1A8VA

Structure of the rna-binding domain of the rho transcription terminator
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
120
structure length
115
Chain Sequence
GHMNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSAAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for terminator recognition by the Rho transcription termination factor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription termination
molecule keywords TRANSCRIPTION TERMINATION FACTOR RHO
total genus 29
structure length 115
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07498 Rho_N Rho termination factor, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.10 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 1a8vA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1a8vA02
3ERSX 5M5WH 4C2MH 2JA5G 1J6QA 2KCTA 1OXUA 3UE0A 1HZBA 1X65A 1PH2A 3JAMc 2UU9Q 5ELNA 4RG1A 2UUBL 2NVYH 4DR1Q 1XNQQ 2K14A 3K7UC 2PNHA 2IX1A 2FXQA 5GROA 4JG2A 4QJFA 4GNXC 4JOIA 4AYBE 4DV6L 5GQOA 4OONA 1N32Q 4R4TA 1VQCA 4MZ9A 3M85A 4A3MH 4LF8Q 4PZ8A 2UXCL 3S24A 3A5ZB 4J15A 3J80c 4LF4Q 2V1CC 5M5YH 2K5NA 5E7NA 3T1HQ 1FVIA 4BXXH 4R1JA 5AJ3Q 3ULLA 3F2DA 4DR3Q 1KL9A 2ZTCA 4KHPQ 2UXBL 1BBWA 2ZTEA 1S3OA 4LF7Q 1L1OB 2D0PA 1KRSA 3CCLA 2HJQA 3FKIG 1HZ9A 2ALYB 1XNRL 2R7ZH 1RIPA 1N34Q 1GD7A 2ZJPA 2ASBA 2XTIA 3K8AA 3HOXG 1BKBA 3PF4A 4NB3A 4JI5L 2IHFA 2BH2A 4DUYL 1IBKL 2JK8A 2ZTDA 1E7LA 3UDIA 1I3QH 1HNWQ 3RLNA 2JEBI 5IYDH 3AQQA 4X62L 5FJ8G 4KHZA 4HIDA 4LUOA 2I5LX 3G6EA 2K4KA 3AEVA 3PGZA 3K80C 4R4CA 3OTOQ 3CF5A 1QZHA 1UWVA 1B70B 2ZM6Q 1EFWA 2VUMH 1QVCA 1Q86C 1OXVA 2B29A 2EIFA 5LMNQ 1X3FA 3RNUA 1C0AA 1WOCA 1X56A 5FLXc 3M4QA 3FHWA 2Z6KC 4Y7NH 3I4NG 4NXNL 2KCMA 1E24A 2K5VA 2NN6G 3A74A 2E5LL 3A5UA 1L1OC 2JA6H 1TWAH 3UDGA 4LFBQ 2UUCQ 1V43A 2YTXA 4OXPA 5BR8Q 2YTVA 4A3EH 1UE5A 3HOVH 3JAMi 3MXNB 1S72A 1UEBA 3KJPA 3DM3A 5IP7H 2UU9L 1VQDA 3NELA 1KHIA 3ULPA 4IO9A 4A76A 4BBSG 4A93H 2OTJA 4IFDJ 1TWHH 4PG3A 4DV0Q 1SROA 2N78A 3D31A 5C0XI 2JA5H 1EUJA 4PZ7A 2JA8G 2R92H 4JI8L 5IE8A 2QNFA 1MIUA 2UXDQ 3HOWG 4ALPA 4UY8C 3AYHB 4X66Q 4GNXA 3CCUA 1V9PA 1KQSA 1G291 1H95A 1YJNA 1VQHA 3HOWH 1XTDA 1VQJA 4YWMA 2CKZB 5C44H 4BY1H 2ZJRA 1S40A 1IBMQ 1WFQA 5IYCH 4GKKQ 2WAQG 1L1OA 2D62A 1MKHA 4GN5A 1N36L 2R93H 4LF6Q 3STBC 1N8RC 4EX5A 3HKZE 1LM0A 5K36G 2Z0SA 3CAMA 4A3MG 4YWKA 1A0IA 3ZJYC 2F4VQ 3S17H 2Q2UA 1N32L 1CKOA 1Q46A 5C3EG 4JI4Q 4XIGS 5GAGC 2JE6I 1Z47A 1R9TH 1IYJB 1N34L 1TWCH 4DR1L 3U4ZA 1E7DA 1SE8A 5C3EH 3RZOH 4DUZL 1EN7A 4JYAL 4DR4L 3GTLH 2MNAA 3CW2C 4B3RQ 2K52A 4DR4Q 4A93G 4BBRH 2NZOA 2LXKA 2H5XA 1WYDA 1TWFH 4P74A 3HOXH 4B3SQ 1YJWA 4C3HH 4MTNA 1NJIC 4DV4Q 4ME3A 4GLXA 3W1BA 4LF4L 2IY5B 4KLKA 3ULJA 2K75A 5C4XG 3G48A 3W1GA 1PH5A 2Y0SG 1K0RA 3I4MH 4DR6L 2PMZE 4NXNQ 5JJIA 2VZAA 2WB1G 1X9NA 2YU9H 2KHIA 4DR6Q 4YHHQ 2JA9A 4DNIA 4DV2L 3PUYA 2B63G 2A19A 3S1NH 3G4SA 5FLMG 4HJ7A 2L15A 1Q8KA 2LXJA 1QZGA 4UPAA 3KF8B 4DR7Q 1HR0W 3I4NH 5IYBG 2ID0A 4JC0A 4JBJA 4OX9L 2JA7G 4X6AH 1XPOA 1X6OA 2CCZA 1HNXL 3KF6A 3AFQA 4LWCA 1IBKQ 1HNWL 1P8LA 1QVFA 1WCMH 1EIFA 4JBWA 4DR2L 3W5OA 4NXMQ 3HOUH 2R7ZG 1CSQA 3KFUA 2VQFQ 1Q1EA 4AQYQ 3TQYA 4IPGA 4YCUA 2R7DA 2KENA 4NXML 1PYBA 3K0XA 4EQ5A 1SN8A 1HZAA 1PHJA 4JV5Q 4JOIC 5IP7G 3I56A 1PH1A 3CMEA 3CD6A 1VQ9A 3GTJH 1TWGH 4LFCQ 3FKIH 3SGIA 5LMNL 3GDEA 4UP7A 3PIPA 2EXDA 3BZCA 2UUAL 1YZ6A 4GKKL 1VQGA 2VUMG 1VQPA 4RMFA 1HNZL 1ASZA 1PVOA 4L5TA 1GKHA 1P16A 1A63A 2HQLA 1VQ8A 1OXTA 5M3MH 1NY4A 1IXRA 2BH8A 2PI2E 4KI0A 4DPGA 1YHQA 5IYDG 4LFAL 4B3TQ 5IYCG 2HT1A 4IFDG 1E3PA 1YNXA 3F1ZA 3CC7A 1B8AA 1D8LA 5LMUQ 1VQIA 1KC8C 2KHJA 2Q2HA 2YV5A 4PMWA 4BY1G 4DK6C 5C44G 2VL6A 2PQAA 1YIJA 2VS1A 4JI6Q 2VNUD 1JE5A 1BBUA 3RR5A 3KF6B 2EQSA 1I94L 2QNCA 1Q12A 2CWAA 4B3RL 2MQHA 1JJCB 4QQBX 2NVTH 4IOCA 4TVAB 3BJUA 2DUDA 3PUVA 1JMCA 4IPHA 3Q8DA 3GTPH 3T1HL 4K0KQ 1EYGA 2MO0A 3H0GH 5JEAG 3BZKA 3UDXA 4LF6L 2E8GA 2N3SA 4YWLA 4UP9A 1PH6A 3H3VI 3A0JA 4A3GG 4AYBG 3M9BA 2JQOA 4X65L 1VQ4A 4A3KG 2I5HA 4AIMA 1XMQQ 1M90C 1Y14B 4GS3A 2RHQB 4X65Q 1VQEA 4A4IA 1C9OA 4DV3L 4APVA 2C35B 2VQEL 4HJ9A 2ATWA 1VQKA 2R7FA 2AWNA 4GOPA 4DAMA 1CKNA 2AWOA 4A3JG 4JI5Q 3KDFB 1PFSA 2WP8J 4LF8L 3TRZA 4XTCS 2VQFL 1PH9A 5LMNW 5JEAJ 1E1TA 4AQYL 2Q2TA 4L5RC 1VQOA 2VW9A 1WI5A 2ZM6L 4GOPC 1A8VA 2GVAA 3FP9A 2NVXH 3TEHB 4JI1L 1U5KA 1VQFA 3EIVA 4YCVA 3I2ZA 1YJ9A 3CCMA 4A3EG 5IP9H 2JJQA 4IPDA 2OTLA 4LF9Q 4POGA 2R93G 3H0GG 5AJ3L 3CC2A 1AE3A 2F52A 1K8GA 1VQMA 4DV1Q 4DR5L 1EIYB 4LFBL 4A75A 2UUCL 3CXCA 2AKWB 4C3IH 4YHHL 4DV2Q 1D7QA 1PH4A 3ICEA 1NE3A 2AMCB 3B6YA 4QGUA 1Q7YC 3HKSA 4Y52H 1U0LA 1V1QA 1VCIA 4OX9Q 3HOYG 3S2HH 1Q82C 3CP0A 3RN5A 3S2DH 1FL0A 3UE1A 4A3KH 1VQNA 1KAWA 4DR2Q 2VY3A 5LMUL 4C3JH 4A3GH 2WB1E 3I7FA 4HJ5A 4B3TL 4GOPB 4HIOA 4A3CG 3MEFA 3S1RH 3HOZG 5JJKA 3KDFA 2QEXA 4JI6L 2N49A 4X66L 3GO5A 1XJVA 3S16H 1OXXK 2IT1A 4O0AA 4P72A 2UXDL 1QUQA 1XMOL 1JT8A 3PUWA 4UP8A 1VQLA 3GTKH 3HOUG 2RCNA 1HH2P 2YTYA 1LTLA 4HJAA 1MJCA 4K0KL 4A3FG 1EQRA 5IP9G 1IBLL 1PH3A 3OYYA 4NPSA 4P75A 1WCMG 1GM5A 5J3BA 4JI2L 5GADC 1N36Q 2I0QA 3KLWA 4OWWB 4QL5A 3S14H 1PV4A 2UXBQ 4BY7G 1NMGA 2E2IH 4YCWA 3PO2G 1FGUA 1XMQL 1Y1WH 3CC4A 1Z9FA 2K5HA 2OCEA 3K81C 1XNQL 2HIXA 2NZHA 1PH7A 2CFMA 5C4XH 1HR0L 1AE2A 4IOAA 4GKJQ 3JC66 5DLQE 1X54A 1FJGL 1W2BA 2A8VA 4A3LH 4R4OA 2QA4A 1IL2A 1KXLA 4JI0L 3K7AH 3I55A 1J5EQ 2UXCQ 4QIWE 5FLMH 4A3IG 4B3SL 1GVPA 1CSPA 1YEZA 3WWVA 3OTOL 4LNQA 4IFDI 4A3BH 1JB7A 4JI1Q 3J7A5 4DAYB 2JA7H 4P73A 1VS0A 3CCVA 4DR3L 4A3FH 1KIXA 1K83H 2BA1A 3J81j 4A3CH 2QGQA 3L0OA 4A3BG 3GD7A 3PV0A 4POFA 1QVGA 1I5FA 2I5MX 3U50C 1LYLA 3GTMH 4TQUS 2HHHL 1I50H 1UE1A 5EAYA 4L5SA 3PUZA 4LF7L 4BA2I 3IRBA 4LW1A 4HJ8A 4DR7L 4JBKA 3L2PA 1GO3E 3S15H 3UDFA 2F3IA 4YY3Q 3D0FA 1T9HA 3J81c 4JI7L 3GTGH 2PQAB 4DK3C 4JI3Q 3TREA 1MJEA 2PI2A 2XGTA 2A1AA 4JI7Q 1SLJA 4JI3L 3F2CA 2WFWA 3S1QH 1E7ZA 4OWXB 4WJ4A 3PO2H 1N9WA 3ER0A 3F8TA 4X64L 5H1SE 1SR3A 3J81i 3E0EA 2YYZA 4FDBA 1Q81C 2OWOA 2CQOA 2KBNA 1CUKA 4MNOA 4DV4L 1BVSA 1Y1VH 1K8AC 1L0WA 3KOJA 1B7YB 1OXSC 3STBD 3CMAA 4DR5Q 1PA6A 4IPCA 1XMOQ 2UUAQ 2NVQH 3EN2A 2GN5A 3RN2A 3PF5A 4R4IA 4OWTB 1IBML 5IWAQ 4A3JH 4A3DG 2NN6I 3OW2A 4JCVE 4LF5Q 5FJ8H 1VQ7A 1YHBA 5M3MG 1KD1C 3RLFA 3VDYA 2IHEA 1M1KC 2B3GA 4GLVB 3PO3H 4GLAC 4PZ6A 4GN4B 3RZDH 5BR8L 1PH8A 1NMFA 1VQAA 2AHOB 3HFZB 4OO1G 4LFAQ 4JI4L 1EQQA 1ASYA 4DV0L 4BY7H 1O7IA 1HNXQ 4JBMA 2OQ0A 3CPFA 5IYBH 1YVCA 5M3FH 1C7YA 2IX0A 5IT9c 1YHAA 1FJGQ 1N33L 2JA6G 2ES2A 3HOYH 5C0XG 1I94Q 1HR0Q 1YI2A 3GTQH 4JI8Q 4DV5L 5C4JH 1QUQB 4B3MQ 4DV6Q 1YITA 2Y0SE 2R92G 4IJHA 3CCSA 5HY6A 4LFCL 1NBWA 4IJLA 1EOVA 1UE7A 1L2FA 1WJJA 3AFPA 4P71A 3CCQA 4WJ3M 3I4MG 1W3SA 1E22A 4JI2Q 2RF4A 2Q2IA 1IBLQ 3PUXA 3CCEA 2E5LQ 2GVBA 1IZ6A 1VQ6A 1EWIA 4A3LG 2CWPA 2LSSA 1Y1VG 1A62A 1XNRQ 1SMXA 2UUBQ 2F4VL 4GKJL 2VQEQ 4BXXG 1KRTA 3HOVG 4DV3Q 4DUZQ 4GNXB 4JYAQ 3T1YQ 4DUYQ 3HOZH 3NBHB 3TS0A 3CQZH 3NENA 3T1YL 1J5EL 4YY3L 3G71A 1G51A 2E2JH 4JI0Q 4DKAC 1RL2A 4X62Q 1X3GA 1DGSA 5C0XJ 4JV5L 4X64Q 1X55A 4OO1I 5HGQA 1HJPA 5IY0A 1I6HH 2JEAI 5M3FG 3J80i 1Y1WG 3H3VH 4LUZA 3BU2A 1XPUA 1CKMA 3CPWA 4DV1L 2DGYA 3LGJA 4BA1I 4LF9L 2D0OA 3E9HA 1E1OA 1K9MC 2E2HH 1UE6A 2R6GA 4O2DA 3L7ZC 3DLLA 1OTCA 2ZJQA 5IWAL 4LF5L 3E9IA 3EBEA 2HHHQ 3TS2A 2HIVA 5M5XH 4AH6A 2JA8H 3U58A 4A3DH 2K50A 4QY7A 4KHPL 4H02A 1CKNB 3HKZG 4L5QA 5ELOA 4A3IH 3M7NA 2B63H 3U4VA 1N33Q 3M4PA 2WAQE 3M3YH 5GAHC 1G6PA 1HZCA 1SFOH 1XPRA 3I4OA 3H15A 3CCRA 2MFIA 1JJGA 1SRUA 3NEMA 1PYSB 5JJLA 3J7ZC 1VQBA 4GN3B 2RHSB 2MO1A 3PCOB 1K3RA 3F2BA 2BA0A 3CCJA 4DV5Q 4R4QA 1JJ2A 4B3ML 3RLOA 1Q1BA 4LUVA 3KYHC 4HIMA 1AH9A 1NTGA 1K73C 3PO3G 3PIOA 2OQKA 1VQ5A 4DV7Q 3M4OH 1HNZQ 2N8NA 3KJOA 1LUZA 5GAEC 4DV7L 4BBSH 1X3EA 1TXYA 4BBRG 2Z6KA 3S1MH 3PSIA 3GTOH 4HIKA 1YBYA
chains in the Genus database with same CATH superfamily
1EY5A 2PZTA 2KCTA 1OXUA 1PH2A 2K28A 2UU9Q 4RG1A 4K8JA 1XNQQ 3M7GA 4DR1Q 2R61A 2PNHA 5GROA 1WTRA 3Q24A 2JA6B 5GQOA 4R4TA 2UXCL 2I07B 3S24A 2WQGA 4G7HC 4LF4Q 2A68D 1BCPC 5M5YH 5C4XB 2CHBD 3V05A 3VA5A 1S5ED 5AJ3Q 2EXZA 1A15A 2E76C 3NQIA 5HGTA 5EBCA 2F0TA 1S3OA 2L5TA 1KRSA 4KTAA 5CBAE 1HZ9A 4R8NA 5KRUA 1XNRL 2R7ZH 5F2DA 3Q23A 2ZJPA 4JI5L 5FO9B 4DUYL 3OSOA 4FXKC 1PXUA 2N88A 3BS1A 1CHQD 3AQQA 4X62L 3TP7A 1G8ZD 3K6OA 1VMPA 1CA6A 3K80C 4R4CA 1QZHA 2VUMH 1OXVA 5JVH3 2EIFA 5IODA 5LMNQ 1EQVA 5FLXc 1Y69U 2EY6A 4Y7NH 3I4NG 2JA6H 3A5UA 4DNRB 1F9RA 1TWAH 1KLGD 3SVMA 2YTVA 1UE5A 4A3MB 3IKJA 3KJPA 3HOXB 2OTJA 3M4OB 1TWHH 4PG3A 4DV0Q 3D31A 2DJGC 2IJ0A 3FRPB 4JI8L 5IE8A 2UXDQ 5K5PA 4LMQD 3HOWG 5KNCA 2F0OA 5IGCA 4QUCA 3AYHB 4X66Q 1QCBD 2BDNA 3S1QB 4UZWA 1KQSA 4IZ8A 1VQHA 3HOWH 1QJOA 4OEMB 1CZGA 5IYCH 4IFDH 4PQXA 4QUFA 2D62A 1KDBA 3BYYB 2R93H 3OMCA 1I6VC 4EGVA 5K36G 2Z0SA 3GV6A 1FR3A 3K5MA 5C3EG 4JI4Q 1U9RA 4XIGS 1SYDA 3I73A 1Z47A 2SNMA 1E7DA 1SE8A 5C3EH 3RZOH 1MI2A 2JA8B 4F7XA 1DZ1A 2K5QA 2MNAA 3QOLA 4B3RQ 2K52A 4DR4Q 4A93G 4F87A 4Q0FA 2H5XA 1KNEA 4P74A 3HOXH 1YJWA 4C3HH 4MTNA 3KLSX 2FMMA 1YNJC 3HG9A 4GLXA 3W1BA 4H7BA 4CDFC 3D8GA 4KLKA 3ULJA 4LF4L 3DWAA 5C4XG 2Y0SG 1K0RA 3I4MH 4DR6L 2KFVA 2KHIA 4N8FA 2JA9A 4DNIA 2A19A 4Y7NB 2B2UA 5FLMG 4TSSA 1C4QA 1QZGA 1CQFA 1G2TA 2KOLA 1FGBD 4JC0A 2JA7G 3KF6A 3K5LA 2B8FA 3HOUH 4JBWA 2R7ZG 4KN4C 1K8MA 1VF7A 2VQFQ 2F0SA 3TQYA 2KENA 4EQ5A 2F0WA 4RH6A 3NUCA 3CMEA 2A6HC 1BO0A 2PO4A 2DNEA 2EVBA 3BZCA 1YZ6A 4GKKL 1VQGA 2VUMG 2LD7A 2B2VA 4K5WA 1SNCA 1NY4A 4KI0A 1EYCA 3E0JA 1I4PA 3RD4A 1V8QA 2F0GA 5IYDG 5LHY1 2ZXPA 1D8LA 5LMUQ 2YV5A 5C44G 1YIJA 4EVOA 2PQAA 4C2MB 2FFKB 2CW0C 1R9TB 4H0LC 4QQBX 1U4LA 2NVTH 4KJNA 3DMUA 4IOCA 4TVAB 