 1UE6A 4O0AA 5IP9H 2UUAL 3FKIH 3NELA 1L1OB 1N36L 3HOXG 4HJ9A 4DR6Q 4A3LG 1TWGH 4NB3A 1L1OA 4LF5Q 4DR3Q 2YU9H 3J81c 2VQEQ 4QY7A 1HNXL 4C2MH 1A63A 1VQBA 1PH3A 1VQAA 3RLOA 4JI8Q 1HNZQ 3UDFA 2ES2A 2IT1A 4A3JG 1SR3A 2ZM6Q 3CCMA 4A3LH 4JI3Q 4X65Q 1IBLQ 3DLLA 1J5EL 2BA0A 1A0IA 4XTCS 2KHJA 4AQYQ 1S3OA 1BKBA 1XPRA 4NXNQ 4HIOA 1I94L 4GLAC 1PVOA 4A3JH 2F3IA 3ER0A 4JI2L 3S14H 5LMUL 3NENA 2YTYA 3RNUA 4IPGA 2K75A 2Z6KC 4LNQA 2MO1A 1LUZA 3H3VI 1HNWL 1S40A 3J7A5 4DV1Q 2A19A 1CKMA 1OXSC 1M1KC 4LF8Q 2LSSA 3BJUA 4EQ5A 1VQ7A 2E2IH 1N32L 1IYJB 3T1YQ 2MQHA 3J80c 1WFQA 4B3TL 1XNQQ 4YWKA 1VQ5A 4DR1Q 4DV7Q 4WJ4A 1VQLA 1N33L 3TS0A 3S1NH 2HT1A 1FL0A 5M5YH 2F52A 1HR0Q 3RZOH 1PYSB 3DM3A 1HZCA 5ELNA 4LUOA 1XMQQ 2NVTH 2LXKA 1EIFA 4LFCL 3GTQH 3FP9A 2EXDA 1N9WA 2PI2E 4MNOA 1G291 4A3KH 2YV5A 3GTLH 1AH9A 2EIFA 2IX0A 1KD1C 1FGUA 1YJNA 4DAYB 4B3RQ 3ULLA 1Y1WG 4L5RC 4BY7H 1PH4A 1Z47A 1JJ2A 1GVPA 2Q2IA 3CPFA 4A4IA 1KIXA 1A62A 1E24A 1Y14B 5M3MG 4JBMA 5M3FH 5C3EG 5H1SE 2WAQG 4A3GG 2KCMA 4ALPA 4EX5A 1Q1EA 4LFBL 4GN3B 3F2CA 4YWMA 3F8TA 3M4PA 2E5LL 4BXXG 2NVYH 1BVSA 1R9TH 1PFSA 2HQLA 1EFWA 4LW1A 4DUZQ 4GLVB 1IBMQ 4B3SL 4LF7Q 3HOVH 3H3VH 4A3GH 1VQFA 2BA1A 4QIWE 4JI5Q 5JEAG 1HZ9A 1L1OC 5GADC 4MTNA 4JI6Q 2OQKA 1YIJA 1KQSA 3S2DH 4JI1L 2PI2A 2K5HA 3HOZH 1XPOA 1E22A 4MZ9A 4JYAL 3RLFA 1W3SA 4Y52H 2JK8A 5BR8L 2VUMG 1RL2A 1CSQA 3KF8B 3GDEA 3RR5A 4X64L 1X56A 1B8AA 3U4VA 2HHHL 1PH7A 3KDFB 4BBRH 2UUAQ 4PZ7A 3L7ZC 2QEXA 1FJGQ 2YTXA 1N36Q 3AYHB 1C0AA 3E9IA 3J80i 4DR4Q 3GTOH 3H0GG 2H5XA 3KDFA 1JB7A 1XNRL 5IT9c 4DR5L 4A3CG 4Y7NH 4KHPL 5JJIA 1YHQA 5M5WH 2QNCA 2D0OA 2QGQA 1YZ6A 4DNIA 1HNXQ 3CD6A 3GTGH 4A3MG 1K83H 1J5EQ 2JA6H 3L0OA 1WOCA 5C4JH 5JJLA 2OCEA 1FVIA 1DGSA 1NMGA 1OXVA 4X66L 1P8LA 4YHHQ 4IPDA 5LMUQ 4DV0L 1HJPA 5C44G 2HIXA 1Y1VG 2WAQE 3STBD 3EN2A 2AWNA 3HKZG 4DK3C 2MNAA 3M85A 3HOYG 4OXPA 4TVAB 1HNWQ 2ALYB 4KHZA 3S16H 3G6EA 4UP7A 1B70B 4IO9A 3L2PA 2MFIA 3M3YH 4DV5L 1N32Q 1JJGA 4B3TQ 2B63H 1Y1VH 4GOPB 4R4IA 3UE0A 5GAHC 3BZKA 4JBKA 1IZ6A 4R4OA 5IP9G 1Q12A 5IYCH 2Q2TA 1N33Q 3FKIG 1VS0A 1KC8C 4POGA 1MIUA 2C35B 1M90C 1HH2P 1PH5A 4GOPA 4DPGA 1RIPA 4LFCQ 1PH1A 3E0EA 1MJCA 4IJLA 1CKOA 1GM5A 1QVFA 1QVGA 2NN6I 4C3IH 5FLMG 3HKSA 1UE7A 3PO2G 2CKZB 3PCOB 3CCLA 3A5ZB 4IOCA 2E2HH 1VQ4A 1SN8A 2OTLA 4P74A 1CKNB 4A3BH 3AFPA 5FLMH 3I4NH 1I50H 1TWFH 4LFBQ 1Q7YC 3PIPA 4UPAA 4AIMA 4XIGS 3K81C 1AE3A 1CKNA 1QVCA 1Q1BA 4NPSA 4LF4L 3CCUA 4B3SQ 3PF4A 4DR7L 1KXLA 4GLXA 4L5QA 4O2DA 3PSIA 1PH6A 1VQJA 2AWOA 3PV0A 3BU2A 1VQGA 4HIDA 5M5XH 2ZJRA 1GKHA 4A3DG 2UXBQ 1YHAA 2JEBI 5E7NA 1VQMA 1X54A 4L5TA 2AMCB 3WWVA 1VQKA 4JI1Q 2JA7H 1HZAA 1BBWA 1CSPA 3SGIA 3B6YA 1X3GA 4JYAQ 1EOVA 4LF9L 2CQOA 2NN6G 2JJQA 4A3DH 2CWAA 3ZJYC 4DV2L 1VQEA 1I5FA 1Q81C 2I5MX 3G48A 4OWXB 2I0QA 4X64Q 5DLQE
chains in the Genus database with same CATH superfamily
3FHWA 3RMHA 3TMEA 3ULJA 5A2QE 2C9OA 1EYDA 1J9OA 1DOLA 3EBEA 3CW2C 2KVUA 1BUVT 2QF7A 1UE5A 4C3JB 5TSSA 4KHPQ 5M3FG 2TSSA 3J81j 2QDBA 1B7YB 5FLXE 1I3QH 5DM63 1EU4A 1QG7A 2F0MA 4JG2A 4NP5A 1JEIA 4IUVA 2EJGC 4EGVA 2R93B 1CQFA 4PMBA 2UUBL 2QNFA 1ZXTA 5IYBH 3S1MB 1YNSA 2EYOA 2WFWA 1FYCA 2J7ZA 1HFNA 4I65A 4UP9A 1TWGB 5LHY1 1DONA 4IFDH 3M7NA 2RA4A 4NDXA 3RLNA 5C0XJ 1BCPC 3A5UA 4RAUC 4FNFA 3MA2B 4FP5D 3PGZA 3VR5A 1PTOF 4XXEA 3D6WA 3GO5A 2UXCL 4N8FA 1Y8PB 2BH8A 4CGYB 3A8KE 3H91A 3DWQA 4DV4L 1YITA 5CBEE 2BDNA 1MSHA 2JYOA 1MKHA 3MWYW 2ZJQA 3DEOA 3Q8DA 1YNXA 3KF6B 2HQEA 2LKVA 1SAPA 2MP1A 3S1NB 2LY7A 1GHKA 3F2DA 1KRTA 1I94Q 3RZOB 1IYVA 4JI2Q 2NVTB 2B63G 1ILPA 3QKJA 3K0YA 4A3KB 1B9MA 3EFXD 4RG1A 4BS9A 2K50A 1X55A 2GA4B 5IYDH 1GOZA 4A76A 1F9QA 1H9MA 4DV2Q 3OYYA 4OONA 4P71A 5G3LF 1QOHA 2F1MA 2FXQA 3MXPA 4LWCA 4CDDC 1MBYA 3ZYYX 3J81i 3VYSA 2E2JH 4YY3Q 4TQUS 1YHBA 3QJYA 1SRUA 2V4DA 1YNJD 2VS1A 2WAQB 2YTVA 2N55A 3I4MH 1SYFA 1X9NA 3HOUH 3I4NG 1F2LA 4JI4Q 2E76C 3A54A 1TWAH 4OO1G 5IGDA 1NJIC 1TR5A 4ME5A 2SOBA 4NXMQ 3BDLA 4BY1H 1C9OA 3FPUB 3MC0B 3PF5A 3X3MA 2ID0A 1DZ1A 5D3IB 5HY6A 3K5MA 3E9HA 1QZGA 4QMGA 3JAME 3CRKC 3T4AC 2NTSA 4DR4L 3PUWA 5FLXc 3CF5A 2A5HA 2QEJC 2X6LA 3TZDA 1YNND 3PUXA 5CV9A 3PUZA 4H44C 5NUCA 3HOXH 1XMOQ 3G4SA 2RDFA 1K83B 4IFDI 3JC66 3KLRA 2SDFA 1WCMG 1WTVA 2B2TA 5IWAQ 4IPHA 2WINB 2PZTA 3BVGA 3AU7A 4IJHA 2MJ8A 2OQ0A 3MVVA 3OWFA 3NXWA 5L37A 3PQIA 2K5QA 2UU9Q 2CQAA 2AHOB 1KTKA 2CFMA 1EY9A 1IBKL 1M8AA 2DUDA 3KLSA 2UUCL 4C3HH 1MHWC 5KIXA 1SYDA 5C44B 1Y1VB 1K28A 5C3WA 2EOTA 1LT4D 2NZHA 4HIKA 2PNHA 4RGMA 1W6JA 3TSSA 3EIVA 1KDBA 2D62A 1GO3E 3TP8A 4DV6Q 4C3IB 2EJMA 3H3VC 3I3CA 4DV3Q 1TWHH 2B29A 1C7YA 2F0OA 4A3BB 1NSNS 1GUOA 2WP8J 1HNZL 4N8X1 3I70A 2GVAA 4ULLA 3BZCA 4ZKBB 5FJ8G 5M3MH 5C3EH 3X3NA 1D5MC 2L15A 4JOIA 3IL8A 5I2YA 2UXBL 3OTOQ 3CCJA 1MJEA 1U4PA 2RDGA 3M4OH 5K36G 1G2SA 4IUNA 3MXNB 2SNSA 2K52A 4A3DB 5JEAH 2JA5G 1RTOA 3IFTA 2ICEC 1N8RC 4ID6A 4R4CA 1XPUA 1GUSA 2SEBD 4WRDA 2F4VQ 4DV7L 4KLKA 2VUMH 2K7VA 3S1QB 5J39A 2JA5H 1F2ZA 2N49A 2VQFQ 1A3VA 1B2TA 3BYYB 4FF4A 1SSOA 4JVZA 2Y0SB 1YNJC 4B3RL 2OXPA 3PIOA 2F0VA 1VQCA 1VQPA 2D9UA 3SR1A 1LLRD 2GVBA 4IUQA 1A3TA 3URYA 4C3JG 5EAYA 3I72A 1S72A 1KABA 3T16A 3JAMc 1K8GA 2LS01 2EYJA 5KGUA 1Q46A 1PFBA 3GV6A 4DUZL 1IBML 2MO0A 3SVMA 2L11A 2ASBA 5IT9E 4A3EB 2FJ2A 2R93G 4JI6L 1RDPD 2RSNA 2F0WA 3GD7A 2D0PA 1VQNA 1QZHA 1EYCA 1LTLA 1YNNC 3CCSA 1F2YA 3U9SA 1NAPA 1J6QA 4O0AA 3N6RA 1UE6A 3NELA 4ODGA 1N36L 1EIHA 1EOTA 1TWGH 1BCPF 2K03A 4LF5Q 2LFNA 1EY5A 1A63A 3RLOA 3QIAA 1PTOD 3UDFA 2IT1A 1SR3A 3H09A 3DLLA 1J5EL 4G4KA 4XTCS 1BKBA 4NXNQ 3TZUA 2WV6D 3OWEB 3NENA 3NQTA 4IPGA 4LNQA 3H3VI 1LUZA 3K5OA 5FO9B 4LF8Q 3M3YB 2LSSA 1TS2A 2HD3A 5E4WC 3RUZA 1WFQA 4K5VA 2R61A 1BOSA 4WJ4A 4B9XA 3S1NH 5I6WA 1W6KA 1NCVA 2F52A 4XQQA 3RZOH 4WJWA 3DM3A 1X3QA 1Z7TA 5ELNA 2NVTH 3NPPA 4LMQD 2LXKA 1EIFA 1XMQQ 1U4LA 2PI2E 4A3KH 5K5PA 1PZKD 1EFID 5G3LD 4NMZA 2B2WC 1YJNA 3ULLA 3KBXA 1SE3A 2Q2IA 1I4PA 1A62A 1BNZA 4DAYA 2WAQG 2O4XA 1Q1EA 3MXGA 3F2CA 3C46A 3HGBA 3F8TA 4YWMA 4BXXG 1QNKA 1AN8A 1X3PA 2AUKA 4P2CB 1STNA 1VQFA 3PIO3 4JI5Q 2EE1A 5CIUA 1PFNA 2DY8A 3OMGA 1L1OC 3NE5B 4HN7A 1YIJA 1KQSA 1AEXA 2K5HA 3HOZH 1XPOA 4MZ9A 2PPBC 1ZYRD 1RL2A 1U9RA 3GDEA 1TS3A 3RR5A 2EYPA 4S3SA 3BG3A 3PO3B 2UUAQ 3ND9A 4PZ7A 2YTXA 4QIWB 3AYHB 1TVXA 4Q0FA 2B2UA 2P5ZX 3E9IA 3V05A 4DR4Q 2H5XA 4NKLA 5IT9c 4A3CG 2BCOA 4KHPL 1SYCA 2K5WA 1YHQA 3DHQA 2QNCA 4DNIA 1YZ6A 1WTQA 3Q24A 1K83H 1UUPA 3R3OA 5EGTA 1D5XC 4V0BA 1WOCA 2N88A 1STBA 2OCEA 1FVIA 2DY7A 3QO2A 4IUPA 5E4XA 5LMUQ 4BWGB 5C44G 1Y1VG 2A6ED 2AWNA 2MNAA 3M85A 4OXPA 3R93A 4XT3B 3G6EA 1SDFA 3D4DA 5E1FA 1Y1VH 1HPCA 1XTCD 4ZUJA 3VYRA 4JBKA 5IP9G 4R4OA 1Q12A 5IYCH 1N33Q 1RF2D 1HH2P 1VMPA 4GOPA 4OL7A 1RIPA 3CHBD 4LFCQ 1GM5A 4IJLA 1PTOC 2R7ZB 1TY0A 2NN6I 4C3IH 5FLMG 2VB2X 3C1FA 2Z6BA 1PYWD 4ZKCB 3A5ZB 2H4OA 2ZXOA 1BCPB 2L0CA 4A3IB 4A3BH 3KK7A 5FLMH 1HTLD 1G8ZD 1Q7YC 2K6AA 4C1NI 2ODCI 4KN7C 5I6YA 1PTOH 3PF4A 2B8FA 3PSIA 1PH6A 2B2VC 2K32A 2ZJRA 4A3DG 2CW0D 2UXBQ 3J80E 5E7NA 1WTOA 1VQMA 1ENAA 2AMCB 3WWVA 4JI1Q 4JK1C 2JA7H 1HZAA 2F03A 1CSPA 1JE4A 2KEEA 2B8GA 2F0SA 3ZJYC 4CDCC 4DV2L 4G7ZC 4A3DH 1MI2A 5FK9C 4ZLTF 5DLQE 4YY3L 1IW7D 5I2XA 1H9RA 4GNXB 3K80C 3S1QH 3I4MB 3HOUB 3I7FA 3EA6A 3A0JA 1B1ZA 2JA8H 4DFAA 2QW7A 1H1JS 1I6VC 1TWAB 4JI4L 4JW0A 3QWNA 1GUNA 3N52A 4JCVE 4C56C 4HJ5A 3HOYB 4CJ0B 1STYA 2ICIA 4RHSA 4BY1B 4NXML 2KVDA 1E7ZA 2CWPA 3UDIA 4JI0L 1ZYRC 3GTPB 4HMJA 4A3EG 1GHJA 2DK4A 1LTTD 2VNUD 4O42A 3SK8A 4DV5Q 1JCKB 1EIGA 1HQMC 4A3EH 2C5CA 2GN5A 3CC2A 4BBRG 4CHTB 4IZ8A 4C2MB 2TMPA 4KV6A 2IX1A 1X3EA 1Z9FA 1XMOL 5IIFA 1SE4A 3CXCA 1I4RA 5IWAL 1QUQB 2PW5A 4KHVA 1LT6D 5IODA 4AQYL 4A3JB 5IGFA 3UDGA 1ASZA 2EQSA 2F0UA 1A15A 3SDZA 2UU9L 3O13A 1SNQA 5I9OA 4A75A 4C3HB 1GKUB 1E0BA 2A6EC 1FNUA 1GD7A 1SLJA 4RFBA 2X6GA 1HUMA 1UE1A 1PA6A 4QL5A 4F88A 4LF4Q 3CKIB 3EVQA 3MXNA 4DR7Q 1RHPA 1A8VA 1C8CA 2QKIC 1MGSA 4J1MA 2NWGA 3T13A 1ZBHA 4DV6L 5JVH3 1EYAA 3E0JA 4V190 1DXMA 3DXJC 2RKSA 4DV3L 4BY7B 4X3KA 3GTKH 4PMCA 2NZOA 5FKAC 4IOAA 1QCBD 4HJ8A 1STHA 1WD0A 5J1ZA 1AE2A 2XN9C 1RODA 4DR2Q 4YCWA 3HOWH 2NVYB 5M3MB 1OXUA 3J80c 1LTRD 2ZTCA 3TEHB 5CORA 3S17H 1SXTA 2EPBA 5HGQA 2ZT9C 1I4HA 4CKCA 3BDOA 2EYFA 3ND8A 1E3PA 3OTOL 4K6DA 3M4OB 4YCUA 5M9OA 4LF6Q 5EPKA 2CW0C 3AEVA 5IGBA 4GN5A 1G2TA 5ELFA 4DXFA 5CC4A 3U9OA 5C4XH 4OX9Q 5IE8A 2F4VL 4QJFA 1CZWA 1OXTA 4R4QA 1X65A 1IW7C 1SMXA 3DMUA 2VQFL 1IKMA 1VQDA 2RBMA 4ZUIA 1CHQD 1X6OA 3PO3G 1TY2A 2RF4A 2RHSB 3GTGB 3BVZA 4QF4A 2WB1E 4DN4M 5IGCA 5C4HA 4X3TA 3PO3H 3BVMA 3P75A 2O5IC 2OF1A 2KVEA 4DNTB 5ELCA 4L63B 3CCRA 4K5WA 3NBHB 3CQZH 2DN8A 5JJKA 2G5DA 3EJIA 3L9AX 1Z6HA 1KLUD 1KNEA 5IYBG 2DGYA 2G9DA 2Q2HA 3HKZB 1ML0D 3J81E 4LUZA 3OW2A 3LLRA 3WOFA 2Q8TA 2VW9A 1CM9A 3KJOA 1SMYD 1ICFB 5I9PA 4B3MQ 4IFDG 2RHQB 1GJJA 1PXUA 1AP0A 5C4ZA 2N78A 2FMCA 1JJCB 4HIMA 1VQOA 2XIWA 5KNBA 3IRBA 4LF5L 1TWFB 1BBXC 2R7ZG 4POFA 1LM0A 2K5VA 4DF7A 2PW7A 4DAVA 4A3IG 2R7ZH 4JBWA 4NXNL 3HZXA 2FMMA 4FYDA 1CZGA 1TWCH 3NWTA 4RMFA 3T51B 1ASYA 2QCPX 2Y0SE 