1A8VA

Structure of the rna-binding domain of the rho transcription terminator
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
120
structure length
115
Chain Sequence
GHMNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSAAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription termination
molecule keywords TRANSCRIPTION TERMINATION FACTOR RHO
publication title The structural basis for terminator recognition by the Rho transcription termination factor.
pubmed doi rcsb
source organism Escherichia coli
total genus 29
structure length 115
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07498 Rho_N Rho termination factor, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.10 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 1a8vA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1a8vA02
1I50H 1Z47A 1VQGA 4GOPB 2JJQA 4DPGA 3CC2A 3OTOQ 3A74A 1S72A 1A0IA 2LXJA 3RLOA 5JEAG 4L5QA 1N34L 2UUCQ 3CCLA 3H0GH 1K8AC 3AYHB 1MKHA 1Q46A 3RR5A 4EQ5A 4UPAA 4DR3L 1K9MC 1XPUA 3GTGH 3I4NH 2L15A 2QA4A 1TWHH 1HZ9A 3M4PA 1XMQL 4NB3A 1IZ6A 2PI2E 3KF6A 4DV5Q 1HNXQ 1GM5A 1QVCA 1IBLQ 3CCVA 4NPSA 3JAMc 3S24A 5IT9c 2AHOB 1XNQL 4LF4L 1VQAA 1JE5A 2K4KA 4OO1G 1EFWA 4LF7Q 3PUWA 2KCTA 1OXVA 4IPHA 2BA0A 1XMOQ 1J6QA 4JI6L 1X9NA 1VCIA 2CQOA 2UUAQ 4BY1H 3CCUA 1TWAH 1Q86C 2JA6H 2NVQH 1OXTA 3PIOA 5IYBG 1E3PA 3I56A 1N8RC 3MXNB 3GTMH 3PO3G 4JYAL 4DAMA 1VQ7A 3T1YQ 5C44G 2AMCB 4DR1Q 4K0KL 4X65Q 5M3FH 1KAWA 1WCMH 4NXNQ 4GOPA 4P73A 4TQUS 3BZKA 2F4VL 1P16A 2Z6KA 2ATWA 4MTNA 4AIMA 4LUOA 4DR2Q 2VUMH 3S1NH 2ID0A 4Y7NH 1DGSA 3MEFA 1N32L 1VQOA 2N49A 4IFDI 3E0EA 1NMGA 1UE1A 4A3DG 1V1QA 1Q12A 1Z9FA 4P71A 2JA7H 1HJPA 4AQYQ 1SLJA 1UE6A 3RN2A 4KHPL 3RZOH 4DV7Q 1YHAA 1PH1A 2VW9A 1ASYA 2E5LL 3S2HH 3H0GG 3H3VH 3ERSX 4B3SL 1K83H 2YYZA 2H5XA 5C0XJ 3I4NG 1B7YB 2VL6A 1PYSB 3KJOA 4DR6L 2D0OA 4JI8Q 4DV1Q 2A1AA 2YTYA 3CAMA 2VQEL 3F8TA 2Q2TA 3G71A 1OTCA 1NMFA 5LMUL 1Y1WH 4DR5Q 4JI2Q 4GKKL 1E1TA 2A8VA 3KJPA 2QGQA 4IJHA 3W1GA 2OCEA 3I4MG 2JA5H 4KI0A 4DK3C 3L7ZC 4X62L 5AJ3Q 1EYGA 1JJGA 3PSIA 2C35B 3DM3A 4LUZA 2ASBA 1SRUA 3CQZH 2JA9A 2UUBL 2D0PA 1EWIA 3BZCA 1KQSA 4BY1G 2JA8H 1NE3A 3G48A 2JA6G 2N3SA 4MZ9A 4JC0A 1N36L 2XTIA 4UP7A 3CC7A 1KHIA 2CFMA 4JOIC 4A3BH 4IOCA 3KLWA 1XPOA 2I5LX 1XNRL 4JI7Q 2OQ0A 5M3FG 1WCMG 2N8NA 1UE7A 3CCEA 1S40A 1K3RA 2ZM6L 1L2FA 4DNIA 3PV0A 3U4ZA 2K5VA 2KHIA 3RLNA 4DV3Q 4B3RL 1VQCA 1FL0A 3LGJA 1HR0Q 1WI5A 3OYYA 4X66Q 1QZHA 1IBML 4JI3Q 4QQBX 1YZ6A 4JI0L 4WJ3M 1YHBA 1AH9A 1V43A 3STBD 1VQDA 3S1RH 4A76A 3TS0A 4UP8A 4BXXH 4IO9A 4YWKA 1N33L 1KXLA 3G6EA 3A5ZB 2F52A 3S14H 4DAYB 2DGYA 3GTPH 3D0FA 4H02A 2I5MX 1AE2A 2ZJRA 3CMEA 4A3CG 3GTKH 3PIPA 1N9WA 1I5FA 1G291 3KF6B 4DR3Q 1VQKA 2UXDL 3GO5A 1U0LA 2MO0A 5M5XH 3TREA 3CCJA 3K80C 2ZJQA 1HZCA 4XTCS 4HIDA 1Q1EA 3ER0A 4PZ8A 3A5UA 2MO1A 2K75A 4A3KG 2PNHA 2R6GA 1VQJA 2HHHL 2UXBL 1KD1C 1VQ6A 3AFQA 3M4QA 4J15A 4OX9L 4DV2L 4B3ML 1S3OA 3T1HQ 5C3EH 4LF4Q 3S2DH 5GADC 2HT1A 1M1KC 1C0AA 3FP9A 2VY3A 3J80i 1I94Q 3W5OA 2RF4A 4YCUA 1PYBA 1E7DA 3PCOB 4JI6Q 1EIFA 1E22A 3CP0A 3UDXA 5K36G 3HOUH 4JYAQ 2E8GA 3E9IA 1G51A 4C3IH 4LF8L 4A3BG 4JCVE 1E7LA 2BH8A 4JI4L 1HNWL 4YY3L 1FJGL 1D8LA 1QZGA 5M3MH 3STBC 5FLMG 4K0KQ 4A4IA 4JV5L 2N78A 2F4VQ 4JOIA 3F2CA 3J81c 3PUXA 4P75A 3CCSA 2EQSA 2HQLA 3JC66 4RMFA 5JEAJ 5IYCH 4HIKA 1KC8C 1PH8A 4BXXG 1VQBA 4QL5A 3HOZG 2WAQG 4A3EH 3AEVA 3PUYA 2KENA 4LF9L 4BBSH 5BR8L 4POGA 4C2MH 1L0WA 3TEHB 1CKOA 4L5SA 1LYLA 3NEMA 2AKWB 5GAGC 1NJIC 2PMZE 3CCRA 3BU2A 2RCNA 1K8GA 1Y1VH 4DV4Q 4B3SQ 4R1JA 3I55A 3TRZA 4GKJQ 1G6PA 4NXML 1I3QH 1BVSA 1IBKQ 3PO2H 3HOXH 2R7ZH 2IX0A 2ZTEA 1HNZL 3J81j 3NELA 4OWXB 5IP9H 1QUQB 4PZ6A 5LMUQ 4DR4L 4BY7H 1L1OC 4LFCL 3HKZG 3S1QH 3G4SA 1KRTA 1HZBA 1W3SA 1VQPA 2R7DA 4IPGA 4DK6C 3JAMi 4GN5A 1Q1BA 4R4TA 5HY6A 2K50A 4LF5L 2MQHA 2WP8J 4X62Q 1X3EA 1YHQA 4JBMA 1QVFA 4DR7Q 1VQ5A 1JMCA 4JI5L 3U50C 1H95A 4LNQA 1EOVA 4LF6L 1L1OB 4KHZA 2IHEA 1XNRQ 3M9BA 4DV6L 4HJ9A 2UXCQ 1YBYA 4LWCA 4QY7A 1VQ9A 3K0XA 3IRBA 2ZM6Q 4O2DA 3Q8DA 1X55A 2E2IH 3ULJA 3HOWH 4B3RQ 1EN7A 3ZJYC 5IYCG 4C3HH 4JI0Q 4APVA 2ZTCA 2QNFA 2E2HH 4EX5A 4A3EG 5ELOA 2VNUD 1N33Q 2AWNA 4JBJA 2Y0SG 1VQLA 2Q2IA 1C7YA 4R4CA 4X64L 3OW2A 4HJAA 1QUQA 2R7FA 4Y52H 3I7FA 2QEXA 1QVGA 1O7IA 1VQFA 5LMNQ 3I4OA 5IYDH 4TVAB 2UXDQ 5FJ8H 1X3GA 1J5EQ 4OWWB 1IXRA 5GAEC 5IYDG 2D62A 2K14A 1EQQA 4C3JH 4ALPA 2HHHQ 2ES2A 2UXBQ 3FKIH 1X6OA 2JEAI 2UUAL 1UE5A 5C4XH 2WB1G 5M5YH 5FLXc 3H15A 1TWFH 3EN2A 3U58A 4B3MQ 3EBEA 4HJ7A 1L1OA 1BBUA 4BA1I 2VUMG 4DV0L 1E1OA 4DR1L 1YI2A 4DUYQ 4X65L 1YJWA 3NENA 4QGUA 3CPFA 2JQOA 4GNXC 5DLQE 5GAHC 2JA7G 4B3TQ 1JT8A 1VQ4A 1GO3E 4PMWA 5GQOA 2OQKA 1JJCB 3EIVA 3PUZA 4OO1I 2OTLA 2B29A 3ULPA 4JI4Q 2QNCA 2I0QA 1A8VA 1N34Q 1PH7A 5J3BA 4A3JH 3K7AH 1PA6A 4A3GH 1EUJA 1OXXK 4DV7L 4JV5Q 1A62A 2A19A 5ELNA 1YITA 1PV4A 4JI1L 1VQMA 4AYBG 3M3YH 1Y1WG 4GNXB 1XMQQ 3GD7A 3UDFA 2BH2A 3ICEA 3KFUA 2CKZB 4BA2I 1VQNA 3S1MH 2PQAA 3J7ZC 2I5HA 4JI8L 3KOJA 4DV1L 2JA5G 3WWVA 1XJVA 1FVIA 1Q8KA 1VS0A 2VZAA 1Q81C 4HJ8A 2HJQA 2IHFA 4DR5L 4JI2L 1VQIA 4JBKA 3HKSA 5H1SE 1XNQQ 4KLKA 4R4IA 4WJ4A 4LFBL 3AQQA 1YJ9A 2JA8G 4IFDG 1X3FA 5IE8A 1K0RA 1T9HA 1HNZQ 2EIFA 4YCVA 3RLFA 5AJ3L 4GN3B 4GN4B 4DR4Q 4LFCQ 4XIGS 3FKIG 1YVCA 1CKNB 4OWTB 3D31A 2NZOA 2DUDA 1CKMA 3NBHB 3PO3H 2E2JH 1GD7A 4JI7L 1BBWA 3GTJH 1SR3A 2KBNA 4FDBA 3GDEA 3VDYA 1N32Q 3E9HA 3CD6A 2KHJA 1HZAA 2NVYH 4JI3L 4GLXA 4LF6Q 2WB1E 3KDFB 3CXCA 2UU9L 4KHPQ 4YHHL 2IY5B 2Z0SA 3CMAA 4GNXA 5IWAL 2E5LQ 4A3JG 4A3DH 1SMXA 5IY0A 2AWOA 3J81i 3HOYH 5IP7H 4DR6Q 3B6YA 3PF4A 4LFAL 2IT1A 2IX1A 3TQYA 2VQEQ 4GLAC 4GKKQ 3AFPA 1U5KA 1R9TH 1B70B 4A3MH 1LTLA 3KYHC 2K5HA 1SFOH 2HIVA 4X64Q 4POFA 4A93H 4A75A 1PH6A 5C3EG 3RNUA 1SN8A 2OTJA 3RN5A 4YCWA 1CKNA 4GLVB 4AYBE 2LSSA 3UE1A 2LXKA 2HIXA 2NN6G 3M85A 3I4MH 2KCMA 1EIYB 2UUBQ 2FXQA 3K81C 3T1HL 5JJLA 3PUVA 3CF5A 3H3VI 4A3LH 3HOUG 1N36Q 2OWOA 2K52A 1XPRA 1I94L 2VQFL 4L5RC 5M3MG 2XGTA 1C9OA 1X56A 4YWLA 4BBRH 3CCMA 3S16H 1WOCA 5C4JH 4DUZL 1K73C 1MJEA 3M7NA 1YJNA 3KDFA 3HOVH 3TS2A 2YU9H 4DV0Q 3OTOL 3ULLA 4P72A 1PFSA 1LUZA 1Q7YC 1XTDA 2ALYB 1IBMQ 1UWVA 2JE6I 3PF5A 3F2DA 2UUCL 4O0AA 3M4OH 4HIMA 2YTVA 1HH2P 4BBSG 1GKHA 2MNAA 1PH9A 1VQ8A 1IL2A 3GTLH 1IYJB 4A3FH 4UY8C 1E24A 1Y1VG 4DUZQ 2B63H 4DV5L 2F3IA 1HNXL 1KRSA 3F2BA 1M90C 1IBLL 3FHWA 5IP7G 3HOYG 5C0XG 3HOXG 2CWPA 2R7ZG 1W2BA 3HFZB 1CSPA 3U4VA 2PQAB 3PO2G 4JBWA 4A3IH 4X6AH 2WAQE 2K5NA 1PH3A 4JI1Q 1WJJA 1YEZA 3W1BA 5IP9G 4DV4L 2ZTDA 4BY7G 2R92H 1KL9A 1EQRA 4A3CH 2B3GA 4GKJL 4A3MG 4LF7L 1V9PA 1IBKL 1D7QA 5EAYA 4HJ5A 5E7NA 5HGQA 4L5TA 4AH6A 1XMOL 4A93G 1TWCH 1RL2A 1NTGA 1WFQA 4OX9Q 4DV2Q 2Q2UA 1PVOA 5JJIA 3PGZA 2ZJPA 4A3KH 1JJ2A 4LFBQ 3T1YL 1TXYA 1MJCA 2NZHA 4LUVA 3CCQA 1YNXA 4A3LG 1LM0A 4NXNL 3HKZE 1NBWA 2NVXH 4MNOA 2YV5A 1B8AA 3L2PA 1P8LA 1SROA 4PZ7A 4UP9A 1PH5A 3GTQH 4DR7L 4DR2L 5GROA 4LF8Q 3BJUA 3J7A5 4BBRG 4JG2A 3RZDH 1HNWQ 2GVAA 4YY3Q 2WFWA 4IPDA 1PHJA 1FJGQ 2VS1A 1WYDA 4HIOA 3HOVG 4QIWE 3UDIA 2R93H 4DKAC 1Y14B 3CW2C 1A63A 2GN5A 4P74A 4IPCA 4AQYL 3HOWG 4IOAA 1SE8A 2V1CC 2PI2A 2UXCL 5LMNW 1NY4A 1AE3A 1TWGH 3A0JA 2EXDA 5FLMH 2JEBI 4OXPA 1JB7A 3CC4A 2Q2HA 4R4OA 3SGIA 1YIJA 4LF9Q 2UU9Q 4LW1A 5BR8Q 2JK8A 5M5WH 2NN6I 4QJFA 1GVPA 4YHHQ 4A3FG 2B63G 3DLLA 1X65A 5IWAQ 2BA1A 2GVBA 2RHSB 3HOZH 3K7UC 5JJKA 1VQHA 4GS3A 2CCZA 4A3IG 4R4QA 5FJ8G 4NXMQ 2RHQB 1HR0W 1VQEA 4YWMA 1FGUA 3I2ZA 3UE0A 4LFAQ 2R92G 4PG3A 2Y0SE 1UEBA 5LMNL 1CUKA 1OXSC 1KIXA 1PH2A 1ASZA 3J80c 4IFDJ 3L0OA 2NVTH 3K8AA 1J5EL 5C4XG 2MFIA 3F1ZA 4IJLA 4GOPC 3GTOH 4LF5Q 1CSQA 1E7ZA 2Z6KC 5IYBH 1RIPA 3CPWA 4JI5Q 5C44H 1Q82C 1OXUA 4RG1A 4DV3L 1X54A 3S17H 2CWAA 2YTXA 1HR0L 4DUYL 3UDGA 4X66L 4OONA 3S15H 5C0XI 4ME3A 2VQFQ 1I6HH 1BKBA 4DV6Q 1PH4A 2R93G 4B3TL 1MIUA 4A3GG 3KF8B
chains in the Genus database with same CATH superfamily