1HA5A 3C46A 1JMCA 3Q8DA 3LWEA 5ELDA 1B9MA 3BZKA 1GUNA 3R93A 1LTBD 2Q8RE 4F8MA 2KVDA 4C3JG 3A0JA 1UEAB 2JQOA 4X65L 4EQNA 2N55A 1VQEA 4X65Q 4APVA 1R4PB 2QDLA 4KKUA 4V0BA 3IFDA 4ODGA 4B9XA 4HJ9A 2ATWA 1CKNA 2AWOA 4A3JG 5I9OA 3J7AV 1M8AA 3D3RA 4XTCS 3T53B 4AQYL 3UI2A 1QOHA 3I4LA 1LO5D 2NVXH 1SAPA 1PTOB 3TEHB 4EQOA 5CR3A 4L63B 1UUPA 4JI1L 2WACA 5K36H 1EFID 2K04A 3EIVA 5IP9H 2JJQA 3J80L 4LF9Q 1AE3A 5IGFA 2NZ1D 4C3IH 1IKLA 4AYBB 1PH4A 3B6YA 2AMCB 1NR2A 4E6IA 1TS2A 3U9SA 5I9PA 4OX9Q 1SSOA 2F1MA 4A3KH 2KCCA 4DR2Q 4I7ZC 3DEOA 4A3GH 3SK6A 4HJ5A 1RTNA 4HIOA 3DM1A 3CHBD 1DM0B 3HOZG 1DCZA 3BDOA 3D4DA 2QEXA 1GUSA 2IT1A 4O0AA 3S14B 1JT8A 1QUQA 2J0TD 2L12A 3HOUG 1ML0D 2RCNA 4K0KL 1ZKOA 4B9WA 1BR9A 5IGDA 4KKTA 1H9RA 1IBLL 4NPSA 1JR0D 1WCMG 1Y8OB 1N36Q 3S14H 2KVEA 1KDCA 1XMQL 2EE1A 1Z9FA 1PFBA 5D14A 5C4ZA 2NZHA 2OT2A 1PH7A 3TBIB 5C4JB 3JC66 1W2BA 2QA4A 2KJXA 4JI0L 3I55A 3S2HB 4N9PA 1JWMD 4B3SL 1GVPA 3WWVA 4F88A 5M5WB 4LK1C 4A3BH 3QG1A 1VS0A 3CCVA 1KIXA 1K83H 3J81j 4QIWB 4A3BG 4XYQA 1QVGA 1PTOH 4HSVA 3R2IA 1LYLA 4HTHA 3VR3A 3PO2B 5G3LF 1UE1A 5EAYA 1C8CA 1LT4D 1O7YA 2NTSA 3HKZB 1V1OA 3SR1A 3SDZA 3S15H 4K5XA 4JI7L 4JI3Q 4DK3C 4HSPA 1HXYD 1JOKA 2C5CA 2PI2A 3TREA 1MJEA 4JI7Q 1SEBD 2WFWA 3S1QH 1IL8A 3MC0B 3X3NA 3ER0A 2K03A 4MTKA 2O4XA 2HD3A 2YYZA 4FF2A 1TWHB 1WTPA 1H9SB 4CDEC 1SJED 3MXUA 4FF1A 1IBML 4R4IA 4OWTB 4LF5Q 1ILPA 2SEBD 2NVTB 2KW9A 4GLAC 4PZ6A 1TWAB 4DF7A 3OW7A 2MUYA 4ZK9B 1WD1A 3G7LA 3HOVB 3QR8A 4KHVA 4DV0L 5EJWA 4L6TB 1YHAA 1HHVA 1A3TA 2JA6G 2ES2A 5C0XG 1I94Q 3MFYA 4JI8Q 4B3MQ 4C3IG 1XTCD 3GTJB 3CCSA 3AFPA 1UE7A 1L2FA 2O5JC 4WJ3M 1XWEA 3A54A 2KVUA 5D65A 1IBLQ 1WCMB 4DAYA 1TS5A 1EU3A 4IUUA 4RKBA 1VQ6A 1JWSD 4C56C 3JAML 2MPHA 3A8KE 1JORA 4UDUC 2VQEQ 2XRSD 4BXXG 3HOVG 3LLRA 1STGA 2G9DA 3NTHA 3T1YL 4YY3L 2OXPA 1STEA 4JI0Q 1LT3D 4DKAC 1B50A 1DGSA 2L0CA 3NP8A 3DEPA 1X55A 1V66A 1BBXC 1RHPA 2JEAI 2Z9HA 3I4MB 1XPUA 3I91A 2D0OA 2LMCB 4C3HB 1E1OA 1UE6A 3L7ZC 2NVYB 5IWAL 3K5OA 3EBEA 3TS2A 3HEJA 2JA8H 4WJWA 2MPMA 5ELOA 2ZT9C 3HGBA 5ELEA 1OO9B 2Q8IB 3U4VA 2B63H 3QKJA 3M4PA 2IPKD 3I4OA 3H15A 3J81L 4K6LA 3NEMA 3NE5B 3TP5A 3OWEB 2BA0A 4RGTA 2F0EA 1KTKA 3SK4A 1Q1BA 3QJYA 1AH9A 1FNWA 1K73C 4HR7B 1SFOB 4OL7A 3HZXA 3NSWA 2G80A 2A73B 2N8NA 1LUZA 5GAEC 3BDLA 2JN4A 2D2CC 2E5LL 3PSIA 3GTOH 4HIKA 1YBYA 3ERSX 5M5WH 1N32Q 2XSCA 1S5DD 1JICA 2B2VC 1WTQA 3JAMc 2F0PA 4ZQ3A 5COYA 2K32A 2K14A 5KIXA 4QJFA 4JOIA 4AYBE 4DV6L 2R3ZA 1V1PA 4MZ9A 4K5VA 3M85A 4A3MH 1PRTF 2QKIC 1SMYD 1PRTC 3J80c 3K59A 3W3AA 1F2MA 3NPPA 2V1CC 2K5NA 5E7NA 4H44C 4JW0A 2E2JB 4FNFA 4XQQA 1KL9A 1LT6D 3ITPA 4OIJA 1BBWA 4IUTA 2A6ED 4J6HA 5EQ0A 1L1OB 2D0PA 3CCLA 2B8GA 4K14A 1RIPA 1N34Q 2F0IA 2XTIA 2EPBA 2KUMA 1BKBA 4NB3A 2NYZD 1E0BA 2IHFA 1E7LA 5FJ8G 2R7ZB 4LUOA 3C2PA 2I5LX 2K4KA 1NR4A 2F0HA 3PMFA 1EY7A 5ISRA 1UWVA 3LNNA 1B70B 4N9TA 1D5XC 3N6RA 1X3FA 3T56B 1C0AA 1WOCA 1X56A 1S4ZA 2AQ3B 3M4QA 3FHWA 3OIQA 1RD9D 3H09A 4FO2A 4NXNL 2NN6G 3A74A 5CYUA 1ICFB 1AP0A 1SXTA 4ZLTF 3WOEA 2KA7A 3MXNB 1S72A 1I4RA 1UEBA 3T4AC 3ULPA 1KHIA 5BN3A 4PNYA 4IO9A 4IFDJ 2P5ZX 5I2XA 3I3CA 4UHVA 1L0XB 1TY2A 3P1HA 2JA5H 2JA8G 5I2YA 2K7VA 3CCUA 3L9AX 1H95A 1YJNA 3EVQA 4BY1H 1EQTA 1J9OA 1II3A 1TT2A 3E6ZX 4EQPA 4GKKQ 2WAQG 4ID6A 4IUVA 1GUWA 5CV5A 3EA6A 1N36L 4GZYC 1D5MC 4LF6Q 4EX5A 3A56A 3HKZE 2PZUA 5J22A 4TRDA 1A0IA 3VYSA 1SYFA 3ZJYC 5M9OA 2JA5B 3SEBA 3AB9A 1ZXTA 2JA7B 2HCCA 1R9TH 1TWCH 4DR1L 3U4ZA 1BNZA 4OHJA 4DUZL 4JYAL 4RWSC 4DR4L 3GTLH 2FJ2A 3PIP3 4BBRH 2LXKA 5ELBA 1WYDA 3TN2A 4B3SQ 1ICWA 2XNAC 1NJIC 2KCNA 4ME3A 4A3EB 3W1GA 2PMZE 4M8AA 2WB1G 1YNSA 1XXGA 2B63G 2H4OA 2K1BA 2LXJA 3CQZB 2X6GA 3I4NH 5CV9A 1XPOA 1HNXL 4LWCA 1P8LA 1TWGB 3S16B 4OO1H 1MSHA 4YCUA 2EYJA 4PMBA 3TZDA 2OF1A 4JV5Q 4H13C 4Q5VA 3I56A 4KV6A 1VQ9A 4IUNA 5LMNL 4UP7A 3PIPA 1DOMA 3A55A 1RTOA 4RMFA 1JWUD 1HNZL 3C1FA 5L37A 1A63A 2ZXRA 1OXTA 1YNJD 1IXRA 2BCOA 2PI2E 1MHWC 1EYAA 2YU9B 4FXDA 4LFAL 2HT1A 5IYCG 4MHEA 4IFDG 5JVG3 1B8AA 1VQIA 4PMWA 2VL6A 4JI6Q 3RR5A 4NP5A 3KF6B 4G57A 1I94L 2QNCA 1Q12A 2CWAA 5EPJA 2MQHA 1BDOA 1JJCB 4DU9A 2HQEA 2RDHA 1B4OA 3K58A 4K0KQ 2MO0A 1HCZA 5JEAG 2R93B 3J81E 3HRZC 4YWLA 1PH6A 5JEAH 4A3GG 4FP5D 4AYBG 2M9VA 3M9BA 2I5HA 1XMQQ 4GS3A 2BE5C 4RCNA 2VQEL 5A35A 1W6KA 1VQKA 2OEOA 2R7FA 5C44B 3KDFB 1PFSA 1RODA 2J4XA 5JJZA 1PH9A 3MXNA 5LMNW 2Q2TA 4L5RC 3GTMB 1E2VA 4QF4A 3P75A 4HEDA 2IX3A 4ILWA 1PMRA 2EYMA 1VQFA 1H9MA 2KEDA 2XN9C 3K7AB 1B1ZA 1HPCA 2R93G 2Y0SB 5CV7A 3OWFA 5AJ3L 3CC2A 1K8GA 5DM63 4DR5L 4A75A 1VDZA 1Q7YC 4U673 3HKSA 3MFGA 1U0LA 1V1QA 5A2QL 2TMPA 1FL0A 3UE1A 1FD7D 1WTWA 1LABA 3JAME 4B3TL 1Z6HA 3S1RH 5JJKA 1PTOC 2F0JA 2E2IB 3GO5A 1NSNS 1OXXK 2F0DA 3H94A 1G91A 4O1NA 1XMOL 3PUWA 1VQLA 3GTKH 2YTYA 2MJ8A 1PH3A 4DAVA 3OYYA 2QW7A 5J3BA 2I0QA 2EJFC 3KLWA 4KY6A 3H3VC 1PV4A 2UXBQ 5M5YB 4YCWA 1DONA 1Y1WH 3CC4A 2OCEA 1XNQL 1B3QA 4XQNA 4DN4M 5EBDA 2CFMA 4GKJQ 4IOAA 1S5FD 1F9SA 1AEXA 4R4OA 1BF4A 3NBHA 1EYDA 3NXWA 1AZPA 1R4QB 2RNOA 4LNQA 2Z1CA 2B2YC 1TY0A 1H9JA 4P73A 2LY7A 2BA1A 4U68A 3L0OA 3GD7A 3PV0A 4G7OC 1H9EA 3VYTA 1STBA 3GV3A 2JSOA 1GL9B 1QE6A 1D1KA 1E2WA 4DR7L 1TVXA 3L2PA 3ND8A 2F3IA 5C6AA 3KF8A 3S15B 1T5EA 4RGOS 1KLUD 1SLJA 3VR6A 4R8IA 1ENFA 4WJ4A 1DJRD 1L0YB 3PO2H 1N9WA 3D6CA 1VMCA 3E0EA 4A3IB 1HUMA 4RAUC 4FDBA 1Q81C 2R92B 2CQOA 2KBNA 3BVGA 3PIO3 2K33A 3A7LA 3STBD 2NVQH 1CTMA 3CMAA 1PA6A 3ND9A 4IPCA 3H0GB 2UUAQ 2GN5A 3RN2A 3PF5A 4A3BB 4A3JH 5FJ8H 3OOCA 1YHBA 4DGZA 5M3MG 1F2YA 1KD1C 2CQAA 2IHEA 4GLVB 3KBGA 4GN4B 2XIWA 1PH8A 1VQAA 3HFZB 1ZEQX 4LFAQ 4JI4L 2J7ZA 4BY7H 4DNTB 4JBMA 2OQ0A 2Z8LA 1H9FA 5IYBH 2F0QA 3X3MA 3GTQH 1RJTA 2XRQD 1QUQB 5JOBA 4ZKBB 4DV5L 1LT5D 2A6EC 2F0LA 4HN7A 2FINB 1SYBA 5HY6A 4LFCL 4P2CB 1EOVA 3VYRA 3I4MG 2Q2IA 4RFBA 1BCPF 3PUXA 3CCEA 4C3HG 1IZ6A 1BXTA 1EWIA 5D3DA 2LSSA 2WKDA 1CFMA 1SDFA 2F4VL 2LKVA 1B44D 1GUGA 1KRTA 5I6WA 4DV3Q 5TSSA 4DUZQ 1I4XA 3T1YQ 3HOZH 4JYAQ 5C5LA 3NENA 3G71A 2PPBC 2E2JH 1BUVT 2B2WA 4ZUJA 4C3IB 1X3GA 3S1NB 3S2DB 3J80E 2V4DA 4OO1I 1HJPA 5M3FG 1Y1WG 3TZUA 3BU2A 3I72A 2ENBA 3CPWA 4DV1L 2DGYA 3LGJA 4BA1I 2NVXB 3E9HA 2BDOA 2R6GA 3DLLA 4LF5L 1A2TA 2EYHA 1Y1VB 4A3DH 2K50A 4H02A 4L5QA 3HKZG 4KKSA 2EDGA 1T5XD 5JPMC 2A74C 3P7JA 2WAQE 2FHTA 2CH4W 1SFOH 1XPRA 1M4VA 1JE4A 2MFIA 2B2WC 1H9SA 1PYSB 4RHSA 5JJLA 2QF7A 4GN3B 2EYFA 2RHSB 1CK1A 2DY7A 1GJJA 1SYEA 3KYHC 3PIOA 1JJRA 2OQKA 2EJMA 2F0UA 2RCFA 2WINB 1HNZQ 2G9HD 1C48A 1D5ZC 1HTPA 5G3LD 1YNNC 4C2MH 3UE0A 1HZBA 2NTTA 3DUZA 2NVYH 2UUBL 3K7UC 1B53A 2IX1A 1HTLD 5CV8A 1D1IA 1ESFA 4FF4A 1VQCA 4LF8Q 1JC7A 3K5NA 4PZ8A 5FOBB 4J15A 3J7YW 1ILQA 5CBEE 4M1UB 2F0FA 4R1JA 3F2DA 3ULLA 4KHPQ 2ZTCA 2I46A 4JK1C 4CGYB 2HJQA 1SYCA 1O7ZA 4KD4A 1EU4A 3D4WA 1GD7A 3FMCA 2ASBA 3K8AA 3PF4A 2O2LD 2WKCA 1XYIA 1IYVA 3WOFA 4DFAA 1IBKL 2JEBI 3GTKB 2EOTA 2ICEC 2XVSA 4QB4A 4ZAIA 3PGZA 3OTOQ 3CF5A 2ZM6Q 3S1RB 1EFWA 2A6HD 1QVCA 4O42A 5M3FB 1PLFA 4LJZC 2F03A 3ZYYX 2RKSA 1E24A 1Q90A 2K5VA 2ICIA 1L1OC 2VB2X 2YTXA 4OXPA 3HOVH 1EY8A 1FNUA 3EFXD 4DA2A 5C3EB 3G6JB 5IP7H 2C9OA 4BBSG 5E4WC 2DY8A 4A93H 3VR4A 2N78A 3TSSA 1UNSA 2EYOA 1WTOA 1JOQA 5E4XA 2QNFA 5BN5A 4K6DA 3SK5A 4ALPA 4UY8C 1EEID 1V9PA 1SNMA 3VA7A 1CT1D 1XTDA 4DK0A 5C44H 2CKZB 1CHPD 2ZJRA 2EJGC 1IBMQ 2SDFA 1A3VA 1L1OA 4XT1B 5AFWA 4GN5A 5KEEA 1N8RC 1VF5C 3O13A 2F4VQ 3S17H 1G6ZA 4YWKA 1N32L 3U9OA 2D9UA 1JQYD 2H1EA 4KY7A 1N34L 4IUPA 3R3OA 5M5XB 3CW2C 1I4GA 3IAYA 1EWCA 2F0VA 2NUCA 1TWFH 4FXGC 1HFGA 4DV4Q 2K75A 1PH5A 5EGTA 4CKBA 2VZAA 3QOJA 2YU9H 2VUMB 2DK4A 2F0KA 3KBXA 4YHHQ 4DV2L 3GP7A 3L3OC 4KY5A 3FKIB 3K57A 4K2LA 3BG3A 1FNVA 4XDXA 2AUJD 4DR7Q 4OX9L 4JBJA 1X6OA 1IBKQ 1SNDA 3AFQA 5CORA 1S5BD 4XXEA 1QVFA 4NXMQ 1BQQT 3W5OA 3KFUA 2K6AA 4AQYQ 4NXML 4IPGA 2R7DA 2XWJB 1QNUA 1PYBA 3FPPA 3K0XA 1SN8A 4HMJA 3V96A 2M00A 4JOIC 1PH1A 3CD6A 1TWGH 3I4NB 2UUAL 3DWQA 2B2YA 1IW7C 4DK1A 2HDMA 3CU7A 4L5TA 4A3GB 2EY5A 1P16A 4BY7B 2HCIA 2HQLA 1F9QA 4A3KB 5M3MH 2B2TC 2BH8A 1IHZA 5E1FA 1EZ6A 1KC8C 4DK6C 2Q2HA 4A3JB 1KHCA 1WVLA 2KHSA 2MHVA 2NB0A 4J8QA 5IIFA 2SOBA 3BJUA 2DUDA 4DAPA 3GTPH 1EYGA 3FPUB 4HCSA 1EOTA 5C4HA 3I70A 1CA5A 4LF6L 2E8GA 4OIKA 1ENAA 1LTGD 2N3SA 1SNOA 3TP6A 3H3VI 1A3UA 1CZWA 2RA4A 3AU7A 4A3KG 2PCFB 1M90C 1Y14B 3BVMA 2RHQB 2D5DA 1JEQA 2GA4B 3QO2A 4DV3L 1U4RA 5IT9L 3A8IE 2C35B 2QDBA 1K8OA 2AWNA 3T16A 4BY1B 3MA2B 3TRZA 1GJXA 3KLRA 5JEAJ 1E1TA 5DEHA 2VW9A 1WI5A 2ZM6L 4GOPC 1A8VA 2QCPX 1TR5A 4BWGB 1YJ9A 1KAAA 4A3FB 4POGA 3EQLC 3H0GG 1BCPD 1AFPA 2F52A 4DV1Q 1EIYB 4LFBL 5M3MB 2AKWB 2Z4IA 1D7QA 1PFMA 3ICEA 1NE3A 1VCIA 1Q82C 3S2DH 2NWGA 1VQNA 2IWHA 5LMUL 3M4YA 1SE2A 3NWTA 3TP8A 1PTOF 1PRTD 2PW5A 3MEFA 5DM73 1HUNA 1STHA 4FF3A 3NTKA 3KDFA 4JPBW 1QB5D 1LV9A 4HMIA 4P72A 3TMEA 3HP3A 1K0SA 1HH2P 4HJAA 3SK8A 1HQRD 5KNDA 1PZJD 1EQRA 1GM5A 4JI2L 4YIJA 5GADC 4OWWB 1B2TA 1A6XA 3PO2G 1FGUA 2A69D 5E3FA 3SHLA 3HOYB 2K5HA 5C0XH 4PMCA 4KMUC 1HR0L 1AE2A 5DLQE 1X54A 4A3LH 4L8JA 3DWPA 1RDPD 1TWFB 3IFTA 1KXLA 1PFNA 3RZDB 3K7AH 1J5EQ 4QIWE 1CSPA 1LACA 4RKLA 1E2ZA 1JB7A 1DOKA 4DAYB 2BOSA 1JCKB 4A3FH 4KHPL 4A3CH 4B08A 2QGQA 3BZDB 1O80A 4POFA 4I65A 4G4KA 2HHHL 4LF7L 3PUZA 4BA2I 3IRBA 4LW1A 2NN6H 2LS01 2ODGC 3I90A 3UDFA 4YY3Q 3D0FA 1T9HA 3J81c 3GTGH 2A1AA 3F2CA 1I50B 2KQ3A 4CDCC 4X64L 3F8TA 3NHHA 1SR3A 5H1SE 3D6WA 1AW7A 4RGMA 2OWOA 1X3PA 5IOCA 4MNOA 1BVSA 1K8AC 5CC4A 1GUOA 2F0NA 4DR5Q 2WV6D 1XMOQ 2NN6I 4JCVE 1VQ7A 3DHQA 3VDYA 2B3GA 3EROA 2RDGA 1I6HB 1NMFA 2L11A 1A2UA 1AZQA 1ASYA 1SNPA 1HNXQ 1C7YA 3CPFA 5M3FH 1WTXA 2IX0A 5IT9c 1FJGQ 1YI2A 4UAIA 4CJ2C 1MSGA 3E5SA 4DV6Q 2Y0SE 2F3WA 1SNQA 3CRLC 3KUPA 1O78A 2BE5D 4IJLA 