3D31A 5CBAE 4A3IH 4LF8L 1E7LA 3DWPA 1NE3A 2A6HD 2FFKB 4EQOA 1JEQA 5CGKA 2ZJPA 3MZ5A 4YCVA 1ZS9A 5IYDG 4Z9CB 5GQOA 1W2BA 1I6HB 3D0FA 4GNXC 1STAA 1CT1D 1U5KA 1EUJA 2QDLA 1XMQL 2KCTA 3P20A 2HIVA 3TP7A 3K59A 3IFDA 1PV4A 3OOCA 2G80A 3V96A 1WD1A 1TS5A 4KTAA 1VQ9A 5GAEC 2AQ3B 3H0GH 5CV6A 4ME3A 3I4MG 2A68D 3HOUG 3R8BA 4IN3A 2L4NA 2OEOA 4X3SA 5EKKA 3I91A 2MPHA 3CCQA 1E1TA 4A3MH 2E74C 1EQTA 1L0YB 4UY8C 3UDXA 4JI5L 2RCNA 3TREA 2F0PA 3T56B 4R9WA 4BY1G 3HOZB 2KENA 4APVA 3HS0C 3HOYH 2PYKA 3CCEA 2PQAB 4JI0Q 3GTPH 4IQZA 4JOIC 3K7AH 4GN4B 2KHIA 2UUAL 3FKIH 1L1OB 3HOXG 4HJ9A 1D1KA 3NWSA 4NB3A 1LTSD 3DM1A 2EDGA 1B3QA 4KN4C 3AB9A 4QY7A 3J81c 4C2MH 1VQBA 1VQAA 4JI8Q 2ES2A 4A3JG 4JI3Q 2DJGC 2KVMA 3NK9A 4X65Q 2RQXA 4M1UB 1H9SB 2BA0A 1VF5C 1C4QA 4AQYQ 4C3HG 4R8NA 4GLAC 1PVOA 4A3JH 3S14H 4RGOS 5LMUL 1EY0A 2F0QA 4I7AA 1GL9B 2YTYA 3RNUA 1SMYC 2K75A 4DV1Q 1OXSC 5CV7A 1M1KC 3BJUA 1IYJB 1F9RA 1I4QA 1XNQQ 2WB1B 4YWKA 3RD4A 1VQ5A 1S5FD 2DNCA 1VQLA 1N33L 3TS0A 4DAPA 1HHVA 2R92B 4LFCL 4L5RC 4ZQ3A 4BY7H 1PH4A 1JJ2A 2M9VA 1KIXA 5M3MG 5C3EG 4HTHA 2IL8A 4KK7A 1WTXA 3M4PA 2E5LL 4EQNA 1PTOB 2NVYH 2BDOA 3GTJB 1R9TH 4FF2A 1M4VA 4LW1A 2A6HC 4GLVB 5KRUA 3HOVH 4U673 3H3VH 4QIWE 2Z8LA 5JEAG 1D6EC 4OELB 2M2LA 4DNRB 2F4IA 2JA7B 3S9WA 3S2DH 1HQRD 2PI2A 4JI1L 4TRDA 4RKLA 5FO8B 1W3SA 2EYMA 2VUMG 2NB0A 4KKUA 3MFGA 3AMUA 1X56A 1B8AA 1PH7A 5C5MA 3KDFB 1WTRA 4DA2A 2QEXA 3FMCA 2A68C 1C0AA 3GTOH 1XX8A 4IURA 3QR8A 2JA8B 2WKDA 5JJIA 2QGQA 1QJOA 1WTPA 3GTGH 1A6XA 2JA6H 3L0OA 5JJLA 3C1EA 1V66A 1NMGA 1SYGA 4X66L 1P8LA 1PLFA 2IX3A 1DD2A 1EEFD 1UAPA 3STBD 3EN2A 3HKZG 1HNWQ 2ALYB 1IL8A 2K5DA 1B70B 4IO9A 3L2PA 1N32Q 4DV5L 2O2LD 5DAUA 2NBFA 2RDHA 2WACA 3SE0A 4E6IA 1JJGA 4R4IA 3I73A 3BZKA 5F2DA 1IZ6A 5GAHC 1EY4A 1KDCA 1KC8C 1BQQT 1M90C 4DPGA 4IUTA 3WDNA 1PH1A 4ILWA 1MJCA 1QVFA 1D1IA 1EY7A 3LWUA 2CKZB 4B9WA 4ZYSA 1F77A 3CCLA 1V1PB 4IOCA 5FO7B 1VQ4A 3PMFA 2EZVA 3AFPA 2K33A 2L55A 4OHJA 1TWFH 4LFBQ 4UPAA 4KY5A 1KNAA 4DGZA 3K81C 1FD7D 1CKNA 1MSGA 1PRTF 1QVCA 4B08A 1Q1BA 1QE6A 4LF4L 3CCUA 1JOOA 1UEAB 4B3SQ 4DR7L 4GLXA 4L5QA 2H1EA 2Q8IB 1VQJA 1EEID 5M5XH 4MHEA 2JEBI 4L5TA 1VQKA 2J4XA 1BBWA 3B6YA 1X3GA 3GTKB 1VDZA 2CQOA 2NN6G 1I5FA 2I5MX 4OWXB 1KLGD 4X64Q 2VXWA 3SEBA 4A3KG 1HA5A 2B2YA 3HOWB 2NN6H 3SHLA 1Y02A 3K8AA 4DR2L 3E6ZX 4ABNA 1I6HH 3HP3A 3S17B 4DR5Q 2CHBD 1PH2A 5JOBA 1Q86C 1E2VA 2I07B 2V1CC 3DWAA 4CKBA 4LF6L 3I4LA 1IXRA 4GOPC 1AZQA 2MHVA 4FVMA 2CH4A 4J6HA 5C4XB 5EBDA 5HGTA 1TQOA 4OX9L 4XQJA 1OTCA 4IFDJ 1ET9A 3HOZG 2NYZD 4LUVA 3KLWA 4TKOB 3SK5A 2M00A 3A8JE 3CMEA 1YJ9A 1HXYD 2ATWA 3ITPA 4G57A 3TS2A 5EBCA 1L0XB 4YIJA 3VDYA 2YU9B 3D4RA 1O78A 1SNCA 3PO2B 1PH8A 2VQEL 1HZBA 2IY5B 4HMIA 1E2WA 3E5SA 3LNNA 1XTDA 3WOEA 2HDMA 1CI3M 5T1IA 5C0XH 5DEHA 1IL2A 1HRJA 2HJQA 1B44D 1EN7A 4H02A 1TKWB 1V8QA 3K5LA 3CQZB 3H94A 5DM73 1SBBB 1JJRA 1TXYA 4H0LC 2E2IB 3STBC 2Z0SA 2CVRA 1LYLA 4F7XA 3MEFA 4DAMA 2K4KA 2FINB 4HSPA 4A3FH 1YVCA 2VY3A 1HR0L 3KF6A 4ZCKA 2E2DC 3IAYA 3GTQB 4B3ML 3K57A 2VB3X 4DK6C 4KKSA 4P75A 2WB1G 3U50C 5IYCG 4OIKA 4LF9Q 3MEHA 4GKKQ 2XGTA 2KFVA 2F0GA 2A1AA 3NTIA 5M3FB 1KRSA 4C3IG 2LMCB 4JBJA 2HCIA 2HCCA 3FPPA 4BA2I 4JI7Q 1WI5A 1O7ZA 4IALA 3T1HQ 3BZDB 1EWIA 4A3BG 2R92H 4J15A 1D7QA 1TWCB 3MXUA 4F87A 2YYZA 1VF7A 5LMNW 3J7ZC 2UXDQ 2B2WA 4O1NA 2E5LQ 2L9HA 3CC4A 3KFUA 1H9EA 5IP7H 3GQBA 2N3SA 2JA7G 3GTJH 1D8LA 1NY4A 2R3ZA 1FJGL 1XXGA 5GROA 2Q2UA 2KHSA 3P7JA 3W5OA 4Y7NB 1Y8NB 2BH2A 2PMZB 1G91A 1BXTA 5M5WB 4MN3A 3H0GB 3HKZE 1F2MA 1PMRA 3KOJA 3VA5A 4HSVA 5C4JB 2JA8G 1JMCA 2Y0SG 4A3MB 4L8JA 5C0XI 4FF3A 3S16B 5KYLA 3SK6A 2L1BA 4M8AA 1ILQA 2F0JA 2JP1A 1Q8KA 1EWCA 2AKWB 1JE5A 3I55A 5IT9L 3GTMH 3LWEA 2KCCA 2F0DA 4X66Q 4CJ2C 1B9NA 3K7AB 1K0RA 2KBNA 3FKIB 1K3BC 4HJ7A 1P16A 4BA1I 2CCZA 1GUWA 4HEDA 4X6AH 1ET6A 1HR0W 1VQHA 4PMWA 1H9KA 1A2TA 1SNDA 3CC7A 1XWEA 3I4NB 1I50B 2VL6A 1CQVA 4JI8L 1Y1WH 4R1JA 2F0FA 4LFAQ 4JI3L 4X65L 2E8GA 4C1NK 1VQ8A 1NR2A 2ZTDA 4GKJQ 1Q82C 2F0LA 3S14B 5JEAJ 1BDOA 3CP0A 1WJJA 3PUYA 1JWMD 1A2UA 5AJ3Q 4L5SA 4DV1L 1PDQA 4U68A 1PRTD 3MFYA 5IY0A 1XNQL 1GJXA 1R4PB 2Z9HA 5JPNC 2LC3A 1LTID 2DJFC 5GAGC 3KUPA 3F1ZA 1YI2A 1K3RA 3W1BA 4X62L 3M4QA 2B3GA 1JB3A 2PZUA 2Z6KA 4DUYL 3HOWG 3KLSX 4K14A 1N34Q 3I2ZA 2XRSD 1XJVA 1TU2B 5COYA 4CJ1B 1CFMA 3Q6SA 3NQIA 2F0NA 3Q0AA 3S24A 3H15A 1HCZA 5LMNQ 3K0XA 4PV1C 1R9TB 3A56A 3J7AV 3HOVB 1HUNA 1FR3A 2I5LX 4RA8A 3ERSX 4AYBB 3QG1A 3F2BA 5C4XG 4WORA 3M7GA 3MTSA 4P73A 3S2DB 3VR4A 1RTNA 4RH6A 3D8GA 1II3A 3E3XA 4LAAA 1CUKA 3W1GA 5ELBA 2JXMB 3FLGA 4QCLA 3DEPA 2AQ1B 1K9MC 2KQ3A 3A7AB 2LXJA 1MD2D 5LL6X 3G71A 1WYDA 3EQLC 3S15B 2Z4IA 4DR6Q 3GTOB 3HG9A 1Y8OB 4A3LG 1JR0D 5DNFA 1VMCA 4DR3Q 2F3VA 2YU9H 1JICA 2VQEQ 3PO2H 2EYHA 1S4ZA 3TP6A 2RNOA 2ZM6Q 4A3LH 2JA6B 2KA7A 3TN2A 4JPBW 4HIOA 3QB3A 3ER0A 4KD3A 4A93B 1O80A 4BBSB 1TIID 4FO2A 4EVOA 1HNWL 1S40A 3J7A5 2A19A 1CKMA 4UAIA 1J8IA 2NVQB 1VQ7A 2E2IH 1N32L 3T1YQ 3NTHA 4DR1Q 1XYIA 3SXHA 4BITA 1FL0A 1FNVA 1LV9A 5M5YH 1HR0Q 2PCFB 1O7LA 1IHZA 1LT3D 4LUOA 3GTQH 3FP9A 1N9WA 1SEBD 1AH9A 2YV5A 2OT2A 2EIFA 1FGUA 4DAYB 4CKEA 2F0HA 1E24A 1Y14B 4K8IA 4JBMA 5M3FH 2KCMA 3OW7A 4EX5A 2RNNA 2KCNA 5IGGA 4LFBL 4GN3B 1GUGA 1E2ZA 4OIJA 1BVSA 1PRTC 4B3SL 4LF7Q 5M5XB 4KJOA 4XDXA 4MTKA 5GADC 4MTNA 4UHVA 1F9PA 2OQKA 3J80L 1I4GA 1Q3LA 3RLFA 1TS4A 2JK8A 5BR8L 2B2TC 1ZKOA 3KF8B 1JOQA 4X64L 2HHHL 3U4VA 1C48A 1FJGQ 2NVXB 3H0GG 1JB7A 4DR5L 4Y7NH 1AW7A 2A74C 3S2HB 5CV4A 3TP5A 5M5WH 2KJXA 2D0OA 1HNXQ 3CD6A 2G9HD 3DUZA 4QUFA 4RCNA 2MPMA 3TBIB 4A3MG 1R4QB 1CA5A 1HA6A 5C4JH 1AZPA 1QB5D 2MUYA 4X3UA 4WFN3 1DGSA 2HIXA 2PQEA 3HOYG 4TVAB 3S16H 2XNAC 4L6TB 2MFIA 4KKTA 4B3TQ 5JVG3 2B63H 4GOPB 3D3RA 2Q2TA 1JOKA 3FKIG 2C35B 3BYTB 2XWBB 1PH5A 1K8OA 1CKOA 1QVGA 2EXZA 2K01A 3HKSA 3PCOB 1V1OA 3A7LA 1EY8A 2E2HH 1SN8A 5IGEA 4P74A 1SNPA 2PO4A 3I4NH 1I50H 2RVLA 1LTBD 3PIPA 4G7OC 5D65A 3R2IA 3VR3A 4XQNA 4OO1H 4A3FB 4N9TA 1KXLA 4O2DA 5EJWA 3S1RB 3PV0A 3BU2A 4HIDA 1GKHA 1KDAA 1YHAA 1X54A 1PZID 4OGQC 3I90A 4JYAQ 5CMDA 4HCSA 1EOVA 4LF9L 5D14A 4GKKL 3G7LA 1D5ZC 4JV5L 4RKBA 2EY6A 2RSOA 2ZXPA 2QA4A 3RZDB 1K73C 5JPMC 5EKLA 4JI7L 4BY7G 2KOLA 3ICEA 4X62Q 4HR7B 4QGUA 3T1HL 3J7YW 1SFOB 2CH4W 1XNRQ 1DOKA 1WCMH 1NR4A 3C2PA 3MAQA 4GNXA 4DUYQ 2DNEA 1V1QA 3CPWA 5JJZA 5BN3A 2UXDL 3HOVG 5J22A 3M9BA 4K6LA 1L2FA 2A8VA 1F9SA 3HEJA 4AYBG 1NTGA 3TRZA 2MGSA 2EY1A 4DV0Q 1U0LA 2ENBA 1PHJA 4K0KL 5EQ0A 4PZ8A 1NBWA 1UEBA 4FDBA 5AFWA 5ISRA 3NEMA 5E3FA 3W3AA 1YBYA 1S5DD 1YEZA 1JT8A 1DJRD 1E1OA 2XTIA 1SE8A 2Z1CA 4IPCA 1KL9A 5D3DA 1B4OA 1A3UA 1PFMA 2SNMA 1NUCA 5C3XA 1IBLL 1E7DA 1T5EA 3I4OA 5A2QL 3S15H 1EL0A 3JAMi 1QUQA 2JA6G 3OHXC 4GS3A 4K2KA 5FJ8H 4DU9A 1I4XA 1SYBA 1CTMA 3I8ZA 1DYQA 2XSCA 3FRPB 2B2YC 3QOJA 1PH9A 3GTMB 4A93G 4DKAC 3KBGA 5FLXL 1KAAA 3A8IE 1ICWA 1SROA 2N8NA 4BBSG 5K36H 1LABA 4K5XA 1VCIA 3J81L 4CBVA 4OO1I 2F0IA 2R6GA 4H7BA 4A93H 3KYHC 3GTLB 4H13C 2R7DA 4BBSH 2OTJA 1Q90A 1YJWA 3PIP3 1CHPD 4Q5VA 1EYGA 2NVQH 2RCFA 4UZWA 1L0WA 1G6PA 3TQYA 4G7HC 2KECA 3U4ZA 1Y1WB 3G6JB 3CAMA 3FDTA 1BBUA 5CYUA 4LFAL 4PZ6A 1ESFA 1O7IA 4A3GB 5CV8A 3UE1A 5ELOA 4C3JH 4OWTB 4GKJL 1B50A 1ESRA 4RGNA 1BR9A 3J7AF 2K5NA 5CV5A 1BF4A 4XYQA 2PMZE 3U58A 4FXDA 5AJ3L 4ZK9B 2OWOA 1QWYA 3K6OA 4TSSA 3V2TA 2UUBQ 2R93H 3NHHA 1OO9B 4BBRB 2B2UC 1EQRA 3S1MH 2PNRC 4F8MA 1VQ6A 2I5HA 2JE6I 1EIYB 3ERQA 1FNWA 2K1BA 4RGTA 3PUVA 1V43A 3A55A 5BR8Q 4LK1C 2WIIB 2K14A 1QILA 1N34L 2D5DA 1K8AC 2HHHQ 2UXCQ 3CCVA 2D2CC 1RCVD 1S5ED 3D6CA 5LMNL 2NVXH 4JC0A 4YHHL 4DV4Q 2XWJB 5ELEA 4PG3A 1NMFA 3MHBA 3S2HH 2KUMA 1EZ8A 2B39A 1WTWA 2NUCA 1DM0B 2IPKD 1GXDC 3NBHA 3AQQA 3RN2A 4KI0A 1JQYD 5HURA 1X3FA 3LGJA 4KY7A 1IYUA 5C5LA 3SK4A 1JORA 1LTGD 1IKLA 5I4DA 4UP8A 3ULPA 1T5XD 2K05A 4AH6A 1CA6A 4DR6L 2ZXRA 3JAML 1KHIA 4WJ3M 4K8JA 4ZAIA 2HUGA 5C0XG 4HJAA 4DR3L 4XT1B 2JEAI 3VR6A 2BOSA 2IHFA 1WTHA 4PQXA 3CMAA 3NP8A 2ZM6L 2F0KA 5LL6S 4KY6A 1V9PA 4I7ZC 4R4TA 3L3OC 2KW9A 1Q8IA 3NSWA 1UWVA 1PYBA 4UDUC 5EKIA 3ONAB 4BXXH 4N9PA 1STEA 4QQBX 4A3FG 2W51A 2KEDA 1VQIA 3OIQA 2IJ0A 4OWWB 1H95A 3T1YL 3NTKA 1K8MA 3OPOA 3HFZB 1OXXK 1ONLA 3FEWX 4DR1L 2LD7A 2JVWA 5M5YB 3KF8A 1T9HA 4K2LA 5J3BA 3S1RH 2VZAA 2ZTEA 1G51A 2IHEA 4P72A 5IOCA 4AYBE 3AFQA 1LT5D 3IKJA 5CR3A 5EPJA 5KNDA 1I3QB 3VYUA 3A74A 2I46A 4JV5Q 2R92G 4A3CH 1LACA 2XVSA 2JA9A 3OMCA 3K58A 2L12A 3RZDH 3C3LA 3EROA 1EWHA 3KJPA 3RN5A 1SFOH 4LF7L 5T1GA 1IBKQ 2WKCA 2L5TA 3K7UC 2UUCQ 4DK0A 4PNYA 3T53B 2A69D 4YWLA 3I56A 1SJED 2JQOA 2WQGA 1H9JA 5ELDA 5EPLA 5IP7G 5C44H 1JWUD 3Q22A 1EQQA 5C6AA 1KAWA 1DCZA 1PRTB 4K0KQ 2R7FA 1K0SA 5KEEA 4KMUC 2PQAA 5IP9H 1RKNA 1S5CD 2Q8RE 1SNMA 2J0TD 1L1OA 1HFGA 4OEMB 1EU3A 1HNXL 1HNZQ 1PH3A 4NW2A 2BE5D 4FF1A 2EVBA 3CCMA 1NNXA 1U4RA 2F0TA 1IBLQ 1JC7A 1A0IA 5KYIA 2KHJA 1B3AA 1S3OA 1XPRA 3TDQA 1I94L 3M4YA 2F3IA 5FOBB 4JI2L 2EJFC 1H9SA 2F3WA 3BS1A 3FVQA 1X32A 2Z6KC 2MO1A 4FXGC 1JWSD 4HAEA 4EQ5A 2B63B 4GZYC 4QUCA 2MQHA 4B3TL 3Q23A 2E2JB 4HCEA 3VR2A 4LJZC 1BO0A 1H9FA 4DV7Q 4FXKC 4KD4A 2HT1A 2IWHA 1PYSB 1HZCA 3D4WA 2XRQD 2EXDA 3GTLH 4MNOA 1G291 3H6MA 2IX0A 1KD1C 3UI2A 1ZEQX 5A35A 4B3RQ 1Y1WG 2E2HB 1Z47A 1GVPA 4A4IA 3CPFA 2QILA 1SJHD 4IUUA 1G6ZA 4A3GG 5H1SE 1LO5D 4MIUA 4ALPA 2JN4A 2EY2A 3CRLC 2PZWA 1PFSA 1CK1A 2HQLA 2X69A 1EFWA 4DUZQ 1IBMQ 4A3GH 2BA1A 1HZ9A 2HDLA 2JSOA 2NZ1D 3R2TA 2O5JC 4JI6Q 1D2BA 1E22A 4JYAL 5BN5A 3CU7A 4Y52H 3HOXB 5BN4A 1CSQA 3QOLA 2EY5A 1U4MA 4BBRH 3L7ZC 1SYEA 2FHTA 1N36Q 3W2DA 1S5BD 1BCPD 1WCMB 2B2VA 3J80i 1WVLA 3KDFA 5JAVA 1XNRL 3VA7A 2NTTA 4J8QA 4RCOA 2A73B 3VYTA 1TT2A 2A69C 4XYOA 1Y69U 1J5EQ 2K04A 1B53A 4DK1A 2E75C 2IW3A 1OXVA 4YHHQ 4IPDA 3K5NA 4DV0L 1HJPA 2WAQE 1GUTA 4DK3C 4KHZA 1FGBD 1TWHB 4UP7A 3NBIA 3M3YH 2Z4HA 3GP7A 4KJNA 3OIPA 1RD9D 3UE0A 1VS0A 4POGA 1MIUA 3BDCA 1ENCA 3OSOA 1KHCA 3NUCA 2BE5C 1QNUA 3E0EA 1STGA 4RHRA 5C3EB 1EQVA 2K28A 3HRZC 1UE7A 3PO2G 4QB4A 2ODGC 1SNOA 3LX0A 1EY6A 3F2UA 2OTLA 1EZ6A 3GV3A 4R8IA 1CKNB 4ZRZA 1V1PA 1DOMA 1O7YA 1ENFA 4CDFC 4AIMA 2EYLA 4XIGS 4DXGA 1AE3A 1UNSA 4NPSA 1HTPA 4RWSC 2VUMB 2AWOA 1PZJD 1VQGA 2JA5B 1AFPA 4CDEC 4EQPA 5KNCA 3SGIA 1RJTA 1SE2A 1LTAD 2JJQA 2AQ2B 2F0EA 2CWAA 2I0QA 1VQEA 3P1HA 1Q81C 3G48A 2AUJD