1VQGA 4CDFC 3NWTA 2L12A 1GXDC 1A0IA 4K2LA 5JEAG 2MPMA 5TSSA 1R4PB 1R4QB 4EQ5A 4TSSA 4DAYA 1WD0A 1HHVA 1TWHH 2JXMB 3M4PA 4NB3A 2PI2E 3KF6A 3H0GB 1GM5A 3SDZA 4F8MA 5EPLA 2Z6BA 3JAMc 4KJNA 1C48A 3R2TA 4RCNA 3O13A 1GUGA 1STHA 4BWGB 3PUWA 1A2UA 1OXVA 1S5BD 4IPHA 2LD7A 4JI6L 1PFMA 1TWAH 3TN2A 3PIOA 4JYAL 5IYBG 1N8RC 2P5ZX 3MTSA 4X65Q 1KAWA 2VB2X 3NUCA 5C4HA 2L11A 4GOPA 4GZYC 4IZ8A 3BZKA 2F4VL 2Z6KA 2VUMH 2IX3A 1O7YA 1EOTA 5E3FA 1DGSA 1KHCA 3MEFA 2KA7A 4A3DG 1NSNS 2JA7H 4RGMA 1HJPA 4AQYQ 1SLJA 1UE6A 3C1FA 5KEEA 3RZOH 1K8OA 1I4QA 2PMZB 2E5LL 3S2HH 2F0PA 4KN7C 1B7YB 3HZXA 1PYSB 4IURA 4KD3A 3SK5A 2D0OA 4DR6L 2YTYA 3CAMA 1JOOA 2LC3A 1OTCA 1Y1WH 4QUFA 1E1TA 4V190 2Z4HA 3I4MG 2OT2A 1LT6D 1JE4A 1PTOC 1SE2A 5AJ3Q 1ML0D 1V66A 1SRUA 4P2CB 2JA8H 3DM1A 4BY1G 1EYDA 1NE3A 1AFPA 4MZ9A 1PTOH 3CC7A 1EY5A 2IPKD 2NYZD 4A3BH 3KLWA 3TP8A 1XPOA 3NBIA 1WCMG 4HSVA 1S40A 1H9SA 3T53B 2FFKB 4DNIA 3PV0A 3RLNA 4HEDA 2EJMA 1SYEA 3LGJA 4QQBX 4WJ3M 2EYOA 1YHBA 1AH9A 2WKCA 3S1RH 1MBYA 1KXLA 4NMZA 4G4KA 3A5ZB 2F52A 3GTPH 1JCKB 5KYLA 2L1BA 2I5MX 1WTHA 2FHTA 3MFYA 2ZJRA 3GTKH 3S14B 3TREA 2CQAA 4XTCS 2F0VA 4PZ8A 2K75A 4QUCA 2UXBL 1HA5A 3HGBA 4OX9L 4B3ML 1S3OA 3S2DH 2HT1A 1M1KC 1GHJA 1CK1A 1STEA 2B39A 5T1IA 3OMGA 4RHRA 3W5OA 3EA6A 2E8GA 4C3IH 1CT1D 4NKLA 3S17B 1ZXTA 5FO7B 4CDEC 3P20A 4JI4L 5CBEE 1HNWL 1FJGL 3S15B 1QZGA 4K0KQ 1LV9A 4LK1C 4A4IA 1W6KA 3FVQA 1RDPD 4JOIA 3F2CA 3J81c 3EROA 3EQLC 3Q6SA 1GUTA 4QL5A 2WV6D 3IFDA 1JOQA 1NAPA 2F0MA 4LF9L 3J7YW 1SNMA 1NR4A 4BBSH 1L0WA 1PFBA 2XRQD 1LYLA 1M8AA 2EY2A 2PMZE 5A2QE 3CCRA 1Y1VH 2EDGA 4B3SQ 4A3EB 5C0XH 2R7ZH 1HTLD 4C2MB 2IX0A 1YNNC 1HNZL 1IW7C 2OXPA 4X3TA 5L37A 3NQTA 1PZID 3R8BA 5LMUQ 3K0YA 1L1OC 2AUJD 1MI2A 1VMCA 1STAA 3J7AV 1STYA 2CH4A 1II3A 1YHQA 1QVFA 2EYHA 2EYJA 1VQ5A 1LTTD 1H95A 1I4GA 2F0GA 2IW3A 4OGQC 2VUMB 4HMJA 5E1FA 4HJ9A 1IYVA 2UXCQ 4LWCA 2B2UC 2ZM6Q 1K28A 3TDQA 2JA7B 1TY2A 4O2DA 1X55A 2G5DA 3E5SA 5IYCG 1KAAA 1JR0D 4APVA 5IGGA 3A7AB 4KKTA 1SYFA 1XX8A 5ELOA 3BVGA 1N33Q 2AWNA 4E6IA 2Y0SG 4V0BA 2JN4A 4R4CA 1QUQA 2ODCI 1JORA 4Y52H 4EQNA 1Y1WB 2MPHA 1LTAD 1QVGA 1O7IA 3I4OA 3H94A 5GAEC 4O42A 2K14A 1EQQA 5IGBA 3FKIH 1X6OA 2JA8B 1B1ZA 2JEAI 3H15A 5M5YH 4HJ7A 1PRTB 1BBUA 2BDOA 4BA1I 1E1OA 3NENA 4QGUA 3CPFA 4GNXC 1JWMD 1JT8A 1VQ4A 1GO3E 1G6ZA 5GQOA 1TS3A 1Y8PB 3T56B 3MC0B 3OW7A 1ENAA 2MJ8A 2G9DA 2A6HC 3DWQA 4BITA 4B08A 2SOBA 3S9WA 4JV5Q 3BG3A 3NQIA 5I6YA 5ELNA 2F3WA 4H0LC 4DGZA 3NHHA 3R93A 2CVRA 4JI1L 3M3YH 5JEAH 4OIJA 3GD7A 3UDFA 3KFUA 4PV1C 3K7AB 1V8QA 4ZYSA 4A3JB 4JI8L 4DR5L 4JI2L 3AU7A 1XTCD 3C1EA 3HKSA 3PIP3 3H6MA 4WJ4A 4LFBL 1YJ9A 4IFDG 1K0RA 3URYA 2F0IA 4CGYB 4RGOS 2ZXRA 4GN4B 4C3JG 1GUOA 4LFCQ 1ILQA 1ET6A 4XIGS 1YVCA 2HCIA 1CKNB 1D5XC 3LWEA 3D31A 2L0CA 2SEBD 3P1HA 5CV6A 1OO9B 1LTBD 1DOMA 2E2JH 4JI7L 1VF5C 2VXWA 1BBWA 1F2YA 1XWEA 3GDEA 4ID6A 2WB1E 3KDFB 2E74C 3GTJB 1VMPA 1STNA 5IWAL 2E5LQ 4A3DH 5IY0A 2NVYB 2AWOA 5IP7H 2L55A 4DR6Q 2IX1A 1EU3A 4ODGA 3NPPA 1JWSD 4GLAC 1Y1VB 1EZ8A 2KEDA 3I70A 5DAUA 4X64Q 2F0OA 3A8KE 4KMUC 2M9VA 4POFA 5C3EG 1DOLA 2NTTA 1EY8A 2OTJA 3K59A 2TMPA 3RN5A 4YCWA 5JJZA 1KNAA 3D3RA 2NN6G 3N52A 4IUQA 1I4HA 3I4MH 3T1HL 1JWUD 3K81C 4A93B 5JJLA 2ZXPA 3DEOA 4A3LH 3H3VI 3HOUG 3E6ZX 2EY6A 4WORA 4L5RC 3K6OA 4I7ZC 3AMUA 3CCMA 4QCLA 1WOCA 5C4JH 3IL8A 3TZUA 1DJRD 1NR2A 5C4ZA 3HOVH 1HFNA 3BDCA 3ULLA 5DM73 4P72A 1PFSA 1LUZA 3SE0A 4OELB 3CU7A 1DONA 3PF5A 3F2DA 4O0AA 2PW5A 3KLSX 2MNAA 4TRDA 3OMCA 3KBXA 1EY6A 4KY6A 2B63H 4CKEA 3F2BA 2KVMA 3PMFA 4X6AH 4JBWA 2WAQE 5IP9G 4A3FB 1DXMA 1UEAB 1LO5D 1EQRA 1V9PA 1FYCA 5E7NA 1JC7A 1B3AA 1B9NA 2F0UA 1ZS9A 3WDNA 1RL2A 4OX9Q 5JJIA 3QIAA 1I4PA 1I4RA 3CCQA 2DK4A 2GA4B 1TWCB 3HKZE 3MXPA 3FDTA 1SE3A 1O80A 4BBRG 4JG2A 3RZDH 2M00A 4DAVA 1HNWQ 1FJGQ 3SVMA 4DKAC 2DJGC 4AQYL 2GN5A 1PZKD 1SE8A 2A5HA 1QNKA 5LMNW 1NY4A 2JEBI 4OXPA 1EIGA 4LF9Q 3Q23A 1TWGB 2NN6I 1BOSA 1GVPA 3DLLA 2RSOA 2BA1A 2RHSB 3DHQA 1VQHA 1ZYRD 2H1EA 4R4QA 2PQEA 4CDCC 1HR0W 1Y69U 3NXWA 5FOBB 2PCFB 4LFAQ 1MSHA 1AW7A 3KUPA 1OXSC 5J22A 2J7ZA 1ASZA 4ZAIA 1TS4A 2NVTH 3IKJA 3WOFA 3F1ZA 3GTOH 3MA2B 1E7ZA 3FRPB 1SYBA 2E76C 2EYFA 1RIPA 2K28A 1O7ZA 5C44H 5JOBA 1FNVA 4RG1A 3MWYW 4K5VA 1BKBA 1PH4A 2R93G 2K01A 4A3GG 3U9OA 2I07B 2LS01 5LL6X 1SDFA 1JQYD 4GOPB 3CC2A 4RA8A 3A74A 4EQPA 1S72A 4IN3A 2LXJA 3RLOA 4L5QA 2X69A 4CKCA 3H0GH 1K8AC 2B2WA 4A3DB 1SYCA 1ZYRC 3AYHB 2JSOA 1CHPD 2TSSA 5IOCA 1BCPD 3QWNA 4RHSA 1XMQL 4DV5Q 1QVCA 4NPSA 1JB3A 2AHOB 1E2ZA 2K4KA 2BCOA 4FO2A 1EFWA 4OHJA 2KCTA 2BDNA 1KABA 2KCCA 4DXGA 1GUWA 1B9MA 2KEEA 4KY7A 3CCUA 4DAMA 2B2TA 4K0KL 4EVOA 3KF8A 1FR3A 4O1NA 4BY1B 2NVQB 1DCZA 4P73A 4MTNA 4AIMA 2ID0A 1N32L 1V1PA 3NP8A 5I6WA 3H3VC 4U68A 1WCMB 4HCSA 4P71A 2D5DA 1H9SB 1Z9FA 4DK0A 3RN2A 1E2WA 2K5QA 3NTHA 4LJZC 4Y7NB 3K5MA 5EPKA 3H3VH 4B3SL 1WD1A 3I4NG 2YYZA 5C0XJ 1SSOA 2VL6A 3KJOA 2D9UA 4DF7A 4JI8Q 4N8FA 1YNJD 3G71A 2KHSA 5LMUL 4GKKL 4DR5Q 4JI2Q 3R3OA 2IWHA 4IJHA 1HQRD 2OCEA 4KI0A 1CTMA 3L7ZC 5IGFA 3KLRA 2EPBA 1AZQA 4B9WA 1JJGA 3W3AA 2UUBL 2JA9A 1EWIA 3BZCA 2K04A 2JA6G 2N3SA 3OIPA 2LKVA 4JC0A 1HTPA 1KHIA 5J39A 4Z9CB 1TS5A 4JI7Q 3ONAB 5M3FG 2EY5A 2F0TA 2ZM6L 4DV3Q 1HXYD 1FL0A 1WI5A 3OYYA 4DA2A 2CH4W 2RSNA 3L3OC 2KVDA 2M2LA 1V43A 4A76A 1BCPF 4UP8A 4IO9A 4L6TB 1N33L 3G6EA 1SEBD 4CJ0B 3S14H 1YNJC 2SNMA 3CMEA 1ESFA 4FVMA 1I5FA 1G291 4DR3Q 2MO0A 3K80C 1HZCA 3EVQA 4HIDA 1BR9A 2N88A 2MO1A 4A3KG 2O2LD 1VQJA 1ZBHA 4DNTB 1VQ6A 1BUVT 1EWHA 3T1HQ 2JVWA 5CV7A 3VR6A 5C3EH 4LF4Q 5IGCA 5JPMC 2NN6H 2RF4A 1PYBA 3PCOB 3CP0A 3UDXA 5K36G 3HOUH 3E9IA 1G51A 1F77A 1E7LA 4YY3L 5CV8A 3HS0C 3IFTA 1LTID 5FLMG 2ICEC 5HGTA 5BN3A 4JV5L 2RNNA 1EFID 4UZWA 1U4MA 2V4DA 2HQLA 5M3MB 5JEAJ 4HIKA 1QCBD 4BXXG 1VQBA 3MXUA 3QJYA 2WACA 4A3EH 3PUYA 4FF4A 3BS1A 4JPBW 2A74C 4C2MH 5D65A 1B53A 5FLXL 3NEMA 2AKWB 5GAGC 1EL0A 2RCNA 4R1JA 4CJ1B 3TRZA 1G6PA 4NXML 1EQTA 1BVSA 2ZTEA 2Y0SB 3J80E 5IP9H 4ZKCB 1QUQB 1PTOD 1PRTD 2CHBD 4LFCL 1LABA 1EY0A 1HZBA 3I91A 1W3SA 4IPGA 4GN5A 4G7OC 5HY6A 4RCOA 2MQHA 4X62Q 3GV6A 2A6EC 3TSSA 3H91A 3AB9A 5I4DA 1RKNA 3OSOA 2IHEA 3M9BA 2QEJC 2PZTA 1VQ9A 1B3QA 2WINB 2EY1A 4H44C 2CW0C 3NTIA 1Y02A 3Q8DA 3QR8A 3ULJA 4B3RQ 1EN7A 3VYTA 2Z9HA 4JI0Q 4KK7A 1TS2A 4EX5A 5M9OA 5F2DA 4JBJA 4C3HB 4X64L 4HJAA 2R7FA 1PRTC 5IT9E 3BYYB 2QEXA 2HDMA 3J7AF 4DN4M 5KNCA 2AUKA 2D62A 1PDQA 3A8IE 3NK9A 2K7VA 2ES2A 5I9OA 1W6JA 2UUAL 1UE5A 1F9QA 5J1ZA 1SNPA 4C3JB 1WTXA 3OOCA 2JQOA 5GAHC 4FYDA 3TP7A 1J9OA 2OQKA 1HQMC 4J8QA 3PUZA 2OTLA 4M8AA 4PMBA 1M4VA 2I0QA 2EJFC 1UAPA 4RGTA 1PH7A 4A3GH 4A3JH 3K7AH 1PA6A 2PZUA 1CI3M 2NUCA 2A19A 4XT3B 1XMQQ 4BA2I 2PQAA 1F9PA 4LAAA 3KOJA 5JAVA 1PTOF 2JA5G 1JEQA 4FF2A 1FD7D 1YNND 2IHFA 1IW7D 3S1MB 1HUNA 4R4IA 3VR2A 5JVG3 1QB5D 4YCVA 3RLFA 1H1JS 4U673 5C3EB 4HAEA 3KK7A 1JJRA 1E0BA 3VYSA 2LFNA 4OWTB 2B2VA 3HOUB 1SAPA 1GD7A 4N9PA 3GTJH 1A6XA 2KBNA 5LHY1 1N32Q 1GJJA 3BDLA 2NVYH 4HCEA 3PO3B 4LF6Q 2A68C 3SXHA 4B9XA 3TZDA 4BS9A 1EY4A 5BN4A 1IKLA 1BNZA 1SNDA 3ND9A 4LFAL 3TQYA 3K5OA 4GKKQ 1B70B 1STBA 2F0EA 1LTLA 4IUPA 4A93H 4A75A 1PH6A 1F2ZA 3SK4A 1D5MC 2BE5C 1SN8A 1R9TB 4GLVB 4ZQ3A 2UUBQ 3PUVA 2OWOA 1XPRA 3TMEA 5M3MG 1C9OA 1NCVA 4YWLA 1K73C 4OEMB 4DV0Q 4G7ZC 1Q7YC 3VR4A 5IGEA 2F4IA 3SR1A 1UWVA 3S16B 4BBRB 4F88A 2B2YC 2A6HD 2X6GA 3M4OH 2C5CA 1GKHA 3HRZC 3J80L 3QB3A 3DWPA 3G7LA 5T1GA 3GTLH 1IYJB 1EYAA 2LY7A 2KUMA 4A3FH 3Q0AA 1E24A 1G2SA 4DV5L 4XQQA 1M90C 4ULLA 3FHWA 3HOYG 4DXFA 3PO2G 1GUSA 2CWPA 1TT2A 3U4VA 4WFN3 5ELFA 5I9PA 1PH3A 1WJJA 1YEZA 4DV4L 2ZTDA 4GKJL 1KL9A 4A3MG 1IBKL 1H9FA 3K57A 3W2DA 1AEXA 1TWCH 1WFQA 2Q2UA 3PGZA 4A3KH 2B8GA 3T4AC 1STGA 2F0LA 3FMCA 5ELEA 2NVXH 1SROA 4UP9A 4DR7L 3E3XA 3OWFA 3BJUA 2IJ0A 1CA5A 1S5ED 2GVAA 4KD4A 4YY3Q 1SYDA 4OL7A 3CW2C 4IOAA 4IPCA 1UUPA 2V1CC 4C3HG 1SMYD 4CKBA 1TWGH 5IT9L 1Z7TA 3A0JA 3T13A 5KNDA 5FLMH 2R93B 4Q0FA 4A3GB 1F9SA 1FGBD 4R4OA 2XWJB 4LW1A 5M5WH 4YHHQ 1PLFA 3K7UC 4GS3A 4A3IG 4NXMQ 3FPPA 1EY9A 2Q8RE 4R8IA 2R92G 4R9WA 1TIID 3HOZB 1UEBA 1CUKA 4N8X1 1WVLA 3CRKC 4IFDJ 1U4RA 3K8AA 1J5EL 4NP5A 4FF3A 1B4OA 4IJLA 4GOPC 2Z6KC 3ND8A 5IYBH 3SHLA 4X3KA 1DD2A 1OXUA 4DV3L 1X54A 2CWAA 4DUYL 1SMYC 5C3WA 4IALA 4OONA 2VQFQ 4ME3A 1IYUA 4K14A 5HURA 1KTKA 4DUZQ 3KF8B 1DOKA 4DPGA 3K5NA 2EJGC 1ICWA 4CDDC 5AFWA 3EJIA 1I50B 3CCLA 2KCNA 3RR5A 1Q46A 4DR3L 2QA4A 1J8IA 1MHWC 3P75A 4F7XA 2K33A 3M4YA 1IZ6A 1B2TA 1CFMA 3GTGB 1QWYA 3I4NB 4F87A 1TR5A 4RGNA 5CGKA 1TQOA 4LF4L 1JE5A 4IUVA 4OO1G 4LF7Q 2DN8A 2FMMA 2BA0A 1XMOQ 1J6QA 1EZ6A 1X9NA 1VCIA 2UUAQ 4BY1H 3MHBA 1Q86C 2NVQH 1QOHA 1E3PA 3PO3G 2J0TD 5A2QL 1WCMH 1KNEA 2JA6B 4TQUS 5IGDA 3GTMB 4ILWA 1P16A 3RD4A 2ATWA 4DR2Q 3S1NH 4Y7NH 3MFGA 3TP5A 4IFDI 1Q90A 5M3FB 2DY8A 1NMGA 1UE1A 1Q12A 1UNSA 1LACA 3M4OB 4KHPL 3R2IA 1YHAA 2RDGA 2VW9A 3GTLB 4XYQA 2ENBA 5D3IB 3ERSX 3SEBA 3QOLA 1K83H 2AQ1B 4JW0A 2EXZA 2VQEL 3WOEA 1S5CD 3D4WA 3F8TA 2Q2TA 3D4RA 2ZXOA 4XT1B 3VR3A 2MHVA 3W1GA 2JA5H 4DK3C 4HMIA 3MXNA 4X62L 1F2LA 1EYGA 5G3LD 1SJHD 2C35B 4A3KB 3V96A 2D0PA 3G48A 3NSWA 2NVXB 1N36L 2J4XA 4UP7A 2HQEA 2CFMA 4JOIC 2NZ1D 4KHVA 2ZT9C 3ERQA 2PNRC 3CCEA 1K3RA 2L5TA 1L2FA 2FMCA 1RTOA 2K5VA 4B3RL 1HR0Q 1QZHA 4JI0L 1A3UA 1RJTA 1E2VA 4HR7B 1VQDA 4K6DA 3TS0A 2LMCB 1DM0B 4YWKA 1G2TA 3D8GA 4DAYB 2DGYA 5M5WB 3RMHA 4XQNA 1AE2A 4A3CG 2OF1A 3PIPA 1N9WA 3SK6A 2RVLA 3KF6B 3GO5A 1ILPA 3CCJA 1Q1EA 3A5UA 5A35A 2PNHA 5JVH3 3AFQA 3M4QA 5M5XB 1HA6A 3L9AX 1L0XB 2RCFA 1H9KA 1EWCA 5GADC 2RBMA 2HDLA 3J80i 1LLRD 3TP6A 2Q8IB 1E7DA 1EIFA 1E22A 1WTQA 1QNUA 4A3BG 5KGUA 2EVBA 4JCVE 2W51A 2BH8A 5ELDA 4QIWB 1D8LA 5M3MH 3D6CA 3DWAA 4I65A 1O7LA 1SNQA 4QMGA 3JC66 5IYCH 1KC8C 2MP1A 3HOZG 5EKKA 2WAQG 2KENA 1GL9B 5IODA 1Q8IA 2X6LA 4POGA 3TEHB 1NJIC 3BU2A 1K8GA 4DV4Q 1PMRA 3I55A 1FNUA 4GKJQ 1IBKQ 4HN7A 3M7GA 3PO2H 4FXKC 1A2TA 3VYRA 5JPNC 3HKZG 1I3QB 1KRTA 1K0SA 3NE5B 1VQPA 2R7DA 4DK6C 3Q22A 1Q1BA 4RKBA 4LF5L 2WP8J 4BY7B 3S1QB 3DEPA 4WJWA 4DR7Q 3SK8A 1VDZA 2NTSA 4EGVA 1DYQA 4LNQA 1EOVA 3PIO3 4C3IG 1KLUD 5FK9C 2OEOA 3BVMA 4LF6L 2O5IC 4KHZA 3LWUA 1XNRQ 3LNNA 4KTAA 3S1NB 1YBYA 2FJ2A 4QY7A 4DK1A 4ZCKA 2RDHA 1HFGA 2E2IH 2N55A 3OWEB 4C3HH 2ODGC 2ZTCA 2QNFA 2F0KA 5COYA 1B44D 2H4OA 3HOWB 2QDLA 1K83B 1VQLA 2Q2IA 1C7YA 5EGTA 3JAME 2E2HB 3A56A 2RA4A 3N6RA 4TVAB 2UXDQ 1X3GA 4NDXA 2C9OA 3UI2A 4IFDH 2JA5B 1J5EQ 1IXRA 1T5EA 5IYDG 4C3JH 2HHHQ 3QOJA 1H9EA 1K8MA 4LMQD 5FLXc 1L1OA 4DV0L 1YI2A 4DR1L 3VYUA 4DUYQ 2AQ2B 1LTRD 1TWFB 1ONLA 2HD3A 4PMWA 4DNRB 3EIVA 2B29A 3ULPA 2QNCA 4KKUA 1K3BC 1EUJA 3TBIB 2E2DC 4DV7L 5C5MA 1PV4A 1A15A 4XDXA 4AYBG 2B2UA 3ICEA 2BH2A 3S1MH 2DJFC 3J7ZC 2QILA 1S5FD 3OIQA 