1Y1WB 3CCQA 1O7LA 1UAPA 1B9NA 1E22A 2RF4A 1TQOA 3LWUA 1MD2D 3VR5A 4PV1C 3RUZA 5KGUA 2DN8A 2G5DA 2EY1A 1Y1VG 2JXMB 1SMXA 1ONLA 1EL0A 4GNXB 4CDDC 2K01A 1ZYRD 4DUYQ 1ET9A 3NBHB 3TS0A 2KVMA 2O5IC 3D4RA 3MWYW 4ZYSA 1RL2A 1ZYRC 4X62Q 4WORA 3E3XA 1I6HH 5HURA 1SMYC 4LUZA 1H1JS 4LF9L 4V190 1Y8PB 1HRJA 1OTCA 4FVMA 4G7ZC 3A7AB 2HIVA 2WIIB 1X32A 5C3WA 4AH6A 5M5XH 3U58A 3WDNA 4QY7A 1PYWD 1CKNB 3NBIA 4KK7A 4BBSB 4CHTB 1N33Q 5FO8B 5IGEA 5GAHC 1G6PA 3S17B 1EIHA 3ERQA 4RGNA 1SRUA 2K5DA 5IGBA 3H6MA 3J7ZC 1VQBA 3P20A 1EY4A 4B3ML 4K8IA 1JJ2A 3QB3A 4R4QA 4CJ1B 1DYQA 4ZUIA 1TS3A 1NTGA 5FO7B 1D2BA 1BCPB 4A3DB 1VQ5A 3KJOA 4DV7L 4HCEA 1TXYA 3S1MH 3FVQA 4A3LG 2JA5G 1J6QA 2L55A 2RNNA 1X65A 1LTSD 3IL8A 5ELNA 4BS9A 2DJFC 2FXQA 4JG2A 1Y02A 4GNXC 4OONA 3URYA 4J1MA 3MZ5A 3A5ZB 1QILA 2AUKA 2F0MA 2L4NA 4NKLA 3SE0A 2RDFA 3T1HQ 1FVIA 4BXXH 1GHKA 4RA8A 5KYIA 1LLRD 4DR3Q 2UXBL 2ZTEA 5DNFA 4Z9CB 3NTIA 2CH4A 4N8X1 2W51A 1FYCA 5FLXL 4LF7Q 3FKIG 1MGSA 4XQJA 2ALYB 4X3UA 3VR2A 2XWBB 3NK9A 3HOXG 5I4DA 5NUCA 2BH2A 1HNWQ 2JK8A 2ZTDA 3CKIB 3UDIA 1I3QH 5IYDH 3RLNA 4KHZA 4HIDA 3G6EA 3AEVA 2B2TA 4ABNA 1Q86C 1QWYA 2B29A 1IYUA 5FK9C 4DXGA 3RNUA 3R8BA 2Z6KC 2EZVA 1F2ZA 2KCMA 4FYDA 2LFNA 2AQ1B 3UDGA 4LFBQ 2UUCQ 1V43A 1I4QA 5BR8Q 4A3EH 3JAMi 1GKUB 2CVRA 5EPKA 3DM3A 4C1NK 1VQDA 1BOSA 3NELA 2UU9L 4TKOB 4A76A 2M2LA 2NVQB 3PO3B 2DNCA 4IN3A 5J39A 1SROA 5C0XI 1EUJA 4NW2A 4PZ7A 2R92H 4KN7C 5CGKA 5CMDA 1MIUA 1NCVA 2A5HA 1TWCB 4X3TA 2FMCA 1EY0A 4GNXA 1G291 4IURA 2RBMA 1VQJA 4QMGA 4YWMA 1HA6A 3V2TA 4R9WA 5EKIA 1S40A 4K2KA 2PYKA 1WFQA 2X69A 1D6EC 1B3AA 1MKHA 2B63B 3STBC 1JEIA 1LM0A 3GTPB 1RF2D 3CAMA 5C5MA 3S9WA 4A3MG 2Q2UA 1CKOA 1Q46A 5GAGC 1Q8IA 2JE6I 2Z6BA 2RSOA 5EKLA 4MIUA 3MHBA 1IYJB 1EN7A 1LTRD 2PZWA 1GOZA 2NZOA 1JB3A 3FDTA 2Q8TA 3Q0AA 5I6YA 1NAPA 1LTAD 2IY5B 3ONAB 1LTID 3G48A 4S3SA 1EY6A 3SXHA 4NXNQ 5JJIA 2QEJC 4DR6Q 1X9NA 1TS4A 3PUYA 3S1NH 1Z7TA 3G4SA 5T1IA 3GQBA 4HJ7A 2L15A 1Q8KA 2CW0D 3DXJC 3EJIA 4UPAA 1WD0A 3KF8B 5KNBA 1CQVA 1HQMC 5IGGA 2ID0A 5IYBG 1HR0W 4X6AH 1HFNA 2CCZA 3BVZA 1JOOA 1HNWL 1WCMH 1EIFA 4DR2L 1CSQA 1Q1EA 1PTOD 1GXDC 1HZAA 1ET6A 2PNRC 3CRKC 3N52A 1PHJA 5IP7G 3GTJH 3HOUB 4IALA 4LFCQ 3FKIH 3SGIA 3GDEA 2PMZB 2RQXA 2EXDA 1W6JA 2VXWA 4CBVA 2Z4HA 1VQPA 1ASZA 4ME5A 4C3JB 1U4PA 1PVOA 1GKHA 5CV6A 1STNA 1VQ8A 1J8IA 4DPGA 3T51B 1YHQA 2F3VA 4B3TQ 5EPLA 1E3PA 4LAAA 1YNXA 3F1ZA 1RKNA 3CC7A 3PO3G 2KHJA 4BY1G 1LTTD 1NUCA 3TDQA 1XX8A 2VNUD 2VS1A 1JE5A 1BBUA 5JPNC 2VB3X 2EQSA 4B3RL 1SE4A 1X3QA 2EY2A 2NBFA 3PUVA 3BDCA 2JVWA 4IPHA 2K5WA 3T1HL 3H0GH 1KDAA 4OGQC 4XYOA 3UDXA 5LL6S 4UP9A 3NQTA 1VQ4A 5BN4A 4AIMA 1MBYA 4A4IA 1C9OA 1TKWB 2HDLA 2PW7A 4WFN3 1KNAA 4DXFA 4GOPA 1IW7D 4DAMA 1EEFD 4JI5Q 4ZCKA 2WP8J 2JP1A 4LF8L 2F4IA 2VQFL 4A93B 2EYPA 1K3BC 1VQOA 2GVAA 3FP9A 1U5KA 4YCVA 3I2ZA 2OTLA 3CCMA 4A3EG 4IPDA 2RSNA 1IKMA 1VQMA 2WB1B 5T1GA 2UUCL 3CXCA 4YHHL 1YNND 5D3IB 4DV2Q 3C1EA 2EYLA 4Y52H 2JYOA 4QGUA 3AMUA 3MXGA 5JAVA 2MP1A 3HOYG 3BYTB 3KLSA 3CP0A 3RN5A 3OMGA 4NDXA 4IQZA 1KAWA 1GUTA 2VY3A 3I8ZA 5KYLA 4HAEA 4C3JH 1KABA 2WB1E 3I7FA 1AN8A 4GOPB 4A3CG 1EWHA 4IUQA 1PZID 1SJHD 3F2UA 4JI6L 1I4HA 2N49A 4X66L 1XJVA 1F9PA 3S16H 2UXDL 1DXMA 1ENCA 1QNKA 4UP8A 4X3SA 1ZS9A 4ZKCB 1LTLA 1MJCA 4A3FG 5ELCA 5IP9G 1PDQA 4P75A 1EIGA 3FEWX 4CJ0B 3Q6SA 4QL5A 4BY7G 1NMGA 2E2IH 2PQEA 2KECA 3K81C 4X3KA 3K0YA 2HIXA 5CV4A 1ESRA 5C4XH 1FJGL 2A8VA 1IL2A 1DD2A 2IW3A 4JVZA 2UXCQ 5FLMH 4A3IG 3OTOL 4IFDI 1YEZA 4CKCA 2ODCI 4JI1Q 3J7A5 5ELFA 2HUGA 4ZRZA 2JA7H 3MVVA 1GHJA 4DR3L 2B2UC 2QILA 1F2LA 2E75C 1I5FA 2I5MX 3U50C 3GTMH 4TQUS 3MEHA 1F77A 1I50H 1SE3A 4L5SA 4HJ8A 4JBKA 5A2QE 1GO3E 3GTGB 1CI3M 3QIAA 3FLGA 2PQAB 1Y8NB 3PQIA 3MAQA 2XGTA 2AQ2B 4JI3L 1E7ZA 4OWXB 4RHRA 1NNXA 2A69C 3J81i 2SNSA 5EKKA 1SYGA 3RMHA 1STYA 2K05A 1CUKA 4DV4L 1STAA 3M3YB 1Y1VH 5C3XA 1K28A 1QG7A 1G2SA 3LX0A 3KOJA 1L0WA 1B7YB 1OXSC 2KEEA 3EN2A 5IWAQ 4A3DG 3OW2A 2IL8A 2X6LA 3RLFA 1WTHA 1K83B 1M1KC 3PO3H 3VYUA 3RZDH 5BR8L 1U4MA 2E2HB 2AHOB 4OO1G 3MXPA 4ULLA 4I7AA 3H91A 1EQQA 1O7IA 3S2HH 1YVCA 1N33L 1CM9A 3KK7A 3HOYH 4BITA 2ZXOA 1HR0Q 3HOZB 2L1BA 3T13A 5C4JH 1YITA 3J7AF 5LL6X 1V1PB 3C3LA 2R92G 4IJHA 4MN3A 1NBWA 4P71A 1WJJA 1W3SA 1SBBB 4JI2Q 4NMZA 2A68C 2MGSA 2E5LQ 2GVBA 3HS0C 1TIID 4CKEA 1I3QB 3A8JE 4KD3A 2CWPA 3OIPA 1XNRQ 1A62A 2B39A 2UUBQ 4GKJL 3MTSA 3GTQB 1WTVA 1S5CD 3CQZH 1J5EL 5FLXE 5CIUA 1G51A 3Q22A 3NWSA 4QCLA 1ZBHA 5C0XJ 4JV5L 4X64Q 5HGQA 5IY0A 3OHXC 3J80i 3H3VH 2RVLA 3W2DA 1CKMA 1EY9A 1Q3LA 1RCVD 2E74C 3RZOB 4XT3B 3GTOB 1K9MC 5J1ZA 2E2HH 2TSSA 4O2DA 2ZJQA 4BBRB 3E9IA 2E2DC 2HHHQ 1TU2B 5FKAC 3GTLB 3QWNA 4A3IH 3M7NA 5IT9E 3S1MB 2LC3A 1EZ8A 4WRDA 3M3YH 3OPOA 4OELB 1HZCA 4KJOA 4RCOA 1PZKD 3CCRA 3HOWB 1JJGA 4C1NI 3CCJA 2MO1A 3PCOB 1K3RA 1H9KA 3F2BA 4DV5Q 5DAUA 1PRTB 3R2TA 3RLOA 4LUVA 4HIMA 1DOLA 2WAQB 2L9HA 4DV7Q 3M4OH 4BBSH 1X3EA 4BBRG 2Z6KA
chains in the Genus database with same CATH topology
3ERSX 5M5WH 4C2MH 2JA5G 1J6QA 2KCTA 1OXUA 3UE0A 1HZBA 1X65A 1PH2A 3JAMc 2UU9Q 5ELNA 4RG1A 2UUBL 2NVYH 4DR1Q 1XNQQ 2K14A 3K7UC 2PNHA 2IX1A 2FXQA 5GROA 4JG2A 1Y02A 4QJFA 4GNXC 4JOIA 4AYBE 4DV6L 5GQOA 4OONA 1N32Q 4R4TA 1VQCA 4MZ9A 3M85A 4A3MH 4LF8Q 4PZ8A 2UXCL 3S24A 3A5ZB 4J15A 3J80c 4LF4Q 2V1CC 5M5YH 2K5NA 5E7NA 3T1HQ 1FVIA 4BXXH 4R1JA 5AJ3Q 3ULLA 3F2DA 4DR3Q 1KL9A 2ZTCA 4KHPQ 2UXBL 1BBWA 2ZTEA 1S3OA 2W51A 1L1OB 2D0PA 1KRSA 3CCLA 2HJQA 3FKIG 4LF7Q 1HZ9A 2ALYB 1XNRL 2R7ZH 1RIPA 1N34Q 1GD7A 2ZJPA 2ASBA 2XTIA 3K8AA 3HOXG 1BKBA 3PF4A 4NB3A 4JI5L 2IHFA 2BH2A 4DUYL 1IBKL 2JK8A 2ZTDA 1E7LA 3UDIA 1I3QH 1HNWQ 3RLNA 2JEBI 5IYDH 3AQQA 4X62L 5FJ8G 4KHZA 4HIDA 4LUOA 2I5LX 3G6EA 2K4KA 3AEVA 3PGZA 3K80C 4R4CA 3OTOQ 3CF5A 1QZHA 1UWVA 1B70B 2ZM6Q 1EFWA 2VUMH 1QVCA 1Q86C 1OXVA 2B29A 2EIFA 5LMNQ 1X3FA 3RNUA 1C0AA 1WOCA 1X56A 5FLXc 3M4QA 3FHWA 2Z6KC 4Y7NH 3I4NG 4NXNL 2KCMA 1E24A 2K5VA 2NN6G 3A74A 2E5LL 3A5UA 1L1OC 2JA6H 1TWAH 3UDGA 4LFBQ 2UUCQ 1V43A 2YTXA 4OXPA 5BR8Q 2YTVA 4A3EH 1UE5A 3HOVH 3JAMi 3MXNB 1S72A 1GKUB 1UEBA 3KJPA 3DM3A 5IP7H 2UU9L 1VQDA 3NELA 1KHIA 3ULPA 4IO9A 4A76A 4BBSG 4A93H 2OTJA 4IFDJ 1TWHH 4PG3A 4DV0Q 1SROA 2N78A 3D31A 5C0XI 2JA5H 1EUJA 4PZ7A 2JA8G 2R92H 4JI8L 5IE8A 2QNFA 1MIUA 2UXDQ 3HOWG 4ALPA 4UY8C 3AYHB 4X66Q 4GNXA 3CCUA 1V9PA 1KQSA 1G291 1H95A 1YJNA 1VQHA 3HOWH 1XTDA 1VQJA 4YWMA 2CKZB 5C44H 4BY1H 2ZJRA 1S40A 1IBMQ 1WFQA 5IYCH 4GKKQ 2WAQG 1L1OA 2D62A 1MKHA 4GN5A 1N36L 2R93H 4LF6Q 3STBC 1N8RC 1JEIA 3HKZE 4EX5A 1LM0A 5K36G 2Z0SA 3CAMA 4A3MG 4YWKA 1A0IA 3ZJYC 2F4VQ 3S17H 2Q2UA 1N32L 1CKOA 1Q46A 5C3EG 4JI4Q 4XIGS 5GAGC 2JE6I 1Z47A 1R9TH 1IYJB 1N34L 1TWCH 4DR1L 3U4ZA 1E7DA 1SE8A 5C3EH 3RZOH 4DUZL 1EN7A 4JYAL 4DR4L 3GTLH 2MNAA 3CW2C 4B3RQ 2K52A 4DR4Q 4A93G 4BBRH 2NZOA 2LXKA 2H5XA 1WYDA 1TWFH 4P74A 3HOXH 4B3SQ 1YJWA 4C3HH 4MTNA 1NJIC 4DV4Q 4ME3A 4GLXA 3W1BA 4LF4L 2IY5B 4KLKA 3ULJA 2K75A 5C4XG 3G48A 3W1GA 1PH5A 2Y0SG 1K0RA 3I4MH 4DR6L 2PMZE 4NXNQ 5JJIA 2VZAA 2KFVA 2WB1G 1X9NA 2KHIA 2YU9H 4DR6Q 2DK4A 4YHHQ 2JA9A 4DNIA 4DV2L 1YNSA 3PUYA 2B63G 2A19A 3S1NH 3G4SA 5FLMG 4HJ7A 2L15A 1Q8KA 2LXJA 1QZGA 4UPAA 3KF8B 4DR7Q 1HR0W 3I4NH 5IYBG 2ID0A 4JC0A 4JBJA 4OX9L 2JA7G 4X6AH 1XPOA 1X6OA 2CCZA 1HNXL 3KF6A 3AFQA 4LWCA 1IBKQ 1HNWL 1P8LA 1QVFA 1WCMH 1EIFA 4JBWA 4DR2L 3W5OA 4NXMQ 3HOUH 2R7ZG 1CSQA 3KFUA 2VQFQ 1Q1EA 4AQYQ 3TQYA 4IPGA 4YCUA 2R7DA 2KENA 4NXML 1PYBA 3K0XA 4EQ5A 1SN8A 1HZAA 1PHJA 4JV5Q 4JOIC 5IP7G 3I56A 1PH1A 3CMEA 3CD6A 1VQ9A 3GTJH 1TWGH 4LFCQ 3FKIH 3SGIA 5LMNL 3GDEA 4UP7A 3PIPA 2EXDA 3BZCA 2UUAL 1YZ6A 4GKKL 1VQGA 2VUMG 1VQPA 4RMFA 1HNZL 2LD7A 1ASZA 1PVOA 4L5TA 1GKHA 1P16A 1A63A 2HQLA 1VQ8A 1OXTA 5M3MH 1NY4A 1IXRA 2BH8A 2PI2E 4KI0A 4DPGA 1YHQA 5IYDG 4LFAL 4B3TQ 5IYCG 2HT1A 4IFDG 1E3PA 1YNXA 3F1ZA 3CC7A 1B8AA 1D8LA 5LMUQ 1VQIA 1KC8C 2KHJA 2Q2HA 2YV5A 4PMWA 4BY1G 4DK6C 5C44G 2VL6A 2PQAA 1YIJA 2VS1A 4JI6Q 2VNUD 1JE5A 1BBUA 3RR5A 3KF6B 2EQSA 1I94L 2QNCA 1Q12A 2CWAA 4B3RL 2MQHA 1JJCB 4QQBX 2NVTH 4IOCA 4TVAB 3BJUA 2DUDA 3PUVA 1JMCA 4IPHA 3Q8DA 3GTPH 3T1HL 4K0KQ 1EYGA 2MO0A 3H0GH 5JEAG 3BZKA 3UDXA 4LF6L 2E8GA 2N3SA 4YWLA 4UP9A 1PH6A 3H3VI 3A0JA 4A3GG 4AYBG 3M9BA 2JQOA 4X65L 1VQ4A 4A3KG 2I5HA 4AIMA 1XMQQ 1M90C 1Y14B 4GS3A 2RHQB 4X65Q 1VQEA 4A4IA 1C9OA 4DV3L 4APVA 2C35B 2VQEL 4HJ9A 2ATWA 1VQKA 2R7FA 2AWNA 4GOPA 4DAMA 1CKNA 2AWOA 4A3JG 4JI5Q 3KDFB 1PFSA 2WP8J 4LF8L 3TRZA 4XTCS 2VQFL 1PH9A 5LMNW 5JEAJ 1E1TA 4AQYL 2Q2TA 4L5RC 1VQOA 2VW9A 1WI5A 2ZM6L 4GOPC 1A8VA 2GVAA 3FP9A 2NVXH 3TEHB 4JI1L 1U5KA 1VQFA 3EIVA 4YCVA 3I2ZA 1YJ9A 3CCMA 4A3EG 5IP9H 2JJQA 4IPDA 2OTLA 4LF9Q 4POGA 2R93G 3H0GG 5AJ3L 3CC2A 1AE3A 2F52A 1K8GA 1VQMA 4DV1Q 4DR5L 1EIYB 4LFBL 4A75A 2UUCL 3CXCA 2AKWB 4C3IH 4YHHL 4DV2Q 1D7QA 1PH4A 3ICEA 1NE3A 2AMCB 3B6YA 4QGUA 1Q7YC 3HKSA 4Y52H 1U0LA 1V1QA 1VCIA 4OX9Q 3HOYG 3S2HH 1Q82C 3CP0A 3RN5A 3S2DH 1FL0A 3UE1A 4A3KH 1VQNA 1KAWA 4DR2Q 2VY3A 5LMUL 4C3JH 4A3GH 2WB1E 3I7FA 4HJ5A 4B3TL 4GOPB 4HIOA 4A3CG 3MEFA 3S1RH 3HOZG 5JJKA 3KDFA 2QEXA 4JI6L 2N49A 4X66L 3GO5A 1XJVA 3S16H 1OXXK 2IT1A 4O0AA 4P72A 2UXDL 1QUQA 1XMOL 1JT8A 3PUWA 4UP8A 1VQLA 3GTKH 3HOUG 1ZS9A 2RCNA 1HH2P 2YTYA 1LTLA 4HJAA 1MJCA 4K0KL 4A3FG 1EQRA 5IP9G 1IBLL 1PH3A 3OYYA 4NPSA 4P75A 1WCMG 1GM5A 5J3BA 4JI2L 5GADC 1N36Q 2I0QA 3KLWA 4OWWB 4QL5A 3S14H 1PV4A 2UXBQ 4BY7G 1NMGA 2E2IH 4YCWA 3PO2G 1FGUA 1XMQL 1Y1WH 3CC4A 1Z9FA 2K5HA 2OCEA 3K81C 1XNQL 2HIXA 2NZHA 1PH7A 2CFMA 5C4XH 1HR0L 1AE2A 4IOAA 4GKJQ 3JC66 5DLQE 1X54A 1FJGL 1W2BA 2A8VA 4A3LH 4R4OA 2QA4A 1IL2A 1KXLA 4JI0L 3K7AH 3I55A 1J5EQ 2UXCQ 4QIWE 5FLMH 4A3IG 4B3SL 1GVPA 1CSPA 1YEZA 3WWVA 3OTOL 4LNQA 4IFDI 4A3BH 2ODCI 4JI1Q 1JB7A 3J7A5 4DAYB 2JA7H 4P73A 1VS0A 3CCVA 4DR3L 4A3FH 1KIXA 1K83H 2BA1A 3J81j 4A3CH 2QGQA 3L0OA 4A3BG 3GD7A 3PV0A 4POFA 1QVGA 1H9EA 1I5FA 2I5MX 3U50C 1LYLA 3GTMH 4TQUS 2HHHL 1I50H 1GL9B 1UE1A 5EAYA 4L5SA 3PUZA 4LF7L 4BA2I 3IRBA 4LW1A 4HJ8A 4DR7L 2ODGC 4JBKA 3L2PA 1GO3E 3S15H 3UDFA 2F3IA 4YY3Q 3D0FA 1T9HA 3J81c 4JI7L 3GTGH 2PQAB 4DK3C 4JI3Q 3TREA 1MJEA 2PI2A 2XGTA 2A1AA 4JI7Q 1SLJA 4JI3L 3F2CA 2WFWA 3S1QH 1E7ZA 4OWXB 4WJ4A 3PO2H 1N9WA 3ER0A 3F8TA 4X64L 5H1SE 1SR3A 3J81i 3E0EA 2YYZA 4FDBA 1Q81C 2OWOA 2CQOA 2KBNA 1CUKA 4MNOA 4DV4L 1BVSA 1Y1VH 1K8AC 1L0WA 3KOJA 1B7YB 1OXSC 3STBD 3CMAA 4DR5Q 1PA6A 4IPCA 1XMOQ 2UUAQ 2NVQH 3EN2A 2GN5A 3RN2A 3PF5A 4R4IA 4OWTB 1IBML 5IWAQ 4A3JH 4A3DG 2NN6I 3OW2A 4JCVE 4LF5Q 5FJ8H 1VQ7A 1YHBA 5M3MG 1KD1C 3RLFA 3VDYA 2IHEA 1M1KC 2B3GA 4GLVB 3PO3H 4GLAC 4PZ6A 4GN4B 3RZDH 5BR8L 1PH8A 1NMFA 1VQAA 2AHOB 3HFZB 4OO1G 4LFAQ 4JI4L 1EQQA 1ASYA 4DV0L 4BY7H 1O7IA 1HNXQ 4JBMA 2OQ0A 3CPFA 5IYBH 1H9FA 1YVCA 5M3FH 2IX0A 5IT9c 1YHAA 1C7YA 1FJGQ 1N33L 2JA6G 2ES2A 3HOYH 5C0XG 1I94Q 1HR0Q 1YI2A 3GTQH 4JI8Q 4DV5L 5C4JH 1QUQB 4B3MQ 4DV6Q 1YITA 2Y0SE 2R92G 4IJHA 3CCSA 5HY6A 4LFCL 1NBWA 4IJLA 1EOVA 1UE7A 1L2FA 1WJJA 3AFPA 4P71A 3CCQA 4WJ3M 3I4MG 1W3SA 1E22A 4JI2Q 2RF4A 2Q2IA 1IBLQ 3PUXA 3CCEA 2E5LQ 2GVBA 1IZ6A 1VQ6A 1EWIA 4A3LG 2CWPA 2MPHA 2LSSA 1Y1VG 1A62A 1XNRQ 1SMXA 2UUBQ 2F4VL 4GKJL 2VQEQ 4BXXG 1KRTA 3HOVG 4DV3Q 4DUZQ 4GNXB 4JYAQ 3T1YQ 4DUYQ 3HOZH 3NBHB 3TS0A 3CQZH 3NENA 3T1YL 1J5EL 4YY3L 3G71A 1G51A 2E2JH 4JI0Q 4DKAC 1RL2A 4X62Q 1X3GA 1DGSA 5C0XJ 4JV5L 4X64Q 1X55A 4OO1I 5HGQA 1HJPA 5IY0A 1I6HH 2JEAI 5M3FG 3J80i 1Y1WG 3H3VH 4LUZA 3BU2A 1XPUA 1CKMA 3CPWA 4DV1L 2DGYA 3LGJA 4BA1I 4LF9L 2D0OA 3E9HA 1E1OA 1K9MC 2E2HH 1UE6A 2R6GA 4O2DA 3L7ZC 3DLLA 1OTCA 2ZJQA 5IWAL 4LF5L 3E9IA 3EBEA 2HHHQ 3TS2A 2HIVA 5M5XH 4AH6A 2JA8H 3U58A 4A3DH 2K50A 4QY7A 4KHPL 4H02A 1CKNB 3HKZG 4L5QA 5ELOA 4A3IH 3M7NA 2B63H 3U4VA 2LC3A 1N33Q 3M4PA 2WAQE 3M3YH 5GAHC 1G6PA 1HZCA 1SFOH 1XPRA 3I4OA 3H15A 3CCRA 2MFIA 1JJGA 1SRUA 3NEMA 1PYSB 5JJLA 3J7ZC 1VQBA 4GN3B 2RHSB 2MO1A 3PCOB 1K3RA 3F2BA 2BA0A 3CCJA 4DV5Q 4R4QA 1JJ2A 4B3ML 1GJJA 3RLOA 1Q1BA 4LUVA 3KYHC 4HIMA 1AH9A 1NTGA 1K73C 3PO3G 3PIOA 2OQKA 1VQ5A 4DV7Q 3M4OH 2G80A 1HNZQ 2N8NA 3KJOA 1LUZA 5GAEC 4DV7L 4BBSH 1X3EA 1TXYA 4BBRG 2Z6KA 3S1MH 3PSIA 3GTOH 4HIKA 1YBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERS X;  5M5W H;  4C2M H;  2JA5 G;  1J6Q A;  2KCT A;  1OXU A;  3UE0 A;  1HZB A;  1X65 A;  1PH2 A;  3JAM c;  2UU9 Q;  5ELN A;  4RG1 A;  2UUB L;  2NVY H;  4DR1 Q;  1XNQ Q;  2K14 A;  3K7U C;  2PNH A;  2IX1 A;  2FXQ A;  5GRO A;  4JG2 A;  4QJF A;  4GNX C;  4JOI A;  4AYB E;  4DV6 L;  5GQO A;  4OON A;  1N32 Q;  4R4T A;  1VQC A;  4MZ9 A;  3M85 A;  4A3M H;  4LF8 Q;  4PZ8 A;  2UXC L;  3S24 A;  3A5Z B;  4J15 A;  3J80 c;  4LF4 Q;  2V1C C;  5M5Y H;  2K5N A;  5E7N A;  3T1H Q;  1FVI A;  4BXX H;  4R1J A;  5AJ3 Q;  3ULL A;  3F2D A;  4DR3 Q;  1KL9 A;  2ZTC A;  4KHP Q;  2UXB L;  1BBW A;  2ZTE A;  1S3O A;  4LF7 Q;  1L1O B;  2D0P A;  1KRS A;  3CCL A;  2HJQ A;  3FKI G;  1HZ9 A;  2ALY B;  1XNR L;  2R7Z H;  1RIP A;  1N34 Q;  1GD7 A;  2ZJP A;  2ASB A;  2XTI A;  3K8A A;  3HOX G;  1BKB A;  3PF4 A;  4NB3 A;  4JI5 L;  2IHF A;  2BH2 A;  4DUY L;  1IBK L;  2JK8 A;  2ZTD A;  1E7L A;  3UDI A;  1I3Q H;  1HNW Q;  3RLN A;  2JEB I;  5IYD H;  3AQQ A;  4X62 L;  5FJ8 G;  4KHZ A;  4HID A;  4LUO A;  2I5L X;  3G6E A;  2K4K A;  3AEV A;  3PGZ A;  3K80 C;  4R4C A;  3OTO Q;  3CF5 A;  1QZH A;  1UWV A;  1B70 B;  2ZM6 Q;  1EFW A;  2VUM H;  1QVC A;  1Q86 C;  1OXV A;  2B29 A;  2EIF A;  5LMN Q;  1X3F A;  3RNU A;  1C0A A;  1WOC A;  1X56 A;  5FLX c;  3M4Q A;  3FHW A;  2Z6K C;  4Y7N H;  3I4N G;  4NXN L;  2KCM A;  1E24 A;  2K5V A;  2NN6 G;  3A74 A;  2E5L L;  3A5U A;  1L1O C;  2JA6 H;  1TWA H;  3UDG A;  4LFB Q;  2UUC Q;  1V43 A;  2YTX A;  4OXP A;  5BR8 Q;  2YTV A;  4A3E H;  1UE5 A;  3HOV H;  3JAM i;  3MXN B;  1S72 A;  1UEB A;  3KJP A;  3DM3 A;  5IP7 H;  2UU9 L;  1VQD A;  3NEL A;  1KHI A;  3ULP A;  4IO9 A;  4A76 A;  4BBS G;  4A93 H;  2OTJ A;  4IFD J;  1TWH H;  4PG3 A;  4DV0 Q;  1SRO A;  2N78 A;  3D31 A;  5C0X I;  2JA5 H;  1EUJ A;  4PZ7 A;  2JA8 G;  2R92 H;  4JI8 L;  5IE8 A;  2QNF A;  1MIU A;  2UXD Q;  3HOW G;  4ALP A;  4UY8 C;  3AYH B;  4X66 Q;  4GNX A;  3CCU A;  1V9P A;  1KQS A;  1G29 1;  1H95 A;  1YJN A;  1VQH A;  3HOW H;  1XTD A;  1VQJ A;  4YWM A;  2CKZ B;  5C44 H;  4BY1 H;  2ZJR A;  1S40 A;  1IBM Q;  1WFQ A;  5IYC H;  4GKK Q;  2WAQ G;  1L1O A;  2D62 A;  1MKH A;  4GN5 A;  1N36 L;  2R93 H;  4LF6 Q;  3STB C;  1N8R C;  4EX5 A;  3HKZ E;  1LM0 A;  5K36 G;  2Z0S A;  3CAM A;  4A3M G;  4YWK A;  1A0I A;  3ZJY C;  2F4V Q;  3S17 H;  2Q2U A;  1N32 L;  1CKO A;  1Q46 A;  5C3E G;  4JI4 Q;  4XIG S;  5GAG C;  2JE6 I;  1Z47 A;  1R9T H;  1IYJ B;  1N34 L;  1TWC H;  4DR1 L;  3U4Z A;  1E7D A;  1SE8 A;  5C3E H;  3RZO H;  4DUZ L;  1EN7 A;  4JYA L;  4DR4 L;  3GTL H;  2MNA A;  3CW2 C;  4B3R Q;  2K52 A;  4DR4 Q;  4A93 G;  4BBR H;  2NZO A;  2LXK A;  2H5X A;  1WYD A;  1TWF H;  4P74 A;  3HOX H;  4B3S Q;  1YJW A;  4C3H H;  4MTN A;  1NJI C;  4DV4 Q;  4ME3 A;  4GLX A;  3W1B A;  4LF4 L;  2IY5 B;  4KLK A;  3ULJ A;  2K75 A;  5C4X G;  3G48 A;  3W1G A;  1PH5 A;  2Y0S G;  1K0R A;  3I4M H;  4DR6 L;  2PMZ E;  4NXN Q;  5JJI A;  2VZA A;  2WB1 G;  1X9N A;  2YU9 H;  2KHI A;  4DR6 Q;  4YHH Q;  2JA9 A;  4DNI A;  4DV2 L;  3PUY A;  2B63 G;  2A19 A;  3S1N H;  3G4S A;  5FLM G;  4HJ7 A;  2L15 A;  1Q8K A;  2LXJ A;  1QZG A;  4UPA A;  3KF8 B;  4DR7 Q;  1HR0 W;  3I4N H;  5IYB G;  2ID0 A;  4JC0 A;  4JBJ A;  4OX9 L;  2JA7 G;  4X6A H;  1XPO A;  1X6O A;  2CCZ A;  1HNX L;  3KF6 A;  3AFQ A;  4LWC A;  1IBK Q;  1HNW L;  1P8L A;  1QVF A;  1WCM H;  1EIF A;  4JBW A;  4DR2 L;  3W5O A;  4NXM Q;  3HOU H;  2R7Z G;  1CSQ A;  3KFU A;  2VQF Q;  1Q1E A;  4AQY Q;  3TQY A;  4IPG A;  4YCU A;  2R7D A;  2KEN A;  4NXM L;  1PYB A;  3K0X A;  4EQ5 A;  1SN8 A;  1HZA A;  1PHJ A;  4JV5 Q;  4JOI C;  5IP7 G;  3I56 A;  1PH1 A;  3CME A;  3CD6 A;  1VQ9 A;  3GTJ H;  1TWG H;  4LFC Q;  3FKI H;  3SGI A;  5LMN L;  3GDE A;  4UP7 A;  3PIP A;  2EXD A;  3BZC A;  2UUA L;  1YZ6 A;  4GKK L;  1VQG A;  2VUM G;  1VQP A;  4RMF A;  1HNZ L;  1ASZ A;  1PVO A;  4L5T A;  1GKH A;  1P16 A;  1A63 A;  2HQL A;  1VQ8 A;  1OXT A;  5M3M H;  1NY4 A;  1IXR A;  2BH8 A;  2PI2 E;  4KI0 A;  4DPG A;  1YHQ A;  5IYD G;  4LFA L;  4B3T Q;  5IYC G;  2HT1 A;  4IFD G;  1E3P A;  1YNX A;  3F1Z A;  3CC7 A;  1B8A A;  1D8L A;  5LMU Q;  1VQI A;  1KC8 C;  2KHJ A;  2Q2H A;  2YV5 A;  4PMW A;  4BY1 G;  4DK6 C;  5C44 G;  2VL6 A;  2PQA A;  1YIJ A;  2VS1 A;  4JI6 Q;  2VNU D;  1JE5 A;  1BBU A;  3RR5 A;  3KF6 B;  2EQS A;  1I94 L;  2QNC A;  1Q12 A;  2CWA A;  4B3R L;  2MQH A;  1JJC B;  4QQB X;  2NVT H;  4IOC A;  4TVA B;  3BJU A;  2DUD A;  3PUV A;  1JMC A;  4IPH A;  3Q8D A;  3GTP H;  3T1H L;  4K0K Q;  1EYG A;  2MO0 A;  3H0G H;  5JEA G;  3BZK A;  3UDX A;  4LF6 L;  2E8G A;  2N3S A;  4YWL A;  4UP9 A;  1PH6 A;  3H3V I;  3A0J A;  4A3G G;  4AYB G;  3M9B A;  2JQO A;  4X65 L;  1VQ4 A;  4A3K G;  2I5H A;  4AIM A;  1XMQ Q;  1M90 C;  1Y14 B;  4GS3 A;  2RHQ B;  4X65 Q;  1VQE A;  4A4I A;  1C9O A;  4DV3 L;  4APV A;  2C35 B;  2VQE L;  4HJ9 A;  2ATW A;  1VQK A;  2R7F A;  2AWN A;  4GOP A;  4DAM A;  1CKN A;  2AWO A;  4A3J G;  4JI5 Q;  3KDF B;  1PFS A;  2WP8 J;  4LF8 L;  3TRZ A;  4XTC S;  2VQF L;  1PH9 A;  5LMN W;  5JEA J;  1E1T A;  4AQY L;  2Q2T A;  4L5R C;  1VQO A;  2VW9 A;  1WI5 A;  2ZM6 L;  4GOP C;  1A8V A;  2GVA A;  3FP9 A;  2NVX H;  3TEH B;  4JI1 L;  1U5K A;  1VQF A;  3EIV A;  4YCV A;  3I2Z A;  1YJ9 A;  3CCM A;  4A3E G;  5IP9 H;  2JJQ A;  4IPD A;  2OTL A;  4LF9 Q;  4POG A;  2R93 G;  3H0G G;  5AJ3 L;  3CC2 A;  1AE3 A;  2F52 A;  1K8G A;  1VQM A;  4DV1 Q;  4DR5 L;  1EIY B;  4LFB L;  4A75 A;  2UUC L;  3CXC A;  2AKW B;  4C3I H;  4YHH L;  4DV2 Q;  1D7Q A;  1PH4 A;  3ICE A;  1NE3 A;  2AMC B;  3B6Y A;  4QGU A;  1Q7Y C;  3HKS A;  4Y52 H;  1U0L A;  1V1Q A;  1VCI A;  4OX9 Q;  3HOY G;  3S2H H;  1Q82 C;  3CP0 A;  3RN5 A;  3S2D H;  1FL0 A;  3UE1 A;  4A3K H;  1VQN A;  1KAW A;  4DR2 Q;  2VY3 A;  5LMU L;  4C3J H;  4A3G H;  2WB1 E;  3I7F A;  4HJ5 A;  4B3T L;  4GOP B;  4HIO A;  4A3C G;  3MEF A;  3S1R H;  3HOZ G;  5JJK A;  3KDF A;  2QEX A;  4JI6 L;  2N49 A;  4X66 L;  3GO5 A;  1XJV A;  3S16 H;  1OXX K;  2IT1 A;  4O0A A;  4P72 A;  2UXD L;  1QUQ A;  1XMO L;  1JT8 A;  3PUW A;  4UP8 A;  1VQL A;  3GTK H;  3HOU G;  2RCN A;  1HH2 P;  2YTY A;  1LTL A;  4HJA A;  1MJC A;  4K0K L;  4A3F G;  1EQR A;  5IP9 G;  1IBL L;  1PH3 A;  3OYY A;  4NPS A;  4P75 A;  1WCM G;  1GM5 A;  5J3B A;  4JI2 L;  5GAD C;  1N36 Q;  2I0Q A;  3KLW A;  4OWW B;  4QL5 A;  3S14 H;  1PV4 A;  2UXB Q;  4BY7 G;  1NMG A;  2E2I H;  4YCW A;  3PO2 G;  1FGU A;  1XMQ L;  1Y1W H;  3CC4 A;  1Z9F A;  2K5H A;  2OCE A;  3K81 C;  1XNQ L;  2HIX A;  2NZH A;  1PH7 A;  2CFM A;  5C4X H;  1HR0 L;  1AE2 A;  4IOA A;  4GKJ Q;  3JC6 6;  5DLQ E;  1X54 A;  1FJG L;  1W2B A;  2A8V A;  4A3L H;  4R4O A;  2QA4 A;  1IL2 A;  1KXL A;  4JI0 L;  3K7A H;  3I55 A;  1J5E Q;  2UXC Q;  4QIW E;  5FLM H;  4A3I G;  4B3S L;  1GVP A;  1CSP A;  1YEZ A;  3WWV A;  3OTO L;  4LNQ A;  4IFD I;  4A3B H;  1JB7 A;  4JI1 Q;  3J7A 5;  4DAY B;  2JA7 H;  4P73 A;  1VS0 A;  3CCV A;  4DR3 L;  4A3F H;  1KIX A;  1K83 H;  2BA1 A;  3J81 j;  4A3C H;  2QGQ A;  3L0O A;  4A3B G;  3GD7 A;  3PV0 A;  4POF A;  1QVG A;  1I5F A;  2I5M X;  