chains in the Genus database with same CATH topology
4JV5L 4A3KG 3FHWA 3ULJA 4YY3L 2QA4A 1K73C 1Y02A 3K8AA 4GNXB 4DR2L 4JI7L 3EBEA 3K80C 3CW2C 4X62Q 3ICEA 3S1QH 4BY7G 1UE5A 4QGUA 3T1HL 1I6HH 1XNRQ 4KHPQ 4DR5Q 1WCMH 5M3FG 3I7FA 3A0JA 2JA8H 4GNXA 1PH2A 4DUYQ 3J81j 4JI4L 1Q86C 1V1QA 3CPWA 1B7YB 1I3QH 2V1CC 2UXDL 4JG2A 4JCVE 4HJ5A 4LF6L 1JEIA 1IXRA 3HOVG 4GOPC 3M9BA 1L2FA 2A8VA 4NXML 4AYBG 1E7ZA 1NTGA 2CWPA 3UDIA 4JI0L 4OX9L 2UUBL 3TRZA 4DV0Q 1U0LA 2QNFA 4A3EG 5IYBH 1PHJA 1OTCA 3HOZG 4K0KL 4IFDJ 2DK4A 4LUVA 1YNSA 4PZ8A 2VNUD 2WFWA 1NBWA 1UEBA 3KLWA 4FDBA 3NEMA 3CMEA 4UP9A 4DV5Q 1YBYA 1YJ9A 2ATWA 4A3EH 3TS2A 1YEZA 1JT8A 2GN5A 3VDYA 3M7NA 5C0XJ 1E1OA 3RLNA 4BBRG 2XTIA 3CC2A 3A5UA 1SE8A 1PH8A 4IPCA 2VQEL 1KL9A 1HZBA 1X3EA 1Z9FA 2IX1A 1XMOL 2IY5B 3PGZA 3CXCA 2UXCL 1XTDA 3GO5A 1IBLL 5IWAL 1E7DA 1QUQB 1IL2A 2HJQA 3I4OA 3S15H 4AQYL 3UDGA 3JAMi 1ASZA 2BH8A 2EQSA 1EN7A 4H02A 4DV4L 2UU9L 1QUQA 1YITA 2JA6G 4GS3A 4A75A 5FJ8H 1TXYA 1GKUB 1MKHA 3STBC 2ZJQA 2Z0SA 1LYLA 1GD7A 1SLJA 1PH9A 3Q8DA 1UE1A 1PA6A 4A93G 4DKAC 3MEFA 4DAMA 1YNXA 2K4KA 3KF6B 2N8NA 1SROA 4QL5A 4LF4Q 4A3FH 4BBSG 4DR7Q 1YVCA 1VCIA 1A8VA 1KRTA 3F2DA 1I94Q 4OO1I 2VY3A 4JI2Q 1HR0L 3KF6A 2R6GA 2B63G 4A93H 3KYHC 4B3ML 2R7DA 4DK6C 4DV6L 4RG1A 4BBSH 2OTJA 4P75A 2WB1G 2K50A 3U50C 5IYCG 1YJWA 1X55A 5IYDH 4LF9Q 4A76A 4DV3L 3GTKH 4GKKQ 2NZOA 2XGTA 3OYYA 4OONA 4P71A 4DV2Q 1EYGA 2NVQH 2KFVA 2A1AA 2FXQA 4IOAA 4LWCA 1KRSA 1L0WA 1G6PA 3TQYA 3J81i 4HJ8A 2E2JH 3U4ZA 4JBJA 4YY3Q 1AE2A 4TQUS 3CAMA 4A3BG 4BA2I 1BBUA 1YHBA 4YCWA 4DR2Q 4JI7Q 4LFAL 4PZ6A 3HOWH 1WI5A 1SRUA 3T1HQ 1O7IA 2VS1A 1EWIA 1OXUA 2YTVA 2ZTCA 5ELOA 3TEHB 3UE1A 4OWTB 4J15A 4C3JH 2R92H 1X9NA 3HOUH 3I4NG 3I4MH 3S17H 4GKJL 2K5NA 1D7QA 5HGQA 4JI4Q 2YYZA 1E3PA 1TWAH 4OO1G 3OTOL 5LMNW 2PMZE 4YCUA 3J7ZC 3U58A 1NJIC 4LF6Q 2UXDQ 5AJ3L 3AEVA 4GN5A 2OWOA 4NXMQ 2E5LQ 5C4XH 3CC4A 3KFUA 4BY1H 1C9OA 2UUBQ 4OX9Q 1H9EA 3PF5A 2R93H 5IP7H 2ID0A 2N3SA 2JA7G 5IE8A 5HY6A 2F4VL 3GTJH 1D8LA 1EQRA 1NY4A 3E9HA 1QZGA 4QJFA 3S1MH 1OXTA 4R4QA 1FJGL 5GROA 2Q2UA 1VQ6A 3W5OA 1X65A 2I5HA 1SMXA 2VQFL 2JE6I 1EIYB 4DR4L 3PUWA 1VQDA 5FLXc 2BH2A 3CF5A 1X6OA 1V43A 3PUVA 5BR8Q 3PO3G 2RF4A 2RHSB 3PUXA 3HOXH 3PUZA 1XMOQ 2K14A 4IFDI 3G4SA 3HKZE 1N34L 3JC66 2WB1E 1K8AC 2HHHQ 1WCMG 2UXCQ 5IWAQ 3KOJA 3CCVA 4IPHA 2JA8G 3PO3H 3PO2H 1JMCA 4IJHA 2OQ0A 2Y0SG 5LMNL 2NVXH 4JC0A 4YHHL 4DV4Q 2UU9Q 5C0XI 2AHOB 2CFMA 3CCRA 4PG3A 1IBKL 1NMFA 2DUDA 3CQZH 3NBHB 5JJKA 3S2HH 2UUCL 1Q8KA 4C3HH 2AKWB 2DGYA 2Q2HA 1JE5A 5IYBG 3I55A 3RN2A 3GTMH 3AQQA 4KI0A 4LUZA 3OW2A 2NZHA 4HIKA 1X3FA 2PNHA 3LGJA 2VW9A 3KJOA 4X66Q 3EIVA 2D62A 4B3MQ 4IFDG 4UP8A 1GO3E 1K0RA 4DV6Q 3ULPA 2KBNA 2RHQB 4AH6A 1GJJA 4HJ7A 4DV3Q 1P16A 4BA1I 1TWHH 2CCZA 4DR6L 2N78A 1KHIA 2B29A 1C7YA 1HR0W 1VQHA 4WJ3M 1JJCB 4PMWA 4X6AH 4HIMA 1VQOA 3CC7A 3IRBA 5C0XG 4HJAA 4LF5L 4DR3L 2JEAI 2IHFA 2WP8J 2R7ZG 2VL6A 1HNZL 4POFA 4JI8L 3CMAA 1LM0A 4R1JA 1Y1WH 4LFAQ 2ZM6L 2K5VA 2GVAA 4JI3L 3BZCA 4X65L 2E8GA 1VQ8A 1V9PA 2ZTDA 5FJ8G 5M3MH 4GKJQ 1Q82C 5C3EH 4R4TA 4A3IG 2R7ZH 5JEAJ 2L15A 4JBWA 4JOIA 4NXNL 1UWVA 3CP0A 1PYBA 1WJJA 4BXXH 1TWCH 2UXBL 3PUYA 4RMFA 3OTOQ 3CCJA 1MJEA 4QQBX 1ASYA 4A3FG 2W51A 5AJ3Q 3M4OH 5K36G 4L5SA 2Y0SE 3D31A 1VQIA 3MXNB 4DV1L 4A3IH 2K52A 4LF8L 1E7LA 4OWWB 1NE3A 1H95A 3T1YL 2JA5G 1N8RC 4R4CA 2ZJPA 5IY0A 1XNQL 1XPUA 3HFZB 1OXXK 4YCVA 1ZS9A 4DR1L 2F4VQ 2LD7A 4DV7L 2LC3A 5IYDG 4KLKA 5GQOA 1W2BA 1T9HA 2VUMH 5J3BA 3S1RH 5GAGC 1YI2A 3F1ZA 2JA5H 1K3RA 2VZAA 3D0FA 2N49A 3W1BA 4X62L 1U5KA 3M4QA 1EUJA 2ZTEA 2VQFQ 4GNXC 1XMQL 2KCTA 1G51A 2B3GA 2IHEA 4P72A 2HIVA 4AYBE 3AFQA 1PV4A 4B3RL 2Z6KA 4DUYL 2G80A 3PIOA 3HOWG 1VQ9A 1N34Q 3I2ZA 1XJVA 1VQCA 3A74A 5GAEC 1VQPA 4JV5Q 3H0GH 2R92G 2GVBA 4ME3A 1S72A 3I4MG 4A3CH 5EAYA 3HOUG 3S24A 2JA9A 3H15A 3RZDH 2MPHA 3CCQA 5LMNQ 1E1TA 3K0XA 3JAMc 1K8GA 3KJPA 3RN5A 4A3MH 4GKKL 1SFOH 4LF7L 1Q46A 2I5LX 4DUZL 1IBKQ 3UDXA 1IBML 3ERSX 2MO0A 4UY8C 3K7UC 4JI5L 2UUCQ 2RCNA 3TREA 3F2BA 3I56A 2ASBA 5C4XG 4YWLA 2JQOA 4BY1G 4P73A 2KENA 2R93G 4JI6L 5IP7G 5C44H 4APVA 1EQQA 3HOYH 1CUKA 3GD7A 3W1GA 2D0PA 1KAWA 3CCEA 2PQAB 4JI0Q 1VQNA 1K9MC 2LXJA 1QZHA 4K0KQ 3GTPH 3G71A 1LTLA 4JOIC 2R7FA 3CCSA 3K7AH 1WYDA 2PQAA 1J6QA 2KHIA 4GN4B 1UE6A 4O0AA 5IP9H 2UUAL 3FKIH 3NELA 1L1OB 1N36L 3HOXG 4HJ9A 4DR6Q 4A3LG 1TWGH 4NB3A 1L1OA 4LF5Q 4DR3Q 2YU9H 3J81c 2VQEQ 4QY7A 1HNXL 4C2MH 1A63A 1VQBA 1PH3A 1VQAA 3RLOA 4JI8Q 1HNZQ 3UDFA 2ES2A 2IT1A 4A3JG 1SR3A 2ZM6Q 3CCMA 4A3LH 4JI3Q 4X65Q 1IBLQ 3DLLA 1J5EL 2BA0A 1A0IA 4XTCS 2KHJA 4AQYQ 1S3OA 1BKBA 1XPRA 4NXNQ 4HIOA 1I94L 4GLAC 1PVOA 4A3JH 2F3IA 3ER0A 4JI2L 3S14H 5LMUL 3NENA 1GL9B 2YTYA 3RNUA 4IPGA 2K75A 2Z6KC 4LNQA 2MO1A 1LUZA 3H3VI 1HNWL 1S40A 3J7A5 4DV1Q 2A19A 1CKMA 1OXSC 1M1KC 4LF8Q 2LSSA 3BJUA 4EQ5A 1VQ7A 2E2IH 1N32L 1IYJB 3T1YQ 2MQHA 3J80c 1WFQA 4B3TL 1XNQQ 4YWKA 1VQ5A 4DR1Q 1H9FA 4DV7Q 4WJ4A 1VQLA 1N33L 3TS0A 3S1NH 2HT1A 1FL0A 5M5YH 2F52A 1HR0Q 3RZOH 1PYSB 3DM3A 1HZCA 5ELNA 4LUOA 1XMQQ 2NVTH 2LXKA 1EIFA 4LFCL 3GTQH 3FP9A 2EXDA 1N9WA 2PI2E 4MNOA 1G291 4A3KH 2YV5A 3GTLH 1AH9A 2EIFA 2IX0A 1KD1C 1FGUA 1YJNA 4DAYB 4B3RQ 3ULLA 1Y1WG 4L5RC 4BY7H 1PH4A 1Z47A 1JJ2A 1GVPA 2Q2IA 3CPFA 4A4IA 1KIXA 1A62A 1E24A 1Y14B 5M3MG 4JBMA 5M3FH 5C3EG 5H1SE 2WAQG 4A3GG 2KCMA 4ALPA 4EX5A 1Q1EA 4LFBL 4GN3B 3F2CA 4YWMA 3F8TA 3M4PA 2E5LL 4BXXG 2NVYH 1BVSA 1R9TH 1PFSA 2HQLA 1EFWA 4LW1A 4DUZQ 4GLVB 1IBMQ 4B3SL 4LF7Q 3HOVH 3H3VH 4A3GH 1VQFA 2BA1A 4QIWE 4JI5Q 5JEAG 1HZ9A 1L1OC 5GADC 4MTNA 4JI6Q 2OQKA 1YIJA 1KQSA 3S2DH 4JI1L 2PI2A 2K5HA 3HOZH 1XPOA 1E22A 4MZ9A 4JYAL 3RLFA 1W3SA 4Y52H 2JK8A 5BR8L 2VUMG 1RL2A 1CSQA 3KF8B 3GDEA 3RR5A 4X64L 1X56A 1B8AA 3U4VA 2HHHL 1PH7A 3KDFB 4BBRH 2UUAQ 4PZ7A 3L7ZC 2QEXA 1FJGQ 2YTXA 1N36Q 3AYHB 1C0AA 3E9IA 3J80i 4DR4Q 3GTOH 3H0GG 2H5XA 3KDFA 1JB7A 1XNRL 5IT9c 4DR5L 4A3CG 4Y7NH 4KHPL 5JJIA 1YHQA 5M5WH 2QNCA 2D0OA 2QGQA 1YZ6A 4DNIA 1HNXQ 3CD6A 3GTGH 4A3MG 1K83H 1J5EQ 2JA6H 3L0OA 1WOCA 5C4JH 5JJLA 2OCEA 1FVIA 1DGSA 1NMGA 1OXVA 4X66L 1P8LA 4YHHQ 4IPDA 5LMUQ 4DV0L 1HJPA 5C44G 2HIXA 1Y1VG 2WAQE 3STBD 3EN2A 2AWNA 3HKZG 4DK3C 2MNAA 3M85A 3HOYG 4OXPA 4TVAB 1HNWQ 2ALYB 4KHZA 3S16H 3G6EA 4UP7A 1B70B 4IO9A 3L2PA 2MFIA 3M3YH 4DV5L 1N32Q 1JJGA 4B3TQ 2B63H 1Y1VH 4GOPB 4R4IA 3UE0A 5GAHC 3BZKA 4JBKA 1IZ6A 4R4OA 5IP9G 1Q12A 5IYCH 2Q2TA 1N33Q 3FKIG 1VS0A 1KC8C 4POGA 1MIUA 2C35B 1M90C 1HH2P 1PH5A 4GOPA 4DPGA 1RIPA 4LFCQ 1PH1A 3E0EA 1MJCA 4IJLA 1CKOA 1GM5A 1QVFA 1QVGA 2NN6I 4C3IH 5FLMG 3HKSA 1UE7A 3PO2G 2CKZB 2ODGC 3PCOB 3CCLA 3A5ZB 4IOCA 2E2HH 1VQ4A 1SN8A 2OTLA 4P74A 1CKNB 4A3BH 3AFPA 5FLMH 3I4NH 1I50H 1TWFH 4LFBQ 1Q7YC 3PIPA 4UPAA 4AIMA 4XIGS 3K81C 1AE3A 1CKNA 1QVCA 2ODCI 1Q1BA 4NPSA 4LF4L 3CCUA 4B3SQ 3PF4A 4DR7L 1KXLA 4GLXA 4L5QA 4O2DA 3PSIA 1PH6A 1VQJA 2AWOA 3PV0A 3BU2A 1VQGA 4HIDA 5M5XH 2ZJRA 1GKHA 4A3DG 2UXBQ 1YHAA 2JEBI 5E7NA 1VQMA 1X54A 4L5TA 2AMCB 3WWVA 1VQKA 4JI1Q 2JA7H 1HZAA 1BBWA 1CSPA 3SGIA 3B6YA 1X3GA 4JYAQ 1EOVA 4LF9L 2CQOA 2NN6G 2JJQA 4A3DH 2CWAA 3ZJYC 4DV2L 1VQEA 1I5FA 1Q81C 2I5MX 3G48A 4OWXB 2I0QA 4X64Q 5DLQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 L;  4A3K G;  3FHW A;  3ULJ A;  4YY3 L;  2QA4 A;  1K73 C;  3K8A A;  4GNX B;  4DR2 L;  4JI7 L;  3EBE A;  3K80 C;  3CW2 C;  4X62 Q;  3ICE A;  3S1Q H;  4BY7 G;  1UE5 A;  4QGU A;  3T1H L;  1I6H H;  1XNR Q;  4KHP Q;  4DR5 Q;  1WCM H;  5M3F G;  3I7F A;  3A0J A;  2JA8 H;  4GNX A;  1PH2 A;  4DUY Q;  3J81 j;  4JI4 L;  1Q86 C;  1V1Q A;  3CPW A;  1B7Y B;  1I3Q H;  2V1C C;  2UXD L;  4JG2 A;  4JCV E;  4HJ5 A;  4LF6 L;  1IXR A;  3HOV G;  4GOP C;  3M9B A;  1L2F A;  2A8V A;  4NXM L;  4AYB G;  1E7Z A;  1NTG A;  2CWP A;  3UDI A;  4JI0 L;  4OX9 L;  2UUB L;  3TRZ A;  4DV0 Q;  1U0L A;  2QNF A;  4A3E G;  5IYB H;  1PHJ A;  1OTC A;  3HOZ G;  4K0K L;  4IFD J;  4LUV A;  4PZ8 A;  2VNU D;  2WFW A;  1NBW A;  1UEB A;  3KLW A;  4FDB A;  3NEM A;  3CME A;  4UP9 A;  4DV5 Q;  1YBY A;  1YJ9 A;  2ATW A;  4A3E H;  3TS2 A;  1YEZ A;  1JT8 A;  2GN5 A;  3VDY A;  3M7N A;  5C0X J;  1E1O A;  3RLN A;  4BBR G;  2XTI A;  3CC2 A;  3A5U A;  1SE8 A;  1PH8 A;  4IPC A;  2VQE L;  1KL9 A;  1HZB A;  1X3E A;  1Z9F A;  2IX1 A;  1XMO L;  2IY5 B;  3PGZ A;  3CXC A;  2UXC L;  1XTD A;  3GO5 A;  1IBL L;  5IWA L;  1E7D A;  1QUQ B;  1IL2 A;  2HJQ A;  3I4O A;  3S15 H;  4AQY L;  3UDG A;  3JAM i;  1ASZ A;  2BH8 A;  2EQS A;  1EN7 A;  4H02 A;  4DV4 L;  2UU9 L;  1QUQ A;  1YIT A;  2JA6 G;  4GS3 A;  4A75 A;  5FJ8 H;  1TXY A;  1MKH A;  3STB C;  2ZJQ A;  2Z0S A;  1LYL A;  1GD7 A;  1SLJ A;  1PH9 A;  3Q8D A;  1UE1 A;  1PA6 A;  4A93 G;  4DKA C;  3MEF A;  4DAM A;  1YNX A;  2K4K A;  3KF6 B;  2N8N A;  1SRO A;  4QL5 A;  4LF4 Q;  4A3F H;  4BBS G;  4DR7 Q;  1YVC A;  1VCI A;  1A8V A;  1KRT A;  3F2D A;  1I94 Q;  4OO1 I;  2VY3 A;  4JI2 Q;  1HR0 L;  3KF6 A;  2R6G A;  2B63 G;  4A93 H;  3KYH C;  4B3M L;  2R7D A;  4DK6 C;  4DV6 L;  4RG1 A;  4BBS H;  2OTJ A;  4P75 A;  2WB1 G;  2K50 A;  3U50 C;  5IYC G;  1YJW A;  1X55 A;  5IYD H;  4LF9 Q;  4A76 A;  4DV3 L;  3GTK H;  4GKK Q;  2NZO A;  2XGT A;  3OYY A;  4OON A;  4P71 A;  4DV2 Q;  1EYG A;  2NVQ H;  2A1A A;  2FXQ A;  4IOA A;  4LWC A;  1KRS A;  1L0W A;  1G6P A;  3TQY A;  3J81 i;  4HJ8 A;  2E2J H;  3U4Z A;  4JBJ A;  4YY3 Q;  1AE2 A;  4TQU S;  3CAM A;  4A3B G;  4BA2 I;  1BBU A;  1YHB A;  4YCW A;  4DR2 Q;  4JI7 Q;  4LFA L;  4PZ6 A;  3HOW H;  1WI5 A;  1SRU A;  3T1H Q;  1O7I A;  1EWI A;  2YTV A;  1OXU A;  2VS1 A;  2ZTC A;  5ELO A;  3TEH B;  3UE1 A;  4OWT B;  4J15 A;  4C3J H;  2R92 H;  1X9N A;  3HOU H;  3I4N G;  3I4M H;  3S17 H;  4GKJ L;  2K5N A;  1D7Q A;  5HGQ A;  4JI4 Q;  2YYZ A;  1E3P A;  1TWA H;  4OO1 G;  3OTO L;  5LMN W;  2PMZ E;  4YCU A;  3J7Z C;  3U58 A;  1NJI C;  4LF6 Q;  2UXD Q;  5AJ3 L;  3AEV A;  4GN5 A;  2OWO A;  4NXM Q;  2E5L Q;  5C4X H;  3CC4 A;  3KFU A;  4BY1 H;  1C9O A;  2UUB Q;  4OX9 Q;  3PF5 A;  2R93 H;  5IP7 H;  2ID0 A;  2N3S A;  2JA7 G;  5IE8 A;  5HY6 A;  2F4V L;  3GTJ H;  1D8L A;  1EQR A;  1NY4 A;  3E9H A;  1QZG A;  4QJF A;  3S1M H;  1OXT A;  4R4Q A;  1FJG L;  5GRO A;  2Q2U A;  1VQ6 A;  3W5O A;  1X65 A;  2I5H A;  1SMX A;  2VQF L;  2JE6 I;  1EIY B;  4DR4 L;  3PUW A;  1VQD A;  5FLX c;  2BH2 A;  3CF5 A;  1X6O A;  1V43 A;  3PUV A;  5BR8 Q;  3PO3 G;  2RF4 A;  2RHS B;  3PUX A;  3HOX H;  3PUZ A;  1XMO Q;  2K14 A;  4IFD I;  3G4S A;  3HKZ E;  1N34 L;  3JC6 6;  2WB1 E;  1K8A C;  2HHH Q;  1WCM G;  2UXC Q;  5IWA Q;  3KOJ A;  3CCV A;  4IPH A;  2JA8 G;  3PO3 H;  3PO2 H;  1JMC A;  4IJH A;  2OQ0 A;  2Y0S G;  5LMN L;  2NVX H;  4JC0 A;  4YHH L;  4DV4 Q;  2UU9 Q;  5C0X I;  2AHO B;  2CFM A;  3CCR A;  4PG3 A;  1IBK L;  1NMF A;  2DUD A;  3CQZ H;  3NBH B;  5JJK A;  3S2H H;  2UUC L;  1Q8K A;  4C3H H;  2AKW B;  2DGY A;  2Q2H A;  1JE5 A;  5IYB G;  3I55 A;  3RN2 A;  3GTM H;  3AQQ A;  4KI0 A;  4LUZ A;  3OW2 A;  2NZH A;  4HIK A;  1X3F A;  2PNH A;  3LGJ A;  2VW9 A;  3KJO A;  4X66 Q;  3EIV A;  2D62 A;  4B3M Q;  4IFD G;  4UP8 A;  1GO3 E;  1K0R A;  4DV6 Q;  3ULP A;  2KBN A;  2RHQ B;  4AH6 A;  4HJ7 A;  4DV3 Q;  1P16 A;  4BA1 I;  1TWH H;  2CCZ A;  4DR6 L;  2N78 A;  1KHI A;  2B29 A;  1C7Y A;  1HR0 W;  1VQH A;  4WJ3 M;  1JJC B;  4PMW A;  4X6A H;  4HIM A;  1VQO A;  3CC7 A;  3IRB A;  5C0X G;  4HJA A;  4LF5 L;  4DR3 L;  2JEA I;  2IHF A;  2WP8 J;  2R7Z G;  2VL6 A;  1HNZ L;  4POF A;  4JI8 L;  3CMA A;  1LM0 A;  4R1J A;  1Y1W H;  4LFA Q;  2ZM6 L;  2K5V A;  2GVA A;  4JI3 L;  3BZC A;  4X65 L;  2E8G A;  1VQ8 A;  1V9P A;  2ZTD A;  5FJ8 G;  5M3M H;  4GKJ Q;  1Q82 C;  5C3E H;  4R4T A;  4A3I G;  2R7Z H;  5JEA J;  2L15 A;  4JBW A;  4JOI A;  4NXN L;  1UWV A;  3CP0 A;  1PYB A;  1WJJ A;  4BXX H;  1TWC H;  2UXB L;  3PUY A;  4RMF A;  3OTO Q;  3CCJ A;  1MJE A;  4QQB X;  1ASY A;  4A3F G;  3M4O H;  5AJ3 Q;  5K36 G;  4L5S A;  2Y0S E;  3D31 A;  1VQI A;  3MXN B;  4DV1 L;  4A3I H;  2K52 A;  4LF8 L;  1E7L A;  4OWW B;  1NE3 A;  1H95 A;  3T1Y L;  2JA5 G;  1N8R C;  4R4C A;  2ZJP A;  5IY0 A;  1XNQ L;  1XPU A;  3HFZ B;  1OXX K;  4YCV A;  4DR1 L;  2F4V Q;  4DV7 L;  5IYD G;  4KLK A;  5GQO A;  1W2B A;  1T9H A;  2VUM H;  5J3B A;  3S1R H;  5GAG C;  1YI2 A;  3F1Z A;  2JA5 H;  1K3R A;  2VZA A;  3D0F A;  2N49 A;  3W1B A;  4X62 L;  1U5K A;  3M4Q A;  1EUJ A;  2ZTE A;  2VQF Q;  4GNX C;  1XMQ L;  2KCT A;  1G51 A;  2B3G A;  2IHE A;  4P72 A;  2HIV A;  4AYB E;  3AFQ A;  1PV4 A;  4B3R L;  2Z6K A;  4DUY L;  3PIO A;  3HOW G;  1VQ9 A;  1N34 Q;  3I2Z A;  1XJV A;  1VQC A;  3A74 A;  5GAE C;  1VQP A;  4JV5 Q;  3H0G H;  2R92 G;  2GVB A;  4ME3 A;  1S72 A;  3I4M G;  4A3C H;  5EAY A;  3HOU G;  3S24 A;  2JA9 A;  3H15 A;  3RZD H;  3CCQ A;  5LMN Q;  1E1T A;  3K0X A;  3JAM c;  1K8G A;  3KJP A;  3RN5 A;  4A3M H;  4GKK L;  1SFO H;  4LF7 L;  1Q46 A;  2I5L X;  4DUZ L;  1IBK Q;  3UDX A;  1IBM L;  3ERS X;  2MO0 A;  4UY8 C;  3K7U C;  4JI5 L;  2UUC Q;  2RCN A;  3TRE A;  3F2B A;  3I56 A;  2ASB A;  5C4X G;  4YWL A;  2JQO A;  4BY1 G;  4P73 A;  2KEN A;  2R93 G;  4JI6 L;  5IP7 G;  5C44 H;  4APV A;  1EQQ A;  3HOY H;  1CUK A;  3GD7 A;  3W1G A;  2D0P A;  1KAW A;  3CCE A;  2PQA B;  4JI0 Q;  1VQN A;  1K9M C;  2LXJ A;  1QZH A;  4K0K Q;  3GTP H;  3G71 A;  1LTL A;  4JOI C;  2R7F A;  3CCS A;  3K7A H;  1WYD A;  2PQA A;  1J6Q A;  2KHI A;  4GN4 B;  1UE6 A;  4O0A A;  5IP9 H;  2UUA L;  3FKI H;  3NEL A;  1L1O B;  1N36 L;  3HOX G;  4HJ9 A;  4DR6 Q;  4A3L G;  1TWG H;  4NB3 A;  1L1O A;  4LF5 Q;  4DR3 Q;  2YU9 H;  3J81 c;  2VQE Q;  4QY7 A;  1HNX L;  4C2M H;  1A63 A;  1VQB A;  1PH3 A;  1VQA A;  3RLO A;  4JI8 Q;  1HNZ Q;  3UDF A;  2ES2 A;  2IT1 A;  4A3J G;  1SR3 A;  2ZM6 Q;  3CCM A;  4A3L H;  4JI3 Q;  4X65 Q;  1IBL Q;  3DLL A;  1J5E L;  2BA0 A;  1A0I A;  4XTC S;  2KHJ A;  4AQY Q;  1S3O A;  1BKB A;  1XPR A;  4NXN Q;  4HIO A;  1I94 L;  4GLA C;  1PVO A;  4A3J H;  2F3I A;  3ER0 A;  4JI2 L;  3S14 H;  5LMU L;  3NEN A;  2YTY A;  3RNU A;  4IPG A;  2K75 A;  2Z6K C;  4LNQ A;  2MO1 A;  1LUZ A;  3H3V I;  1HNW L;  1S40 A;  3J7A 5;  4DV1 Q;  2A19 A;  1CKM A;  1OXS C;  1M1K C;  4LF8 Q;  2LSS A;  3BJU A;  4EQ5 A;  1VQ7 A;  2E2I H;  1N32 L;  1IYJ B;  3T1Y Q;  2MQH A;  3J80 c;  1WFQ A;  4B3T L;  1XNQ Q;  4YWK A;  1VQ5 A;  4DR1 Q;  4DV7 Q;  4WJ4 A;  1VQL A;  1N33 L;  3TS0 A;  3S1N H;  2HT1 A;  1FL0 A;  5M5Y H;  2F52 A;  1HR0 Q;  3RZO H;  1PYS B;  3DM3 A;  1HZC A;  5ELN A;  4LUO A;  1XMQ Q;  2NVT H;  2LXK A;  1EIF A;  4LFC L;  3GTQ H;  3FP9 A;  2EXD A;  1N9W A;  2PI2 E;  4MNO A;  1G29 1;  4A3K H;  2YV5 A;  3GTL H;  1AH9 A;  2EIF A;  2IX0 A;  1KD1 C;  1FGU A;  1YJN A;  4DAY B;  4B3R Q;  3ULL A;  1Y1W G;  4L5R C;  4BY7 H;  1PH4 A;  1Z47 A;  1JJ2 A;  1GVP A;  2Q2I A;  3CPF A;  4A4I A;  1KIX A;  1A62 A;  1E24 A;  1Y14 B;  5M3M G;  4JBM A;  5M3F H;  5C3E G;  5H1S E;  2WAQ G;  4A3G G;  2KCM A;  4ALP A;  4EX5 A;  1Q1E A;  4LFB L;  4GN3 B;  3F2C A;  4YWM A;  3F8T A;  3M4P A;  2E5L L;  4BXX G;  2NVY H;  1BVS A;  1R9T H;  1PFS A;  2HQL A;  1EFW A;  4LW1 A;  4DUZ Q;  4GLV B;  1IBM Q;  4B3S L;  4LF7 Q;  3HOV H;  3H3V H;  4A3G H;  1VQF A;  2BA1 A;  4QIW E;  4JI5 Q;  5JEA G;  1HZ9 A;  1L1O C;  5GAD C;  4MTN A;  4JI6 Q;  2OQK A;  1YIJ A;  1KQS A;  3S2D H;  4JI1 L;  2PI2 A;  2K5H A;  3HOZ H;  1XPO A;  1E22 A;  4MZ9 A;  4JYA L;  3RLF A;  1W3S A;  4Y52 H;  2JK8 A;  5BR8 L;  2VUM G;  1RL2 A;  1CSQ A;  3KF8 B;  3GDE A;  3RR5 A;  4X64 L;  1X56 A;  1B8A A;  3U4V A;  2HHH L;  1PH7 A;  3KDF B;  4BBR H;  2UUA Q;  4PZ7 A;  3L7Z C;  2QEX A;  1FJG Q;  2YTX A;  1N36 Q;  3AYH B;  1C0A A;  3E9I A;  3J80 i;  4DR4 Q;  3GTO H;  3H0G G;  2H5X A;  3KDF A;  1JB7 A;  1XNR L;  5IT9 c;  4DR5 L;  4A3C G;  4Y7N H;  4KHP L;  5JJI A;  1YHQ A;  5M5W H;  2QNC A;  2D0O A;  2QGQ A;  1YZ6 A;  4DNI A;  1HNX Q;  3CD6 A;  3GTG H;  4A3M G;  1K83 H;  1J5E Q;  2JA6 H;  3L0O A;  1WOC A;  5C4J H;  5JJL A;  2OCE A;  1FVI A;  1DGS A;  1NMG A;  1OXV A;  4X66 L;  1P8L A;  4YHH Q;  4IPD A;  5LMU Q;  4DV0 L;  1HJP A;  5C44 G;  2HIX A;  1Y1V G;  2WAQ E;  3STB D;  3EN2 A;  2AWN A;  3HKZ G;  4DK3 C;  2MNA A;  3M85 A;  3HOY G;  4OXP A;  4TVA B;  1HNW Q;  2ALY B;  4KHZ A;  3S16 H;  3G6E A;  4UP7 A;  1B70 B;  4IO9 A;  3L2P A;  2MFI A;  3M3Y H;  4DV5 L;  1N32 Q;  1JJG A;  4B3T Q;  2B63 H;  1Y1V H;  4GOP B;  4R4I A;  3UE0 A;  5GAH C;  3BZK A;  4JBK A;  1IZ6 A;  4R4O A;  5IP9 G;  1Q12 A;  5IYC H;  2Q2T A;  1N33 Q;  3FKI G;  1VS0 A;  1KC8 C;  4POG A;  1MIU A;  2C35 B;  1M90 C;  1HH2 P;  1PH5 A;  4GOP A;  4DPG A;  1RIP A;  4LFC Q;  1PH1 A;  3E0E A;  1MJC A;  4IJL A;  1CKO A;  1GM5 A;  1QVF A;  1QVG A;  2NN6 I;  4C3I H;  5FLM G;  3HKS A;  1UE7 A;  3PO2 G;  2CKZ B;  3PCO B;  3CCL A;  3A5Z B;  4IOC A;  2E2H H;  1VQ4 A;  1SN8 A;  2OTL A;  4P74 A;  1CKN B;  4A3B H;  3AFP A;  5FLM H;  3I4N H;  1I50 H;  1TWF H;  4LFB Q;  1Q7Y C;  3PIP A;  4UPA A;  4AIM A;  4XIG S;  3K81 C;  1AE3 A;  1CKN A;  1QVC A;  1Q1B A;  4NPS A;  4LF4 L;  3CCU A;  4B3S Q;  3PF4 A;  4DR7 L;  1KXL A;  4GLX A;  4L5Q A;  4O2D A;  3PSI A;  1PH6 A;  1VQJ A;  2AWO A;  3PV0 A;  3BU2 A;  1VQG A;  4HID A;  5M5X H;  2ZJR A;  1GKH A;  4A3D G;  2UXB Q;  1YHA A;  2JEB I;  5E7N A;  1VQM A;  1X54 A;  4L5T A;  2AMC B;  3WWV A;  1VQK A;  4JI1 Q;  2JA7 H;  1HZA A;  1BBW A;  1CSP A;  3SGI A;  3B6Y A;  1X3G A;  4JYA Q;  1EOV A;  4LF9 L;  2CQO A;  2NN6 G;  2JJQ A;  4A3D H;  2CWA A;  3ZJY C;  4DV2 L;  1VQE A;  1I5F A;  1Q81 C;  2I5M X;  3G48 A;  4OWX B;  2I0Q A;  4X64 Q;  5DLQ E; 