4DV1L 3WWVA 1FVIA 1Q8KA 2WQGA 1Q81C 4HJ8A 2HJQA 1VQIA 2JYOA 4KV6A 3AQQA 4CHTB 1X3FA 1T9HA 2EIFA 1U4LA 4GN3B 4DR4Q 4C1NK 3FKIG 1Y8OB 5EKIA 2A6ED 2QDBA 3C2PA 3ITPA 4X3SA 2DUDA 1CKMA 3PO3H 1EEID 2RQXA 4EQOA 4NW2A 1SR3A 5I2YA 2O5JC 1HZAA 4JI3L 4XXEA 4GLXA 4DAPA 4KHPQ 2CW0D 4YHHL 2IY5B 1WTVA 4GNXA 1D5ZC 5EJWA 4C1NI 2PPBC 1SMXA 3X3MA 2KECA 2VQEQ 2F0QA 4JK1C 4FF1A 3AFPA 1U5KA 2DNEA 1R9TH 2HUGA 3HOYB 1XYIA 3PO2B 2HIVA 3I4LA 3RNUA 1G8ZD 1SXTA 1HPCA 2VB3X 2K6AA 4A3MB 1FNWA 2HIXA 2LXKA 5CV4A 3M85A 1SFOB 1EIYB 3NWSA 3CF5A 3NBHA 4XYOA 1N36Q 3A55A 2K52A 4J6HA 1I94L 2VQFL 5C6AA 4MTKA 5CIUA 3S16H 4BBRH 4RKLA 1MSGA 4DUZL 1MJEA 2PZWA 2Z8LA 5LL6S 1RD9D 1Y8NB 3J81E 2YTVA 1HH2P 1RODA 3ZYYX 4DFAA 2YU9B 2E2IB 1PH9A 1QE6A 1VQ8A 1IL2A 3I3CA 3V2TA 1KDBA 1AZPA 1CZWA 2F3IA 3CHBD 1KRSA 1NUCA 1TY0A 5IP7G 3HOXG 2A73B 5EBCA 4L63B 2FINB 4BY7G 4A3CH 2B3GA 1D7QA 4LF7L 4UDUC 5NUCA 3DMUA 5EAYA 1LT4D 4L5TA 4KN4C 4AH6A 1XMOL 4A3IB 1BO0A 1BXTA 2K05A 4UAIA 2R92B 1RTNA 4L8JA 2ZJPA 1BCPB 2NZHA 1TXYA 1MJCA 2KJXA 1YNXA 4A3LG 1NBWA 4MNOA 4PZ7A 4DR2L 5GROA 4J1MA 3J7A5 1PHJA 2WFWA 2VS1A 1WYDA 4HIOA 3HOVG 2R93H 1Y14B 2B2WC 1A63A 3HOWG 3GTQB 1ET9A 2PI2A 3JAML 2A68D 3PQIA 2D2CC 2Q2HA 3LLRA 2UU9Q 1TVXA 2F0FA 4QJFA 1PRTF 2B63G 2XRSD 1X65A 1B50A 1QILA 2GVBA 4HTHA 2B8FA 3HOZH 1H9RA 5KIXA 5ISRA 2CCZA 5FJ8G 4UHVA 2RHQB 3UE0A 1SE4A 4JVZA 2G9HD 4PG3A 2Y0SE 5LMNL 1KIXA 2BE5D 1PH2A 2B2TC 3J80c 5C4XG 2Z4IA 2KQ3A 2MFIA 5D3DA 5DNFA 3IAYA 4LF5Q 3MXGA 3I72A 1AN8A 3CPWA 3A8JE 2EYPA 3F2UA 3FPUB 4FNFA 1PFNA 2YTXA 1HR0L 2A69D 4C56C 5KNBA 1I6HH 3K58A 2PW7A 3I8ZA 4B3TL 1MIUA 2QKIC 1I50H 1Z47A 5ELBA 2JJQA 3OTOQ 3X3NA 2R3ZA 4KKSA 1N34L 1ENFA 2UUCQ 3HEJA 3QG1A 1K9MC 1MKHA 3GTGH 1O78A 4UPAA 1XPUA 3I4NH 1SNOA 1DZ1A 5BN5A 2L15A 1HZ9A 3QKJA 1SNCA 1CQVA 2NWGA 3T51B 1HNXQ 5EPJA 1IBLQ 4M1UB 3CCVA 2KOLA 3H09A 1TWHB 3S24A 2MUYA 5IT9c 1XNQL 1VQAA 4ZLTF 2K5DA 1YNSA 2CQOA 3FEWX 2JA6H 1OXTA 3GTMH 5IYDH 3I56A 2A69C 3MXNB 1G91A 1VQ7A 3T1YQ 5C44G 2AMCB 4DR1Q 5M3FH 4NXNQ 1TWAB 4LUOA 4G57A 4R8NA 1VQOA 2N49A 3E0EA 2WB1B 1V1QA 2K5WA 1JICA 1PXUA 4DV7Q 1PH1A 1ASYA 4KY5A 5CYUA 3H0GG 2H5XA 3RZOB 2Z1CA 4DV1Q 2A1AA 3S2HB 4PNYA 1NMFA 2EE1A 1D6EC 2F0NA 2A8VA 3KJPA 2QGQA 1A3TA 1JOKA 3J81L 1PYWD 3PSIA 2ICIA 3DM3A 4LUZA 2ASBA 3CQZH 5ELCA 1KQSA 4IUNA 2XTIA 5CV5A 5K36H 4IOCA 1XNRL 2I5LX 2XVSA 1RF2D 2OQ0A 3FLGA 2N8NA 2XWBB 1UE7A 1PTOB 3U4ZA 2KHIA 1VQCA 4JI3Q 5CC4A 4A3BB 4X66Q 1IBML 1YZ6A 3STBD 4IUTA 4BXXH 1Z6HA 1GUNA 4PQXA 1WTWA 3G6JB 3D0FA 4H02A 5EBDA 3S1RB 4WRDA 5DEHA 1MD2D 1S4ZA 1XXGA 2WAQB 3NTKA 1CA6A 3DUZA 5I2XA 1WTRA 1VQKA 2UXDL 1U0LA 5M5XH 1KDCA 3GTPB 3D4DA 2XN9C 2ZJQA 1D1IA 1KLGD 2F3VA 3ER0A 3GTKB 2NB0A 2R6GA 5CBAE 2HHHL 4K5WA 1KD1C 5CMDA 2F0JA 4J15A 3BYTB 3E0JA 1IL8A 1CHQD 4DV2L 4MIUA 2KVEA 1C0AA 1L0YB 3FP9A 1I4XA 2VY3A 3HKZB 3GP7A 1I94Q 4YCUA 4JI6Q 4K8JA 1IKMA 3S2DB 4JYAQ 4LF8L 4FXGC 1EIHA 2XSCA 4FP5D 1SJED 3STBC 1I6HB 1V1PB 1BDOA 2N78A 4RWSC 4C3IB 2F4VQ 1X3PA 2R61A 3PUXA 4P75A 3CCSA 2EQSA 4RMFA 1A3VA 1LT5D 1PH8A 1HUMA 2O4XA 2G80A 3AEVA 5BR8L 1CKOA 1RCVD 2QCPX 2SNSA 3MEHA 3OPOA 4S3SA 2EYLA 4I7AA 1I3QH 4BBSB 3HOXH 3Q24A 4ZUJA 4RH6A 2WIIB 5EKLA 3J81j 3NELA 4OWXB 1EYCA 4PZ6A 4DR4L 4BY7H 1QJOA 3S1QH 3G4SA 2R7ZB 3JAMi 4R4TA 1ESRA 2EOTA 5EQ0A 2K50A 1X3EA 4JBMA 4MN3A 3GQBA 1JMCA 1LTGD 4JI5L 5C3XA 3U50C 4CJ2C 1ICFB 1EEFD 4K8IA 3I73A 2K1BA 3OHXC 1L1OB 4DV6L 3KBGA 2HCCA 3K0XA 3IRBA 4PMCA 1T5XD 3HOWH 1H9MA 3ZJYC 2E2HH 3MZ5A 4QB4A 4A3EG 2PYKA 1BF4A 1WTPA 1F2MA 2VNUD 2L4NA 3OW2A 4ZKBB 4AYBB 2KVUA 3I7FA 5FKAC 2EZVA 5LMNQ 1VQFA 2EYMA 5FJ8H 2B2VC 1ZKOA 4OWWB 1S5DD 4H7BA 3CKIB 4ALPA 2UXBQ 3CQZB 5C4XH 2WB1G 1TWFH 3EN2A 3U58A 4B3MQ 3EBEA 5C5LA 2VUMG 1YJWA 3FKIB 4X65L 2K32A 2QW7A 5DLQE 5M5YB 5CORA 2JA7G 4B3TQ 4ZRZA 2AQ3B 1JJCB 1I6VC 2F0WA 4OO1I 1JEIA 1QG7A 4JI4Q 1CM9A 1A8VA 1N34Q 5J3BA 1OXXK 4KJOA 1RHPA 1A62A 1YITA 2F0DA 1SYGA 1VQMA 1Y1WG 4GNXB 2QF7A 2CKZB 5K5PA 1VQNA 5D14A 4RAUC 1IHZA 2I5HA 1XJVA 4K5XA 1VS0A 1V1OA 2VZAA 3M3YB 4IQZA 4JBKA 5H1SE 1XNQQ 4KLKA 1U4PA 2JA8G 5IE8A 3C46A 1HNZQ 1BQQT 1HRJA 5DM63 5AJ3L 1EQVA 5CR3A 1BBXC 5CV9A 3A7LA 2NZOA 1X32A 3MVVA 5FLXE 3NBHB 4XQJA 4CBVA 2I46A 2XIWA 4FDBA 3VA7A 3VDYA 3E9HA 3CD6A 2KHJA 1GHKA 2E2JB 2SDFA 3GV3A 3CXCA 2UU9L 3HG9A 2Z0SA 3CMAA 1LT3D 4A3JG 1D1KA 4OIKA 3BVZA 5KRUA 3J81i 1VF7A 3K5LA 3HOYH 3A54A 3B6YA 3PF4A 5G3LF 2IT1A 1EY7A 3V05A 3BZDB 5E4XA 4A3MH 3I90A 3KYHC 3HOXB 2K5HA 1SFOH 2F0HA 2F1MA 1ZEQX 1CKNA 4AYBE 2LSSA 3UE1A 4Q5VA 2KCMA 2Q8TA 2FXQA 3LX0A 2DNCA 2XGTA 3I4MB 1X56A 4HSPA 3M7NA 1YJNA 1MGSA 3KDFA 4ABNA 3TS2A 2YU9H 3OTOL 2L9HA 1WTOA 1GOZA 1XTDA 2ALYB 1IBMQ 2JE6I 1PZJD 5C4JB 1CZGA 2UUCL 3EFXD 2KFVA 4HIMA 3HOVB 4BBSG 5E4WC 1H9JA 4UY8C 1Y1VG 1TKWB 1HNXL 3VA5A 4K2KA 1IBLL 4H13C 1GJXA 1BCPC 5C0XG 2R7ZG 1W2BA 3HFZB 1CSPA 2PQAB 2MGSA 4TKOB 5KYIA 4A3IH 2K5NA 2RNOA 1X3QA 4JI1Q 5FO8B 3CRLC 3W1BA 4IUUA 2B63B 4YIJA 2R92H 1Q3LA 3VR5A 4HJ5A 1D2BA 4N9TA 5HGQA 4A93G 1NTGA 1C8CA 4DV2Q 4ZUIA 1PVOA 1U9RA 1JJ2A 3T16A 3D6WA 3T1YL 4LFBQ 4LUVA 3MAQA 1GKUB 3QO2A 1LM0A 4NXNL 5C4XB 2YV5A 1B8AA 2XNAC 3L2PA 1P8LA 3GTQH 1PH5A 2RKSA 2JP1A 4LF8Q 3C3LA 2KW9A 3HP3A 4IPDA 4MHEA 4QIWE 3UDIA 4DU9A 4P74A 4ME5A 2DY7A 3KLSA 2UXCL 3RZDB 1AE3A 1HCZA 4ZK9B 2E75C 2EXDA 1JB7A 1TU2B 2NBFA 3CC4A 3SGIA 1YIJA 4QF4A 4G7HC 5BR8Q 1CQFA 2JK8A 4A3FG 2B2YA 5IWAQ 3P7JA 1NNXA 1AP0A 5JJKA 1ENCA 4RFBA 4X3UA 4K6LA 1VQEA 1F9RA 1FGUA 3I2ZA 4YWMA 5IIFA 2BOSA 2F0SA 3RUZA 4OO1H 3L0OA 2WKDA 3DXJC 3BDOA 1CSQA 1EU4A 2F03A 2NVTB 4JI5Q 4FXDA 1Q82C 2PO4A 3GTOB 3S17H 1KDAA 1LTSD 3UDGA 4X66L 1SBBB 2IL8A 2K03A 5C0XI 3S15H 3U9SA 5FO9B 5C44B 4DV6Q 2RDFA 4L5SA 1C4QA
chains in the Genus database with same CATH topology
1I50H 1Z47A 1VQGA 4GOPB 2JJQA 4DPGA 3CC2A 3OTOQ 3A74A 1S72A 1A0IA 2LXJA 3RLOA 5JEAG 4L5QA 1N34L 2UUCQ 3CCLA 3H0GH 1K8AC 3AYHB 1MKHA 1Q46A 3RR5A 4EQ5A 4UPAA 4DR3L 1K9MC 1XPUA 3GTGH 3I4NH 2L15A 2QA4A 1TWHH 1HZ9A 3M4PA 1XMQL 4NB3A 1IZ6A 2PI2E 3KF6A 4DV5Q 1HNXQ 1GM5A 1QVCA 1IBLQ 3CCVA 4NPSA 3JAMc 3S24A 5IT9c 2AHOB 1XNQL 4LF4L 1VQAA 1JE5A 2K4KA 4OO1G 1EFWA 4LF7Q 3PUWA 2KCTA 1OXVA 4IPHA 2BA0A 1XMOQ 2LD7A 1J6QA 4JI6L 1X9NA 1YNSA 1VCIA 2CQOA 2UUAQ 3CCUA 1TWAH 1Q86C 4BY1H 2JA6H 1OXTA 3PIOA 5IYBG 1E3PA 3I56A 1N8RC 3MXNB 2NVQH 3GTMH 3PO3G 4DAMA 1VQ7A 3T1YQ 5C44G 2AMCB 4DR1Q 4K0KL 4X65Q 5M3FH 1KAWA 1WCMH 4NXNQ 4GOPA 4P73A 4TQUS 3BZKA 2F4VL 1P16A 2Z6KA 2ATWA 4MTNA 4AIMA 4LUOA 4DR2Q 2VUMH 3S1NH 2ID0A 4Y7NH 1DGSA 3MEFA 1N32L 1VQOA 2N49A 4IFDI 3E0EA 1NMGA 1UE1A 4A3DG 1V1QA 1Q12A 1Z9FA 4P71A 2JA7H 1HJPA 4AQYQ 1SLJA 1UE6A 3RN2A 4KHPL 3RZOH 4DV7Q 1YHAA 1PH1A 2VW9A 1ASYA 2E5LL 3S2HH 3H0GG 3H3VH 3ERSX 4B3SL 1K83H 2YYZA 2H5XA 5C0XJ 3I4NG 1B7YB 2VL6A 1PYSB 3KJOA 4DR6L 2D0OA 4JI8Q 4DV1Q 2A1AA 2YTYA 3CAMA 2VQEL 3F8TA 2Q2TA 3G71A 2LC3A 1OTCA 1NMFA 5LMUL 1Y1WH 4DR5Q 4JI2Q 4GKKL 1E1TA 2A8VA 3KJPA 2QGQA 4IJHA 3W1GA 2OCEA 3I4MG 2JA5H 4KI0A 4DK3C 3L7ZC 4X62L 5AJ3Q 1EYGA 1JJGA 3PSIA 2C35B 3DM3A 4LUZA 2ASBA 1SRUA 3CQZH 2JA9A 2UUBL 2D0PA 1EWIA 3BZCA 1KQSA 4BY1G 2JA8H 1NE3A 3G48A 2JA6G 2N3SA 4MZ9A 4JC0A 1N36L 2XTIA 4UP7A 3CC7A 1KHIA 2CFMA 4JOIC 4A3BH 4IOCA 3KLWA 1XPOA 2I5LX 1XNRL 4JI7Q 2OQ0A 5M3FG 1WCMG 2N8NA 1UE7A 3CCEA 1S40A 1K3RA 2ZM6L 1L2FA 4DNIA 3PV0A 3U4ZA 2K5VA 2KHIA 3RLNA 4DV3Q 4B3RL 1VQCA 1FL0A 3LGJA 1HR0Q 1WI5A 3OYYA 4X66Q 1QZHA 1IBML 4JI3Q 4QQBX 1YZ6A 4JI0L 4WJ3M 1YHBA 1AH9A 1V43A 3STBD 1VQDA 3S1RH 4A76A 3TS0A 4UP8A 4BXXH 4IO9A 4YWKA 1N33L 1KXLA 3G6EA 3A5ZB 2F52A 3S14H 4DAYB 2DGYA 3GTPH 3D0FA 4H02A 2I5MX 1AE2A 2ZJRA 3CMEA 4A3CG 3GTKH 3PIPA 1N9WA 1I5FA 1G291 3KF6B 4DR3Q 1VQKA 2UXDL 3GO5A 1U0LA 2MO0A 5M5XH 3TREA 3CCJA 3K80C 2ZJQA 1HZCA 4XTCS 4HIDA 1Q1EA 3ER0A 4PZ8A 3A5UA 2MO1A 2K75A 4A3KG 2PNHA 2R6GA 1VQJA 2HHHL 2UXBL 1KD1C 1VQ6A 3AFQA 3M4QA 4J15A 4OX9L 4DV2L 4B3ML 1S3OA 3T1HQ 5C3EH 4LF4Q 3S2DH 5GADC 2HT1A 1M1KC 1C0AA 3FP9A 2VY3A 3J80i 1I94Q 3W5OA 2RF4A 4YCUA 1PYBA 1E7DA 3PCOB 4JI6Q 1EIFA 1E22A 3CP0A 3UDXA 5K36G 3HOUH 4JYAQ 2E8GA 3E9IA 1G51A 4C3IH 4LF8L 4A3BG 4JCVE 2W51A 1E7LA 2BH8A 4JI4L 1HNWL 4YY3L 1FJGL 1D8LA 1QZGA 5M3MH 3STBC 5FLMG 4K0KQ 4A4IA 4JV5L 2N78A 2F4VQ 4JOIA 3F2CA 3J81c 3PUXA 4P75A 3CCSA 2EQSA 2HQLA 3JC66 4RMFA 5JEAJ 5IYCH 4HIKA 1KC8C 1PH8A 4BXXG 1VQBA 4QL5A 3HOZG 2WAQG 2G80A 4A3EH 3AEVA 3PUYA 2KENA 4LF9L 4BBSH 5BR8L 1GL9B 4POGA 4C2MH 1L0WA 3TEHB 1CKOA 4L5SA 1LYLA 3NEMA 2AKWB 5GAGC 1NJIC 2PMZE 3CCRA 3BU2A 2RCNA 1K8GA 1Y1VH 4DV4Q 4B3SQ 4R1JA 3I55A 3TRZA 4GKJQ 1G6PA 4NXML 1I3QH 1BVSA 1IBKQ 3PO2H 3HOXH 2R7ZH 2IX0A 2ZTEA 1HNZL 3J81j 3NELA 4OWXB 5IP9H 1QUQB 4PZ6A 5LMUQ 4DR4L 4BY7H 1L1OC 4LFCL 3HKZG 3S1QH 3G4SA 1KRTA 1HZBA 1W3SA 1VQPA 2R7DA 4IPGA 4DK6C 3JAMi 4GN5A 1Q1BA 4R4TA 5HY6A 2K50A 4LF5L 2MQHA 2WP8J 4X62Q 1X3EA 1YHQA 4JBMA 1QVFA 4DR7Q 1VQ5A 1JMCA 4JI5L 3U50C 1H95A 4LNQA 1EOVA 4LF6L 1L1OB 4KHZA 2IHEA 1XNRQ 3M9BA 4DV6L 4HJ9A 2UXCQ 1YBYA 4LWCA 4QY7A 1VQ9A 3K0XA 3IRBA 2ZM6Q 4O2DA 3Q8DA 1Y02A 1X55A 3ULJA 2E2IH 3HOWH 1EN7A 3ZJYC 5IYCG 4B3RQ 4C3HH 2ODGC 4JI0Q 4APVA 2ZTCA 2QNFA 2E2HH 4EX5A 4A3EG 5ELOA 2VNUD 1N33Q 2AWNA 4JBJA 2Y0SG 1VQLA 2Q2IA 1C7YA 4R4CA 4X64L 3OW2A 4HJAA 1QUQA 2ODCI 2R7FA 4Y52H 3I7FA 2QEXA 2MPHA 1QVGA 1O7IA 1VQFA 5LMNQ 3I4OA 