3U50 C;  1LYL A;  3GTM H;  4TQU S;  2HHH L;  1I50 H;  1UE1 A;  5EAY A;  4L5S A;  3PUZ A;  4LF7 L;  4BA2 I;  3IRB A;  4LW1 A;  4HJ8 A;  4DR7 L;  4JBK A;  3L2P A;  1GO3 E;  3S15 H;  3UDF A;  2F3I A;  4YY3 Q;  3D0F A;  1T9H A;  3J81 c;  4JI7 L;  3GTG H;  2PQA B;  4DK3 C;  4JI3 Q;  3TRE A;  1MJE A;  2PI2 A;  2XGT A;  2A1A A;  4JI7 Q;  1SLJ A;  4JI3 L;  3F2C A;  2WFW A;  3S1Q H;  1E7Z A;  4OWX B;  4WJ4 A;  3PO2 H;  1N9W A;  3ER0 A;  3F8T A;  4X64 L;  5H1S E;  1SR3 A;  3J81 i;  3E0E A;  2YYZ A;  4FDB A;  1Q81 C;  2OWO A;  2CQO A;  2KBN A;  1CUK A;  4MNO A;  4DV4 L;  1BVS A;  1Y1V H;  1K8A C;  1L0W A;  3KOJ A;  1B7Y B;  1OXS C;  3STB D;  3CMA A;  4DR5 Q;  1PA6 A;  4IPC A;  1XMO Q;  2UUA Q;  2NVQ H;  3EN2 A;  2GN5 A;  3RN2 A;  3PF5 A;  4R4I A;  4OWT B;  1IBM L;  5IWA Q;  4A3J H;  4A3D G;  2NN6 I;  3OW2 A;  4JCV E;  4LF5 Q;  5FJ8 H;  1VQ7 A;  1YHB A;  5M3M G;  1KD1 C;  3RLF A;  3VDY A;  2IHE A;  1M1K C;  2B3G A;  4GLV B;  3PO3 H;  4GLA C;  4PZ6 A;  4GN4 B;  3RZD H;  5BR8 L;  1PH8 A;  1NMF A;  1VQA A;  2AHO B;  3HFZ B;  4OO1 G;  4LFA Q;  4JI4 L;  1EQQ A;  1ASY A;  4DV0 L;  4BY7 H;  1O7I A;  1HNX Q;  4JBM A;  2OQ0 A;  3CPF A;  5IYB H;  1YVC A;  5M3F H;  1C7Y A;  2IX0 A;  5IT9 c;  1YHA A;  1FJG Q;  1N33 L;  2JA6 G;  2ES2 A;  3HOY H;  5C0X G;  1I94 Q;  1HR0 Q;  1YI2 A;  3GTQ H;  4JI8 Q;  4DV5 L;  5C4J H;  1QUQ B;  4B3M Q;  4DV6 Q;  1YIT A;  2Y0S E;  2R92 G;  4IJH A;  3CCS A;  5HY6 A;  4LFC L;  1NBW A;  4IJL A;  1EOV A;  1UE7 A;  1L2F A;  1WJJ A;  3AFP A;  4P71 A;  3CCQ A;  4WJ3 M;  3I4M G;  1W3S A;  1E22 A;  4JI2 Q;  2RF4 A;  2Q2I A;  1IBL Q;  3PUX A;  3CCE A;  2E5L Q;  2GVB A;  1IZ6 A;  1VQ6 A;  1EWI A;  4A3L G;  2CWP A;  2LSS A;  1Y1V G;  1A62 A;  1XNR Q;  1SMX A;  2UUB Q;  2F4V L;  4GKJ L;  2VQE Q;  4BXX G;  1KRT A;  3HOV G;  4DV3 Q;  4DUZ Q;  4GNX B;  4JYA Q;  3T1Y Q;  4DUY Q;  3HOZ H;  3NBH B;  3TS0 A;  3CQZ H;  3NEN A;  3T1Y L;  1J5E L;  4YY3 L;  3G71 A;  1G51 A;  2E2J H;  4JI0 Q;  4DKA C;  1RL2 A;  4X62 Q;  1X3G A;  1DGS A;  5C0X J;  4JV5 L;  4X64 Q;  1X55 A;  4OO1 I;  5HGQ A;  1HJP A;  5IY0 A;  1I6H H;  2JEA I;  5M3F G;  3J80 i;  1Y1W G;  3H3V H;  4LUZ A;  3BU2 A;  1XPU A;  1CKM A;  3CPW A;  4DV1 L;  2DGY A;  3LGJ A;  4BA1 I;  4LF9 L;  2D0O A;  3E9H A;  1E1O A;  1K9M C;  2E2H H;  1UE6 A;  2R6G A;  4O2D A;  3L7Z C;  3DLL A;  1OTC A;  2ZJQ A;  5IWA L;  4LF5 L;  3E9I A;  3EBE A;  2HHH Q;  3TS2 A;  2HIV A;  5M5X H;  4AH6 A;  2JA8 H;  3U58 A;  4A3D H;  2K50 A;  4QY7 A;  4KHP L;  4H02 A;  1CKN B;  3HKZ G;  4L5Q A;  5ELO A;  4A3I H;  3M7N A;  2B63 H;  3U4V A;  1N33 Q;  3M4P A;  2WAQ E;  3M3Y H;  5GAH C;  1G6P A;  1HZC A;  1SFO H;  1XPR A;  3I4O A;  3H15 A;  3CCR A;  2MFI A;  1JJG A;  1SRU A;  3NEM A;  1PYS B;  5JJL A;  3J7Z C;  1VQB A;  4GN3 B;  2RHS B;  2MO1 A;  3PCO B;  1K3R A;  3F2B A;  2BA0 A;  3CCJ A;  4DV5 Q;  4R4Q A;  1JJ2 A;  4B3M L;  3RLO A;  1Q1B A;  4LUV A;  3KYH C;  4HIM A;  1AH9 A;  1NTG A;  1K73 C;  3PO3 G;  3PIO A;  2OQK A;  1VQ5 A;  4DV7 Q;  3M4O H;  1HNZ Q;  2N8N A;  3KJO A;  1LUZ A;  5GAE C;  4DV7 L;  4BBS H;  1X3E A;  1TXY A;  4BBR G;  2Z6K A;  3S1M H;  3PSI A;  3GTO H;  4HIK A;  1YBY A; 
#chains in the Genus database with same CATH topology
 1EY5 A;  2PZT A;  2KCT A;  1OXU A;  1PH2 A;  2K28 A;  2UU9 Q;  4RG1 A;  4K8J A;  1XNQ Q;  3M7G A;  4DR1 Q;  2R61 A;  2PNH A;  5GRO A;  1WTR A;  3Q24 A;  2JA6 B;  5GQO A;  4R4T A;  2UXC L;  2I07 B;  3S24 A;  2WQG A;  4G7H C;  4LF4 Q;  2A68 D;  1BCP C;  5M5Y H;  5C4X B;  2CHB D;  3V05 A;  3VA5 A;  1S5E D;  5AJ3 Q;  2EXZ A;  1A15 A;  2E76 C;  3NQI A;  5HGT A;  5EBC A;  2F0T A;  1S3O A;  2L5T A;  1KRS A;  4KTA A;  5CBA E;  1HZ9 A;  4R8N A;  5KRU A;  1XNR L;  2R7Z H;  5F2D A;  3Q23 A;  2ZJP A;  4JI5 L;  5FO9 B;  4DUY L;  3OSO A;  4FXK C;  1PXU A;  2N88 A;  3BS1 A;  1CHQ D;  3AQQ A;  4X62 L;  3TP7 A;  1G8Z D;  3K6O A;  1VMP A;  1CA6 A;  3K80 C;  4R4C A;  1QZH A;  2VUM H;  1OXV A;  5JVH 3;  2EIF A;  5IOD A;  5LMN Q;  1EQV A;  5FLX c;  1Y69 U;  2EY6 A;  4Y7N H;  3I4N G;  2JA6 H;  3A5U A;  4DNR B;  1F9R A;  1TWA H;  1KLG D;  3SVM A;  2YTV A;  1UE5 A;  4A3M B;  3IKJ A;  3KJP A;  3HOX B;  2OTJ A;  3M4O B;  1TWH H;  4PG3 A;  4DV0 Q;  3D31 A;  2DJG C;  2IJ0 A;  3FRP B;  4JI8 L;  5IE8 A;  2UXD Q;  5K5P A;  4LMQ D;  3HOW G;  5KNC A;  2F0O A;  5IGC A;  4QUC A;  3AYH B;  4X66 Q;  1QCB D;  2BDN A;  3S1Q B;  4UZW A;  1KQS A;  4IZ8 A;  1VQH A;  3HOW H;  1QJO A;  4OEM B;  1CZG A;  5IYC H;  4IFD H;  4PQX A;  4QUF A;  2D62 A;  1KDB A;  3BYY B;  2R93 H;  3OMC A;  1I6V C;  4EGV A;  5K36 G;  2Z0S A;  3GV6 A;  1FR3 A;  3K5M A;  5C3E G;  4JI4 Q;  1U9R A;  4XIG S;  1SYD A;  3I73 A;  1Z47 A;  2SNM A;  1E7D A;  1SE8 A;  5C3E H;  3RZO H;  1MI2 A;  2JA8 B;  4F7X A;  1DZ1 A;  2K5Q A;  2MNA A;  3QOL A;  4B3R Q;  2K52 A;  4DR4 Q;  4A93 G;  4F87 A;  4Q0F A;  2H5X A;  1KNE A;  4P74 A;  3HOX H;  1YJW A;  4C3H H;  4MTN A;  3KLS X;  2FMM A;  1YNJ C;  3HG9 A;  4GLX A;  3W1B A;  4H7B A;  4CDF C;  3D8G A;  4KLK A;  3ULJ A;  4LF4 L;  3DWA A;  5C4X G;  2Y0S G;  1K0R A;  3I4M H;  4DR6 L;  2KFV A;  2KHI A;  4N8F A;  2JA9 A;  4DNI A;  2A19 A;  4Y7N B;  2B2U A;  5FLM G;  4TSS A;  1C4Q A;  1QZG A;  1CQF A;  1G2T A;  2KOL A;  1FGB D;  4JC0 A;  2JA7 G;  3KF6 A;  3K5L A;  2B8F A;  3HOU H;  4JBW A;  2R7Z G;  4KN4 C;  1K8M A;  1VF7 A;  2VQF Q;  2F0S A;  3TQY A;  2KEN A;  4EQ5 A;  2F0W A;  4RH6 A;  3NUC A;  3CME A;  2A6H C;  1BO0 A;  2PO4 A;  2DNE A;  2EVB A;  3BZC A;  1YZ6 A;  4GKK L;  1VQG A;  2VUM G;  2LD7 A;  2B2V A;  4K5W A;  1SNC A;  1NY4 A;  4KI0 A;  1EYC A;  3E0J A;  1I4P A;  3RD4 A;  1V8Q A;  2F0G A;  5IYD G;  5LHY 1;  2ZXP A;  1D8L A;  5LMU Q;  2YV5 A;  5C44 G;  1YIJ A;  4EVO A;  2PQA A;  4C2M B;  2FFK B;  2CW0 C;  1R9T B;  4H0L C;  4QQB X;  1U4L A;  2NVT H;  4KJN A;  3DMU A;  4IOC A;  4TVA B;  1HA5 A;  3C46 A;  1JMC A;  3Q8D A;  3LWE A;  5ELD A;  1B9M A;  3BZK A;  1GUN A;  3R93 A;  1LTB D;  2Q8R E;  4F8M A;  2KVD A;  4C3J G;  3A0J A;  1UEA B;  2JQO A;  4X65 L;  4EQN A;  2N55 A;  1VQE A;  4X65 Q;  4APV A;  1R4P B;  2QDL A;  4KKU A;  4V0B A;  3IFD A;  4ODG A;  4B9X A;  4HJ9 A;  2ATW A;  1CKN A;  2AWO A;  4A3J G;  5I9O A;  3J7A V;  1M8A A;  3D3R A;  4XTC S;  3T53 B;  4AQY L;  3UI2 A;  1QOH A;  3I4L A;  1LO5 D;  2NVX H;  1SAP A;  1PTO B;  3TEH B;  4EQO A;  5CR3 A;  4L63 B;  1UUP A;  4JI1 L;  2WAC A;  5K36 H;  1EFI D;  2K04 A;  3EIV A;  5IP9 H;  2JJQ A;  3J80 L;  4LF9 Q;  1AE3 A;  5IGF A;  2NZ1 D;  4C3I H;  1IKL A;  4AYB B;  1PH4 A;  3B6Y A;  2AMC B;  1NR2 A;  4E6I A;  1TS2 A;  3U9S A;  5I9P A;  4OX9 Q;  1SSO A;  2F1M A;  4A3K H;  2KCC A;  4DR2 Q;  4I7Z C;  3DEO A;  4A3G H;  3SK6 A;  4HJ5 A;  1RTN A;  4HIO A;  3DM1 A;  3CHB D;  1DM0 B;  3HOZ G;  1DCZ A;  3BDO A;  3D4D A;  2QEX A;  1GUS A;  2IT1 A;  4O0A A;  3S14 B;  1JT8 A;  1QUQ A;  2J0T D;  2L12 A;  3HOU G;  1ML0 D;  2RCN A;  4K0K L;  1ZKO A;  4B9W A;  1BR9 A;  5IGD A;  4KKT A;  1H9R A;  1IBL L;  4NPS A;  1JR0 D;  1WCM G;  1Y8O B;  1N36 Q;  3S14 H;  2KVE A;  1KDC A;  1XMQ L;  2EE1 A;  1Z9F A;  1PFB A;  5D14 A;  5C4Z A;  2NZH A;  2OT2 A;  1PH7 A;  3TBI B;  5C4J B;  3JC6 6;  1W2B A;  2QA4 A;  2KJX A;  4JI0 L;  3I55 A;  3S2H B;  4N9P A;  1JWM D;  4B3S L;  1GVP A;  3WWV A;  4F88 A;  5M5W B;  4LK1 C;  4A3B H;  3QG1 A;  1VS0 A;  3CCV A;  1KIX A;  1K83 H;  3J81 j;  4QIW B;  4A3B G;  4XYQ A;  1QVG A;  1PTO H;  4HSV A;  3R2I A;  1LYL A;  4HTH A;  3VR3 A;  3PO2 B;  5G3L F;  1UE1 A;  5EAY A;  1C8C A;  1LT4 D;  1O7Y A;  2NTS A;  3HKZ B;  1V1O A;  3SR1 A;  3SDZ A;  3S15 H;  4K5X A;  4JI7 L;  4JI3 Q;  4DK3 C;  4HSP A;  1HXY D;  1JOK A;  2C5C A;  2PI2 A;  3TRE A;  1MJE A;  4JI7 Q;  1SEB D;  2WFW A;  3S1Q H;  1IL8 A;  3MC0 B;  3X3N A;  3ER0 A;  2K03 A;  4MTK A;  2O4X A;  2HD3 A;  2YYZ A;  4FF2 A;  1TWH B;  1WTP A;  1H9S B;  4CDE C;  1SJE D;  3MXU A;  4FF1 A;  1IBM L;  4R4I A;  4OWT B;  4LF5 Q;  1ILP A;  2SEB D;  2NVT B;  2KW9 A;  4GLA C;  4PZ6 A;  1TWA B;  4DF7 A;  3OW7 A;  2MUY A;  4ZK9 B;  1WD1 A;  3G7L A;  3HOV B;  3QR8 A;  4KHV A;  4DV0 L;  5EJW A;  4L6T B;  1YHA A;  1HHV A;  1A3T A;  2JA6 G;  2ES2 A;  5C0X G;  1I94 Q;  3MFY A;  4JI8 Q;  4B3M Q;  4C3I G;  1XTC D;  3GTJ B;  3CCS A;  3AFP A;  1UE7 A;  1L2F A;  2O5J C;  4WJ3 M;  1XWE A;  3A54 A;  2KVU A;  5D65 A;  1IBL Q;  1WCM B;  4DAY A;  1TS5 A;  1EU3 A;  4IUU A;  4RKB A;  1VQ6 A;  1JWS D;  4C56 C;  3JAM L;  2MPH A;  3A8K E;  1JOR A;  4UDU C;  2VQE Q;  2XRS D;  4BXX G;  3HOV G;  3LLR A;  1STG A;  2G9D A;  3NTH A;  3T1Y L;  4YY3 L;  2OXP A;  1STE A;  4JI0 Q;  1LT3 D;  4DKA C;  1B50 A;  1DGS A;  2L0C A;  3NP8 A;  3DEP A;  1X55 A;  1V66 A;  1BBX C;  1RHP A;  2JEA I;  2Z9H A;  3I4M B;  1XPU A;  3I91 A;  2D0O A;  2LMC B;  4C3H B;  1E1O A;  1UE6 A;  3L7Z C;  2NVY B;  5IWA L;  3K5O A;  3EBE A;  3TS2 A;  3HEJ A;  2JA8 H;  4WJW A;  2MPM A;  5ELO A;  2ZT9 C;  3HGB A;  5ELE A;  1OO9 B;  2Q8I B;  3U4V A;  2B63 H;  3QKJ A;  3M4P A;  2IPK D;  3I4O A;  3H15 A;  3J81 L;  4K6L A;  3NEM A;  3NE5 B;  3TP5 A;  3OWE B;  2BA0 A;  4RGT A;  2F0E A;  1KTK A;  3SK4 A;  1Q1B A;  3QJY A;  1AH9 A;  1FNW A;  1K73 C;  4HR7 B;  1SFO B;  4OL7 A;  3HZX A;  3NSW A;  2G80 A;  2A73 B;  2N8N A;  1LUZ A;  5GAE C;  3BDL A;  2JN4 A;  2D2C C;  2E5L L;  3PSI A;  3GTO H;  4HIK A;  1YBY A;  3ERS X;  5M5W H;  1N32 Q;  2XSC A;  1S5D D;  1JIC A;  2B2V C;  1WTQ A;  3JAM c;  2F0P A;  4ZQ3 A;  5COY A;  