#chains in the Genus database with same CATH topology
 3FHW A;  3RMH A;  3TME A;  3ULJ A;  5A2Q E;  2C9O A;  1EYD A;  1J9O A;  1DOL A;  3EBE A;  3CW2 C;  2KVU A;  1BUV T;  2QF7 A;  1UE5 A;  4C3J B;  5TSS A;  4KHP Q;  5M3F G;  2TSS A;  3J81 j;  2QDB A;  1B7Y B;  5FLX E;  1I3Q H;  5DM6 3;  1EU4 A;  1QG7 A;  2F0M A;  4JG2 A;  4NP5 A;  1JEI A;  4IUV A;  2EJG C;  4EGV A;  2R93 B;  1CQF A;  4PMB A;  2UUB L;  2QNF A;  1ZXT A;  5IYB H;  3S1M B;  1YNS A;  2EYO A;  2WFW A;  1FYC A;  2J7Z A;  1HFN A;  4I65 A;  4UP9 A;  1TWG B;  5LHY 1;  1DON A;  4IFD H;  3M7N A;  2RA4 A;  4NDX A;  3RLN A;  5C0X J;  1BCP C;  3A5U A;  4RAU C;  4FNF A;  3MA2 B;  4FP5 D;  3PGZ A;  3VR5 A;  1PTO F;  4XXE A;  3D6W A;  3GO5 A;  2UXC L;  4N8F A;  1Y8P B;  2BH8 A;  4CGY B;  3A8K E;  3H91 A;  3DWQ A;  4DV4 L;  1YIT A;  5CBE E;  2BDN A;  1MSH A;  2JYO A;  1MKH A;  3MWY W;  2ZJQ A;  3DEO A;  3Q8D A;  1YNX A;  3KF6 B;  2HQE A;  2LKV A;  1SAP A;  2MP1 A;  3S1N B;  2LY7 A;  1GHK A;  3F2D A;  1KRT A;  1I94 Q;  3RZO B;  1IYV A;  4JI2 Q;  2NVT B;  2B63 G;  1ILP A;  3QKJ A;  3K0Y A;  4A3K B;  1B9M A;  3EFX D;  4RG1 A;  4BS9 A;  2K50 A;  1X55 A;  2GA4 B;  5IYD H;  1GOZ A;  4A76 A;  1F9Q A;  1H9M A;  4DV2 Q;  3OYY A;  4OON A;  4P71 A;  5G3L F;  1QOH A;  2F1M A;  2FXQ A;  3MXP A;  4LWC A;  4CDD C;  1MBY A;  3ZYY X;  3J81 i;  3VYS A;  2E2J H;  4YY3 Q;  4TQU S;  1YHB A;  3QJY A;  1SRU A;  2V4D A;  1YNJ D;  2VS1 A;  2WAQ B;  2YTV A;  2N55 A;  3I4M H;  1SYF A;  1X9N A;  3HOU H;  3I4N G;  1F2L A;  4JI4 Q;  2E76 C;  3A54 A;  1TWA H;  4OO1 G;  5IGD A;  1NJI C;  1TR5 A;  4ME5 A;  2SOB A;  4NXM Q;  3BDL A;  4BY1 H;  1C9O A;  3FPU B;  3MC0 B;  3PF5 A;  3X3M A;  2ID0 A;  1DZ1 A;  5D3I B;  5HY6 A;  3K5M A;  3E9H A;  1QZG A;  4QMG A;  3JAM E;  3CRK C;  3T4A C;  2NTS A;  4DR4 L;  3PUW A;  5FLX c;  3CF5 A;  2A5H A;  2QEJ C;  2X6L A;  3TZD A;  1YNN D;  3PUX A;  5CV9 A;  3PUZ A;  4H44 C;  5NUC A;  3HOX H;  1XMO Q;  3G4S A;  2RDF A;  1K83 B;  4IFD I;  3JC6 6;  3KLR A;  2SDF A;  1WCM G;  1WTV A;  2B2T A;  5IWA Q;  4IPH A;  2WIN B;  2PZT A;  3BVG A;  3AU7 A;  4IJH A;  2MJ8 A;  2OQ0 A;  3MVV A;  3OWF A;  3NXW A;  5L37 A;  3PQI A;  2K5Q A;  2UU9 Q;  2CQA A;  2AHO B;  1KTK A;  2CFM A;  1EY9 A;  1IBK L;  1M8A A;  2DUD A;  3KLS A;  2UUC L;  4C3H H;  1MHW C;  5KIX A;  1SYD A;  5C44 B;  1Y1V B;  1K28 A;  5C3W A;  2EOT A;  1LT4 D;  2NZH A;  4HIK A;  2PNH A;  4RGM A;  1W6J A;  3TSS A;  3EIV A;  1KDB A;  2D62 A;  1GO3 E;  3TP8 A;  4DV6 Q;  4C3I B;  2EJM A;  3H3V C;  3I3C A;  4DV3 Q;  1TWH H;  2B29 A;  1C7Y A;  2F0O A;  4A3B B;  1NSN S;  1GUO A;  2WP8 J;  1HNZ L;  4N8X 1;  3I70 A;  2GVA A;  4ULL A;  3BZC A;  4ZKB B;  5FJ8 G;  5M3M H;  5C3E H;  3X3N A;  1D5M C;  2L15 A;  4JOI A;  3IL8 A;  5I2Y A;  2UXB L;  3OTO Q;  3CCJ A;  1MJE A;  1U4P A;  2RDG A;  3M4O H;  5K36 G;  1G2S A;  4IUN A;  3MXN B;  2SNS A;  2K52 A;  4A3D B;  5JEA H;  2JA5 G;  1RTO A;  3IFT A;  2ICE C;  1N8R C;  4ID6 A;  4R4C A;  1XPU A;  1GUS A;  2SEB D;  4WRD A;  2F4V Q;  4DV7 L;  4KLK A;  2VUM H;  2K7V A;  3S1Q B;  5J39 A;  2JA5 H;  1F2Z A;  2N49 A;  2VQF Q;  1A3V A;  1B2T A;  3BYY B;  4FF4 A;  1SSO A;  4JVZ A;  2Y0S B;  1YNJ C;  4B3R L;  2OXP A;  3PIO A;  2F0V A;  1VQC A;  1VQP A;  2D9U A;  3SR1 A;  1LLR D;  2GVB A;  4IUQ A;  1A3T A;  3URY A;  4C3J G;  5EAY A;  3I72 A;  1S72 A;  1KAB A;  3T16 A;  3JAM c;  1K8G A;  2LS0 1;  2EYJ A;  5KGU A;  1Q46 A;  1PFB A;  3GV6 A;  4DUZ L;  1IBM L;  2MO0 A;  3SVM A;  2L11 A;  2ASB A;  5IT9 E;  4A3E B;  2FJ2 A;  2R93 G;  4JI6 L;  1RDP D;  2RSN A;  2F0W A;  3GD7 A;  2D0P A;  1VQN A;  1QZH A;  1EYC A;  1LTL A;  1YNN C;  3CCS A;  1F2Y A;  3U9S A;  1NAP A;  1J6Q A;  4O0A A;  3N6R A;  1UE6 A;  3NEL A;  4ODG A;  1N36 L;  1EIH A;  1EOT A;  1TWG H;  1BCP F;  2K03 A;  4LF5 Q;  2LFN A;  1EY5 A;  1A63 A;  3RLO A;  3QIA A;  1PTO D;  3UDF A;  2IT1 A;  1SR3 A;  3H09 A;  3DLL A;  1J5E L;  4G4K A;  4XTC S;  1BKB A;  4NXN Q;  3TZU A;  2WV6 D;  3OWE B;  3NEN A;  3NQT A;  4IPG A;  4LNQ A;  3H3V I;  1LUZ A;  3K5O A;  5FO9 B;  4LF8 Q;  3M3Y B;  2LSS A;  1TS2 A;  2HD3 A;  5E4W C;  3RUZ A;  1WFQ A;  4K5V A;  2R61 A;  1BOS A;  4WJ4 A;  4B9X A;  3S1N H;  5I6W A;  1W6K A;  1NCV A;  2F52 A;  4XQQ A;  3RZO H;  4WJW A;  3DM3 A;  1X3Q A;  1Z7T A;  5ELN A;  2NVT H;  3NPP A;  4LMQ D;  2LXK A;  1EIF A;  1XMQ Q;  1U4L A;  2PI2 E;  4A3K H;  5K5P A;  1PZK D;  1EFI D;  5G3L D;  4NMZ A;  2B2W C;  1YJN A;  3ULL A;  3KBX A;  1SE3 A;  2Q2I A;  1I4P A;  1A62 A;  1BNZ A;  4DAY A;  2WAQ G;  2O4X A;  1Q1E A;  3MXG A;  3F2C A;  3C46 A;  3HGB A;  3F8T A;  4YWM A;  4BXX G;  1QNK A;  1AN8 A;  1X3P A;  2AUK A;  4P2C B;  1STN A;  1VQF A;  3PIO 3;  4JI5 Q;  2EE1 A;  5CIU A;  1PFN A;  2DY8 A;  3OMG A;  1L1O C;  3NE5 B;  4HN7 A;  1YIJ A;  1KQS A;  1AEX A;  2K5H A;  3HOZ H;  1XPO A;  4MZ9 A;  2PPB C;  1ZYR D;  1RL2 A;  1U9R A;  3GDE A;  1TS3 A;  3RR5 A;  2EYP A;  4S3S A;  3BG3 A;  3PO3 B;  2UUA Q;  3ND9 A;  4PZ7 A;  2YTX A;  4QIW B;  3AYH B;  1TVX A;  4Q0F A;  2B2U A;  2P5Z X;  3E9I A;  3V05 A;  4DR4 Q;  2H5X A;  4NKL A;  5IT9 c;  4A3C G;  2BCO A;  4KHP L;  1SYC A;  2K5W A;  1YHQ A;  3DHQ A;  2QNC A;  4DNI A;  1YZ6 A;  1WTQ A;  3Q24 A;  1K83 H;  1UUP A;  3R3O A;  5EGT A;  1D5X C;  4V0B A;  1WOC A;  2N88 A;  1STB A;  2OCE A;  1FVI A;  2DY7 A;  3QO2 A;  4IUP A;  5E4X A;  5LMU Q;  4BWG B;  5C44 G;  1Y1V G;  2A6E D;  2AWN A;  2MNA A;  3M85 A;  4OXP A;  3R93 A;  4XT3 B;  3G6E A;  1SDF A;  3D4D A;  5E1F A;  1Y1V H;  1HPC A;  1XTC D;  4ZUJ A;  3VYR A;  4JBK A;  5IP9 G;  4R4O A;  1Q12 A;  5IYC H;  1N33 Q;  1RF2 D;  1HH2 P;  1VMP A;  4GOP A;  4OL7 A;  1RIP A;  3CHB D;  4LFC Q;  1GM5 A;  4IJL A;  1PTO C;  2R7Z B;  1TY0 A;  2NN6 I;  4C3I H;  5FLM G;  2VB2 X;  3C1F A;  2Z6B A;  1PYW D;  4ZKC B;  3A5Z B;  2H4O A;  2ZXO A;  1BCP B;  2L0C A;  4A3I B;  4A3B H;  3KK7 A;  5FLM H;  1HTL D;  1G8Z D;  1Q7Y C;  2K6A A;  4C1N I;  2ODC I;  4KN7 C;  5I6Y A;  1PTO H;  3PF4 A;  2B8F A;  3PSI A;  1PH6 A;  2B2V C;  2K32 A;  2ZJR A;  4A3D G;  2CW0 D;  2UXB Q;  3J80 E;  5E7N A;  1WTO A;  1VQM A;  1ENA A;  2AMC B;  3WWV A;  4JI1 Q;  4JK1 C;  2JA7 H;  1HZA A;  2F03 A;  1CSP A;  1JE4 A;  2KEE A;  2B8G A;  2F0S A;  3ZJY C;  4CDC C;  4DV2 L;  4G7Z C;  4A3D H;  1MI2 A;  5FK9 C;  4ZLT F;  5DLQ E;  4YY3 L;  1IW7 D;  5I2X A;  1H9R A;  4GNX B;  3K80 C;  3S1Q H;  3I4M B;  3HOU B;  3I7F A;  3EA6 A;  3A0J A;  1B1Z A;  2JA8 H;  4DFA A;  2QW7 A;  1H1J S;  1I6V C;  1TWA B;  4JI4 L;  4JW0 A;  3QWN A;  1GUN A;  3N52 A;  4JCV E;  4C56 C;  4HJ5 A;  3HOY B;  4CJ0 B;  1STY A;  2ICI A;  4RHS A;  4BY1 B;  4NXM L;  2KVD A;  1E7Z A;  2CWP A;  3UDI A;  4JI0 L;  1ZYR C;  3GTP B;  4HMJ A;  4A3E G;  1GHJ A;  2DK4 A;  1LTT D;  2VNU D;  4O42 A;  3SK8 A;  4DV5 Q;  1JCK B;  1EIG A;  1HQM C;  4A3E H;  2C5C A;  2GN5 A;  3CC2 A;  4BBR G;  4CHT B;  4IZ8 A;  4C2M B;  2TMP A;  4KV6 A;  2IX1 A;  1X3E A;  1Z9F A;  1XMO L;  5IIF A;  1SE4 A;  3CXC A;  1I4R A;  5IWA L;  1QUQ B;  2PW5 A;  4KHV A;  1LT6 D;  5IOD A;  4AQY L;  4A3J B;  5IGF A;  3UDG A;  1ASZ A;  2EQS A;  2F0U A;  1A15 A;  3SDZ A;  2UU9 L;  3O13 A;  1SNQ A;  5I9O A;  4A75 A;  4C3H B;  1GKU B;  1E0B A;  2A6E C;  1FNU A;  1GD7 A;  1SLJ A;  4RFB A;  2X6G A;  1HUM A;  1UE1 A;  1PA6 A;  4QL5 A;  4F88 A;  4LF4 Q;  3CKI B;  3EVQ A;  3MXN A;  4DR7 Q;  1RHP A;  1A8V A;  1C8C A;  2QKI C;  1MGS A;  4J1M A;  2NWG A;  3T13 A;  1ZBH A;  4DV6 L;  5JVH 3;  1EYA A;  3E0J A;  4V19 0;  1DXM A;  3DXJ C;  2RKS A;  4DV3 L;  4BY7 B;  4X3K A;  3GTK H;  4PMC A;  2NZO A;  5FKA C;  4IOA A;  1QCB D;  4HJ8 A;  1STH A;  1WD0 A;  5J1Z A;  1AE2 A;  2XN9 C;  1ROD A;  4DR2 Q;  4YCW A;  3HOW H;  2NVY B;  5M3M B;  1OXU A;  3J80 c;  1LTR D;  2ZTC A;  3TEH B;  5COR A;  3S17 H;  1SXT A;  2EPB A;  5HGQ A;  2ZT9 C;  1I4H A;  4CKC A;  3BDO A;  2EYF A;  3ND8 A;  1E3P A;  3OTO L;  4K6D A;  3M4O B;  4YCU A;  5M9O A;  4LF6 Q;  5EPK A;  2CW0 C;  3AEV A;  5IGB A;  4GN5 A;  1G2T A;  5ELF A;  4DXF A;  5CC4 A;  3U9O A;  5C4X H;  4OX9 Q;  5IE8 A;  2F4V L;  