5IYDH 4TVAB 2UXDQ 5FJ8H 1X3GA 1J5EQ 4OWWB 1IXRA 5GAEC 5IYDG 2D62A 2K14A 1EQQA 4C3JH 4ALPA 2HHHQ 2ES2A 2UXBQ 3FKIH 1X6OA 1H9EA 2JEAI 2UUAL 4JYAL 1UE5A 5C4XH 2WB1G 5M5YH 5FLXc 3H15A 1TWFH 3EN2A 3U58A 4B3MQ 3EBEA 4HJ7A 1L1OA 1BBUA 4BA1I 2VUMG 4DV0L 1E1OA 4DR1L 1YI2A 4DUYQ 4X65L 1YJWA 3NENA 4QGUA 3CPFA 2JQOA 4GNXC 5DLQE 5GAHC 2JA7G 4B3TQ 1JT8A 1VQ4A 1GO3E 4PMWA 5GQOA 2OQKA 1JJCB 3EIVA 3PUZA 4OO1I 2OTLA 1JEIA 2B29A 3ULPA 4JI4Q 2QNCA 2I0QA 1A8VA 1N34Q 1PH7A 5J3BA 4A3JH 3K7AH 1PA6A 4A3GH 1EUJA 1OXXK 4DV7L 4JV5Q 1A62A 2A19A 5ELNA 1YITA 1PV4A 4JI1L 1VQMA 4AYBG 3M3YH 1Y1WG 4GNXB 1XMQQ 3GD7A 3UDFA 2BH2A 3ICEA 3KFUA 2CKZB 4BA2I 1VQNA 3S1MH 2PQAA 3J7ZC 2I5HA 4JI8L 3KOJA 4DV1L 2JA5G 3WWVA 1XJVA 1FVIA 1Q8KA 1VS0A 2VZAA 1Q81C 4HJ8A 2HJQA 2IHFA 4DR5L 4JI2L 1VQIA 4JBKA 3HKSA 5H1SE 1XNQQ 4KLKA 4R4IA 4WJ4A 4LFBL 3AQQA 1YJ9A 2JA8G 4IFDG 1X3FA 5IE8A 1K0RA 1T9HA 1HNZQ 2EIFA 4YCVA 3RLFA 5AJ3L 4GN3B 4GN4B 4DR4Q 4LFCQ 4XIGS 3FKIG 1YVCA 1CKNB 4OWTB 3D31A 2NZOA 2DUDA 1CKMA 3NBHB 3PO3H 2E2JH 1GD7A 4JI7L 1BBWA 3GTJH 1SR3A 2KBNA 4FDBA 3GDEA 3VDYA 1N32Q 3E9HA 3CD6A 1GJJA 2KHJA 1HZAA 2NVYH 4JI3L 4GLXA 4LF6Q 2WB1E 3KDFB 3CXCA 2UU9L 4KHPQ 4YHHL 2IY5B 2Z0SA 3CMAA 4GNXA 5IWAL 2E5LQ 4A3JG 4A3DH 1SMXA 5IY0A 2AWOA 3J81i 3HOYH 5IP7H 4DR6Q 3B6YA 3PF4A 4LFAL 2IT1A 2IX1A 3TQYA 2VQEQ 4GLAC 4GKKQ 3AFPA 1U5KA 1R9TH 1B70B 4A3MH 1LTLA 3KYHC 2K5HA 1SFOH 2HIVA 4X64Q 4POFA 4A93H 4A75A 1PH6A 5C3EG 3RNUA 1SN8A 2OTJA 3RN5A 4YCWA 1CKNA 4GLVB 4AYBE 2LSSA 3UE1A 2LXKA 2HIXA 2NN6G 3M85A 3I4MH 2KCMA 1EIYB 2UUBQ 2FXQA 3K81C 3T1HL 5JJLA 3PUVA 3CF5A 3H3VI 4A3LH 3HOUG 1N36Q 2OWOA 2K52A 1XPRA 1I94L 2VQFL 4L5RC 5M3MG 2XGTA 1C9OA 1X56A 4YWLA 4BBRH 3CCMA 3S16H 1WOCA 5C4JH 4DUZL 1K73C 1MJEA 3M7NA 1YJNA 3KDFA 3HOVH 3TS2A 2YU9H 4DV0Q 3OTOL 3ULLA 4P72A 1PFSA 1LUZA 1Q7YC 1XTDA 2ALYB 1IBMQ 1UWVA 2JE6I 3PF5A 3F2DA 2UUCL 4O0AA 3M4OH 2KFVA 4HIMA 2YTVA 1HH2P 4BBSG 1GKHA 2MNAA 1PH9A 1VQ8A 1IL2A 3GTLH 1IYJB 4A3FH 4UY8C 1E24A 1Y1VG 4DUZQ 2B63H 4DV5L 2F3IA 1HNXL 1KRSA 3F2BA 1M90C 1IBLL 3FHWA 5IP7G 3HOYG 5C0XG 3HOXG 2CWPA 2R7ZG 1W2BA 3HFZB 1CSPA 3U4VA 2PQAB 3PO2G 4JBWA 4A3IH 4X6AH 2WAQE 2K5NA 1PH3A 4JI1Q 1WJJA 1YEZA 3W1BA 5IP9G 4DV4L 2ZTDA 4BY7G 2R92H 1KL9A 1EQRA 4A3CH 2B3GA 4GKJL 4A3MG 4LF7L 1V9PA 1IBKL 1D7QA 5EAYA 1H9FA 5E7NA 4HJ5A 5HGQA 4L5TA 4AH6A 1XMOL 4A93G 1ZS9A 1TWCH 1RL2A 1NTGA 1WFQA 4OX9Q 4DV2Q 2Q2UA 1PVOA 5JJIA 3PGZA 2ZJPA 4A3KH 1JJ2A 4LFBQ 3T1YL 1TXYA 1MJCA 2NZHA 1GKUB 4LUVA 3CCQA 2DK4A 1YNXA 4A3LG 1LM0A 4NXNL 3HKZE 1NBWA 2NVXH 4MNOA 2YV5A 1B8AA 3L2PA 1P8LA 1SROA 4PZ7A 4UP9A 1PH5A 3GTQH 4DR7L 4DR2L 5GROA 4LF8Q 3BJUA 3J7A5 4BBRG 4JG2A 3RZDH 1HNWQ 2GVAA 4YY3Q 2WFWA 4IPDA 1PHJA 1FJGQ 2VS1A 1WYDA 4HIOA 3HOVG 4QIWE 3UDIA 2R93H 4DKAC 1Y14B 3CW2C 1A63A 2GN5A 4P74A 4IPCA 4AQYL 3HOWG 4IOAA 1SE8A 2V1CC 2PI2A 2UXCL 5LMNW 1NY4A 1AE3A 1TWGH 3A0JA 2EXDA 5FLMH 2JEBI 4OXPA 1JB7A 3CC4A 2Q2HA 4R4OA 3SGIA 1YIJA 4LF9Q 2UU9Q 4LW1A 5BR8Q 2JK8A 5M5WH 2NN6I 4QJFA 1GVPA 4YHHQ 4A3FG 2B63G 3DLLA 1X65A 5IWAQ 2BA1A 2GVBA 2RHSB 3HOZH 3K7UC 5JJKA 1VQHA 4GS3A 2CCZA 4A3IG 4R4QA 5FJ8G 4NXMQ 2RHQB 1HR0W 1VQEA 4YWMA 1FGUA 3I2ZA 3UE0A 4LFAQ 2R92G 4PG3A 2Y0SE 1UEBA 5LMNL 1CUKA 1OXSC 1KIXA 1PH2A 1ASZA 3J80c 4IFDJ 3L0OA 2NVTH 3K8AA 1J5EL 5C4XG 2MFIA 3F1ZA 4IJLA 4GOPC 3GTOH 4LF5Q 1CSQA 1E7ZA 2Z6KC 5IYBH 1RIPA 3CPWA 4JI5Q 5C44H 1Q82C 1OXUA 4RG1A 4DV3L 1X54A 3S17H 2CWAA 2YTXA 1HR0L 4DUYL 3UDGA 4X66L 4OONA 3S15H 5C0XI 4ME3A 2VQFQ 1I6HH 1BKBA 4DV6Q 1PH4A 2R93G 4B3TL 1MIUA 4A3GG 3KF8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I50 H;  1Z47 A;  1VQG A;  4GOP B;  2JJQ A;  4DPG A;  3CC2 A;  3OTO Q;  3A74 A;  1S72 A;  1A0I A;  2LXJ A;  3RLO A;  5JEA G;  4L5Q A;  1N34 L;  2UUC Q;  3CCL A;  3H0G H;  1K8A C;  3AYH B;  1MKH A;  1Q46 A;  3RR5 A;  4EQ5 A;  4UPA A;  4DR3 L;  1K9M C;  1XPU A;  3GTG H;  3I4N H;  2L15 A;  2QA4 A;  1TWH H;  1HZ9 A;  3M4P A;  1XMQ L;  4NB3 A;  1IZ6 A;  2PI2 E;  3KF6 A;  4DV5 Q;  1HNX Q;  1GM5 A;  1QVC A;  1IBL Q;  3CCV A;  4NPS A;  3JAM c;  3S24 A;  5IT9 c;  2AHO B;  1XNQ L;  4LF4 L;  1VQA A;  1JE5 A;  2K4K A;  4OO1 G;  1EFW A;  4LF7 Q;  3PUW A;  2KCT A;  1OXV A;  4IPH A;  2BA0 A;  1XMO Q;  1J6Q A;  4JI6 L;  1X9N A;  1VCI A;  2CQO A;  2UUA Q;  4BY1 H;  3CCU A;  1TWA H;  1Q86 C;  2JA6 H;  2NVQ H;  1OXT A;  3PIO A;  5IYB G;  1E3P A;  3I56 A;  1N8R C;  3MXN B;  3GTM H;  3PO3 G;  4JYA L;  4DAM A;  1VQ7 A;  3T1Y Q;  5C44 G;  2AMC B;  4DR1 Q;  4K0K L;  4X65 Q;  5M3F H;  1KAW A;  1WCM H;  4NXN Q;  4GOP A;  4P73 A;  4TQU S;  3BZK A;  2F4V L;  1P16 A;  2Z6K A;  2ATW A;  4MTN A;  4AIM A;  4LUO A;  4DR2 Q;  2VUM H;  3S1N H;  2ID0 A;  4Y7N H;  1DGS A;  3MEF A;  1N32 L;  1VQO A;  2N49 A;  4IFD I;  3E0E A;  1NMG A;  1UE1 A;  4A3D G;  1V1Q A;  1Q12 A;  1Z9F A;  4P71 A;  2JA7 H;  1HJP A;  4AQY Q;  1SLJ A;  1UE6 A;  3RN2 A;  4KHP L;  3RZO H;  4DV7 Q;  1YHA A;  1PH1 A;  2VW9 A;  1ASY A;  2E5L L;  3S2H H;  3H0G G;  3H3V H;  3ERS X;  4B3S L;  1K83 H;  2YYZ A;  2H5X A;  5C0X J;  3I4N G;  1B7Y B;  2VL6 A;  1PYS B;  3KJO A;  4DR6 L;  2D0O A;  4JI8 Q;  4DV1 Q;  2A1A A;  2YTY A;  3CAM A;  2VQE L;  3F8T A;  2Q2T A;  3G71 A;  1OTC A;  1NMF A;  5LMU L;  1Y1W H;  4DR5 Q;  4JI2 Q;  4GKK L;  1E1T A;  2A8V A;  3KJP A;  2QGQ A;  4IJH A;  3W1G A;  2OCE A;  3I4M G;  2JA5 H;  4KI0 A;  4DK3 C;  3L7Z C;  4X62 L;  5AJ3 Q;  1EYG A;  1JJG A;  3PSI A;  2C35 B;  3DM3 A;  4LUZ A;  2ASB A;  1SRU A;  3CQZ H;  2JA9 A;  2UUB L;  2D0P A;  1EWI A;  3BZC A;  1KQS A;  4BY1 G;  2JA8 H;  1NE3 A;  3G48 A;  2JA6 G;  2N3S A;  4MZ9 A;  4JC0 A;  1N36 L;  2XTI A;  4UP7 A;  3CC7 A;  1KHI A;  2CFM A;  4JOI C;  4A3B H;  4IOC A;  3KLW A;  1XPO A;  2I5L X;  1XNR L;  4JI7 Q;  2OQ0 A;  5M3F G;  1WCM G;  2N8N A;  1UE7 A;  3CCE A;  1S40 A;  1K3R A;  2ZM6 L;  1L2F A;  4DNI A;  3PV0 A;  3U4Z A;  2K5V A;  2KHI A;  3RLN A;  4DV3 Q;  4B3R L;  1VQC A;  1FL0 A;  3LGJ A;  1HR0 Q;  1WI5 A;  3OYY A;  4X66 Q;  1QZH A;  1IBM L;  4JI3 Q;  4QQB X;  1YZ6 A;  4JI0 L;  4WJ3 M;  1YHB A;  1AH9 A;  1V43 A;  3STB D;  1VQD A;  3S1R H;  4A76 A;  3TS0 A;  4UP8 A;  4BXX H;  4IO9 A;  4YWK A;  1N33 L;  1KXL A;  3G6E A;  3A5Z B;  2F52 A;  3S14 H;  4DAY B;  2DGY A;  3GTP H;  3D0F A;  4H02 A;  2I5M X;  1AE2 A;  2ZJR A;  3CME A;  4A3C G;  3GTK H;  3PIP A;  1N9W A;  1I5F A;  1G29 1;  3KF6 B;  4DR3 Q;  1VQK A;  2UXD L;  3GO5 A;  1U0L A;  2MO0 A;  5M5X H;  3TRE A;  3CCJ A;  3K80 C;  2ZJQ A;  1HZC A;  4XTC S;  4HID A;  1Q1E A;  3ER0 A;  4PZ8 A;  3A5U A;  2MO1 A;  2K75 A;  4A3K G;  2PNH A;  2R6G A;  1VQJ A;  2HHH L;  2UXB L;  1KD1 C;  1VQ6 A;  3AFQ A;  3M4Q A;  4J15 A;  4OX9 L;  4DV2 L;  4B3M L;  1S3O A;  3T1H Q;  5C3E H;  4LF4 Q;  3S2D H;  5GAD C;  2HT1 A;  1M1K C;  1C0A A;  3FP9 A;  2VY3 A;  3J80 i;  1I94 Q;  3W5O A;  2RF4 A;  4YCU A;  1PYB A;  1E7D A;  3PCO B;  4JI6 Q;  1EIF A;  1E22 A;  3CP0 A;  3UDX A;  5K36 G;  3HOU H;  4JYA Q;  2E8G A;  3E9I A;  1G51 A;  4C3I H;  4LF8 L;  4A3B G;  4JCV E;  1E7L A;  2BH8 A;  4JI4 L;  1HNW L;  4YY3 L;  1FJG L;  1D8L A;  1QZG A;  5M3M H;  3STB C;  5FLM G;  4K0K Q;  4A4I A;  4JV5 L;  2N78 A;  2F4V Q;  4JOI A;  3F2C A;  3J81 c;  3PUX A;  4P75 A;  3CCS A;  2EQS A;  2HQL A;  3JC6 6;  4RMF A;  5JEA J;  5IYC H;  4HIK A;  1KC8 C;  1PH8 A;  4BXX G;  1VQB A;  4QL5 A;  3HOZ G;  2WAQ G;  4A3E H;  3AEV A;  3PUY A;  2KEN A;  4LF9 L;  4BBS H;  5BR8 L;  4POG A;  4C2M H;  1L0W A;  3TEH B;  1CKO A;  4L5S A;  1LYL A;  3NEM A;  2AKW B;  5GAG C;  1NJI C;  2PMZ E;  3CCR A;  3BU2 A;  2RCN A;  1K8G A;  1Y1V H;  4DV4 Q;  4B3S Q;  4R1J A;  3I55 A;  3TRZ A;  4GKJ Q;  1G6P A;  4NXM L;  1I3Q H;  1BVS A;  1IBK Q;  3PO2 H;  3HOX H;  2R7Z H;  2IX0 A;  2ZTE A;  1HNZ L;  3J81 j;  3NEL A;  4OWX B;  5IP9 H;  1QUQ B;  4PZ6 A;  5LMU Q;  4DR4 L;  4BY7 H;  1L1O C;  4LFC L;  3HKZ G;  3S1Q H;  3G4S A;  1KRT A;  1HZB A;  1W3S A;  1VQP A;  2R7D A;  4IPG A;  4DK6 C;  3JAM i;  4GN5 A;  1Q1B A;  4R4T A;  5HY6 A;  2K50 A;  4LF5 L;  2MQH A;  2WP8 J;  4X62 Q;  1X3E A;  1YHQ A;  4JBM A;  1QVF A;  4DR7 Q;  1VQ5 A;  1JMC A;  4JI5 L;  3U50 C;  1H95 A;  4LNQ A;  1EOV A;  4LF6 L;  1L1O B;  4KHZ A;  2IHE A;  1XNR Q;  3M9B A;  4DV6 L;  4HJ9 A;  2UXC Q;  1YBY A;  4LWC A;  4QY7 A;  1VQ9 A;  3K0X A;  3IRB A;  2ZM6 Q;  4O2D A;  3Q8D A;  1X55 A;  2E2I H;  3ULJ A;  3HOW H;  4B3R Q;  1EN7 A;  3ZJY C;  5IYC G;  4C3H H;  4JI0 Q;  4APV A;  2ZTC A;  2QNF A;  2E2H H;  4EX5 A;  4A3E G;  5ELO A;  2VNU D;  1N33 Q;  2AWN A;  4JBJ A;  2Y0S G;  1VQL A;  2Q2I A;  1C7Y A;  4R4C A;  4X64 L;  3OW2 A;  4HJA A;  1QUQ A;  2R7F A;  4Y52 H;  3I7F A;  2QEX A;  1QVG A;  1O7I A;  1VQF A;  5LMN Q;  3I4O A;  5IYD H;  4TVA B;  2UXD Q;  5FJ8 H;  1X3G A;  1J5E Q;  4OWW B;  1IXR A;  5GAE C;  5IYD G;  2D62 A;  2K14 A;  1EQQ A;  4C3J H;  4ALP A;  2HHH Q;  2ES2 A;  2UXB Q;  3FKI H;  1X6O A;  2JEA I;  2UUA L;  1UE5 A;  5C4X H;  2WB1 G;  5M5Y H;  5FLX c;  3H15 A;  1TWF H;  3EN2 A;  3U58 A;  4B3M Q;  3EBE A;  4HJ7 A;  1L1O A;  1BBU A;  4BA1 I;  2VUM G;  4DV0 L;  1E1O A;  4DR1 L;  1YI2 A;  4DUY Q;  4X65 L;  1YJW A;  3NEN A;  4QGU A;  3CPF A;  2JQO