2K32 A;  2K14 A;  5KIX A;  4QJF A;  4JOI A;  4AYB E;  4DV6 L;  2R3Z A;  1V1P A;  4MZ9 A;  4K5V A;  3M85 A;  4A3M H;  1PRT F;  2QKI C;  1SMY D;  1PRT C;  3J80 c;  3K59 A;  3W3A A;  1F2M A;  3NPP A;  2V1C C;  2K5N A;  5E7N A;  4H44 C;  4JW0 A;  2E2J B;  4FNF A;  4XQQ A;  1KL9 A;  1LT6 D;  3ITP A;  4OIJ A;  1BBW A;  4IUT A;  2A6E D;  4J6H A;  5EQ0 A;  1L1O B;  2D0P A;  3CCL A;  2B8G A;  4K14 A;  1RIP A;  1N34 Q;  2F0I A;  2XTI A;  2EPB A;  2KUM A;  1BKB A;  4NB3 A;  2NYZ D;  1E0B A;  2IHF A;  1E7L A;  5FJ8 G;  2R7Z B;  4LUO A;  3C2P A;  2I5L X;  2K4K A;  1NR4 A;  2F0H A;  3PMF A;  1EY7 A;  5ISR A;  1UWV A;  3LNN A;  1B70 B;  4N9T A;  1D5X C;  3N6R A;  1X3F A;  3T56 B;  1C0A A;  1WOC A;  1X56 A;  1S4Z A;  2AQ3 B;  3M4Q A;  3FHW A;  3OIQ A;  1RD9 D;  3H09 A;  4FO2 A;  4NXN L;  2NN6 G;  3A74 A;  5CYU A;  1ICF B;  1AP0 A;  1SXT A;  4ZLT F;  3WOE A;  2KA7 A;  3MXN B;  1S72 A;  1I4R A;  1UEB A;  3T4A C;  3ULP A;  1KHI A;  5BN3 A;  4PNY A;  4IO9 A;  4IFD J;  2P5Z X;  5I2X A;  3I3C A;  4UHV A;  1L0X B;  1TY2 A;  3P1H A;  2JA5 H;  2JA8 G;  5I2Y A;  2K7V A;  3CCU A;  3L9A X;  1H95 A;  1YJN A;  3EVQ A;  4BY1 H;  1EQT A;  1J9O A;  1II3 A;  1TT2 A;  3E6Z X;  4EQP A;  4GKK Q;  2WAQ G;  4ID6 A;  4IUV A;  1GUW A;  5CV5 A;  3EA6 A;  1N36 L;  4GZY C;  1D5M C;  4LF6 Q;  4EX5 A;  3A56 A;  3HKZ E;  2PZU A;  5J22 A;  4TRD A;  1A0I A;  3VYS A;  1SYF A;  3ZJY C;  5M9O A;  2JA5 B;  3SEB A;  3AB9 A;  1ZXT A;  2JA7 B;  2HCC A;  1R9T H;  1TWC H;  4DR1 L;  3U4Z A;  1BNZ A;  4OHJ A;  4DUZ L;  4JYA L;  4RWS C;  4DR4 L;  3GTL H;  2FJ2 A;  3PIP 3;  4BBR H;  2LXK A;  5ELB A;  1WYD A;  3TN2 A;  4B3S Q;  1ICW A;  2XNA C;  1NJI C;  2KCN A;  4ME3 A;  4A3E B;  3W1G A;  2PMZ E;  4M8A A;  2WB1 G;  1YNS A;  1XXG A;  2B63 G;  2H4O A;  2K1B A;  2LXJ A;  3CQZ B;  2X6G A;  3I4N H;  5CV9 A;  1XPO A;  1HNX L;  4LWC A;  1P8L A;  1TWG B;  3S16 B;  4OO1 H;  1MSH A;  4YCU A;  2EYJ A;  4PMB A;  3TZD A;  2OF1 A;  4JV5 Q;  4H13 C;  4Q5V A;  3I56 A;  4KV6 A;  1VQ9 A;  4IUN A;  5LMN L;  4UP7 A;  3PIP A;  1DOM A;  3A55 A;  1RTO A;  4RMF A;  1JWU D;  1HNZ L;  3C1F A;  5L37 A;  1A63 A;  2ZXR A;  1OXT A;  1YNJ D;  1IXR A;  2BCO A;  2PI2 E;  1MHW C;  1EYA A;  2YU9 B;  4FXD A;  4LFA L;  2HT1 A;  5IYC G;  4MHE A;  4IFD G;  5JVG 3;  1B8A A;  1VQI A;  4PMW A;  2VL6 A;  4JI6 Q;  3RR5 A;  4NP5 A;  3KF6 B;  4G57 A;  1I94 L;  2QNC A;  1Q12 A;  2CWA A;  5EPJ A;  2MQH A;  1BDO A;  1JJC B;  4DU9 A;  2HQE A;  2RDH A;  1B4O A;  3K58 A;  4K0K Q;  2MO0 A;  1HCZ A;  5JEA G;  2R93 B;  3J81 E;  3HRZ C;  4YWL A;  1PH6 A;  5JEA H;  4A3G G;  4FP5 D;  4AYB G;  2M9V A;  3M9B A;  2I5H A;  1XMQ Q;  4GS3 A;  2BE5 C;  4RCN A;  2VQE L;  5A35 A;  1W6K A;  1VQK A;  2OEO A;  2R7F A;  5C44 B;  3KDF B;  1PFS A;  1ROD A;  2J4X A;  5JJZ A;  1PH9 A;  3MXN A;  5LMN W;  2Q2T A;  4L5R C;  3GTM B;  1E2V A;  4QF4 A;  3P75 A;  4HED A;  2IX3 A;  4ILW A;  1PMR A;  2EYM A;  1VQF A;  1H9M A;  2KED A;  2XN9 C;  3K7A B;  1B1Z A;  1HPC A;  2R93 G;  2Y0S B;  5CV7 A;  3OWF A;  5AJ3 L;  3CC2 A;  1K8G A;  5DM6 3;  4DR5 L;  4A75 A;  1VDZ A;  1Q7Y C;  4U67 3;  3HKS A;  3MFG A;  1U0L A;  1V1Q A;  5A2Q L;  2TMP A;  1FL0 A;  3UE1 A;  1FD7 D;  1WTW A;  1LAB A;  3JAM E;  4B3T L;  1Z6H A;  3S1R H;  5JJK A;  1PTO C;  2F0J A;  2E2I B;  3GO5 A;  1NSN S;  1OXX K;  2F0D A;  3H94 A;  1G91 A;  4O1N A;  1XMO L;  3PUW A;  1VQL A;  3GTK H;  2YTY A;  2MJ8 A;  1PH3 A;  4DAV A;  3OYY A;  2QW7 A;  5J3B A;  2I0Q A;  2EJF C;  3KLW A;  4KY6 A;  3H3V C;  1PV4 A;  2UXB Q;  5M5Y B;  4YCW A;  1DON A;  1Y1W H;  3CC4 A;  2OCE A;  1XNQ L;  1B3Q A;  4XQN A;  4DN4 M;  5EBD A;  2CFM A;  4GKJ Q;  4IOA A;  1S5F D;  1F9S A;  1AEX A;  4R4O A;  1BF4 A;  3NBH A;  1EYD A;  3NXW A;  1AZP A;  1R4Q B;  2RNO A;  4LNQ A;  2Z1C A;  2B2Y C;  1TY0 A;  1H9J A;  4P73 A;  2LY7 A;  2BA1 A;  4U68 A;  3L0O A;  3GD7 A;  3PV0 A;  4G7O C;  1H9E A;  3VYT A;  1STB A;  3GV3 A;  2JSO A;  1GL9 B;  1QE6 A;  1D1K A;  1E2W A;  4DR7 L;  1TVX A;  3L2P A;  3ND8 A;  2F3I A;  5C6A A;  3KF8 A;  3S15 B;  1T5E A;  4RGO S;  1KLU D;  1SLJ A;  3VR6 A;  4R8I A;  1ENF A;  4WJ4 A;  1DJR D;  1L0Y B;  3PO2 H;  1N9W A;  3D6C A;  1VMC A;  3E0E A;  4A3I B;  1HUM A;  4RAU C;  4FDB A;  1Q81 C;  2R92 B;  2CQO A;  2KBN A;  3BVG A;  3PIO 3;  2K33 A;  3A7L A;  3STB D;  2NVQ H;  1CTM A;  3CMA A;  1PA6 A;  3ND9 A;  4IPC A;  3H0G B;  2UUA Q;  2GN5 A;  3RN2 A;  3PF5 A;  4A3B B;  4A3J H;  5FJ8 H;  3OOC A;  1YHB A;  4DGZ A;  5M3M G;  1F2Y A;  1KD1 C;  2CQA A;  2IHE A;  4GLV B;  3KBG A;  4GN4 B;  2XIW A;  1PH8 A;  1VQA A;  3HFZ B;  1ZEQ X;  4LFA Q;  4JI4 L;  2J7Z A;  4BY7 H;  4DNT B;  4JBM A;  2OQ0 A;  2Z8L A;  1H9F A;  5IYB H;  2F0Q A;  3X3M A;  3GTQ H;  1RJT A;  2XRQ D;  1QUQ B;  5JOB A;  4ZKB B;  4DV5 L;  1LT5 D;  2A6E C;  2F0L A;  4HN7 A;  2FIN B;  1SYB A;  5HY6 A;  4LFC L;  4P2C B;  1EOV A;  3VYR A;  3I4M G;  2Q2I A;  4RFB A;  1BCP F;  3PUX A;  3CCE A;  4C3H G;  1IZ6 A;  1BXT A;  1EWI A;  5D3D A;  2LSS A;  2WKD A;  1CFM A;  1SDF A;  2F4V L;  2LKV A;  1B44 D;  1GUG A;  1KRT A;  5I6W A;  4DV3 Q;  5TSS A;  4DUZ Q;  1I4X A;  3T1Y Q;  3HOZ H;  4JYA Q;  5C5L A;  3NEN A;  3G71 A;  2PPB C;  2E2J H;  1BUV T;  2B2W A;  4ZUJ A;  4C3I B;  1X3G A;  3S1N B;  3S2D B;  3J80 E;  2V4D A;  4OO1 I;  1HJP A;  5M3F G;  1Y1W G;  3TZU A;  3BU2 A;  3I72 A;  2ENB A;  3CPW A;  4DV1 L;  2DGY A;  3LGJ A;  4BA1 I;  2NVX B;  3E9H A;  2BDO A;  2R6G A;  3DLL A;  4LF5 L;  1A2T A;  2EYH A;  1Y1V B;  4A3D H;  2K50 A;  4H02 A;  4L5Q A;  3HKZ G;  4KKS A;  2EDG A;  1T5X D;  5JPM C;  2A74 C;  3P7J A;  2WAQ E;  2FHT A;  2CH4 W;  1SFO H;  1XPR A;  1M4V A;  1JE4 A;  2MFI A;  2B2W C;  1H9S A;  1PYS B;  4RHS A;  5JJL A;  2QF7 A;  4GN3 B;  2EYF A;  2RHS B;  1CK1 A;  2DY7 A;  1GJJ A;  1SYE A;  3KYH C;  3PIO A;  1JJR A;  2OQK A;  2EJM A;  2F0U A;  2RCF A;  2WIN B;  1HNZ Q;  2G9H D;  1C48 A;  1D5Z C;  1HTP A;  5G3L D;  1YNN C;  4C2M H;  3UE0 A;  1HZB A;  2NTT A;  3DUZ A;  2NVY H;  2UUB L;  3K7U C;  1B53 A;  2IX1 A;  1HTL D;  5CV8 A;  1D1I A;  1ESF A;  4FF4 A;  1VQC A;  4LF8 Q;  1JC7 A;  3K5N A;  4PZ8 A;  5FOB B;  4J15 A;  3J7Y W;  1ILQ A;  5CBE E;  4M1U B;  2F0F A;  4R1J A;  3F2D A;  3ULL A;  4KHP Q;  2ZTC A;  2I46 A;  4JK1 C;  4CGY B;  2HJQ A;  1SYC A;  1O7Z A;  4KD4 A;  1EU4 A;  3D4W A;  1GD7 A;  3FMC A;  2ASB A;  3K8A A;  3PF4 A;  2O2L D;  2WKC A;  1XYI A;  1IYV A;  3WOF A;  4DFA A;  1IBK L;  2JEB I;  3GTK B;  2EOT A;  2ICE C;  2XVS A;  4QB4 A;  4ZAI A;  3PGZ A;  3OTO Q;  3CF5 A;  2ZM6 Q;  3S1R B;  1EFW A;  2A6H D;  1QVC A;  4O42 A;  5M3F B;  1PLF A;  4LJZ C;  2F03 A;  3ZYY X;  2RKS A;  1E24 A;  1Q90 A;  2K5V A;  2ICI A;  1L1O C;  2VB2 X;  2YTX A;  4OXP A;  3HOV H;  1EY8 A;  1FNU A;  3EFX D;  4DA2 A;  5C3E B;  3G6J B;  5IP7 H;  2C9O A;  4BBS G;  5E4W C;  2DY8 A;  4A93 H;  3VR4 A;  2N78 A;  3TSS A;  1UNS A;  2EYO A;  1WTO A;  1JOQ A;  5E4X A;  2QNF A;  5BN5 A;  4K6D A;  3SK5 A;  4ALP A;  4UY8 C;  1EEI D;  1V9P A;  1SNM A;  3VA7 A;  1CT1 D;  1XTD A;  4DK0 A;  5C44 H;  2CKZ B;  1CHP D;  2ZJR A;  2EJG C;  1IBM Q;  2SDF A;  1A3V A;  1L1O A;  4XT1 B;  5AFW A;  4GN5 A;  5KEE A;  1N8R C;  1VF5 C;  3O13 A;  2F4V Q;  3S17 H;  1G6Z A;  4YWK A;  1N32 L;  3U9O A;  2D9U A;  1JQY D;  2H1E A;  4KY7 A;  1N34 L;  4IUP A;  3R3O A;  5M5X B;  3CW2 C;  1I4G A;  3IAY A;  1EWC A;  2F0V A;  2NUC A;  1TWF H;  4FXG C;  1HFG A;  4DV4 Q;  2K75 A;  1PH5 A;  5EGT A;  4CKB A;  2VZA A;  3QOJ A;  2YU9 H;  2VUM B;  2DK4 A;  2F0K A;  3KBX A;  4YHH Q;  4DV2 L;  3GP7 A;  3L3O C;  4KY5 A;  3FKI B;  3K57 A;  4K2L A;  3BG3 A;  1FNV A;  4XDX A;  2AUJ D;  4DR7 Q;  4OX9 L;  4JBJ A;  1X6O A;  1IBK Q;  1SND A;  3AFQ A;  5COR A;  1S5B D;  4XXE A;  1QVF A;  4NXM Q;  1BQQ T;  3W5O A;  3KFU A;  2K6A A;  4AQY Q;  4NXM L;  4IPG A;  2R7D A;  2XWJ B;  1QNU A;  1PYB A;  3FPP A;  3K0X A;  1SN8 A;  4HMJ A;  3V96 A;  2M00 A;  4JOI C;  1PH1 A;  3CD6 A;  1TWG H;  3I4N B;  2UUA L;  3DWQ A;  2B2Y A;  1IW7 C;  4DK1 A;  2HDM A;  3CU7 A;  4L5T A;  4A3G B;  2EY5 A;  1P16 A;  4BY7 B;  2HCI A;  2HQL A;  1F9Q A;  4A3K B;  5M3M H;  2B2T C;  2BH8 A;  1IHZ A;  5E1F A;  1EZ6 A;  1KC8 C;  4DK6 C;  2Q2H A;  4A3J B;  1KHC A;  1WVL A;  2KHS A;  2MHV A;  2NB0 A;  4J8Q A;  5IIF A;  2SOB A;  3BJU A;  2DUD A;  4DAP A;  3GTP H;  1EYG A;  3FPU B;  4HCS A;  1EOT A;  5C4H A;  3I70 A;  1CA5 A;  4LF6 L;  2E8G A;  4OIK A;  1ENA A;  1LTG D;  2N3S A;  1SNO A;  3TP6 A;  3H3V I;  1A3U A;  1CZW A;  2RA4 A;  3AU7 A;  4A3K G;  2PCF B;  1M90 C;  1Y14 B;  3BVM A;  2RHQ B;  2D5D A;  1JEQ A;  2GA4 B;  3QO2 A;  4DV3 L;  1U4R A;  5IT9 L;  3A8I E;  2C35 B;  2QDB A;  1K8O A;  2AWN A;  3T16 A;  4BY1 B;  3MA2 B;  3TRZ A;  1GJX A;  3KLR A;  5JEA J;  1E1T A;  5DEH A;  2VW9 A;  1WI5 A;  2ZM6 L;  4GOP C;  1A8V A;  2QCP X;  1TR5 A;  4BWG B;  1YJ9 A;  1KAA A;  4A3F B;  4POG A;  3EQL C;  3H0G G;  1BCP D;  1AFP A;  2F52 A;  4DV1 Q;  1EIY B;  4LFB L;  5M3M B;  2AKW B;  2Z4I A;  1D7Q A;  1PFM A;  3ICE A;  1NE3 A;  1VCI A;  1Q82 C;  3S2D H;  2NWG A;  1VQN A;  2IWH A;  5LMU L;  3M4Y A;  1SE2 A;  3NWT A;  3TP8 A;  1PTO F;  1PRT D;  2PW5 A;  3MEF A;  5DM7 3;  1HUN A;  1STH A;  4FF3 A;  3NTK A;  3KDF A;  4JPB W;  1QB5 D;  1LV9 A;  4HMI A;  4P72 A;  3TME A;  3HP3 A;  1K0S A;  1HH2 P;  4HJA A;  3SK8 A;  1HQR D;  5KND A;  1PZJ D;  1EQR A;  1GM5 A;  4JI2 L;  4YIJ A;  5GAD C;  4OWW B;  1B2T A;  1A6X A;  3PO2 