4QJF A;  1CZW A;  1OXT A;  4R4Q A;  1X65 A;  1IW7 C;  1SMX A;  3DMU A;  2VQF L;  1IKM A;  1VQD A;  2RBM A;  4ZUI A;  1CHQ D;  1X6O A;  3PO3 G;  1TY2 A;  2RF4 A;  2RHS B;  3GTG B;  3BVZ A;  4QF4 A;  2WB1 E;  4DN4 M;  5IGC A;  5C4H A;  4X3T A;  3PO3 H;  3BVM A;  3P75 A;  2O5I C;  2OF1 A;  2KVE A;  4DNT B;  5ELC A;  4L63 B;  3CCR A;  4K5W A;  3NBH B;  3CQZ H;  2DN8 A;  5JJK A;  2G5D A;  3EJI A;  3L9A X;  1Z6H A;  1KLU D;  1KNE A;  5IYB G;  2DGY A;  2G9D A;  2Q2H A;  3HKZ B;  1ML0 D;  3J81 E;  4LUZ A;  3OW2 A;  3LLR A;  3WOF A;  2Q8T A;  2VW9 A;  1CM9 A;  3KJO A;  1SMY D;  1ICF B;  5I9P A;  4B3M Q;  4IFD G;  2RHQ B;  1GJJ A;  1PXU A;  1AP0 A;  5C4Z A;  2N78 A;  2FMC A;  1JJC B;  4HIM A;  1VQO A;  2XIW A;  5KNB A;  3IRB A;  4LF5 L;  1TWF B;  1BBX C;  2R7Z G;  4POF A;  1LM0 A;  2K5V A;  4DF7 A;  2PW7 A;  4DAV A;  4A3I G;  2R7Z H;  4JBW A;  4NXN L;  3HZX A;  2FMM A;  4FYD A;  1CZG A;  1TWC H;  3NWT A;  4RMF A;  3T51 B;  1ASY A;  2QCP X;  2Y0S E;  3D31 A;  5CBA E;  4A3I H;  4LF8 L;  1E7L A;  3DWP A;  1NE3 A;  2A6H D;  2FFK B;  4EQO A;  1JEQ A;  5CGK A;  2ZJP A;  3MZ5 A;  4YCV A;  1ZS9 A;  5IYD G;  4Z9C B;  5GQO A;  1W2B A;  1I6H B;  3D0F A;  4GNX C;  1STA A;  1CT1 D;  1U5K A;  1EUJ A;  2QDL A;  1XMQ L;  2KCT A;  3P20 A;  2HIV A;  3TP7 A;  3K59 A;  3IFD A;  1PV4 A;  3OOC A;  2G80 A;  3V96 A;  1WD1 A;  1TS5 A;  4KTA A;  1VQ9 A;  5GAE C;  2AQ3 B;  3H0G H;  5CV6 A;  4ME3 A;  3I4M G;  2A68 D;  3HOU G;  3R8B A;  4IN3 A;  2L4N A;  2OEO A;  4X3S A;  5EKK A;  3I91 A;  2MPH A;  3CCQ A;  1E1T A;  4A3M H;  2E74 C;  1EQT A;  1L0Y B;  4UY8 C;  3UDX A;  4JI5 L;  2RCN A;  3TRE A;  2F0P A;  3T56 B;  4R9W A;  4BY1 G;  3HOZ B;  2KEN A;  4APV A;  3HS0 C;  3HOY H;  2PYK A;  3CCE A;  2PQA B;  4JI0 Q;  3GTP H;  4IQZ A;  4JOI C;  3K7A H;  4GN4 B;  2KHI A;  2UUA L;  3FKI H;  1L1O B;  3HOX G;  4HJ9 A;  1D1K A;  3NWS A;  4NB3 A;  1LTS D;  3DM1 A;  2EDG A;  1B3Q A;  4KN4 C;  3AB9 A;  4QY7 A;  3J81 c;  4C2M H;  1VQB A;  1VQA A;  4JI8 Q;  2ES2 A;  4A3J G;  4JI3 Q;  2DJG C;  2KVM A;  3NK9 A;  4X65 Q;  2RQX A;  4M1U B;  1H9S B;  2BA0 A;  1VF5 C;  1C4Q A;  4AQY Q;  4C3H G;  4R8N A;  4GLA C;  1PVO A;  4A3J H;  3S14 H;  4RGO S;  5LMU L;  1EY0 A;  2F0Q A;  4I7A A;  1GL9 B;  2YTY A;  3RNU A;  1SMY C;  2K75 A;  4DV1 Q;  1OXS C;  5CV7 A;  1M1K C;  3BJU A;  1IYJ B;  1F9R A;  1I4Q A;  1XNQ Q;  2WB1 B;  4YWK A;  3RD4 A;  1VQ5 A;  1S5F D;  2DNC A;  1VQL A;  1N33 L;  3TS0 A;  4DAP A;  1HHV A;  2R92 B;  4LFC L;  4L5R C;  4ZQ3 A;  4BY7 H;  1PH4 A;  1JJ2 A;  2M9V A;  1KIX A;  5M3M G;  5C3E G;  4HTH A;  2IL8 A;  4KK7 A;  1WTX A;  3M4P A;  2E5L L;  4EQN A;  1PTO B;  2NVY H;  2BDO A;  3GTJ B;  1R9T H;  4FF2 A;  1M4V A;  4LW1 A;  2A6H C;  4GLV B;  5KRU A;  3HOV H;  4U67 3;  3H3V H;  4QIW E;  2Z8L A;  5JEA G;  1D6E C;  4OEL B;  2M2L A;  4DNR B;  2F4I A;  2JA7 B;  3S9W A;  3S2D H;  1HQR D;  2PI2 A;  4JI1 L;  4TRD A;  4RKL A;  5FO8 B;  1W3S A;  2EYM A;  2VUM G;  2NB0 A;  4KKU A;  3MFG A;  3AMU A;  1X56 A;  1B8A A;  1PH7 A;  5C5M A;  3KDF B;  1WTR A;  4DA2 A;  2QEX A;  3FMC A;  2A68 C;  1C0A A;  3GTO H;  1XX8 A;  4IUR A;  3QR8 A;  2JA8 B;  2WKD A;  5JJI A;  2QGQ A;  1QJO A;  1WTP A;  3GTG H;  1A6X A;  2JA6 H;  3L0O A;  5JJL A;  3C1E A;  1V66 A;  1NMG A;  1SYG A;  4X66 L;  1P8L A;  1PLF A;  2IX3 A;  1DD2 A;  1EEF D;  1UAP A;  3STB D;  3EN2 A;  3HKZ G;  1HNW Q;  2ALY B;  1IL8 A;  2K5D A;  1B70 B;  4IO9 A;  3L2P A;  1N32 Q;  4DV5 L;  2O2L D;  5DAU A;  2NBF A;  2RDH A;  2WAC A;  3SE0 A;  4E6I A;  1JJG A;  4R4I A;  3I73 A;  3BZK A;  5F2D A;  1IZ6 A;  5GAH C;  1EY4 A;  1KDC A;  1KC8 C;  1BQQ T;  1M90 C;  4DPG A;  4IUT A;  3WDN A;  1PH1 A;  4ILW A;  1MJC A;  1QVF A;  1D1I A;  1EY7 A;  3LWU A;  2CKZ B;  4B9W A;  4ZYS A;  1F77 A;  3CCL A;  1V1P B;  4IOC A;  5FO7 B;  1VQ4 A;  3PMF A;  2EZV A;  3AFP A;  2K33 A;  2L55 A;  4OHJ A;  1TWF H;  4LFB Q;  4UPA A;  4KY5 A;  1KNA A;  4DGZ A;  3K81 C;  1FD7 D;  1CKN A;  1MSG A;  1PRT F;  1QVC A;  4B08 A;  1Q1B A;  1QE6 A;  4LF4 L;  3CCU A;  1JOO A;  1UEA B;  4B3S Q;  4DR7 L;  4GLX A;  4L5Q A;  2H1E A;  2Q8I B;  1VQJ A;  1EEI D;  5M5X H;  4MHE A;  2JEB I;  4L5T A;  1VQK A;  2J4X A;  1BBW A;  3B6Y A;  1X3G A;  3GTK B;  1VDZ A;  2CQO A;  2NN6 G;  1I5F A;  2I5M X;  4OWX B;  1KLG D;  4X64 Q;  2VXW A;  3SEB A;  4A3K G;  1HA5 A;  2B2Y A;  3HOW B;  2NN6 H;  3SHL A;  1Y02 A;  3K8A A;  4DR2 L;  3E6Z X;  4ABN A;  1I6H H;  3HP3 A;  3S17 B;  4DR5 Q;  2CHB D;  1PH2 A;  5JOB A;  1Q86 C;  1E2V A;  2I07 B;  2V1C C;  3DWA A;  4CKB A;  4LF6 L;  3I4L A;  1IXR A;  4GOP C;  1AZQ A;  2MHV A;  4FVM A;  2CH4 A;  4J6H A;  5C4X B;  5EBD A;  5HGT A;  1TQO A;  4OX9 L;  4XQJ A;  1OTC A;  4IFD J;  1ET9 A;  3HOZ G;  2NYZ D;  4LUV A;  3KLW A;  4TKO B;  3SK5 A;  2M00 A;  3A8J E;  3CME A;  1YJ9 A;  1HXY D;  2ATW A;  3ITP A;  4G57 A;  3TS2 A;  5EBC A;  1L0X B;  4YIJ A;  3VDY A;  2YU9 B;  3D4R A;  1O78 A;  1SNC A;  3PO2 B;  1PH8 A;  2VQE L;  1HZB A;  2IY5 B;  4HMI A;  1E2W A;  3E5S A;  3LNN A;  1XTD A;  3WOE A;  2HDM A;  1CI3 M;  5T1I A;  5C0X H;  5DEH A;  1IL2 A;  1HRJ A;  2HJQ A;  1B44 D;  1EN7 A;  4H02 A;  1TKW B;  1V8Q A;  3K5L A;  3CQZ B;  3H94 A;  5DM7 3;  1SBB B;  1JJR A;  1TXY A;  4H0L C;  2E2I B;  3STB C;  2Z0S A;  2CVR A;  1LYL A;  4F7X A;  3MEF A;  4DAM A;  2K4K A;  2FIN B;  4HSP A;  4A3F H;  1YVC A;  2VY3 A;  1HR0 L;  3KF6 A;  4ZCK A;  2E2D C;  3IAY A;  3GTQ B;  4B3M L;  3K57 A;  2VB3 X;  4DK6 C;  4KKS A;  4P75 A;  2WB1 G;  3U50 C;  5IYC G;  4OIK A;  4LF9 Q;  3MEH A;  4GKK Q;  2XGT A;  2KFV A;  2F0G A;  2A1A A;  3NTI A;  5M3F B;  1KRS A;  4C3I G;  2LMC B;  4JBJ A;  2HCI A;  2HCC A;  3FPP A;  4BA2 I;  4JI7 Q;  1WI5 A;  1O7Z A;  4IAL A;  3T1H Q;  3BZD B;  1EWI A;  4A3B G;  2R92 H;  4J15 A;  1D7Q A;  1TWC B;  3MXU A;  4F87 A;  2YYZ A;  1VF7 A;  5LMN W;  3J7Z C;  2UXD Q;  2B2W A;  4O1N A;  2E5L Q;  2L9H A;  3CC4 A;  3KFU A;  1H9E A;  5IP7 H;  3GQB A;  2N3S A;  2JA7 G;  3GTJ H;  1D8L A;  1NY4 A;  2R3Z A;  1FJG L;  1XXG A;  5GRO A;  2Q2U A;  2KHS A;  3P7J A;  3W5O A;  4Y7N B;  1Y8N B;  2BH2 A;  2PMZ B;  1G91 A;  1BXT A;  5M5W B;  4MN3 A;  3H0G B;  3HKZ E;  1F2M A;  1PMR A;  3KOJ A;  3VA5 A;  4HSV A;  5C4J B;  2JA8 G;  1JMC A;  2Y0S G;  4A3M B;  4L8J A;  5C0X I;  4FF3 A;  3S16 B;  5KYL A;  3SK6 A;  2L1B A;  4M8A A;  1ILQ A;  2F0J A;  2JP1 A;  1Q8K A;  1EWC A;  2AKW B;  1JE5 A;  3I55 A;  5IT9 L;  3GTM H;  3LWE A;  2KCC A;  2F0D A;  4X66 Q;  4CJ2 C;  1B9N A;  3K7A B;  1K0R A;  2KBN A;  3FKI B;  1K3B C;  4HJ7 A;  1P16 A;  4BA1 I;  2CCZ A;  1GUW A;  4HED A;  4X6A H;  1ET6 A;  1HR0 W;  1VQH A;  4PMW A;  1H9K A;  1A2T A;  1SND A;  3CC7 A;  1XWE A;  3I4N B;  1I50 B;  2VL6 A;  1CQV A;  4JI8 L;  1Y1W H;  4R1J A;  2F0F A;  4LFA Q;  4JI3 L;  4X65 L;  2E8G A;  4C1N K;  1VQ8 A;  1NR2 A;  2ZTD A;  4GKJ Q;  1Q82 C;  2F0L A;  3S14 B;  5JEA J;  1BDO A;  3CP0 A;  1WJJ A;  3PUY A;  1JWM D;  1A2U A;  5AJ3 Q;  4L5S A;  4DV1 L;  1PDQ A;  4U68 A;  1PRT D;  3MFY A;  5IY0 A;  1XNQ L;  1GJX A;  1R4P B;  2Z9H A;  5JPN C;  2LC3 A;  1LTI D;  2DJF C;  5GAG C;  3KUP A;  3F1Z A;  1YI2 A;  1K3R A;  3W1B A;  4X62 L;  3M4Q A;  2B3G A;  1JB3 A;  2PZU A;  2Z6K A;  4DUY L;  3HOW G;  3KLS X;  4K14 A;  1N34 Q;  3I2Z A;  2XRS D;  1XJV A;  1TU2 B;  5COY A;  4CJ1 B;  1CFM A;  3Q6S A;  3NQI A;  2F0N A;  3Q0A A;  3S24 A;  3H15 A;  1HCZ A;  5LMN Q;  3K0X A;  4PV1 C;  1R9T B;  3A56 A;  3J7A V;  3HOV B;  1HUN A;  1FR3 A;  2I5L X;  4RA8 A;  3ERS X;  4AYB B;  3QG1 A;  3F2B A;  5C4X G;  4WOR A;  3M7G A;  3MTS A;  4P73 A;  3S2D B;  3VR4 A;  1RTN A;  4RH6 A;  3D8G A;  1II3 A;  3E3X A;  4LAA A;  1CUK A;  3W1G A;  5ELB A;  2JXM B;  3FLG A;  4QCL A;  3DEP A;  2AQ1 B;  1K9M C;  2KQ3 A;  3A7A B;  2LXJ A;  1MD2 D;  5LL6 X;  3G71 A;  1WYD A;  3EQL C;  3S15 B;  2Z4I A;  4DR6 Q;  3GTO B;  3HG9 A;  1Y8O B;  4A3L G;  1JR0 D;  5DNF A;  1VMC A;  4DR3 Q;  2F3V A;  2YU9 H;  1JIC A;  2VQE Q;  3PO2 H;  2EYH A;  1S4Z A;  3TP6 A;  2RNO A;  2ZM6 Q;  4A3L H;  2JA6 B;  2KA7 A;  3TN2 A;  4JPB W;  4HIO A;  3QB3 A;  3ER0 A;  4KD3 A;  4A93 B;  1O80 A;  4BBS B;  1TII D;  4FO2 A;  4EVO A;  1HNW L;  1S40 A;  3J7A 5;  2A19 A;  1CKM A;  4UAI A;  1J8I A;  2NVQ B;  1VQ7 A;  2E2I H;  1N32 L;  3T1Y Q;  3NTH A;  4DR1 Q;  1XYI A;  3SXH A;  4BIT A;  1FL0 A;  1FNV A;  1LV9 A;  5M5Y H;  1HR0 Q;  2PCF B;  1O7L A;  1IHZ A;  1LT3 D;  4LUO A;  3GTQ H;  3FP9 A;  1N9W A;  1SEB D;  1AH9 A;  2YV5 A;  2OT2 A;  2EIF A;  1FGU A;  4DAY B;  4CKE A;  2F0H A;  1E24 A;  1Y14 B;  4K8I A;  4JBM A;  5M3F H;  2KCM A;  3OW7 A;  4EX5 A;  2RNN A;  2KCN A;  5IGG A;  4LFB L;  4GN3 B;  1GUG A;  1E2Z A;  4OIJ A;  1BVS A;  1PRT C;  4B3S L;  4LF7 Q;  5M5X B;  4KJO A;  4XDX A;  4MTK A;  5GAD C;  4MTN A;  4UHV A;  1F9P A;  2OQK A;  3J80 L;  1I4G A;  