A;  4GNX C;  5DLQ E;  5GAH C;  2JA7 G;  4B3T Q;  1JT8 A;  1VQ4 A;  1GO3 E;  4PMW A;  5GQO A;  2OQK A;  1JJC B;  3EIV A;  3PUZ A;  4OO1 I;  2OTL A;  2B29 A;  3ULP A;  4JI4 Q;  2QNC A;  2I0Q A;  1A8V A;  1N34 Q;  1PH7 A;  5J3B A;  4A3J H;  3K7A H;  1PA6 A;  4A3G H;  1EUJ A;  1OXX K;  4DV7 L;  4JV5 Q;  1A62 A;  2A19 A;  5ELN A;  1YIT A;  1PV4 A;  4JI1 L;  1VQM A;  4AYB G;  3M3Y H;  1Y1W G;  4GNX B;  1XMQ Q;  3GD7 A;  3UDF A;  2BH2 A;  3ICE A;  3KFU A;  2CKZ B;  4BA2 I;  1VQN A;  3S1M H;  2PQA A;  3J7Z C;  2I5H A;  4JI8 L;  3KOJ A;  4DV1 L;  2JA5 G;  3WWV A;  1XJV A;  1FVI A;  1Q8K A;  1VS0 A;  2VZA A;  1Q81 C;  4HJ8 A;  2HJQ A;  2IHF A;  4DR5 L;  4JI2 L;  1VQI A;  4JBK A;  3HKS A;  5H1S E;  1XNQ Q;  4KLK A;  4R4I A;  4WJ4 A;  4LFB L;  3AQQ A;  1YJ9 A;  2JA8 G;  4IFD G;  1X3F A;  5IE8 A;  1K0R A;  1T9H A;  1HNZ Q;  2EIF A;  4YCV A;  3RLF A;  5AJ3 L;  4GN3 B;  4GN4 B;  4DR4 Q;  4LFC Q;  4XIG S;  3FKI G;  1YVC A;  1CKN B;  4OWT B;  3D31 A;  2NZO A;  2DUD A;  1CKM A;  3NBH B;  3PO3 H;  2E2J H;  1GD7 A;  4JI7 L;  1BBW A;  3GTJ H;  1SR3 A;  2KBN A;  4FDB A;  3GDE A;  3VDY A;  1N32 Q;  3E9H A;  3CD6 A;  2KHJ A;  1HZA A;  2NVY H;  4JI3 L;  4GLX A;  4LF6 Q;  2WB1 E;  3KDF B;  3CXC A;  2UU9 L;  4KHP Q;  4YHH L;  2IY5 B;  2Z0S A;  3CMA A;  4GNX A;  5IWA L;  2E5L Q;  4A3J G;  4A3D H;  1SMX A;  5IY0 A;  2AWO A;  3J81 i;  3HOY H;  5IP7 H;  4DR6 Q;  3B6Y A;  3PF4 A;  4LFA L;  2IT1 A;  2IX1 A;  3TQY A;  2VQE Q;  4GLA C;  4GKK Q;  3AFP A;  1U5K A;  1R9T H;  1B70 B;  4A3M H;  1LTL A;  3KYH C;  2K5H A;  1SFO H;  2HIV A;  4X64 Q;  4POF A;  4A93 H;  4A75 A;  1PH6 A;  5C3E G;  3RNU A;  1SN8 A;  2OTJ A;  3RN5 A;  4YCW A;  1CKN A;  4GLV B;  4AYB E;  2LSS A;  3UE1 A;  2LXK A;  2HIX A;  2NN6 G;  3M85 A;  3I4M H;  2KCM A;  1EIY B;  2UUB Q;  2FXQ A;  3K81 C;  3T1H L;  5JJL A;  3PUV A;  3CF5 A;  3H3V I;  4A3L H;  3HOU G;  1N36 Q;  2OWO A;  2K52 A;  1XPR A;  1I94 L;  2VQF L;  4L5R C;  5M3M G;  2XGT A;  1C9O A;  1X56 A;  4YWL A;  4BBR H;  3CCM A;  3S16 H;  1WOC A;  5C4J H;  4DUZ L;  1K73 C;  1MJE A;  3M7N A;  1YJN A;  3KDF A;  3HOV H;  3TS2 A;  2YU9 H;  4DV0 Q;  3OTO L;  3ULL A;  4P72 A;  1PFS A;  1LUZ A;  1Q7Y C;  1XTD A;  2ALY B;  1IBM Q;  1UWV A;  2JE6 I;  3PF5 A;  3F2D A;  2UUC L;  4O0A A;  3M4O H;  4HIM A;  2YTV A;  1HH2 P;  4BBS G;  1GKH A;  2MNA A;  1PH9 A;  1VQ8 A;  1IL2 A;  3GTL H;  1IYJ B;  4A3F H;  4UY8 C;  1E24 A;  1Y1V G;  4DUZ Q;  2B63 H;  4DV5 L;  2F3I A;  1HNX L;  1KRS A;  3F2B A;  1M90 C;  1IBL L;  3FHW A;  5IP7 G;  3HOY G;  5C0X G;  3HOX G;  2CWP A;  2R7Z G;  1W2B A;  3HFZ B;  1CSP A;  3U4V A;  2PQA B;  3PO2 G;  4JBW A;  4A3I H;  4X6A H;  2WAQ E;  2K5N A;  1PH3 A;  4JI1 Q;  1WJJ A;  1YEZ A;  3W1B A;  5IP9 G;  4DV4 L;  2ZTD A;  4BY7 G;  2R92 H;  1KL9 A;  1EQR A;  4A3C H;  2B3G A;  4GKJ L;  4A3M G;  4LF7 L;  1V9P A;  1IBK L;  1D7Q A;  5EAY A;  4HJ5 A;  5E7N A;  5HGQ A;  4L5T A;  4AH6 A;  1XMO L;  4A93 G;  1TWC H;  1RL2 A;  1NTG A;  1WFQ A;  4OX9 Q;  4DV2 Q;  2Q2U A;  1PVO A;  5JJI A;  3PGZ A;  2ZJP A;  4A3K H;  1JJ2 A;  4LFB Q;  3T1Y L;  1TXY A;  1MJC A;  2NZH A;  4LUV A;  3CCQ A;  1YNX A;  4A3L G;  1LM0 A;  4NXN L;  3HKZ E;  1NBW A;  2NVX H;  4MNO A;  2YV5 A;  1B8A A;  3L2P A;  1P8L A;  1SRO A;  4PZ7 A;  4UP9 A;  1PH5 A;  3GTQ H;  4DR7 L;  4DR2 L;  5GRO A;  4LF8 Q;  3BJU A;  3J7A 5;  4BBR G;  4JG2 A;  3RZD H;  1HNW Q;  2GVA A;  4YY3 Q;  2WFW A;  4IPD A;  1PHJ A;  1FJG Q;  2VS1 A;  1WYD A;  4HIO A;  3HOV G;  4QIW E;  3UDI A;  2R93 H;  4DKA C;  1Y14 B;  3CW2 C;  1A63 A;  2GN5 A;  4P74 A;  4IPC A;  4AQY L;  3HOW G;  4IOA A;  1SE8 A;  2V1C C;  2PI2 A;  2UXC L;  5LMN W;  1NY4 A;  1AE3 A;  1TWG H;  3A0J A;  2EXD A;  5FLM H;  2JEB I;  4OXP A;  1JB7 A;  3CC4 A;  2Q2H A;  4R4O A;  3SGI A;  1YIJ A;  4LF9 Q;  2UU9 Q;  4LW1 A;  5BR8 Q;  2JK8 A;  5M5W H;  2NN6 I;  4QJF A;  1GVP A;  4YHH Q;  4A3F G;  2B63 G;  3DLL A;  1X65 A;  5IWA Q;  2BA1 A;  2GVB A;  2RHS B;  3HOZ H;  3K7U C;  5JJK A;  1VQH A;  4GS3 A;  2CCZ A;  4A3I G;  4R4Q A;  5FJ8 G;  4NXM Q;  2RHQ B;  1HR0 W;  1VQE A;  4YWM A;  1FGU A;  3I2Z A;  3UE0 A;  4LFA Q;  2R92 G;  4PG3 A;  2Y0S E;  1UEB A;  5LMN L;  1CUK A;  1OXS C;  1KIX A;  1PH2 A;  1ASZ A;  3J80 c;  4IFD J;  3L0O A;  2NVT H;  3K8A A;  1J5E L;  5C4X G;  2MFI A;  3F1Z A;  4IJL A;  4GOP C;  3GTO H;  4LF5 Q;  1CSQ A;  1E7Z A;  2Z6K C;  5IYB H;  1RIP A;  3CPW A;  4JI5 Q;  5C44 H;  1Q82 C;  1OXU A;  4RG1 A;  4DV3 L;  1X54 A;  3S17 H;  2CWA A;  2YTX A;  1HR0 L;  4DUY L;  3UDG A;  4X66 L;  4OON A;  3S15 H;  5C0X I;  4ME3 A;  2VQF Q;  1I6H H;  1BKB A;  4DV6 Q;  1PH4 A;  2R93 G;  4B3T L;  1MIU A;  4A3G G;  3KF8 B; 
#chains in the Genus database with same CATH topology
 1VQG A;  4CDF C;  3NWT A;  2L12 A;  1GXD C;  1A0I A;  4K2L A;  5JEA G;  2MPM A;  5TSS A;  1R4P B;  1R4Q B;  4EQ5 A;  4TSS A;  4DAY A;  1WD0 A;  1HHV A;  1TWH H;  2JXM B;  3M4P A;  4NB3 A;  2PI2 E;  3KF6 A;  3H0G B;  1GM5 A;  3SDZ A;  4F8M A;  5EPL A;  2Z6B A;  3JAM c;  4KJN A;  1C48 A;  3R2T A;  4RCN A;  3O13 A;  1GUG A;  1STH A;  4BWG B;  3PUW A;  1A2U A;  1OXV A;  1S5B D;  4IPH A;  2LD7 A;  4JI6 L;  1PFM A;  1TWA H;  3TN2 A;  3PIO A;  4JYA L;  5IYB G;  1N8R C;  2P5Z X;  3MTS A;  4X65 Q;  1KAW A;  2VB2 X;  3NUC A;  5C4H A;  2L11 A;  4GOP A;  4GZY C;  4IZ8 A;  3BZK A;  2F4V L;  2Z6K A;  2VUM H;  2IX3 A;  1O7Y A;  1EOT A;  5E3F A;  1DGS A;  1KHC A;  3MEF A;  2KA7 A;  4A3D G;  1NSN S;  2JA7 H;  4RGM A;  1HJP A;  4AQY Q;  1SLJ A;  1UE6 A;  3C1F A;  5KEE A;  3RZO H;  1K8O A;  1I4Q A;  2PMZ B;  2E5L L;  3S2H H;  2F0P A;  4KN7 C;  1B7Y B;  3HZX A;  1PYS B;  4IUR A;  4KD3 A;  3SK5 A;  2D0O A;  4DR6 L;  2YTY A;  3CAM A;  1JOO A;  2LC3 A;  1OTC A;  1Y1W H;  4QUF A;  1E1T A;  4V19 0;  2Z4H A;  3I4M G;  2OT2 A;  1LT6 D;  1JE4 A;  1PTO C;  1SE2 A;  5AJ3 Q;  1ML0 D;  1V66 A;  1SRU A;  4P2C B;  2JA8 H;  3DM1 A;  4BY1 G;  1EYD A;  1NE3 A;  1AFP A;  4MZ9 A;  1PTO H;  3CC7 A;  1EY5 A;  2IPK D;  2NYZ D;  4A3B H;  3KLW A;  3TP8 A;  1XPO A;  3NBI A;  1WCM G;  4HSV A;  1S40 A;  1H9S A;  3T53 B;  2FFK B;  4DNI A;  3PV0 A;  3RLN A;  4HED A;  2EJM A;  1SYE A;  3LGJ A;  4QQB X;  4WJ3 M;  2EYO A;  1YHB A;  1AH9 A;  2WKC A;  3S1R H;  1MBY A;  1KXL A;  4NMZ A;  4G4K A;  3A5Z B;  2F52 A;  3GTP H;  1JCK B;  5KYL A;  2L1B A;  2I5M X;  1WTH A;  2FHT A;  3MFY A;  2ZJR A;  3GTK H;  3S14 B;  3TRE A;  2CQA A;  4XTC S;  2F0V A;  4PZ8 A;  2K75 A;  4QUC A;  2UXB L;  1HA5 A;  3HGB A;  4OX9 L;  4B3M L;  1S3O A;  3S2D H;  2HT1 A;  1M1K C;  1GHJ A;  1CK1 A;  1STE A;  2B39 A;  5T1I A;  3OMG A;  4RHR A;  3W5O A;  3EA6 A;  2E8G A;  4C3I H;  1CT1 D;  4NKL A;  3S17 B;  1ZXT A;  5FO7 B;  4CDE C;  3P20 A;  4JI4 L;  5CBE E;  1HNW L;  1FJG L;  3S15 B;  1QZG A;  4K0K Q;  1LV9 A;  4LK1 C;  4A4I A;  1W6K A;  3FVQ A;  1RDP D;  4JOI A;  3F2C A;  3J81 c;  3ERO A;  3EQL C;  3Q6S A;  1GUT A;  4QL5 A;  2WV6 D;  3IFD A;  1JOQ A;  1NAP A;  2F0M A;  4LF9 L;  3J7Y W;  1SNM A;  1NR4 A;  4BBS H;  1L0W A;  1PFB A;  2XRQ D;  1LYL A;  1M8A A;  2EY2 A;  2PMZ E;  5A2Q E;  3CCR A;  1Y1V H;  2EDG A;  4B3S Q;  4A3E B;  5C0X H;  2R7Z H;  1HTL D;  4C2M B;  2IX0 A;  1YNN C;  1HNZ L;  1IW7 C;  2OXP A;  4X3T A;  5L37 A;  3NQT A;  1PZI D;  3R8B A;  5LMU Q;  3K0Y A;  1L1O C;  2AUJ D;  1MI2 A;  1VMC A;  1STA A;  3J7A V;  1STY A;  2CH4 A;  1II3 A;  1YHQ A;  1QVF A;  2EYH A;  2EYJ A;  1VQ5 A;  1LTT D;  1H95 A;  1I4G A;  2F0G A;  2IW3 A;  4OGQ C;  2VUM B;  4HMJ A;  5E1F A;  4HJ9 A;  1IYV A;  2UXC Q;  4LWC A;  2B2U C;  2ZM6 Q;  1K28 A;  3TDQ A;  2JA7 B;  1TY2 A;  4O2D A;  1X55 A;  2G5D A;  3E5S A;  5IYC G;  1KAA A;  1JR0 D;  4APV A;  5IGG A;  3A7A B;  4KKT A;  1SYF A;  1XX8 A;  5ELO A;  3BVG A;  1N33 Q;  2AWN A;  4E6I A;  2Y0S G;  4V0B A;  2JN4 A;  4R4C A;  1QUQ A;  2ODC I;  1JOR A;  4Y52 H;  4EQN A;  1Y1W B;  2MPH A;  1LTA D;  1QVG A;  1O7I A;  3I4O A;  3H94 A;  5GAE C;  4O42 A;  2K14 A;  1EQQ A;  5IGB A;  3FKI H;  1X6O A;  2JA8 B;  1B1Z A;  2JEA I;  3H15 A;  5M5Y H;  4HJ7 A;  1PRT B;  1BBU A;  2BDO A;  4BA1 I;  1E1O A;  3NEN A;  4QGU A;  3CPF A;  4GNX C;  1JWM D;  1JT8 A;  1VQ4 A;  1GO3 E;  1G6Z A;  5GQO A;  1TS3 A;  1Y8P B;  3T56 B;  3MC0 B;  3OW7 A;  1ENA A;  2MJ8 A;  2G9D A;  2A6H C;  3DWQ A;  4BIT A;  4B08 A;  2SOB A;  3S9W A;  4JV5 Q;  3BG3 A;  3NQI A;  5I6Y A;  5ELN A;  2F3W A;  4H0L C;  4DGZ A;  3NHH A;  3R93 A;  2CVR A;  4JI1 L;  3M3Y H;  5JEA H;  4OIJ A;  3GD7 A;  3UDF A;  3KFU A;  4PV1 C;  3K7A B;  1V8Q A;  4ZYS A;  4A3J B;  4JI8 L;  4DR5 L;  4JI2 L;  3AU7 A;  1XTC D;  3C1E A;  3HKS A;  3PIP 3;  3H6M A;  4WJ4 A;  4LFB L;  1YJ9 A;  4IFD G;  1K0R A;  3URY A;  2F0I A;  4CGY B;  4RGO S;  2ZXR A;  4GN4 B;  4C3J G;  1GUO A;  4LFC Q;  1ILQ A;  1ET6 A;  4XIG S;  1YVC A;  2HCI A;  1CKN B;  1D5X C;  3LWE A;  3D31 A;  2L0C A;  2SEB D;  3P1H A;  5CV6 A;  1OO9 B;  1LTB D;  1DOM A;  2E2J H;  4JI7 L;  1VF5 C;  2VXW A;  1BBW A;  1F2Y A;  1XWE A;  3GDE A;  4ID6 A;  2WB1 E;  3KDF B;  2E74 C;  3GTJ B;  1VMP A;  1STN A;  5IWA L;  2E5L Q;  4A3D H;  