G;  1FGU A;  2A69 D;  5E3F A;  3SHL A;  3HOY B;  2K5H A;  5C0X H;  4PMC A;  4KMU C;  1HR0 L;  1AE2 A;  5DLQ E;  1X54 A;  4A3L H;  4L8J A;  3DWP A;  1RDP D;  1TWF B;  3IFT A;  1KXL A;  1PFN A;  3RZD B;  3K7A H;  1J5E Q;  4QIW E;  1CSP A;  1LAC A;  4RKL A;  1E2Z A;  1JB7 A;  1DOK A;  4DAY B;  2BOS A;  1JCK B;  4A3F H;  4KHP L;  4A3C H;  4B08 A;  2QGQ A;  3BZD B;  1O80 A;  4POF A;  4I65 A;  4G4K A;  2HHH L;  4LF7 L;  3PUZ A;  4BA2 I;  3IRB A;  4LW1 A;  2NN6 H;  2LS0 1;  2ODG C;  3I90 A;  3UDF A;  4YY3 Q;  3D0F A;  1T9H A;  3J81 c;  3GTG H;  2A1A A;  3F2C A;  1I50 B;  2KQ3 A;  4CDC C;  4X64 L;  3F8T A;  3NHH A;  1SR3 A;  5H1S E;  3D6W A;  1AW7 A;  4RGM A;  2OWO A;  1X3P A;  5IOC A;  4MNO A;  1BVS A;  1K8A C;  5CC4 A;  1GUO A;  2F0N A;  4DR5 Q;  2WV6 D;  1XMO Q;  2NN6 I;  4JCV E;  1VQ7 A;  3DHQ A;  3VDY A;  2B3G A;  3ERO A;  2RDG A;  1I6H B;  1NMF A;  2L11 A;  1A2U A;  1AZQ A;  1ASY A;  1SNP A;  1HNX Q;  1C7Y A;  3CPF A;  5M3F H;  1WTX A;  2IX0 A;  5IT9 c;  1FJG Q;  1YI2 A;  4UAI A;  4CJ2 C;  1MSG A;  3E5S A;  4DV6 Q;  2Y0S E;  2F3W A;  1SNQ A;  3CRL C;  3KUP A;  1O78 A;  2BE5 D;  4IJL A;  1Y1W B;  3CCQ A;  1O7L A;  1UAP A;  1B9N A;  1E22 A;  2RF4 A;  1TQO A;  3LWU A;  1MD2 D;  3VR5 A;  4PV1 C;  3RUZ A;  5KGU A;  2DN8 A;  2G5D A;  2EY1 A;  1Y1V G;  2JXM B;  1SMX A;  1ONL A;  1EL0 A;  4GNX B;  4CDD C;  2K01 A;  1ZYR D;  4DUY Q;  1ET9 A;  3NBH B;  3TS0 A;  2KVM A;  2O5I C;  3D4R A;  3MWY W;  4ZYS A;  1RL2 A;  1ZYR C;  4X62 Q;  4WOR A;  3E3X A;  1I6H H;  5HUR A;  1SMY C;  4LUZ A;  1H1J S;  4LF9 L;  4V19 0;  1Y8P B;  1HRJ A;  1OTC A;  4FVM A;  4G7Z C;  3A7A B;  2HIV A;  2WII B;  1X32 A;  5C3W A;  4AH6 A;  5M5X H;  3U58 A;  3WDN A;  4QY7 A;  1PYW D;  1CKN B;  3NBI A;  4KK7 A;  4BBS B;  4CHT B;  1N33 Q;  5FO8 B;  5IGE A;  5GAH C;  1G6P A;  3S17 B;  1EIH A;  3ERQ A;  4RGN A;  1SRU A;  2K5D A;  5IGB A;  3H6M A;  3J7Z C;  1VQB A;  3P20 A;  1EY4 A;  4B3M L;  4K8I A;  1JJ2 A;  3QB3 A;  4R4Q A;  4CJ1 B;  1DYQ A;  4ZUI A;  1TS3 A;  1NTG A;  5FO7 B;  1D2B A;  1BCP B;  4A3D B;  1VQ5 A;  3KJO A;  4DV7 L;  4HCE A;  1TXY A;  3S1M H;  3FVQ A;  4A3L G;  2JA5 G;  1J6Q A;  2L55 A;  2RNN A;  1X65 A;  1LTS D;  3IL8 A;  5ELN A;  4BS9 A;  2DJF C;  2FXQ A;  4JG2 A;  1Y02 A;  4GNX C;  4OON A;  3URY A;  4J1M A;  3MZ5 A;  3A5Z B;  1QIL A;  2AUK A;  2F0M A;  2L4N A;  4NKL A;  3SE0 A;  2RDF A;  3T1H Q;  1FVI A;  4BXX H;  1GHK A;  4RA8 A;  5KYI A;  1LLR D;  4DR3 Q;  2UXB L;  2ZTE A;  5DNF A;  4Z9C B;  3NTI A;  2CH4 A;  4N8X 1;  2W51 A;  1FYC A;  5FLX L;  4LF7 Q;  3FKI G;  1MGS A;  4XQJ A;  2ALY B;  4X3U A;  3VR2 A;  2XWB B;  3NK9 A;  3HOX G;  5I4D A;  5NUC A;  2BH2 A;  1HNW Q;  2JK8 A;  2ZTD A;  3CKI B;  3UDI A;  1I3Q H;  5IYD H;  3RLN A;  4KHZ A;  4HID A;  3G6E A;  3AEV A;  2B2T A;  4ABN A;  1Q86 C;  1QWY A;  2B29 A;  1IYU A;  5FK9 C;  4DXG A;  3RNU A;  3R8B A;  2Z6K C;  2EZV A;  1F2Z A;  2KCM A;  4FYD A;  2LFN A;  2AQ1 B;  3UDG A;  4LFB Q;  2UUC Q;  1V43 A;  1I4Q A;  5BR8 Q;  4A3E H;  3JAM i;  1GKU B;  2CVR A;  5EPK A;  3DM3 A;  4C1N K;  1VQD A;  1BOS A;  3NEL A;  2UU9 L;  4TKO B;  4A76 A;  2M2L A;  2NVQ B;  3PO3 B;  2DNC A;  4IN3 A;  5J39 A;  1SRO A;  5C0X I;  1EUJ A;  4NW2 A;  4PZ7 A;  2R92 H;  4KN7 C;  5CGK A;  5CMD A;  1MIU A;  1NCV A;  2A5H A;  1TWC B;  4X3T A;  2FMC A;  1EY0 A;  4GNX A;  1G29 1;  4IUR A;  2RBM A;  1VQJ A;  4QMG A;  4YWM A;  1HA6 A;  3V2T A;  4R9W A;  5EKI A;  1S40 A;  4K2K A;  2PYK A;  1WFQ A;  2X69 A;  1D6E C;  1B3A A;  1MKH A;  2B63 B;  3STB C;  1JEI A;  1LM0 A;  3GTP B;  1RF2 D;  3CAM A;  5C5M A;  3S9W A;  4A3M G;  2Q2U A;  1CKO A;  1Q46 A;  5GAG C;  1Q8I A;  2JE6 I;  2Z6B A;  2RSO A;  5EKL A;  4MIU A;  3MHB A;  1IYJ B;  1EN7 A;  1LTR D;  2PZW A;  1GOZ A;  2NZO A;  1JB3 A;  3FDT A;  2Q8T A;  3Q0A A;  5I6Y A;  1NAP A;  1LTA D;  2IY5 B;  3ONA B;  1LTI D;  3G48 A;  4S3S A;  1EY6 A;  3SXH A;  4NXN Q;  5JJI A;  2QEJ C;  4DR6 Q;  1X9N A;  1TS4 A;  3PUY A;  3S1N H;  1Z7T A;  3G4S A;  5T1I A;  3GQB A;  4HJ7 A;  2L15 A;  1Q8K A;  2CW0 D;  3DXJ C;  3EJI A;  4UPA A;  1WD0 A;  3KF8 B;  5KNB A;  1CQV A;  1HQM C;  5IGG A;  2ID0 A;  5IYB G;  1HR0 W;  4X6A H;  1HFN A;  2CCZ A;  3BVZ A;  1JOO A;  1HNW L;  1WCM H;  1EIF A;  4DR2 L;  1CSQ A;  1Q1E A;  1PTO D;  1GXD C;  1HZA A;  1ET6 A;  2PNR C;  3CRK C;  3N52 A;  1PHJ A;  5IP7 G;  3GTJ H;  3HOU B;  4IAL A;  4LFC Q;  3FKI H;  3SGI A;  3GDE A;  2PMZ B;  2RQX A;  2EXD A;  1W6J A;  2VXW A;  4CBV A;  2Z4H A;  1VQP A;  1ASZ A;  4ME5 A;  4C3J B;  1U4P A;  1PVO A;  1GKH A;  5CV6 A;  1STN A;  1VQ8 A;  1J8I A;  4DPG A;  3T51 B;  1YHQ A;  2F3V A;  4B3T Q;  5EPL A;  1E3P A;  4LAA A;  1YNX A;  3F1Z A;  1RKN A;  3CC7 A;  3PO3 G;  2KHJ A;  4BY1 G;  1LTT D;  1NUC A;  3TDQ A;  1XX8 A;  2VNU D;  2VS1 A;  1JE5 A;  1BBU A;  5JPN C;  2VB3 X;  2EQS A;  4B3R L;  1SE4 A;  1X3Q A;  2EY2 A;  2NBF A;  3PUV A;  3BDC A;  2JVW A;  4IPH A;  2K5W A;  3T1H L;  3H0G H;  1KDA A;  4OGQ C;  4XYO A;  3UDX A;  5LL6 S;  4UP9 A;  3NQT A;  1VQ4 A;  5BN4 A;  4AIM A;  1MBY A;  4A4I A;  1C9O A;  1TKW B;  2HDL A;  2PW7 A;  4WFN 3;  1KNA A;  4DXF A;  4GOP A;  1IW7 D;  4DAM A;  1EEF D;  4JI5 Q;  4ZCK A;  2WP8 J;  2JP1 A;  4LF8 L;  2F4I A;  2VQF L;  4A93 B;  2EYP A;  1K3B C;  1VQO A;  2GVA A;  3FP9 A;  1U5K A;  4YCV A;  3I2Z A;  2OTL A;  3CCM A;  4A3E G;  4IPD A;  2RSN A;  1IKM A;  1VQM A;  2WB1 B;  5T1G A;  2UUC L;  3CXC A;  4YHH L;  1YNN D;  5D3I B;  4DV2 Q;  3C1E A;  2EYL A;  4Y52 H;  2JYO A;  4QGU A;  3AMU A;  3MXG A;  5JAV A;  2MP1 A;  3HOY G;  3BYT B;  3KLS A;  3CP0 A;  3RN5 A;  3OMG A;  4NDX A;  4IQZ A;  1KAW A;  1GUT A;  2VY3 A;  3I8Z A;  5KYL A;  4HAE A;  4C3J H;  1KAB A;  2WB1 E;  3I7F A;  1AN8 A;  4GOP B;  4A3C G;  1EWH A;  4IUQ A;  1PZI D;  1SJH D;  3F2U A;  4JI6 L;  1I4H A;  2N49 A;  4X66 L;  1XJV A;  1F9P A;  3S16 H;  2UXD L;  1DXM A;  1ENC A;  1QNK A;  4UP8 A;  4X3S A;  1ZS9 A;  4ZKC B;  1LTL A;  1MJC A;  4A3F G;  5ELC A;  5IP9 G;  1PDQ A;  4P75 A;  1EIG A;  3FEW X;  4CJ0 B;  3Q6S A;  4QL5 A;  4BY7 G;  1NMG A;  2E2I H;  2PQE A;  2KEC A;  3K81 C;  4X3K A;  3K0Y A;  2HIX A;  5CV4 A;  1ESR A;  5C4X H;  1FJG L;  2A8V A;  1IL2 A;  1DD2 A;  2IW3 A;  4JVZ A;  2UXC Q;  5FLM H;  4A3I G;  3OTO L;  4IFD I;  1YEZ A;  4CKC A;  2ODC I;  4JI1 Q;  3J7A 5;  5ELF A;  2HUG A;  4ZRZ A;  2JA7 H;  3MVV A;  1GHJ A;  4DR3 L;  2B2U C;  2QIL A;  1F2L A;  2E75 C;  1I5F A;  2I5M X;  3U50 C;  3GTM H;  4TQU S;  3MEH A;  1F77 A;  1I50 H;  1SE3 A;  4L5S A;  4HJ8 A;  4JBK A;  5A2Q E;  1GO3 E;  3GTG B;  1CI3 M;  3QIA A;  3FLG A;  2PQA B;  1Y8N B;  3PQI A;  3MAQ A;  2XGT A;  2AQ2 B;  4JI3 L;  1E7Z A;  4OWX B;  4RHR A;  1NNX A;  2A69 C;  3J81 i;  2SNS A;  5EKK A;  1SYG A;  3RMH A;  1STY A;  2K05 A;  1CUK A;  4DV4 L;  1STA A;  3M3Y B;  1Y1V H;  5C3X A;  1K28 A;  1QG7 A;  1G2S A;  3LX0 A;  3KOJ A;  1L0W A;  1B7Y B;  1OXS C;  2KEE A;  3EN2 A;  5IWA Q;  4A3D G;  3OW2 A;  2IL8 A;  2X6L A;  3RLF A;  1WTH A;  1K83 B;  1M1K C;  3PO3 H;  3VYU A;  3RZD H;  5BR8 L;  1U4M A;  2E2H B;  2AHO B;  4OO1 G;  3MXP A;  4ULL A;  4I7A A;  3H91 A;  1EQQ A;  1O7I A;  3S2H H;  1YVC A;  1N33 L;  1CM9 A;  3KK7 A;  3HOY H;  4BIT A;  2ZXO A;  1HR0 Q;  3HOZ B;  2L1B A;  3T13 A;  5C4J H;  1YIT A;  3J7A F;  5LL6 X;  1V1P B;  3C3L A;  2R92 G;  4IJH A;  4MN3 A;  1NBW A;  4P71 A;  1WJJ A;  1W3S A;  1SBB B;  4JI2 Q;  4NMZ A;  2A68 C;  2MGS A;  2E5L Q;  2GVB A;  3HS0 C;  1TII D;  4CKE A;  1I3Q B;  3A8J E;  4KD3 A;  2CWP A;  3OIP A;  1XNR Q;  1A62 A;  2B39 A;  2UUB Q;  4GKJ L;  3MTS A;  3GTQ B;  1WTV A;  1S5C D;  3CQZ H;  1J5E L;  5FLX E;  5CIU A;  1G51 A;  3Q22 A;  3NWS A;  4QCL A;  1ZBH A;  5C0X J;  4JV5 L;  4X64 Q;  5HGQ A;  5IY0 A;  3OHX C;  3J80 i;  3H3V H;  2RVL A;  3W2D A;  1CKM A;  1EY9 A;  1Q3L A;  1RCV D;  2E74 C;  3RZO B;  4XT3 B;  3GTO B;  1K9M C;  5J1Z A;  2E2H H;  2TSS A;  4O2D A;  2ZJQ A;  4BBR B;  3E9I A;  2E2D C;  2HHH Q;  1TU2 B;  5FKA C;  3GTL B;  3QWN A;  4A3I H;  3M7N A;  5IT9 E;  3S1M B;  2LC3 A;  1EZ8 A;  4WRD A;  3M3Y H;  3OPO A;  4OEL B;  1HZC A;  4KJO A;  4RCO A;  1PZK D;  3CCR A;  3HOW B;  1JJG A;  4C1N I;  3CCJ A;  2MO1 A;  3PCO B;  1K3R A;  1H9K A;  3F2B A;  4DV5 Q;  5DAU A;  1PRT B;  3R2T A;  3RLO A;  4LUV A;  4HIM A;  1DOL A;  2WAQ B;  2L9H A;  4DV7 Q;  3M4O H;  4BBS H;  1X3E A;  4BBR G;  2Z6K A; 
#chains in the Genus database with same CATH homology