1Q3L A;  3RLF A;  1TS4 A;  2JK8 A;  5BR8 L;  2B2T C;  1ZKO A;  3KF8 B;  1JOQ A;  4X64 L;  2HHH L;  3U4V A;  1C48 A;  1FJG Q;  2NVX B;  3H0G G;  1JB7 A;  4DR5 L;  4Y7N H;  1AW7 A;  2A74 C;  3S2H B;  5CV4 A;  3TP5 A;  5M5W H;  2KJX A;  2D0O A;  1HNX Q;  3CD6 A;  2G9H D;  3DUZ A;  4QUF A;  4RCN A;  2MPM A;  3TBI B;  4A3M G;  1R4Q B;  1CA5 A;  1HA6 A;  5C4J H;  1AZP A;  1QB5 D;  2MUY A;  4X3U A;  4WFN 3;  1DGS A;  2HIX A;  2PQE A;  3HOY G;  4TVA B;  3S16 H;  2XNA C;  4L6T B;  2MFI A;  4KKT A;  4B3T Q;  5JVG 3;  2B63 H;  4GOP B;  3D3R A;  2Q2T A;  1JOK A;  3FKI G;  2C35 B;  3BYT B;  2XWB B;  1PH5 A;  1K8O A;  1CKO A;  1QVG A;  2EXZ A;  2K01 A;  3HKS A;  3PCO B;  1V1O A;  3A7L A;  1EY8 A;  2E2H H;  1SN8 A;  5IGE A;  4P74 A;  1SNP A;  2PO4 A;  3I4N H;  1I50 H;  2RVL A;  1LTB D;  3PIP A;  4G7O C;  5D65 A;  3R2I A;  3VR3 A;  4XQN A;  4OO1 H;  4A3F B;  4N9T A;  1KXL A;  4O2D A;  5EJW A;  3S1R B;  3PV0 A;  3BU2 A;  4HID A;  1GKH A;  1KDA A;  1YHA A;  1X54 A;  1PZI D;  4OGQ C;  3I90 A;  4JYA Q;  5CMD A;  4HCS A;  1EOV A;  4LF9 L;  5D14 A;  4GKK L;  3G7L A;  1D5Z C;  4JV5 L;  4RKB A;  2EY6 A;  2RSO A;  2ZXP A;  2QA4 A;  3RZD B;  1K73 C;  5JPM C;  5EKL A;  4JI7 L;  4BY7 G;  2KOL A;  3ICE A;  4X62 Q;  4HR7 B;  4QGU A;  3T1H L;  3J7Y W;  1SFO B;  2CH4 W;  1XNR Q;  1DOK A;  1WCM H;  1NR4 A;  3C2P A;  3MAQ A;  4GNX A;  4DUY Q;  2DNE A;  1V1Q A;  3CPW A;  5JJZ A;  5BN3 A;  2UXD L;  3HOV G;  5J22 A;  3M9B A;  4K6L A;  1L2F A;  2A8V A;  1F9S A;  3HEJ A;  4AYB G;  1NTG A;  3TRZ A;  2MGS A;  2EY1 A;  4DV0 Q;  1U0L A;  2ENB A;  1PHJ A;  4K0K L;  5EQ0 A;  4PZ8 A;  1NBW A;  1UEB A;  4FDB A;  5AFW A;  5ISR A;  3NEM A;  5E3F A;  3W3A A;  1YBY A;  1S5D D;  1YEZ A;  1JT8 A;  1DJR D;  1E1O A;  2XTI A;  1SE8 A;  2Z1C A;  4IPC A;  1KL9 A;  5D3D A;  1B4O A;  1A3U A;  1PFM A;  2SNM A;  1NUC A;  5C3X A;  1IBL L;  1E7D A;  1T5E A;  3I4O A;  5A2Q L;  3S15 H;  1EL0 A;  3JAM i;  1QUQ A;  2JA6 G;  3OHX C;  4GS3 A;  4K2K A;  5FJ8 H;  4DU9 A;  1I4X A;  1SYB A;  1CTM A;  3I8Z A;  1DYQ A;  2XSC A;  3FRP B;  2B2Y C;  3QOJ A;  1PH9 A;  3GTM B;  4A93 G;  4DKA C;  3KBG A;  5FLX L;  1KAA A;  3A8I E;  1ICW A;  1SRO A;  2N8N A;  4BBS G;  5K36 H;  1LAB A;  4K5X A;  1VCI A;  3J81 L;  4CBV A;  4OO1 I;  2F0I A;  2R6G A;  4H7B A;  4A93 H;  3KYH C;  3GTL B;  4H13 C;  2R7D A;  4BBS H;  2OTJ A;  1Q90 A;  1YJW A;  3PIP 3;  1CHP D;  4Q5V A;  1EYG A;  2NVQ H;  2RCF A;  4UZW A;  1L0W A;  1G6P A;  3TQY A;  4G7H C;  2KEC A;  3U4Z A;  1Y1W B;  3G6J B;  3CAM A;  3FDT A;  1BBU A;  5CYU A;  4LFA L;  4PZ6 A;  1ESF A;  1O7I A;  4A3G B;  5CV8 A;  3UE1 A;  5ELO A;  4C3J H;  4OWT B;  4GKJ L;  1B50 A;  1ESR A;  4RGN A;  1BR9 A;  3J7A F;  2K5N A;  5CV5 A;  1BF4 A;  4XYQ A;  2PMZ E;  3U58 A;  4FXD A;  5AJ3 L;  4ZK9 B;  2OWO A;  1QWY A;  3K6O A;  4TSS A;  3V2T A;  2UUB Q;  2R93 H;  3NHH A;  1OO9 B;  4BBR B;  2B2U C;  1EQR A;  3S1M H;  2PNR C;  4F8M A;  1VQ6 A;  2I5H A;  2JE6 I;  1EIY B;  3ERQ A;  1FNW A;  2K1B A;  4RGT A;  3PUV A;  1V43 A;  3A55 A;  5BR8 Q;  4LK1 C;  2WII B;  2K14 A;  1QIL A;  1N34 L;  2D5D A;  1K8A C;  2HHH Q;  2UXC Q;  3CCV A;  2D2C C;  1RCV D;  1S5E D;  3D6C A;  5LMN L;  2NVX H;  4JC0 A;  4YHH L;  4DV4 Q;  2XWJ B;  5ELE A;  4PG3 A;  1NMF A;  3MHB A;  3S2H H;  2KUM A;  1EZ8 A;  2B39 A;  1WTW A;  2NUC A;  1DM0 B;  2IPK D;  1GXD C;  3NBH A;  3AQQ A;  3RN2 A;  4KI0 A;  1JQY D;  5HUR A;  1X3F A;  3LGJ A;  4KY7 A;  1IYU A;  5C5L A;  3SK4 A;  1JOR A;  1LTG D;  1IKL A;  5I4D A;  4UP8 A;  3ULP A;  1T5X D;  2K05 A;  4AH6 A;  1CA6 A;  4DR6 L;  2ZXR A;  3JAM L;  1KHI A;  4WJ3 M;  4K8J A;  4ZAI A;  2HUG A;  5C0X G;  4HJA A;  4DR3 L;  4XT1 B;  2JEA I;  3VR6 A;  2BOS A;  2IHF A;  1WTH A;  4PQX A;  3CMA A;  3NP8 A;  2ZM6 L;  2F0K A;  5LL6 S;  4KY6 A;  1V9P A;  4I7Z C;  4R4T A;  3L3O C;  2KW9 A;  1Q8I A;  3NSW A;  1UWV A;  1PYB A;  4UDU C;  5EKI A;  3ONA B;  4BXX H;  4N9P A;  1STE A;  4QQB X;  4A3F G;  2W51 A;  2KED A;  1VQI A;  3OIQ A;  2IJ0 A;  4OWW B;  1H95 A;  3T1Y L;  3NTK A;  1K8M A;  3OPO A;  3HFZ B;  1OXX K;  1ONL A;  3FEW X;  4DR1 L;  2LD7 A;  2JVW A;  5M5Y B;  3KF8 A;  1T9H A;  4K2L A;  5J3B A;  3S1R H;  2VZA A;  2ZTE A;  1G51 A;  2IHE A;  4P72 A;  5IOC A;  4AYB E;  3AFQ A;  1LT5 D;  3IKJ A;  5CR3 A;  5EPJ A;  5KND A;  1I3Q B;  3VYU A;  3A74 A;  2I46 A;  4JV5 Q;  2R92 G;  4A3C H;  1LAC A;  2XVS A;  2JA9 A;  3OMC A;  3K58 A;  2L12 A;  3RZD H;  3C3L A;  3ERO A;  1EWH A;  3KJP A;  3RN5 A;  1SFO H;  4LF7 L;  5T1G A;  1IBK Q;  2WKC A;  2L5T A;  3K7U C;  2UUC Q;  4DK0 A;  4PNY A;  3T53 B;  2A69 D;  4YWL A;  3I56 A;  1SJE D;  2JQO A;  2WQG A;  1H9J A;  5ELD A;  5EPL A;  5IP7 G;  5C44 H;  1JWU D;  3Q22 A;  1EQQ A;  5C6A A;  1KAW A;  1DCZ A;  1PRT B;  4K0K Q;  2R7F A;  1K0S A;  5KEE A;  4KMU C;  2PQA A;  5IP9 H;  1RKN A;  1S5C D;  2Q8R E;  1SNM A;  2J0T D;  1L1O A;  1HFG A;  4OEM B;  1EU3 A;  1HNX L;  1HNZ Q;  1PH3 A;  4NW2 A;  2BE5 D;  4FF1 A;  2EVB A;  3CCM A;  1NNX A;  1U4R A;  2F0T A;  1IBL Q;  1JC7 A;  1A0I A;  5KYI A;  2KHJ A;  1B3A A;  1S3O A;  1XPR A;  3TDQ A;  1I94 L;  3M4Y A;  2F3I A;  5FOB B;  4JI2 L;  2EJF C;  1H9S A;  2F3W A;  3BS1 A;  3FVQ A;  1X32 A;  2Z6K C;  2MO1 A;  4FXG C;  1JWS D;  4HAE A;  4EQ5 A;  2B63 B;  4GZY C;  4QUC A;  2MQH A;  4B3T L;  3Q23 A;  2E2J B;  4HCE A;  3VR2 A;  4LJZ C;  1BO0 A;  1H9F A;  4DV7 Q;  4FXK C;  4KD4 A;  2HT1 A;  2IWH A;  1PYS B;  1HZC A;  3D4W A;  2XRQ D;  2EXD A;  3GTL H;  4MNO A;  1G29 1;  3H6M A;  2IX0 A;  1KD1 C;  3UI2 A;  1ZEQ X;  5A35 A;  4B3R Q;  1Y1W G;  2E2H B;  1Z47 A;  1GVP A;  4A4I A;  3CPF A;  2QIL A;  1SJH D;  4IUU A;  1G6Z A;  4A3G G;  5H1S E;  1LO5 D;  4MIU A;  4ALP A;  2JN4 A;  2EY2 A;  3CRL C;  2PZW A;  1PFS A;  1CK1 A;  2HQL A;  2X69 A;  1EFW A;  4DUZ Q;  1IBM Q;  4A3G H;  2BA1 A;  1HZ9 A;  2HDL A;  2JSO A;  2NZ1 D;  3R2T A;  2O5J C;  4JI6 Q;  1D2B A;  1E22 A;  4JYA L;  5BN5 A;  3CU7 A;  4Y52 H;  3HOX B;  5BN4 A;  1CSQ A;  3QOL A;  2EY5 A;  1U4M A;  4BBR H;  3L7Z C;  1SYE A;  2FHT A;  1N36 Q;  3W2D A;  1S5B D;  1BCP D;  1WCM B;  2B2V A;  3J80 i;  1WVL A;  3KDF A;  5JAV A;  1XNR L;  3VA7 A;  2NTT A;  4J8Q A;  4RCO A;  2A73 B;  3VYT A;  1TT2 A;  2A69 C;  4XYO A;  1Y69 U;  1J5E Q;  2K04 A;  1B53 A;  4DK1 A;  2E75 C;  2IW3 A;  1OXV A;  4YHH Q;  4IPD A;  3K5N A;  4DV0 L;  1HJP A;  2WAQ E;  1GUT A;  4DK3 C;  4KHZ A;  1FGB D;  1TWH B;  4UP7 A;  3NBI A;  3M3Y H;  2Z4H A;  3GP7 A;  4KJN A;  3OIP A;  1RD9 D;  3UE0 A;  1VS0 A;  4POG A;  1MIU A;  3BDC A;  1ENC A;  3OSO A;  1KHC A;  3NUC A;  2BE5 C;  1QNU A;  3E0E A;  1STG A;  4RHR A;  5C3E B;  1EQV A;  2K28 A;  3HRZ C;  1UE7 A;  3PO2 G;  4QB4 A;  2ODG C;  1SNO A;  3LX0 A;  1EY6 A;  3F2U A;  2OTL A;  1EZ6 A;  3GV3 A;  4R8I A;  1CKN B;  4ZRZ A;  1V1P A;  1DOM A;  1O7Y A;  1ENF A;  4CDF C;  4AIM A;  2EYL A;  4XIG S;  4DXG A;  1AE3 A;  1UNS A;  4NPS A;  1HTP A;  4RWS C;  2VUM B;  2AWO A;  1PZJ D;  1VQG A;  2JA5 B;  1AFP A;  4CDE C;  4EQP A;  5KNC A;  3SGI A;  1RJT A;  1SE2 A;  1LTA D;  2JJQ A;  2AQ2 B;  2F0E A;  2CWA A;  2I0Q A;  1VQE A;  3P1H A;  1Q81 C;  3G48 A;  2AUJ D; 
#chains in the Genus database with same CATH homology
 4JV5 L;  4A3K G;  3FHW A;  3ULJ A;  4YY3 L;  2QA4 A;  1K73 C;  1Y02 A;  3K8A A;  4GNX B;  4DR2 L;  4JI7 L;  3EBE A;  3K80 C;  3CW2 C;  4X62 Q;  3ICE A;  3S1Q H;  4BY7 G;  1UE5 A;  4QGU A;  3T1H L;  1I6H H;  1XNR Q;  4KHP Q;  4DR5 Q;  1WCM H;  5M3F G;  3I7F A;  3A0J A;  2JA8 H;  4GNX A;  1PH2 A;  4DUY Q;  3J81 j;  4JI4 L;  1Q86 C;  1V1Q A;  3CPW A;  1B7Y B;  1I3Q H;  2V1C C;  2UXD L;  4JG2 A;  4JCV E;  4HJ5 A;  4LF6 L;  1JEI A;  1IXR A;  3HOV G;  4GOP C;  3M9B A;  1L2F A;  2A8V A;  4NXM L;  4AYB G;  1E7Z A;  1NTG A;  2CWP A;  3UDI A;  4JI0 L;  4OX9 L;  2UUB L;  3TRZ A;  4DV0 Q;  1U0L A;  2QNF A;  4A3E G;  5IYB H;  1PHJ A;  1OTC A;  3HOZ G;  4K0K L;  4IFD J;  2DK4 A;  4LUV A;  1YNS A;  4PZ8 A;  2VNU D;  2WFW A;  1NBW A;  1UEB A;  3KLW A;  4FDB A;  3NEM A;  3CME A;  4UP9 A;  4DV5 Q;  1YBY A;  1YJ9 A;  2ATW A;  4A3E H;  3TS2 A;  1YEZ A;  1JT8 A;  2GN5 A;  3VDY A;  3M7N A;  5C0X J;  1E1O A;  3RLN A;  4BBR G;  2XTI A;  3CC2 A;  3A5U A;  1SE8 A;  1PH8 A;  4IPC A;  2VQE L;  1KL9 A;  1HZB A;  1X3E A;  1Z9F A;  2IX1 A;  1XMO L;  2IY5 B;  3PGZ A;  3CXC A;  2UXC L;  1XTD A;  3GO5 A;  1IBL L;  5IWA L;  1E7D A;  1QUQ B;  1IL2 A;  2HJQ A;  3I4O A;  3S15 H;  4AQY L;  3UDG A;  3JAM i;  1ASZ A;  2BH8 A;  2EQS A;  1EN7 A;  4H02 A;  4DV4 L;  2UU9 L;  1QUQ A;  1YIT A;  2JA6 G;  4GS3 A;  4A75 A;  5FJ8 H;  1TXY A;  1GKU B;  1MKH A;  3STB C;  2ZJQ A;  2Z0S A;  1LYL A;  1GD7 A;  1SLJ A;  1PH9 A;  3Q8D A;  1UE1 A;  1PA6 A;  4A93 G;  4DKA C;  3MEF A;  4DAM A;  1YNX A;  2K4K A;  3KF6 B;  2N8N A;  1SRO A;  4QL5 A;  4LF4 Q;  4A3F H;  4BBS G;  4DR7 