5IY0 A;  2NVY B;  2AWO A;  5IP7 H;  2L55 A;  4DR6 Q;  2IX1 A;  1EU3 A;  4ODG A;  3NPP A;  1JWS D;  4GLA C;  1Y1V B;  1EZ8 A;  2KED A;  3I70 A;  5DAU A;  4X64 Q;  2F0O A;  3A8K E;  4KMU C;  2M9V A;  4POF A;  5C3E G;  1DOL A;  2NTT A;  1EY8 A;  2OTJ A;  3K59 A;  2TMP A;  3RN5 A;  4YCW A;  5JJZ A;  1KNA A;  3D3R A;  2NN6 G;  3N52 A;  4IUQ A;  1I4H A;  3I4M H;  3T1H L;  1JWU D;  3K81 C;  4A93 B;  5JJL A;  2ZXP A;  3DEO A;  4A3L H;  3H3V I;  3HOU G;  3E6Z X;  2EY6 A;  4WOR A;  4L5R C;  3K6O A;  4I7Z C;  3AMU A;  3CCM A;  4QCL A;  1WOC A;  5C4J H;  3IL8 A;  3TZU A;  1DJR D;  1NR2 A;  5C4Z A;  3HOV H;  1HFN A;  3BDC A;  3ULL A;  5DM7 3;  4P72 A;  1PFS A;  1LUZ A;  3SE0 A;  4OEL B;  3CU7 A;  1DON A;  3PF5 A;  3F2D A;  4O0A A;  2PW5 A;  3KLS X;  2MNA A;  4TRD A;  3OMC A;  3KBX A;  1EY6 A;  4KY6 A;  2B63 H;  4CKE A;  3F2B A;  2KVM A;  3PMF A;  4X6A H;  4JBW A;  2WAQ E;  5IP9 G;  4A3F B;  1DXM A;  1UEA B;  1LO5 D;  1EQR A;  1V9P A;  1FYC A;  5E7N A;  1JC7 A;  1B3A A;  1B9N A;  2F0U A;  1ZS9 A;  3WDN A;  1RL2 A;  4OX9 Q;  5JJI A;  3QIA A;  1I4P A;  1I4R A;  3CCQ A;  2DK4 A;  2GA4 B;  1TWC B;  3HKZ E;  3MXP A;  3FDT A;  1SE3 A;  1O80 A;  4BBR G;  4JG2 A;  3RZD H;  2M00 A;  4DAV A;  1HNW Q;  1FJG Q;  3SVM A;  4DKA C;  2DJG C;  4AQY L;  2GN5 A;  1PZK D;  1SE8 A;  2A5H A;  1QNK A;  5LMN W;  1NY4 A;  2JEB I;  4OXP A;  1EIG A;  4LF9 Q;  3Q23 A;  1TWG B;  2NN6 I;  1BOS A;  1GVP A;  3DLL A;  2RSO A;  2BA1 A;  2RHS B;  3DHQ A;  1VQH A;  1ZYR D;  2H1E A;  4R4Q A;  2PQE A;  4CDC C;  1HR0 W;  1Y69 U;  3NXW A;  5FOB B;  2PCF B;  4LFA Q;  1MSH A;  1AW7 A;  3KUP A;  1OXS C;  5J22 A;  2J7Z A;  1ASZ A;  4ZAI A;  1TS4 A;  2NVT H;  3IKJ A;  3WOF A;  3F1Z A;  3GTO H;  3MA2 B;  1E7Z A;  3FRP B;  1SYB A;  2E76 C;  2EYF A;  1RIP A;  2K28 A;  1O7Z A;  5C44 H;  5JOB A;  1FNV A;  4RG1 A;  3MWY W;  4K5V A;  1BKB A;  1PH4 A;  2R93 G;  2K01 A;  4A3G G;  3U9O A;  2I07 B;  2LS0 1;  5LL6 X;  1SDF A;  1JQY D;  4GOP B;  3CC2 A;  4RA8 A;  3A74 A;  4EQP A;  1S72 A;  4IN3 A;  2LXJ A;  3RLO A;  4L5Q A;  2X69 A;  4CKC A;  3H0G H;  1K8A C;  2B2W A;  4A3D B;  1SYC A;  1ZYR C;  3AYH B;  2JSO A;  1CHP D;  2TSS A;  5IOC A;  1BCP D;  3QWN A;  4RHS A;  1XMQ L;  4DV5 Q;  1QVC A;  4NPS A;  1JB3 A;  2AHO B;  1E2Z A;  2K4K A;  2BCO A;  4FO2 A;  1EFW A;  4OHJ A;  2KCT A;  2BDN A;  1KAB A;  2KCC A;  4DXG A;  1GUW A;  1B9M A;  2KEE A;  4KY7 A;  3CCU A;  4DAM A;  2B2T A;  4K0K L;  4EVO A;  3KF8 A;  1FR3 A;  4O1N A;  4BY1 B;  2NVQ B;  1DCZ A;  4P73 A;  4MTN A;  4AIM A;  2ID0 A;  1N32 L;  1V1P A;  3NP8 A;  5I6W A;  3H3V C;  4U68 A;  1WCM B;  4HCS A;  4P71 A;  2D5D A;  1H9S B;  1Z9F A;  4DK0 A;  3RN2 A;  1E2W A;  2K5Q A;  3NTH A;  4LJZ C;  4Y7N B;  3K5M A;  5EPK A;  3H3V H;  4B3S L;  1WD1 A;  3I4N G;  2YYZ A;  5C0X J;  1SSO A;  2VL6 A;  3KJO A;  2D9U A;  4DF7 A;  4JI8 Q;  4N8F A;  1YNJ D;  3G71 A;  2KHS A;  5LMU L;  4GKK L;  4DR5 Q;  4JI2 Q;  3R3O A;  2IWH A;  4IJH A;  1HQR D;  2OCE A;  4KI0 A;  1CTM A;  3L7Z C;  5IGF A;  3KLR A;  2EPB A;  1AZQ A;  4B9W A;  1JJG A;  3W3A A;  2UUB L;  2JA9 A;  1EWI A;  3BZC A;  2K04 A;  2JA6 G;  2N3S A;  3OIP A;  2LKV A;  4JC0 A;  1HTP A;  1KHI A;  5J39 A;  4Z9C B;  1TS5 A;  4JI7 Q;  3ONA B;  5M3F G;  2EY5 A;  2F0T A;  2ZM6 L;  4DV3 Q;  1HXY D;  1FL0 A;  1WI5 A;  3OYY A;  4DA2 A;  2CH4 W;  2RSN A;  3L3O C;  2KVD A;  2M2L A;  1V43 A;  4A76 A;  1BCP F;  4UP8 A;  4IO9 A;  4L6T B;  1N33 L;  3G6E A;  1SEB D;  4CJ0 B;  3S14 H;  1YNJ C;  2SNM A;  3CME A;  1ESF A;  4FVM A;  1I5F A;  1G29 1;  4DR3 Q;  2MO0 A;  3K80 C;  1HZC A;  3EVQ A;  4HID A;  1BR9 A;  2N88 A;  2MO1 A;  4A3K G;  2O2L D;  1VQJ A;  1ZBH A;  4DNT B;  1VQ6 A;  1BUV T;  1EWH A;  3T1H Q;  2JVW A;  5CV7 A;  3VR6 A;  5C3E H;  4LF4 Q;  5IGC A;  5JPM C;  2NN6 H;  2RF4 A;  1PYB A;  3PCO B;  3CP0 A;  3UDX A;  5K36 G;  3HOU H;  3E9I A;  1G51 A;  1F77 A;  1E7L A;  4YY3 L;  5CV8 A;  3HS0 C;  3IFT A;  1LTI D;  5FLM G;  2ICE C;  5HGT A;  5BN3 A;  4JV5 L;  2RNN A;  1EFI D;  4UZW A;  1U4M A;  2V4D A;  2HQL A;  5M3M B;  5JEA J;  4HIK A;  1QCB D;  4BXX G;  1VQB A;  3MXU A;  3QJY A;  2WAC A;  4A3E H;  3PUY A;  4FF4 A;  3BS1 A;  4JPB W;  2A74 C;  4C2M H;  5D65 A;  1B53 A;  5FLX L;  3NEM A;  2AKW B;  5GAG C;  1EL0 A;  2RCN A;  4R1J A;  4CJ1 B;  3TRZ A;  1G6P A;  4NXM L;  1EQT A;  1BVS A;  2ZTE A;  2Y0S B;  3J80 E;  5IP9 H;  4ZKC B;  1QUQ B;  1PTO D;  1PRT D;  2CHB D;  4LFC L;  1LAB A;  1EY0 A;  1HZB A;  3I91 A;  1W3S A;  4IPG A;  4GN5 A;  4G7O C;  5HY6 A;  4RCO A;  2MQH A;  4X62 Q;  3GV6 A;  2A6E C;  3TSS A;  3H91 A;  3AB9 A;  5I4D A;  1RKN A;  3OSO A;  2IHE A;  3M9B A;  2QEJ C;  2PZT A;  1VQ9 A;  1B3Q A;  2WIN B;  2EY1 A;  4H44 C;  2CW0 C;  3NTI A;  1Y02 A;  3Q8D A;  3QR8 A;  3ULJ A;  4B3R Q;  1EN7 A;  3VYT A;  2Z9H A;  4JI0 Q;  4KK7 A;  1TS2 A;  4EX5 A;  5M9O A;  5F2D A;  4JBJ A;  4C3H B;  4X64 L;  4HJA A;  2R7F A;  1PRT C;  5IT9 E;  3BYY B;  2QEX A;  2HDM A;  3J7A F;  4DN4 M;  5KNC A;  2AUK A;  2D62 A;  1PDQ A;  3A8I E;  3NK9 A;  2K7V A;  2ES2 A;  5I9O A;  1W6J A;  2UUA L;  1UE5 A;  1F9Q A;  5J1Z A;  1SNP A;  4C3J B;  1WTX A;  3OOC A;  2JQO A;  5GAH C;  4FYD A;  3TP7 A;  1J9O A;  2OQK A;  1HQM C;  4J8Q A;  3PUZ A;  2OTL A;  4M8A A;  4PMB A;  1M4V A;  2I0Q A;  2EJF C;  1UAP A;  4RGT A;  1PH7 A;  4A3G H;  4A3J H;  3K7A H;  1PA6 A;  2PZU A;  1CI3 M;  2NUC A;  2A19 A;  4XT3 B;  1XMQ Q;  4BA2 I;  2PQA A;  1F9P A;  4LAA A;  3KOJ A;  5JAV A;  1PTO F;  2JA5 G;  1JEQ A;  4FF2 A;  1FD7 D;  1YNN D;  2IHF A;  1IW7 D;  3S1M B;  1HUN A;  4R4I A;  3VR2 A;  5JVG 3;  1QB5 D;  4YCV A;  3RLF A;  1H1J S;  4U67 3;  5C3E B;  4HAE A;  3KK7 A;  1JJR A;  1E0B A;  3VYS A;  2LFN A;  4OWT B;  2B2V A;  3HOU B;  1SAP A;  1GD7 A;  4N9P A;  3GTJ H;  1A6X A;  2KBN A;  5LHY 1;  1N32 Q;  1GJJ A;  3BDL A;  2NVY H;  4HCE A;  3PO3 B;  4LF6 Q;  2A68 C;  3SXH A;  4B9X A;  3TZD A;  4BS9 A;  1EY4 A;  5BN4 A;  1IKL A;  1BNZ A;  1SND A;  3ND9 A;  4LFA L;  3TQY A;  3K5O A;  4GKK Q;  1B70 B;  1STB A;  2F0E A;  1LTL A;  4IUP A;  4A93 H;  4A75 A;  1PH6 A;  1F2Z A;  3SK4 A;  1D5M C;  2BE5 C;  1SN8 A;  1R9T B;  4GLV B;  4ZQ3 A;  2UUB Q;  3PUV A;  2OWO A;  1XPR A;  3TME A;  5M3M G;  1C9O A;  1NCV A;  4YWL A;  1K73 C;  4OEM B;  4DV0 Q;  4G7Z C;  1Q7Y C;  3VR4 A;  5IGE A;  2F4I A;  3SR1 A;  1UWV A;  3S16 B;  4BBR B;  4F88 A;  2B2Y C;  2A6H D;  2X6G A;  3M4O H;  2C5C A;  1GKH A;  3HRZ C;  3J80 L;  3QB3 A;  3DWP A;  3G7L A;  5T1G A;  3GTL H;  1IYJ B;  1EYA A;  2LY7 A;  2KUM A;  4A3F H;  3Q0A A;  1E24 A;  1G2S A;  4DV5 L;  4XQQ A;  1M90 C;  4ULL A;  3FHW A;  3HOY G;  4DXF A;  3PO2 G;  1GUS A;  2CWP A;  1TT2 A;  3U4V A;  4WFN 3;  5ELF A;  5I9P A;  1PH3 A;  1WJJ A;  1YEZ A;  4DV4 L;  2ZTD A;  4GKJ L;  1KL9 A;  4A3M G;  1IBK L;  1H9F A;  3K57 A;  3W2D A;  1AEX A;  1TWC H;  1WFQ A;  2Q2U A;  3PGZ A;  4A3K H;  2B8G A;  3T4A C;  1STG A;  2F0L A;  3FMC A;  5ELE A;  2NVX H;  1SRO A;  4UP9 A;  4DR7 L;  3E3X A;  3OWF A;  3BJU A;  2IJ0 A;  1CA5 A;  1S5E D;  2GVA A;  4KD4 A;  4YY3 Q;  1SYD A;  4OL7 A;  3CW2 C;  4IOA A;  4IPC A;  1UUP A;  2V1C C;  4C3H G;  1SMY D;  4CKB A;  1TWG H;  5IT9 L;  1Z7T A;  3A0J A;  3T13 A;  5KND A;  5FLM H;  2R93 B;  4Q0F A;  4A3G B;  1F9S A;  1FGB D;  4R4O A;  2XWJ B;  4LW1 A;  5M5W H;  4YHH Q;  1PLF A;  3K7U C;  4GS3 A;  4A3I G;  4NXM Q;  3FPP A;  1EY9 A;  2Q8R E;  4R8I A;  2R92 G;  4R9W A;  1TII D;  3HOZ B;  1UEB A;  1CUK A;  4N8X 1;  1WVL A;  3CRK C;  4IFD J;  1U4R A;  3K8A A;  1J5E L;  4NP5 A;  4FF3 A;  1B4O A;  4IJL A;  4GOP C;  2Z6K C;  3ND8 A;  5IYB H;  3SHL A;  4X3K A;  1DD2 A;  1OXU A;  4DV3 L;  1X54 A;  2CWA A;  4DUY L;  1SMY C;  5C3W A;  4IAL A;  4OON A;  2VQF Q;  4ME3 A;  1IYU A;  4K14 A;  5HUR A;  1KTK A;  4DUZ Q;  3KF8 B;  1DOK A;  4DPG A;  3K5N A;  2EJG C;  1ICW A;  4CDD C;  5AFW A;  3EJI A;  1I50 B;  3CCL A;  2KCN A;  3RR5 A;  1Q46 A;  4DR3 L;  2QA4 A;  1J8I A;  1MHW C;  3P75 A;  4F7X A;  2K33 A;  3M4Y A;  1IZ6 A;  1B2T A;  1CFM A;  3GTG B;  1QWY A;  3I4N B;  4F87 A;  1TR5 A;  4RGN A;  5CGK A;  1TQO A;  4LF4 L;  1JE5 A;  4IUV A;  4OO1 G;  4LF7 Q;  2DN8 A;  2FMM A;  2BA0 A;  1XMO Q;  1J6Q A;  1EZ6 A;  1X9N A;  1VCI A;  2UUA Q;  4BY1 H;  3MHB A;  1Q86 C;  2NVQ H;  1QOH A;  1E3P A;  3PO3 G;  2J0T D;  5A2Q L;  1WCM H;  1KNE A;  2JA6 B;  4TQU S;  5IGD A;  3GTM B;  4ILW A;  1P16 A;  3RD4 A;  2ATW A;  4DR2 Q;  3S1N H;  4Y7N H;  3MFG A;  3TP5 A;  4IFD I;  1Q90 A;  5M3F B;  2DY8 A;  1NMG A;  1UE1 A;  1Q12 A;  1UNS A;  1LAC A;  3M4O B;  4KHP L;  3R2I A;  1YHA A;  2RDG A;  2VW9 A;  3GTL B;  4XYQ A;  2ENB A;  5D3I B;  3ERS X;  3SEB A;  3QOL A;  1K83 H;  2AQ1 B;  4JW0 A;  2EXZ A;  2VQE L;  3WOE A;  1S5C D;  3D4W A;  3F8T A;  2Q2T A;  3D4R A;  2ZXO A;  4XT1 B;  3VR3 A;  2MHV A;  3W1G A;  2JA5 H;  4DK3 C;  4HMI A;  3MXN A;  4X62 L;  1F2L A;  1EYG A;  5G3L D;  1SJH D;  2C35 B;  4A3K B;  3V96 A;  2D0P A;  3G48 A;  3NSW A;  2NVX B;  1N36 L;  2J4X A;  4UP7 A;  2HQE A;  2CFM A;  4JOI C;  2NZ1 D;  4KHV A;  2ZT9 C;  3ERQ A;  2PNR C;  3CCE