 3ERS X;  5M5W H;  4C2M H;  2JA5 G;  1J6Q A;  2KCT A;  1OXU A;  3UE0 A;  1HZB A;  1X65 A;  1PH2 A;  3JAM c;  2UU9 Q;  5ELN A;  4RG1 A;  2UUB L;  2NVY H;  4DR1 Q;  1XNQ Q;  2K14 A;  3K7U C;  2PNH A;  2IX1 A;  2FXQ A;  5GRO A;  4JG2 A;  1Y02 A;  4QJF A;  4GNX C;  4JOI A;  4AYB E;  4DV6 L;  5GQO A;  4OON A;  1N32 Q;  4R4T A;  1VQC A;  4MZ9 A;  3M85 A;  4A3M H;  4LF8 Q;  4PZ8 A;  2UXC L;  3S24 A;  3A5Z B;  4J15 A;  3J80 c;  4LF4 Q;  2V1C C;  5M5Y H;  2K5N A;  5E7N A;  3T1H Q;  1FVI A;  4BXX H;  4R1J A;  5AJ3 Q;  3ULL A;  3F2D A;  4DR3 Q;  1KL9 A;  2ZTC A;  4KHP Q;  2UXB L;  1BBW A;  2ZTE A;  1S3O A;  2W51 A;  1L1O B;  2D0P A;  1KRS A;  3CCL A;  2HJQ A;  3FKI G;  4LF7 Q;  1HZ9 A;  2ALY B;  1XNR L;  2R7Z H;  1RIP A;  1N34 Q;  1GD7 A;  2ZJP A;  2ASB A;  2XTI A;  3K8A A;  3HOX G;  1BKB A;  3PF4 A;  4NB3 A;  4JI5 L;  2IHF A;  2BH2 A;  4DUY L;  1IBK L;  2JK8 A;  2ZTD A;  1E7L A;  3UDI A;  1I3Q H;  1HNW Q;  3RLN A;  2JEB I;  5IYD H;  3AQQ A;  4X62 L;  5FJ8 G;  4KHZ A;  4HID A;  4LUO A;  2I5L X;  3G6E A;  2K4K A;  3AEV A;  3PGZ A;  3K80 C;  4R4C A;  3OTO Q;  3CF5 A;  1QZH A;  1UWV A;  1B70 B;  2ZM6 Q;  1EFW A;  2VUM H;  1QVC A;  1Q86 C;  1OXV A;  2B29 A;  2EIF A;  5LMN Q;  1X3F A;  3RNU A;  1C0A A;  1WOC A;  1X56 A;  5FLX c;  3M4Q A;  3FHW A;  2Z6K C;  4Y7N H;  3I4N G;  4NXN L;  2KCM A;  1E24 A;  2K5V A;  2NN6 G;  3A74 A;  2E5L L;  3A5U A;  1L1O C;  2JA6 H;  1TWA H;  3UDG A;  4LFB Q;  2UUC Q;  1V43 A;  2YTX A;  4OXP A;  5BR8 Q;  2YTV A;  4A3E H;  1UE5 A;  3HOV H;  3JAM i;  3MXN B;  1S72 A;  1GKU B;  1UEB A;  3KJP A;  3DM3 A;  5IP7 H;  2UU9 L;  1VQD A;  3NEL A;  1KHI A;  3ULP A;  4IO9 A;  4A76 A;  4BBS G;  4A93 H;  2OTJ A;  4IFD J;  1TWH H;  4PG3 A;  4DV0 Q;  1SRO A;  2N78 A;  3D31 A;  5C0X I;  2JA5 H;  1EUJ A;  4PZ7 A;  2JA8 G;  2R92 H;  4JI8 L;  5IE8 A;  2QNF A;  1MIU A;  2UXD Q;  3HOW G;  4ALP A;  4UY8 C;  3AYH B;  4X66 Q;  4GNX A;  3CCU A;  1V9P A;  1KQS A;  1G29 1;  1H95 A;  1YJN A;  1VQH A;  3HOW H;  1XTD A;  1VQJ A;  4YWM A;  2CKZ B;  5C44 H;  4BY1 H;  2ZJR A;  1S40 A;  1IBM Q;  1WFQ A;  5IYC H;  4GKK Q;  2WAQ G;  1L1O A;  2D62 A;  1MKH A;  4GN5 A;  1N36 L;  2R93 H;  4LF6 Q;  3STB C;  1N8R C;  1JEI A;  3HKZ E;  4EX5 A;  1LM0 A;  5K36 G;  2Z0S A;  3CAM A;  4A3M G;  4YWK A;  1A0I A;  3ZJY C;  2F4V Q;  3S17 H;  2Q2U A;  1N32 L;  1CKO A;  1Q46 A;  5C3E G;  4JI4 Q;  4XIG S;  5GAG C;  2JE6 I;  1Z47 A;  1R9T H;  1IYJ B;  1N34 L;  1TWC H;  4DR1 L;  3U4Z A;  1E7D A;  1SE8 A;  5C3E H;  3RZO H;  4DUZ L;  1EN7 A;  4JYA L;  4DR4 L;  3GTL H;  2MNA A;  3CW2 C;  4B3R Q;  2K52 A;  4DR4 Q;  4A93 G;  4BBR H;  2NZO A;  2LXK A;  2H5X A;  1WYD A;  1TWF H;  4P74 A;  3HOX H;  4B3S Q;  1YJW A;  4C3H H;  4MTN A;  1NJI C;  4DV4 Q;  4ME3 A;  4GLX A;  3W1B A;  4LF4 L;  2IY5 B;  4KLK A;  3ULJ A;  2K75 A;  5C4X G;  3G48 A;  3W1G A;  1PH5 A;  2Y0S G;  1K0R A;  3I4M H;  4DR6 L;  2PMZ E;  4NXN Q;  5JJI A;  2VZA A;  2KFV A;  2WB1 G;  1X9N A;  2KHI A;  2YU9 H;  4DR6 Q;  2DK4 A;  4YHH Q;  2JA9 A;  4DNI A;  4DV2 L;  1YNS A;  3PUY A;  2B63 G;  2A19 A;  3S1N H;  3G4S A;  5FLM G;  4HJ7 A;  2L15 A;  1Q8K A;  2LXJ A;  1QZG A;  4UPA A;  3KF8 B;  4DR7 Q;  1HR0 W;  3I4N H;  5IYB G;  2ID0 A;  4JC0 A;  4JBJ A;  4OX9 L;  2JA7 G;  4X6A H;  1XPO A;  1X6O A;  2CCZ A;  1HNX L;  3KF6 A;  3AFQ A;  4LWC A;  1IBK Q;  1HNW L;  1P8L A;  1QVF A;  1WCM H;  1EIF A;  4JBW A;  4DR2 L;  3W5O A;  4NXM Q;  3HOU H;  2R7Z G;  1CSQ A;  3KFU A;  2VQF Q;  1Q1E A;  4AQY Q;  3TQY A;  4IPG A;  4YCU A;  2R7D A;  2KEN A;  4NXM L;  1PYB A;  3K0X A;  4EQ5 A;  1SN8 A;  1HZA A;  1PHJ A;  4JV5 Q;  4JOI C;  5IP7 G;  3I56 A;  1PH1 A;  3CME A;  3CD6 A;  1VQ9 A;  3GTJ H;  1TWG H;  4LFC Q;  3FKI H;  3SGI A;  5LMN L;  3GDE A;  4UP7 A;  3PIP A;  2EXD A;  3BZC A;  2UUA L;  1YZ6 A;  4GKK L;  1VQG A;  2VUM G;  1VQP A;  4RMF A;  1HNZ L;  2LD7 A;  1ASZ A;  1PVO A;  4L5T A;  1GKH A;  1P16 A;  1A63 A;  2HQL A;  1VQ8 A;  1OXT A;  5M3M H;  1NY4 A;  1IXR A;  2BH8 A;  2PI2 E;  4KI0 A;  4DPG A;  1YHQ A;  5IYD G;  4LFA L;  4B3T Q;  5IYC G;  2HT1 A;  4IFD G;  1E3P A;  1YNX A;  3F1Z A;  3CC7 A;  1B8A A;  1D8L A;  5LMU Q;  1VQI A;  1KC8 C;  2KHJ A;  2Q2H A;  2YV5 A;  4PMW A;  4BY1 G;  4DK6 C;  5C44 G;  2VL6 A;  2PQA A;  1YIJ A;  2VS1 A;  4JI6 Q;  2VNU D;  1JE5 A;  1BBU A;  3RR5 A;  3KF6 B;  2EQS A;  1I94 L;  2QNC A;  1Q12 A;  2CWA A;  4B3R L;  2MQH A;  1JJC B;  4QQB X;  2NVT H;  4IOC A;  4TVA B;  3BJU A;  2DUD A;  3PUV A;  1JMC A;  4IPH A;  3Q8D A;  3GTP H;  3T1H L;  4K0K Q;  1EYG A;  2MO0 A;  3H0G H;  5JEA G;  3BZK A;  3UDX A;  4LF6 L;  2E8G A;  2N3S A;  4YWL A;  4UP9 A;  1PH6 A;  3H3V I;  3A0J A;  4A3G G;  4AYB G;  3M9B A;  2JQO A;  4X65 L;  1VQ4 A;  4A3K G;  2I5H A;  4AIM A;  1XMQ Q;  1M90 C;  1Y14 B;  4GS3 A;  2RHQ B;  4X65 Q;  1VQE A;  4A4I A;  1C9O A;  4DV3 L;  4APV A;  2C35 B;  2VQE L;  4HJ9 A;  2ATW A;  1VQK A;  2R7F A;  2AWN A;  4GOP A;  4DAM A;  1CKN A;  2AWO A;  4A3J G;  4JI5 Q;  3KDF B;  1PFS A;  2WP8 J;  4LF8 L;  3TRZ A;  4XTC S;  2VQF L;  1PH9 A;  5LMN W;  5JEA J;  1E1T A;  4AQY L;  2Q2T A;  4L5R C;  1VQO A;  2VW9 A;  1WI5 A;  2ZM6 L;  4GOP C;  1A8V A;  2GVA A;  3FP9 A;  2NVX H;  3TEH B;  4JI1 L;  1U5K A;  1VQF A;  3EIV A;  4YCV A;  3I2Z A;  1YJ9 A;  3CCM A;  4A3E G;  5IP9 H;  2JJQ A;  4IPD A;  2OTL A;  4LF9 Q;  4POG A;  2R93 G;  3H0G G;  5AJ3 L;  3CC2 A;  1AE3 A;  2F52 A;  1K8G A;  1VQM A;  4DV1 Q;  4DR5 L;  1EIY B;  4LFB L;  4A75 A;  2UUC L;  3CXC A;  2AKW B;  4C3I H;  4YHH L;  4DV2 Q;  1D7Q A;  1PH4 A;  3ICE A;  1NE3 A;  2AMC B;  3B6Y A;  4QGU A;  1Q7Y C;  3HKS A;  4Y52 H;  1U0L A;  1V1Q A;  1VCI A;  4OX9 Q;  3HOY G;  3S2H H;  1Q82 C;  3CP0 A;  3RN5 A;  3S2D H;  1FL0 A;  3UE1 A;  4A3K H;  1VQN A;  1KAW A;  4DR2 Q;  2VY3 A;  5LMU L;  4C3J H;  4A3G H;  2WB1 E;  3I7F A;  4HJ5 A;  4B3T L;  4GOP B;  4HIO A;  4A3C G;  3MEF A;  3S1R H;  3HOZ G;  5JJK A;  3KDF A;  2QEX A;  4JI6 L;  2N49 A;  4X66 L;  3GO5 A;  1XJV A;  3S16 H;  1OXX K;  2IT1 A;  4O0A A;  4P72 A;  2UXD L;  1QUQ A;  1XMO L;  1JT8 A;  3PUW A;  4UP8 A;  1VQL A;  3GTK H;  3HOU G;  1ZS9 A;  2RCN A;  1HH2 P;  2YTY A;  1LTL A;  4HJA A;  1MJC A;  4K0K L;  4A3F G;  1EQR A;  5IP9 G;  1IBL L;  1PH3 A;  3OYY A;  4NPS A;  4P75 A;  1WCM G;  1GM5 A;  5J3B A;  4JI2 L;  5GAD C;  1N36 Q;  2I0Q A;  3KLW A;  4OWW B;  4QL5 A;  3S14 H;  1PV4 A;  2UXB Q;  4BY7 G;  1NMG A;  2E2I H;  4YCW A;  3PO2 G;  1FGU A;  1XMQ L;  1Y1W H;  3CC4 A;  1Z9F A;  2K5H A;  2OCE A;  3K81 C;  1XNQ L;  2HIX A;  2NZH A;  1PH7 A;  2CFM A;  5C4X H;  1HR0 L;  1AE2 A;  4IOA A;  4GKJ Q;  3JC6 6;  5DLQ E;  1X54 A;  1FJG L;  1W2B A;  2A8V A;  4A3L H;  4R4O A;  2QA4 A;  1IL2 A;  1KXL A;  4JI0 L;  3K7A H;  3I55 A;  1J5E Q;  2UXC Q;  4QIW E;  5FLM H;  4A3I G;  4B3S L;  1GVP A;  1CSP A;  1YEZ A;  3WWV A;  3OTO L;  4LNQ A;  4IFD I;  4A3B H;  2ODC I;  4JI1 Q;  1JB7 A;  3J7A 5;  4DAY B;  2JA7 H;  4P73 A;  1VS0 A;  3CCV A;  4DR3 L;  4A3F H;  1KIX A;  1K83 H;  2BA1 A;  3J81 j;  4A3C H;  2QGQ A;  3L0O A;  4A3B G;  3GD7 A;  3PV0 A;  4POF A;  1QVG A;  1H9E A;  1I5F A;  2I5M X;  3U50 C;  1LYL A;  3GTM H;  4TQU S;  2HHH L;  1I50 H;  1GL9 B;  1UE1 A;  5EAY A;  4L5S A;  3PUZ A;  4LF7 L;  4BA2 I;  3IRB A;  4LW1 A;  4HJ8 A;  4DR7 L;  2ODG C;  4JBK A;  3L2P A;  1GO3 E;  3S15 H;  3UDF A;  2F3I A;  4YY3 Q;  3D0F A;  1T9H A;  3J81 c;  4JI7 L;  3GTG H;  2PQA B;  4DK3 C;  4JI3 Q;  3TRE A;  1MJE A;  2PI2 A;  2XGT A;  2A1A A;  4JI7 Q;  1SLJ A;  4JI3 L;  3F2C A;  2WFW A;  3S1Q H;  1E7Z A;  4OWX B;  4WJ4 A;  3PO2 H;  1N9W A;  3ER0 A;  3F8T A;  4X64 L;  5H1S E;  1SR3 A;  3J81 i;  3E0E A;  2YYZ A;  4FDB A;  1Q81 C;  2OWO A;  2CQO A;  2KBN A;  1CUK A;  4MNO A;  4DV4 L;  1BVS A;  1Y1V H;  1K8A C;  1L0W A;  3KOJ A;  1B7Y B;  1OXS C;  3STB D;  3CMA A;  4DR5 Q;  1PA6 A;  4IPC A;  1XMO Q;  2UUA Q;  2NVQ H;  3EN2 A;  2GN5 A;  3RN2 A;  3PF5 A;  4R4I A;  4OWT B;  1IBM L;  5IWA Q;  4A3J H;  4A3D G;  2NN6 I;  3OW2 A;  4JCV E;  4LF5 Q;  5FJ8 H;  1VQ7 A;  1YHB A;  5M3M G;  1KD1 C;  3RLF A;  3VDY A;  2IHE A;  1M1K C;  2B3G A;  4GLV B;  3PO3 H;  4GLA C;  4PZ6 A;  4GN4 B;  3RZD H;  5BR8 L;  1PH8 A;  1NMF A;  1VQA A;  2AHO B;  3HFZ B;  4OO1 G;  4LFA Q;  4JI4 L;  1EQQ A;  1ASY A;  4DV0 L;  4BY7 H;  1O7I A;  1HNX Q;  4JBM A;  2OQ0 A;  3CPF A;  5IYB H;  1H9F A;  1YVC A;  5M3F H;  2IX0 A;  5IT9 c;  1YHA A;  1C7Y A;  1FJG Q;  1N33 L;  2JA6 G;  2ES2 A;  3HOY H;  5C0X G;  1I94 Q;  1HR0 Q;  1YI2 A;  3GTQ H;  4JI8 Q;  4DV5 L;  5C4J H;  1QUQ B;  4B3M Q;  4DV6 Q;  1YIT A;  2Y0S E;  2R92 G;  4IJH A;  3CCS A;  5HY6 A;  4LFC L;  1NBW A;  4IJL A;  1EOV A;  1UE7 A;  1L2F A;  1WJJ A;  3AFP A;  4P71 A;  3CCQ A;  4WJ3 M;  3I4M G;  1W3S A;  1E22 A;  4JI2 Q;  2RF4 A;  2Q2I A;  1IBL Q;  3PUX A;  3CCE A;  2E5L Q;  2GVB A;  1IZ6 A;  1VQ6 A;  1EWI A;  4A3L G;  2CWP A;  2MPH A;  2LSS A;  1Y1V G;  1A62 A;  1XNR Q;  1SMX A;  2UUB Q;  2F4V L;  4GKJ L;  2VQE Q;  4BXX G;  1KRT A;  3HOV G;  4DV3 Q;  4DUZ Q;  4GNX B;  4JYA Q;  3T1Y Q;  4DUY Q;  3HOZ H;  3NBH B;  3TS0 A;  3CQZ H;  3NEN A;  3T1Y L;  1J5E L;  4YY3 L;  3G71 A;  1G51 A;  2E2J H;  4JI0 Q;  4DKA C;  1RL2 A;  4X62 Q;  1X3G A;  1DGS A;  5C0X J;  4JV5 L;  4X64 Q;  1X55 A;  4OO1 I;  5HGQ A;  1HJP A;  5IY0 A;  1I6H H;  2JEA I;  5M3F G;  3J80 i;  1Y1W G;  3H3V H;  4LUZ A;  3BU2 A;  1XPU A;  1CKM A;  3CPW A;  4DV1 L;  2DGY A;  3LGJ A;  4BA1 I;  4LF9 L;  2D0O A;  3E9H A;  1E1O A;  1K9M C;  2E2H H;  1UE6 A;  2R6G A;  4O2D A;  3L7Z C;  3DLL A;  1OTC A;  2ZJQ A;  5IWA L;  4LF5 L;  3E9I A;  3EBE A;  2HHH Q;  3TS2 A;  2HIV A;  5M5X H;  4AH6 A;  2JA8 H;  3U58 A;  4A3D H;  2K50 A;  4QY7 A;  4KHP L;  4H02 A;  1CKN B;  3HKZ G;  4L5Q A;  5ELO A;  4A3I H;  3M7N A;  2B63 H;  3U4V A;  2LC3 A;  1N33 Q;  3M4P A;  2WAQ E;  3M3Y H;  5GAH C;  1G6P A;  1HZC A;  1SFO H;  1XPR A;  3I4O A;  3H15 A;  3CCR A;  2MFI A;  1JJG A;  1SRU A;  3NEM A;  1PYS B;  5JJL A;  3J7Z C;  1VQB A;  4GN3 B;  2RHS B;  2MO1 A;  3PCO B;  1K3R A;  3F2B A;  2BA0 A;  3CCJ A;  4DV5 Q;  4R4Q A;  1JJ2 A;  4B3M L;  1GJJ A;  3RLO A;  1Q1B A;  4LUV A;  3KYH C;  4HIM A;  1AH9 A;  1NTG A;  1K73 C;  3PO3 G;  3PIO A;  2OQK A;  1VQ5 A;  4DV7 Q;  3M4O H;  2G80 A;  1HNZ Q;  2N8N A;  3KJO A;  1LUZ A;  5GAE C;  4DV7 L;  4BBS H;  1X3E A;  1TXY A;  4BBR G;  2Z6K A;  3S1M H;  3PSI A;  3GTO H;  4HIK A;  1YBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...