Q;  1YVC A;  1VCI A;  1A8V A;  1KRT A;  3F2D A;  1I94 Q;  4OO1 I;  2VY3 A;  4JI2 Q;  1HR0 L;  3KF6 A;  2R6G A;  2B63 G;  4A93 H;  3KYH C;  4B3M L;  2R7D A;  4DK6 C;  4DV6 L;  4RG1 A;  4BBS H;  2OTJ A;  4P75 A;  2WB1 G;  2K50 A;  3U50 C;  5IYC G;  1YJW A;  1X55 A;  5IYD H;  4LF9 Q;  4A76 A;  4DV3 L;  3GTK H;  4GKK Q;  2NZO A;  2XGT A;  3OYY A;  4OON A;  4P71 A;  4DV2 Q;  1EYG A;  2NVQ H;  2KFV A;  2A1A A;  2FXQ A;  4IOA A;  4LWC A;  1KRS A;  1L0W A;  1G6P A;  3TQY A;  3J81 i;  4HJ8 A;  2E2J H;  3U4Z A;  4JBJ A;  4YY3 Q;  1AE2 A;  4TQU S;  3CAM A;  4A3B G;  4BA2 I;  1BBU A;  1YHB A;  4YCW A;  4DR2 Q;  4JI7 Q;  4LFA L;  4PZ6 A;  3HOW H;  1WI5 A;  1SRU A;  3T1H Q;  1O7I A;  2VS1 A;  1EWI A;  1OXU A;  2YTV A;  2ZTC A;  5ELO A;  3TEH B;  3UE1 A;  4OWT B;  4J15 A;  4C3J H;  2R92 H;  1X9N A;  3HOU H;  3I4N G;  3I4M H;  3S17 H;  4GKJ L;  2K5N A;  1D7Q A;  5HGQ A;  4JI4 Q;  2YYZ A;  1E3P A;  1TWA H;  4OO1 G;  3OTO L;  5LMN W;  2PMZ E;  4YCU A;  3J7Z C;  3U58 A;  1NJI C;  4LF6 Q;  2UXD Q;  5AJ3 L;  3AEV A;  4GN5 A;  2OWO A;  4NXM Q;  2E5L Q;  5C4X H;  3CC4 A;  3KFU A;  4BY1 H;  1C9O A;  2UUB Q;  4OX9 Q;  1H9E A;  3PF5 A;  2R93 H;  5IP7 H;  2ID0 A;  2N3S A;  2JA7 G;  5IE8 A;  5HY6 A;  2F4V L;  3GTJ H;  1D8L A;  1EQR A;  1NY4 A;  3E9H A;  1QZG A;  4QJF A;  3S1M H;  1OXT A;  4R4Q A;  1FJG L;  5GRO A;  2Q2U A;  1VQ6 A;  3W5O A;  1X65 A;  2I5H A;  1SMX A;  2VQF L;  2JE6 I;  1EIY B;  4DR4 L;  3PUW A;  1VQD A;  5FLX c;  2BH2 A;  3CF5 A;  1X6O A;  1V43 A;  3PUV A;  5BR8 Q;  3PO3 G;  2RF4 A;  2RHS B;  3PUX A;  3HOX H;  3PUZ A;  1XMO Q;  2K14 A;  4IFD I;  3G4S A;  3HKZ E;  1N34 L;  3JC6 6;  2WB1 E;  1K8A C;  2HHH Q;  1WCM G;  2UXC Q;  5IWA Q;  3KOJ A;  3CCV A;  4IPH A;  2JA8 G;  3PO3 H;  3PO2 H;  1JMC A;  4IJH A;  2OQ0 A;  2Y0S G;  5LMN L;  2NVX H;  4JC0 A;  4YHH L;  4DV4 Q;  2UU9 Q;  5C0X I;  2AHO B;  2CFM A;  3CCR A;  4PG3 A;  1IBK L;  1NMF A;  2DUD A;  3CQZ H;  3NBH B;  5JJK A;  3S2H H;  2UUC L;  1Q8K A;  4C3H H;  2AKW B;  2DGY A;  2Q2H A;  1JE5 A;  5IYB G;  3I55 A;  3RN2 A;  3GTM H;  3AQQ A;  4KI0 A;  4LUZ A;  3OW2 A;  2NZH A;  4HIK A;  1X3F A;  2PNH A;  3LGJ A;  2VW9 A;  3KJO A;  4X66 Q;  3EIV A;  2D62 A;  4B3M Q;  4IFD G;  4UP8 A;  1GO3 E;  1K0R A;  4DV6 Q;  3ULP A;  2KBN A;  2RHQ B;  4AH6 A;  1GJJ A;  4HJ7 A;  4DV3 Q;  1P16 A;  4BA1 I;  1TWH H;  2CCZ A;  4DR6 L;  2N78 A;  1KHI A;  2B29 A;  1C7Y A;  1HR0 W;  1VQH A;  4WJ3 M;  1JJC B;  4PMW A;  4X6A H;  4HIM A;  1VQO A;  3CC7 A;  3IRB A;  5C0X G;  4HJA A;  4LF5 L;  4DR3 L;  2JEA I;  2IHF A;  2WP8 J;  2R7Z G;  2VL6 A;  1HNZ L;  4POF A;  4JI8 L;  3CMA A;  1LM0 A;  4R1J A;  1Y1W H;  4LFA Q;  2ZM6 L;  2K5V A;  2GVA A;  4JI3 L;  3BZC A;  4X65 L;  2E8G A;  1VQ8 A;  1V9P A;  2ZTD A;  5FJ8 G;  5M3M H;  4GKJ Q;  1Q82 C;  5C3E H;  4R4T A;  4A3I G;  2R7Z H;  5JEA J;  2L15 A;  4JBW A;  4JOI A;  4NXN L;  1UWV A;  3CP0 A;  1PYB A;  1WJJ A;  4BXX H;  1TWC H;  2UXB L;  3PUY A;  4RMF A;  3OTO Q;  3CCJ A;  1MJE A;  4QQB X;  1ASY A;  4A3F G;  2W51 A;  5AJ3 Q;  3M4O H;  5K36 G;  4L5S A;  2Y0S E;  3D31 A;  1VQI A;  3MXN B;  4DV1 L;  4A3I H;  2K52 A;  4LF8 L;  1E7L A;  4OWW B;  1NE3 A;  1H95 A;  3T1Y L;  2JA5 G;  1N8R C;  4R4C A;  2ZJP A;  5IY0 A;  1XNQ L;  1XPU A;  3HFZ B;  1OXX K;  4YCV A;  1ZS9 A;  4DR1 L;  2F4V Q;  2LD7 A;  4DV7 L;  2LC3 A;  5IYD G;  4KLK A;  5GQO A;  1W2B A;  1T9H A;  2VUM H;  5J3B A;  3S1R H;  5GAG C;  1YI2 A;  3F1Z A;  2JA5 H;  1K3R A;  2VZA A;  3D0F A;  2N49 A;  3W1B A;  4X62 L;  1U5K A;  3M4Q A;  1EUJ A;  2ZTE A;  2VQF Q;  4GNX C;  1XMQ L;  2KCT A;  1G51 A;  2B3G A;  2IHE A;  4P72 A;  2HIV A;  4AYB E;  3AFQ A;  1PV4 A;  4B3R L;  2Z6K A;  4DUY L;  2G80 A;  3PIO A;  3HOW G;  1VQ9 A;  1N34 Q;  3I2Z A;  1XJV A;  1VQC A;  3A74 A;  5GAE C;  1VQP A;  4JV5 Q;  3H0G H;  2R92 G;  2GVB A;  4ME3 A;  1S72 A;  3I4M G;  4A3C H;  5EAY A;  3HOU G;  3S24 A;  2JA9 A;  3H15 A;  3RZD H;  2MPH A;  3CCQ A;  5LMN Q;  1E1T A;  3K0X A;  3JAM c;  1K8G A;  3KJP A;  3RN5 A;  4A3M H;  4GKK L;  1SFO H;  4LF7 L;  1Q46 A;  2I5L X;  4DUZ L;  1IBK Q;  3UDX A;  1IBM L;  3ERS X;  2MO0 A;  4UY8 C;  3K7U C;  4JI5 L;  2UUC Q;  2RCN A;  3TRE A;  3F2B A;  3I56 A;  2ASB A;  5C4X G;  4YWL A;  2JQO A;  4BY1 G;  4P73 A;  2KEN A;  2R93 G;  4JI6 L;  5IP7 G;  5C44 H;  4APV A;  1EQQ A;  3HOY H;  1CUK A;  3GD7 A;  3W1G A;  2D0P A;  1KAW A;  3CCE A;  2PQA B;  4JI0 Q;  1VQN A;  1K9M C;  2LXJ A;  1QZH A;  4K0K Q;  3GTP H;  3G71 A;  1LTL A;  4JOI C;  2R7F A;  3CCS A;  3K7A H;  1WYD A;  2PQA A;  1J6Q A;  2KHI A;  4GN4 B;  1UE6 A;  4O0A A;  5IP9 H;  2UUA L;  3FKI H;  3NEL A;  1L1O B;  1N36 L;  3HOX G;  4HJ9 A;  4DR6 Q;  4A3L G;  1TWG H;  4NB3 A;  1L1O A;  4LF5 Q;  4DR3 Q;  2YU9 H;  3J81 c;  2VQE Q;  4QY7 A;  1HNX L;  4C2M H;  1A63 A;  1VQB A;  1PH3 A;  1VQA A;  3RLO A;  4JI8 Q;  1HNZ Q;  3UDF A;  2ES2 A;  2IT1 A;  4A3J G;  1SR3 A;  2ZM6 Q;  3CCM A;  4A3L H;  4JI3 Q;  4X65 Q;  1IBL Q;  3DLL A;  1J5E L;  2BA0 A;  1A0I A;  4XTC S;  2KHJ A;  4AQY Q;  1S3O A;  1BKB A;  1XPR A;  4NXN Q;  4HIO A;  1I94 L;  4GLA C;  1PVO A;  4A3J H;  2F3I A;  3ER0 A;  4JI2 L;  3S14 H;  5LMU L;  3NEN A;  1GL9 B;  2YTY A;  3RNU A;  4IPG A;  2K75 A;  2Z6K C;  4LNQ A;  2MO1 A;  1LUZ A;  3H3V I;  1HNW L;  1S40 A;  3J7A 5;  4DV1 Q;  2A19 A;  1CKM A;  1OXS C;  1M1K C;  4LF8 Q;  2LSS A;  3BJU A;  4EQ5 A;  1VQ7 A;  2E2I H;  1N32 L;  1IYJ B;  3T1Y Q;  2MQH A;  3J80 c;  1WFQ A;  4B3T L;  1XNQ Q;  4YWK A;  1VQ5 A;  4DR1 Q;  1H9F A;  4DV7 Q;  4WJ4 A;  1VQL A;  1N33 L;  3TS0 A;  3S1N H;  2HT1 A;  1FL0 A;  5M5Y H;  2F52 A;  1HR0 Q;  3RZO H;  1PYS B;  3DM3 A;  1HZC A;  5ELN A;  4LUO A;  1XMQ Q;  2NVT H;  2LXK A;  1EIF A;  4LFC L;  3GTQ H;  3FP9 A;  2EXD A;  1N9W A;  2PI2 E;  4MNO A;  1G29 1;  4A3K H;  2YV5 A;  3GTL H;  1AH9 A;  2EIF A;  2IX0 A;  1KD1 C;  1FGU A;  1YJN A;  4DAY B;  4B3R Q;  3ULL A;  1Y1W G;  4L5R C;  4BY7 H;  1PH4 A;  1Z47 A;  1JJ2 A;  1GVP A;  2Q2I A;  3CPF A;  4A4I A;  1KIX A;  1A62 A;  1E24 A;  1Y14 B;  5M3M G;  4JBM A;  5M3F H;  5C3E G;  5H1S E;  2WAQ G;  4A3G G;  2KCM A;  4ALP A;  4EX5 A;  1Q1E A;  4LFB L;  4GN3 B;  3F2C A;  4YWM A;  3F8T A;  3M4P A;  2E5L L;  4BXX G;  2NVY H;  1BVS A;  1R9T H;  1PFS A;  2HQL A;  1EFW A;  4LW1 A;  4DUZ Q;  4GLV B;  1IBM Q;  4B3S L;  4LF7 Q;  3HOV H;  3H3V H;  4A3G H;  1VQF A;  2BA1 A;  4QIW E;  4JI5 Q;  5JEA G;  1HZ9 A;  1L1O C;  5GAD C;  4MTN A;  4JI6 Q;  2OQK A;  1YIJ A;  1KQS A;  3S2D H;  4JI1 L;  2PI2 A;  2K5H A;  3HOZ H;  1XPO A;  1E22 A;  4MZ9 A;  4JYA L;  3RLF A;  1W3S A;  4Y52 H;  2JK8 A;  5BR8 L;  2VUM G;  1RL2 A;  1CSQ A;  3KF8 B;  3GDE A;  3RR5 A;  4X64 L;  1X56 A;  1B8A A;  3U4V A;  2HHH L;  1PH7 A;  3KDF B;  4BBR H;  2UUA Q;  4PZ7 A;  3L7Z C;  2QEX A;  1FJG Q;  2YTX A;  1N36 Q;  3AYH B;  1C0A A;  3E9I A;  3J80 i;  4DR4 Q;  3GTO H;  3H0G G;  2H5X A;  3KDF A;  1JB7 A;  1XNR L;  5IT9 c;  4DR5 L;  4A3C G;  4Y7N H;  4KHP L;  5JJI A;  1YHQ A;  5M5W H;  2QNC A;  2D0O A;  2QGQ A;  1YZ6 A;  4DNI A;  1HNX Q;  3CD6 A;  3GTG H;  4A3M G;  1K83 H;  1J5E Q;  2JA6 H;  3L0O A;  1WOC A;  5C4J H;  5JJL A;  2OCE A;  1FVI A;  1DGS A;  1NMG A;  1OXV A;  4X66 L;  1P8L A;  4YHH Q;  4IPD A;  5LMU Q;  4DV0 L;  1HJP A;  5C44 G;  2HIX A;  1Y1V G;  2WAQ E;  3STB D;  3EN2 A;  2AWN A;  3HKZ G;  4DK3 C;  2MNA A;  3M85 A;  3HOY G;  4OXP A;  4TVA B;  1HNW Q;  2ALY B;  4KHZ A;  3S16 H;  3G6E A;  4UP7 A;  1B70 B;  4IO9 A;  3L2P A;  2MFI A;  3M3Y H;  4DV5 L;  1N32 Q;  1JJG A;  4B3T Q;  2B63 H;  1Y1V H;  4GOP B;  4R4I A;  3UE0 A;  5GAH C;  3BZK A;  4JBK A;  1IZ6 A;  4R4O A;  5IP9 G;  1Q12 A;  5IYC H;  2Q2T A;  1N33 Q;  3FKI G;  1VS0 A;  1KC8 C;  4POG A;  1MIU A;  2C35 B;  1M90 C;  1HH2 P;  1PH5 A;  4GOP A;  4DPG A;  1RIP A;  4LFC Q;  1PH1 A;  3E0E A;  1MJC A;  4IJL A;  1CKO A;  1GM5 A;  1QVF A;  1QVG A;  2NN6 I;  4C3I H;  5FLM G;  3HKS A;  1UE7 A;  3PO2 G;  2CKZ B;  2ODG C;  3PCO B;  3CCL A;  3A5Z B;  4IOC A;  2E2H H;  1VQ4 A;  1SN8 A;  2OTL A;  4P74 A;  1CKN B;  4A3B H;  3AFP A;  5FLM H;  3I4N H;  1I50 H;  1TWF H;  4LFB Q;  1Q7Y C;  3PIP A;  4UPA A;  4AIM A;  4XIG S;  3K81 C;  1AE3 A;  1CKN A;  1QVC A;  2ODC I;  1Q1B A;  4NPS A;  4LF4 L;  3CCU A;  4B3S Q;  3PF4 A;  4DR7 L;  1KXL A;  4GLX A;  4L5Q A;  4O2D A;  3PSI A;  1PH6 A;  1VQJ A;  2AWO A;  3PV0 A;  3BU2 A;  1VQG A;  4HID A;  5M5X H;  2ZJR A;  1GKH A;  4A3D G;  2UXB Q;  1YHA A;  2JEB I;  5E7N A;  1VQM A;  1X54 A;  4L5T A;  2AMC B;  3WWV A;  1VQK A;  4JI1 Q;  2JA7 H;  1HZA A;  1BBW A;  1CSP A;  3SGI A;  3B6Y A;  1X3G A;  4JYA Q;  1EOV A;  4LF9 L;  2CQO A;  2NN6 G;  2JJQ A;  4A3D H;  2CWA A;  3ZJY C;  4DV2 L;  1VQE A;  1I5F A;  1Q81 C;  2I5M X;  3G48 A;  4OWX B;  2I0Q A;  4X64 Q;  5DLQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...