A;  1K3R A;  2L5T A;  1L2F A;  2FMC A;  1RTO A;  2K5V A;  4B3R L;  1HR0 Q;  1QZH A;  4JI0 L;  1A3U A;  1RJT A;  1E2V A;  4HR7 B;  1VQD A;  4K6D A;  3TS0 A;  2LMC B;  1DM0 B;  4YWK A;  1G2T A;  3D8G A;  4DAY B;  2DGY A;  5M5W B;  3RMH A;  4XQN A;  1AE2 A;  4A3C G;  2OF1 A;  3PIP A;  1N9W A;  3SK6 A;  2RVL A;  3KF6 B;  3GO5 A;  1ILP A;  3CCJ A;  1Q1E A;  3A5U A;  5A35 A;  2PNH A;  5JVH 3;  3AFQ A;  3M4Q A;  5M5X B;  1HA6 A;  3L9A X;  1L0X B;  2RCF A;  1H9K A;  1EWC A;  5GAD C;  2RBM A;  2HDL A;  3J80 i;  1LLR D;  3TP6 A;  2Q8I B;  1E7D A;  1EIF A;  1E22 A;  1WTQ A;  1QNU A;  4A3B G;  5KGU A;  2EVB A;  4JCV E;  2W51 A;  2BH8 A;  5ELD A;  4QIW B;  1D8L A;  5M3M H;  3D6C A;  3DWA A;  4I65 A;  1O7L A;  1SNQ A;  4QMG A;  3JC6 6;  5IYC H;  1KC8 C;  2MP1 A;  3HOZ G;  5EKK A;  2WAQ G;  2KEN A;  1GL9 B;  5IOD A;  1Q8I A;  2X6L A;  4POG A;  3TEH B;  1NJI C;  3BU2 A;  1K8G A;  4DV4 Q;  1PMR A;  3I55 A;  1FNU A;  4GKJ Q;  1IBK Q;  4HN7 A;  3M7G A;  3PO2 H;  4FXK C;  1A2T A;  3VYR A;  5JPN C;  3HKZ G;  1I3Q B;  1KRT A;  1K0S A;  3NE5 B;  1VQP A;  2R7D A;  4DK6 C;  3Q22 A;  1Q1B A;  4RKB A;  4LF5 L;  2WP8 J;  4BY7 B;  3S1Q B;  3DEP A;  4WJW A;  4DR7 Q;  3SK8 A;  1VDZ A;  2NTS A;  4EGV A;  1DYQ A;  4LNQ A;  1EOV A;  3PIO 3;  4C3I G;  1KLU D;  5FK9 C;  2OEO A;  3BVM A;  4LF6 L;  2O5I C;  4KHZ A;  3LWU A;  1XNR Q;  3LNN A;  4KTA A;  3S1N B;  1YBY A;  2FJ2 A;  4QY7 A;  4DK1 A;  4ZCK A;  2RDH A;  1HFG A;  2E2I H;  2N55 A;  3OWE B;  4C3H H;  2ODG C;  2ZTC A;  2QNF A;  2F0K A;  5COY A;  1B44 D;  2H4O A;  3HOW B;  2QDL A;  1K83 B;  1VQL A;  2Q2I A;  1C7Y A;  5EGT A;  3JAM E;  2E2H B;  3A56 A;  2RA4 A;  3N6R A;  4TVA B;  2UXD Q;  1X3G A;  4NDX A;  2C9O A;  3UI2 A;  4IFD H;  2JA5 B;  1J5E Q;  1IXR A;  1T5E A;  5IYD G;  4C3J H;  2HHH Q;  3QOJ A;  1H9E A;  1K8M A;  4LMQ D;  5FLX c;  1L1O A;  4DV0 L;  1YI2 A;  4DR1 L;  3VYU A;  4DUY Q;  2AQ2 B;  1LTR D;  1TWF B;  1ONL A;  2HD3 A;  4PMW A;  4DNR B;  3EIV A;  2B29 A;  3ULP A;  2QNC A;  4KKU A;  1K3B C;  1EUJ A;  3TBI B;  2E2D C;  4DV7 L;  5C5M A;  1PV4 A;  1A15 A;  4XDX A;  4AYB G;  2B2U A;  3ICE A;  2BH2 A;  3S1M H;  2DJF C;  3J7Z C;  2QIL A;  1S5F D;  3OIQ A;  4DV1 L;  3WWV A;  1FVI A;  1Q8K A;  2WQG A;  1Q81 C;  4HJ8 A;  2HJQ A;  1VQI A;  2JYO A;  4KV6 A;  3AQQ A;  4CHT B;  1X3F A;  1T9H A;  2EIF A;  1U4L A;  4GN3 B;  4DR4 Q;  4C1N K;  3FKI G;  1Y8O B;  5EKI A;  2A6E D;  2QDB A;  3C2P A;  3ITP A;  4X3S A;  2DUD A;  1CKM A;  3PO3 H;  1EEI D;  2RQX A;  4EQO A;  4NW2 A;  1SR3 A;  5I2Y A;  2O5J C;  1HZA A;  4JI3 L;  4XXE A;  4GLX A;  4DAP A;  4KHP Q;  2CW0 D;  4YHH L;  2IY5 B;  1WTV A;  4GNX A;  1D5Z C;  5EJW A;  4C1N I;  2PPB C;  1SMX A;  3X3M A;  2KEC A;  2VQE Q;  2F0Q A;  4JK1 C;  4FF1 A;  3AFP A;  1U5K A;  2DNE A;  1R9T H;  2HUG A;  3HOY B;  1XYI A;  3PO2 B;  2HIV A;  3I4L A;  3RNU A;  1G8Z D;  1SXT A;  1HPC A;  2VB3 X;  2K6A A;  4A3M B;  1FNW A;  2HIX A;  2LXK A;  5CV4 A;  3M85 A;  1SFO B;  1EIY B;  3NWS A;  3CF5 A;  3NBH A;  4XYO A;  1N36 Q;  3A55 A;  2K52 A;  4J6H A;  1I94 L;  2VQF L;  5C6A A;  4MTK A;  5CIU A;  3S16 H;  4BBR H;  4RKL A;  1MSG A;  4DUZ L;  1MJE A;  2PZW A;  2Z8L A;  5LL6 S;  1RD9 D;  1Y8N B;  3J81 E;  2YTV A;  1HH2 P;  1ROD A;  3ZYY X;  4DFA A;  2YU9 B;  2E2I B;  1PH9 A;  1QE6 A;  1VQ8 A;  1IL2 A;  3I3C A;  3V2T A;  1KDB A;  1AZP A;  1CZW A;  2F3I A;  3CHB D;  1KRS A;  1NUC A;  1TY0 A;  5IP7 G;  3HOX G;  2A73 B;  5EBC A;  4L63 B;  2FIN B;  4BY7 G;  4A3C H;  2B3G A;  1D7Q A;  4LF7 L;  4UDU C;  5NUC A;  3DMU A;  5EAY A;  1LT4 D;  4L5T A;  4KN4 C;  4AH6 A;  1XMO L;  4A3I B;  1BO0 A;  1BXT A;  2K05 A;  4UAI A;  2R92 B;  1RTN A;  4L8J A;  2ZJP A;  1BCP B;  2NZH A;  1TXY A;  1MJC A;  2KJX A;  1YNX A;  4A3L G;  1NBW A;  4MNO A;  4PZ7 A;  4DR2 L;  5GRO A;  4J1M A;  3J7A 5;  1PHJ A;  2WFW A;  2VS1 A;  1WYD A;  4HIO A;  3HOV G;  2R93 H;  1Y14 B;  2B2W C;  1A63 A;  3HOW G;  3GTQ B;  1ET9 A;  2PI2 A;  3JAM L;  2A68 D;  3PQI A;  2D2C C;  2Q2H A;  3LLR A;  2UU9 Q;  1TVX A;  2F0F A;  4QJF A;  1PRT F;  2B63 G;  2XRS D;  1X65 A;  1B50 A;  1QIL A;  2GVB A;  4HTH A;  2B8F A;  3HOZ H;  1H9R A;  5KIX A;  5ISR A;  2CCZ A;  5FJ8 G;  4UHV A;  2RHQ B;  3UE0 A;  1SE4 A;  4JVZ A;  2G9H D;  4PG3 A;  2Y0S E;  5LMN L;  1KIX A;  2BE5 D;  1PH2 A;  2B2T C;  3J80 c;  5C4X G;  2Z4I A;  2KQ3 A;  2MFI A;  5D3D A;  5DNF A;  3IAY A;  4LF5 Q;  3MXG A;  3I72 A;  1AN8 A;  3CPW A;  3A8J E;  2EYP A;  3F2U A;  3FPU B;  4FNF A;  1PFN A;  2YTX A;  1HR0 L;  2A69 D;  4C56 C;  5KNB A;  1I6H H;  3K58 A;  2PW7 A;  3I8Z A;  4B3T L;  1MIU A;  2QKI C;  1I50 H;  1Z47 A;  5ELB A;  2JJQ A;  3OTO Q;  3X3N A;  2R3Z A;  4KKS A;  1N34 L;  1ENF A;  2UUC Q;  3HEJ A;  3QG1 A;  1K9M C;  1MKH A;  3GTG H;  1O78 A;  4UPA A;  1XPU A;  3I4N H;  1SNO A;  1DZ1 A;  5BN5 A;  2L15 A;  1HZ9 A;  3QKJ A;  1SNC A;  1CQV A;  2NWG A;  3T51 B;  1HNX Q;  5EPJ A;  1IBL Q;  4M1U B;  3CCV A;  2KOL A;  3H09 A;  1TWH B;  3S24 A;  2MUY A;  5IT9 c;  1XNQ L;  1VQA A;  4ZLT F;  2K5D A;  1YNS A;  2CQO A;  3FEW X;  2JA6 H;  1OXT A;  3GTM H;  5IYD H;  3I56 A;  2A69 C;  3MXN B;  1G91 A;  1VQ7 A;  3T1Y Q;  5C44 G;  2AMC B;  4DR1 Q;  5M3F H;  4NXN Q;  1TWA B;  4LUO A;  4G57 A;  4R8N A;  1VQO A;  2N49 A;  3E0E A;  2WB1 B;  1V1Q A;  2K5W A;  1JIC A;  1PXU A;  4DV7 Q;  1PH1 A;  1ASY A;  4KY5 A;  5CYU A;  3H0G G;  2H5X A;  3RZO B;  2Z1C A;  4DV1 Q;  2A1A A;  3S2H B;  4PNY A;  1NMF A;  2EE1 A;  1D6E C;  2F0N A;  2A8V A;  3KJP A;  2QGQ A;  1A3T A;  1JOK A;  3J81 L;  1PYW D;  3PSI A;  2ICI A;  3DM3 A;  4LUZ A;  2ASB A;  3CQZ H;  5ELC A;  1KQS A;  4IUN A;  2XTI A;  5CV5 A;  5K36 H;  4IOC A;  1XNR L;  2I5L X;  2XVS A;  1RF2 D;  2OQ0 A;  3FLG A;  2N8N A;  2XWB B;  1UE7 A;  1PTO B;  3U4Z A;  2KHI A;  1VQC A;  4JI3 Q;  5CC4 A;  4A3B B;  4X66 Q;  1IBM L;  1YZ6 A;  3STB D;  4IUT A;  4BXX H;  1Z6H A;  1GUN A;  4PQX A;  1WTW A;  3G6J B;  3D0F A;  4H02 A;  5EBD A;  3S1R B;  4WRD A;  5DEH A;  1MD2 D;  1S4Z A;  1XXG A;  2WAQ B;  3NTK A;  1CA6 A;  3DUZ A;  5I2X A;  1WTR A;  1VQK A;  2UXD L;  1U0L A;  5M5X H;  1KDC A;  3GTP B;  3D4D A;  2XN9 C;  2ZJQ A;  1D1I A;  1KLG D;  2F3V A;  3ER0 A;  3GTK B;  2NB0 A;  2R6G A;  5CBA E;  2HHH L;  4K5W A;  1KD1 C;  5CMD A;  2F0J A;  4J15 A;  3BYT B;  3E0J A;  1IL8 A;  1CHQ D;  4DV2 L;  4MIU A;  2KVE A;  1C0A A;  1L0Y B;  3FP9 A;  1I4X A;  2VY3 A;  3HKZ B;  3GP7 A;  1I94 Q;  4YCU A;  4JI6 Q;  4K8J A;  1IKM A;  3S2D B;  4JYA Q;  4LF8 L;  4FXG C;  1EIH A;  2XSC A;  4FP5 D;  1SJE D;  3STB C;  1I6H B;  1V1P B;  1BDO A;  2N78 A;  4RWS C;  4C3I B;  2F4V Q;  1X3P A;  2R61 A;  3PUX A;  4P75 A;  3CCS A;  2EQS A;  4RMF A;  1A3V A;  1LT5 D;  1PH8 A;  1HUM A;  2O4X A;  2G80 A;  3AEV A;  5BR8 L;  1CKO A;  1RCV D;  2QCP X;  2SNS A;  3MEH A;  3OPO A;  4S3S A;  2EYL A;  4I7A A;  1I3Q H;  4BBS B;  3HOX H;  3Q24 A;  4ZUJ A;  4RH6 A;  2WII B;  5EKL A;  3J81 j;  3NEL A;  4OWX B;  1EYC A;  4PZ6 A;  4DR4 L;  4BY7 H;  1QJO A;  3S1Q H;  3G4S A;  2R7Z B;  3JAM i;  4R4T A;  1ESR A;  2EOT A;  5EQ0 A;  2K50 A;  1X3E A;  4JBM A;  4MN3 A;  3GQB A;  1JMC A;  1LTG D;  4JI5 L;  5C3X A;  3U50 C;  4CJ2 C;  1ICF B;  1EEF D;  4K8I A;  3I73 A;  2K1B A;  3OHX C;  1L1O B;  4DV6 L;  3KBG A;  2HCC A;  3K0X A;  3IRB A;  4PMC A;  1T5X D;  3HOW H;  1H9M A;  3ZJY C;  2E2H H;  3MZ5 A;  4QB4 A;  4A3E G;  2PYK A;  1BF4 A;  1WTP A;  1F2M A;  2VNU D;  2L4N A;  3OW2 A;  4ZKB B;  4AYB B;  2KVU A;  3I7F A;  5FKA C;  2EZV A;  5LMN Q;  1VQF A;  2EYM A;  5FJ8 H;  2B2V C;  1ZKO A;  4OWW B;  1S5D D;  4H7B A;  3CKI B;  4ALP A;  2UXB Q;  3CQZ B;  5C4X H;  2WB1 G;  1TWF H;  3EN2 A;  3U58 A;  4B3M Q;  3EBE A;  5C5L A;  2VUM G;  1YJW A;  3FKI B;  4X65 L;  2K32 A;  2QW7 A;  5DLQ E;  5M5Y B;  5COR A;  2JA7 G;  4B3T Q;  4ZRZ A;  2AQ3 B;  1JJC B;  1I6V C;  2F0W A;  4OO1 I;  1JEI A;  1QG7 A;  4JI4 Q;  1CM9 A;  1A8V A;  1N34 Q;  5J3B A;  1OXX K;  4KJO A;  1RHP A;  1A62 A;  1YIT A;  2F0D A;  1SYG A;  1VQM A;  1Y1W G;  4GNX B;  2QF7 A;  2CKZ B;  5K5P A;  1VQN A;  5D14 A;  4RAU C;  1IHZ A;  2I5H A;  1XJV A;  4K5X A;  1VS0 A;  1V1O A;  2VZA A;  3M3Y B;  4IQZ A;  4JBK A;  5H1S E;  1XNQ Q;  4KLK A;  1U4P A;  2JA8 G;  5IE8 A;  3C46 A;  1HNZ Q;  1BQQ T;  1HRJ A;  5DM6 3;  5AJ3 L;  1EQV A;  5CR3 A;  1BBX C;  5CV9 A;  3A7L A;  2NZO A;  1X32 A;  3MVV A;  5FLX E;  3NBH B;  4XQJ A;  4CBV A;  2I46 A;  2XIW A;  4FDB A;  3VA7 A;  3VDY A;  3E9H A;  3CD6 A;  2KHJ A;  1GHK A;  2E2J B;  2SDF A;  3GV3 A;  3CXC A;  2UU9 L;  3HG9 A;  2Z0S A;  3CMA A;  1LT3 D;  4A3J G;  1D1K A;  4OIK A;  3BVZ A;  5KRU A;  3J81 i;  1VF7 A;  3K5L A;  3HOY H;  3A54 A;  3B6Y A;  3PF4 A;  5G3L F;  2IT1 A;  1EY7 A;  3V05 A;  3BZD B;  5E4X A;  4A3M H;  3I90 A;  3KYH C;  3HOX B;  2K5H A;  1SFO H;  2F0H A;  2F1M A;  1ZEQ X;  1CKN A;  4AYB E;  2LSS A;  3UE1 A;  4Q5V A;  2KCM A;  2Q8T A;  2FXQ A;  3LX0 A;  2DNC A;  2XGT A;  3I4M B;  1X56 A;  4HSP A;  3M7N A;  1YJN A;  1MGS A;  3KDF A;  4ABN A;  3TS2 A;  2YU9 H;  3OTO L;  2L9H A;  1WTO A;  1GOZ A;  1XTD A;  2ALY B;  1IBM Q;  2JE6 I;  1PZJ D;  5C4J B;  1CZG A;  2UUC L;  3EFX D;  2KFV A;  4HIM A;  3HOV B;  4BBS G;  5E4W C;  1H9J A;  4UY8 C;  1Y1V G;  1TKW B;  1HNX L;  3VA5 A;  4K2K A;  1IBL L;  4H13 C;  1GJX A;  1BCP C;  5C0X G;  2R7Z G;  1W2B A;  3HFZ B;  1CSP A;  2PQA B;  2MGS A;  4TKO B;  5KYI A;  4A3I H;  2K5N A;  2RNO A;  1X3Q A;  4JI1 Q;  5FO8 B;  3CRL C;  3W1B A;  4IUU A;  2B63 B;  4YIJ A;  2R92 H;  1Q3L A;  3VR5 A;  4HJ5 A;  1D2B A;  4N9T A;  5HGQ A;  4A93 G;  1NTG A;  1C8C A;  4DV2 Q;  4ZUI A;  1PVO A;  1U9R A;  1JJ2 A;  3T16 A;  3D6W A;  3T1Y L;  4LFB Q;  4LUV A;  3MAQ A;  1GKU B;  3QO2 A;  1LM0 A;  4NXN L;  5C4X B;  2YV5 A;  1B8A A;  2XNA C;  3L2P A;  1P8L A;  3GTQ H;  1PH5 A;  2RKS A;  2JP1 A;  4LF8 Q;  3C3L A;  2KW9 A;  3HP3 A;  4IPD A;  4MHE A;  4QIW E;  3UDI A;  4DU9 A;  4P74 A;  4ME5 A;  2DY7 A;  3KLS A;  2UXC L;  3RZD B;  1AE3 A;  1HCZ A;  4ZK9 B;  2E75 C;  2EXD A;  1JB7 A;  1TU2 B;  2NBF A;  3CC4 A;  3SGI A;  1YIJ A;  4QF4 A;  4G7H C;  5BR8 Q;  1CQF A;  2JK8 A;  4A3F G;  2B2Y A;  5IWA Q;  3P7J A;  1NNX A;  1AP0 A;  5JJK A;  1ENC A;  4RFB A;  4X3U A;  4K6L A;  1VQE A;  1F9R A;  1FGU A;  3I2Z A;  4YWM A;  5IIF A;  2BOS A;  2F0S A;  3RUZ A;  4OO1 H;  3L0O A;  2WKD A;  3DXJ C;  3BDO A;  1CSQ A;  1EU4 A;  2F03 A;  2NVT B;  4JI5 Q;  4FXD A;  1Q82 C;  2PO4 A;  3GTO B;  3S17 H;  1KDA A;  1LTS D;  3UDG A;  4X66 L;  1SBB B;  2IL8 A;  2K03 A;  5C0X I;  3S15 H;  3U9S A;  5FO9 B;  5C44 B;  4DV6 Q;  2RDF A;  4L5S A;  1C4Q A; 
#chains in the Genus database with same CATH homology
 1I50 H;  1Z47 A;  1VQG A;  4GOP B;  2JJQ A;  4DPG A;  3CC2 A;  3OTO Q;  3A74 A;  1S72 A;  1A0I A;  2LXJ A;  3RLO A;  5JEA G;  4L5Q A;  1N34 L;  2UUC Q;  3CCL A;  3H0G H;  1K8A C;  3AYH B;  1MKH A;  1Q46 A;  3RR5 A;  4EQ5 A;  4UPA A;  4DR3 L;  1K9M C;  1XPU A;  3GTG H;  3I4N H;  2L15 A;  2QA4 A;  1TWH H;  1HZ9 A;  3M4P A;  1XMQ L;  4NB3 A;  1IZ6 A;  2PI2 E;  3KF6 A;  4DV5 Q;  1HNX Q;  1GM5 A;  1QVC A;  1IBL Q;  3CCV A;  4NPS A;  3JAM c;  3S24 A;  5IT9 c;  2AHO B;  1XNQ L;  4LF4 L;  1VQA A;  1JE5 A;  2K4K A;  4OO1 G;  1EFW A;  4LF7 Q;  3PUW A;  2KCT A;  1OXV A;  4IPH A;  2BA0 A;  1XMO Q;  2LD7 A;  1J6Q A;  4JI6 L;  1X9N A;  1YNS A;  1VCI A;  2CQO A;  2UUA Q;  3CCU A;  1TWA H;  1Q86 C;  4BY1 H;  2JA6 H;  1OXT A;  3PIO A;  5IYB G;  1E3P A;  3I56 A;  1N8R C;  3MXN B;  2NVQ H;  3GTM H;  3PO3 G;  4DAM A;  1VQ7 A;  3T1Y Q;  5C44 G;  2AMC B;  4DR1 Q;  4K0K L;  4X65 Q;  5M3F H;  1KAW A;  1WCM H;  4NXN Q;  4GOP A;  4P73 A;  4TQU S;  3BZK A;  2F4V L;  1P16 A;  2Z6K A;  2ATW A;  4MTN A;  4AIM A;  4LUO A;  4DR2 Q;  2VUM H;  3S1N H;  2ID0 A;  4Y7N H;  1DGS A;  3MEF A;  1N32 L;  1VQO A;  2N49 A;  4IFD I;  3E0E A;  1NMG A;  1UE1 A;  4A3D G;  1V1Q A;  1Q12 A;  1Z9F A;  4P71 A;  2JA7 H;  1HJP A;  4AQY Q;  1SLJ A;  1UE6 A;  3RN2 A;  4KHP L;  3RZO H;  4DV7 Q;  1YHA A;  1PH1 A;  2VW9 A;  1ASY A;  2E5L L;  3S2H H;  3H0G G;  3H3V H;  3ERS X;  4B3S L;  1K83 H;  2YYZ A;  2H5X A;  5C0X J;  3I4N G;  1B7Y B;  2VL6 A;  1PYS B;  3KJO A;  4DR6 L;  2D0O A;  4JI8 Q;  4DV1 Q;  2A1A A;  2YTY A;  3CAM A;  2VQE L;  3F8T A;  2Q2T A;  3G71 A;  2LC3 A;  1OTC A;  1NMF A;  5LMU L;  1Y1W H;  4DR5 Q;  4JI2 Q;  4GKK L;  1E1T A;  2A8V A;  3KJP A;  2QGQ A;  4IJH A;  3W1G A;  2OCE A;  3I4M G;  2JA5 H;  4KI0 A;  4DK3 C;  3L7Z C;  4X62 L;  5AJ3 Q;  1EYG A;  1JJG A;  3PSI A;  2C35 B;  3DM3 A;  4LUZ A;  2ASB A;  1SRU A;  3CQZ H;  2JA9 A;  2UUB L;  2D0P A;  1EWI A;  3BZC A;  1KQS A;  4BY1 G;  2JA8 H;  1NE3 A;  3G48 A;  2JA6 G;  2N3S A;  4MZ9 A;  4JC0 A;  1N36 L;  2XTI A;  4UP7 A;  3CC7 A;  1KHI A;  2CFM A;  4JOI C;  4A3B H;  4IOC A;  3KLW A;  1XPO A;  2I5L X;  1XNR L;  4JI7 Q;  2OQ0 A;  5M3F G;  1WCM G;  2N8N A;  1UE7 A;  3CCE A;  1S40 A;  1K3R A;  2ZM6 L;  1L2F A;  4DNI A;  3PV0 A;  3U4Z A;  2K5V A;  2KHI A;  3RLN A;  4DV3 Q;  4B3R L;  1VQC A;  1FL0 A;  3LGJ A;  1HR0 Q;  1WI5 A;  3OYY A;  4X66 Q;  1QZH A;  1IBM L;  4JI3 Q;  4QQB X;  1YZ6 A;  4JI0 L;  4WJ3 M;  1YHB A;  1AH9 A;  1V43 A;  3STB D;  1VQD A;  3S1R H;  4A76 A;  3TS0 A;  4UP8 A;  4BXX H;  4IO9 A;  4YWK A;  1N33 L;  1KXL A;  3G6E A;  3A5Z B;  2F52 A;  3S14 H;  4DAY B;  2DGY A;  3GTP H;  3D0F A;  4H02 A;  2I5M X;  1AE2 A;  2ZJR A;  3CME A;  4A3C G;  3GTK H;  3PIP A;  1N9W A;  1I5F A;  1G29 1;  3KF6 B;  4DR3 Q;  1VQK A;  2UXD L;  3GO5 A;  1U0L A;  2MO0 A;  5M5X H;  3TRE A;  3CCJ A;  3K80 C;  2ZJQ A;  1HZC A;  4XTC S;  4HID A;  1Q1E A;  3ER0 A;  4PZ8 A;  3A5U A;  2MO1 A;  2K75 A;  4A3K G;  2PNH A;  2R6G A;  1VQJ A;  2HHH L;  2UXB L;  1KD1 C;  1VQ6 A;  3AFQ A;  3M4Q A;  4J15 A;  4OX9 L;  4DV2 L;  4B3M L;  1S3O A;  3T1H Q;  5C3E H;  4LF4 Q;  3S2D H;  5GAD C;  2HT1 A;  1M1K C;  1C0A A;  3FP9 A;  2VY3 A;  3J80 i;  1I94 Q;  3W5O A;  2RF4 A;  4YCU A;  1PYB A;  1E7D A;  3PCO B;  4JI6 Q;  1EIF A;  1E22 A;  3CP0 A;  3UDX A;  5K36 G;  3HOU H;  4JYA Q;  2E8G A;  3E9I A;  1G51 A;  4C3I H;  4LF8 L;  4A3B G;  4JCV E;  2W51 A;  1E7L A;  2BH8 A;  4JI4 L;  1HNW L;  4YY3 L;  1FJG L;  1D8L A;  1QZG A;  5M3M H;  3STB C;  5FLM G;  4K0K Q;  4A4I A;  4JV5 L;  2N78 A;  2F4V Q;  4JOI A;  3F2C A;  3J81 c;  3PUX A;  4P75 A;  3CCS A;  2EQS A;  2HQL A;  3JC6 6;  4RMF A;  5JEA J;  5IYC H;  4HIK A;  1KC8 C;  1PH8 A;  4BXX G;  1VQB A;  4QL5 A;  3HOZ G;  2WAQ G;  2G80 A;  4A3E H;  3AEV A;  3PUY A;  2KEN A;  4LF9 L;  4BBS H;  5BR8 L;  1GL9 B;  4POG A;  4C2M H;  1L0W A;  3TEH B;  1CKO A;  4L5S A;  1LYL A;  3NEM A;  2AKW B;  5GAG C;  1NJI C;  2PMZ E;  3CCR A;  3BU2 A;  2RCN A;  1K8G A;  1Y1V H;  4DV4 Q;  4B3S Q;  4R1J A;  3I55 A;  3TRZ A;  4GKJ Q;  1G6P A;  4NXM L;  1I3Q H;  1BVS A;  1IBK Q;  3PO2 H;  3HOX H;  2R7Z H;  2IX0 A;  2ZTE A;  1HNZ L;  3J81 j;  3NEL A;  4OWX B;  5IP9 H;  1QUQ B;  4PZ6 A;  5LMU Q;  4DR4 L;  4BY7 H;  1L1O C;  4LFC L;  3HKZ G;  3S1Q H;  3G4S A;  1KRT A;  1HZB A;  1W3S A;  1VQP A;  2R7D A;  4IPG A;  4DK6 C;  3JAM i;  4GN5 A;  1Q1B A;  4R4T A;  5HY6 A;  2K50 A;  4LF5 L;  2MQH A;  2WP8 J;  4X62 Q;  1X3E A;  1YHQ A;  4JBM A;  1QVF A;  4DR7 Q;  1VQ5 A;  1JMC A;  4JI5 L;  3U50 C;  1H95 A;  4LNQ A;  1EOV A;  4LF6 L;  1L1O B;  4KHZ A;  2IHE A;  1XNR Q;  3M9B A;  4DV6 L;  4HJ9 A;  2UXC Q;  1YBY A;  4LWC A;  4QY7 A;  1VQ9 A;  3K0X A;  3IRB A;  2ZM6 Q;  4O2D A;  3Q8D A;  1Y02 A;  1X55 A;  3ULJ A;  2E2I H;  3HOW H;  1EN7 A;  3ZJY C;  5IYC G;  4B3R Q;  4C3H H;  2ODG C;  4JI0 Q;  4APV A;  2ZTC A;  2QNF A;  2E2H H;  4EX5 A;  4A3E G;  5ELO A;  2VNU D;  1N33 Q;  2AWN A;  4JBJ A;  2Y0S G;  1VQL A;  2Q2I A;  1C7Y A;  4R4C A;  4X64 L;  3OW2 A;  4HJA A;  1QUQ A;  2ODC I;  2R7F A;  4Y52 H;  3I7F A;  2QEX A;  2MPH A;  1QVG A;  1O7I A;  1VQF A;  5LMN Q;  3I4O A;  5IYD H;  4TVA B;  2UXD Q;  5FJ8 H;  1X3G A;  1J5E Q;  4OWW B;  1IXR A;  5GAE C;  5IYD G;  2D62 A;  2K14 A;  1EQQ A;  4C3J H;  4ALP A;  2HHH Q;  2ES2 A;  2UXB Q;  3FKI H;  1X6O A;  1H9E A;  2JEA I;  2UUA L;  4JYA L;  1UE5 A;  5C4X H;  2WB1 G;  5M5Y H;  5FLX c;  3H15 A;  1TWF H;  3EN2 A;  3U58 A;  4B3M Q;  3EBE A;  4HJ7 A;  1L1O A;  1BBU A;  4BA1 I;  2VUM G;  4DV0 L;  1E1O A;  4DR1 L;  1YI2 A;  4DUY Q;  4X65 L;  1YJW A;  3NEN A;  4QGU A;  3CPF A;  2JQO A;  4GNX C;  5DLQ E;  5GAH C;  2JA7 G;  4B3T Q;  1JT8 A;  1VQ4 A;  1GO3 E;  4PMW A;  5GQO A;  2OQK A;  1JJC B;  3EIV A;  3PUZ A;  4OO1 I;  2OTL A;  1JEI A;  2B29 A;  3ULP A;  4JI4 Q;  2QNC A;  2I0Q A;  1A8V A;  1N34 Q;  1PH7 A;  5J3B A;  4A3J H;  3K7A H;  1PA6 A;  4A3G H;  1EUJ A;  1OXX K;  4DV7 L;  4JV5 Q;  1A62 A;  2A19 A;  5ELN A;  1YIT A;  1PV4 A;  4JI1 L;  1VQM A;  4AYB G;  3M3Y H;  1Y1W G;  4GNX B;  1XMQ Q;  3GD7 A;  3UDF A;  2BH2 A;  3ICE A;  3KFU A;  2CKZ B;  4BA2 I;  1VQN A;  3S1M H;  2PQA A;  3J7Z C;  2I5H A;  4JI8 L;  3KOJ A;  4DV1 L;  2JA5 G;  3WWV A;  1XJV A;  1FVI A;  1Q8K A;  1VS0 A;  2VZA A;  1Q81 C;  4HJ8 A;  2HJQ A;  2IHF A;  4DR5 L;  4JI2 L;  1VQI A;  4JBK A;  3HKS A;  5H1S E;  1XNQ Q;  4KLK A;  4R4I A;  4WJ4 A;  4LFB L;  3AQQ A;  1YJ9 A;  2JA8 G;  4IFD G;  1X3F A;  5IE8 A;  1K0R A;  1T9H A;  1HNZ Q;  2EIF A;  4YCV A;  3RLF A;  5AJ3 L;  4GN3 B;  4GN4 B;  4DR4 Q;  4LFC Q;  4XIG S;  3FKI G;  1YVC A;  1CKN B;  4OWT B;  3D31 A;  2NZO A;  2DUD A;  1CKM A;  3NBH B;  3PO3 H;  2E2J H;  1GD7 A;  4JI7 L;  1BBW A;  3GTJ H;  1SR3 A;  2KBN A;  4FDB A;  3GDE A;  3VDY A;  1N32 Q;  3E9H A;  3CD6 A;  1GJJ A;  2KHJ A;  1HZA A;  2NVY H;  4JI3 L;  4GLX A;  4LF6 Q;  2WB1 E;  3KDF B;  3CXC A;  2UU9 L;  4KHP Q;  4YHH L;  2IY5 B;  2Z0S A;  3CMA A;  4GNX A;  5IWA L;  2E5L Q;  4A3J G;  4A3D H;  1SMX A;  5IY0 A;  2AWO A;  3J81 i;  3HOY H;  5IP7 H;  4DR6 Q;  3B6Y A;  3PF4 A;  4LFA L;  2IT1 A;  2IX1 A;  3TQY A;  2VQE Q;  4GLA C;  4GKK Q;  3AFP A;  1U5K A;  1R9T H;  1B70 B;  4A3M H;  1LTL A;  3KYH C;  2K5H A;  1SFO H;  2HIV A;  4X64 Q;  4POF A;  4A93 H;  4A75 A;  1PH6 A;  5C3E G;  3RNU A;  1SN8 A;  2OTJ A;  3RN5 A;  4YCW A;  1CKN A;  4GLV B;  4AYB E;  2LSS A;  3UE1 A;  2LXK A;  2HIX A;  2NN6 G;  3M85 A;  3I4M H;  2KCM A;  1EIY B;  2UUB Q;  2FXQ A;  3K81 C;  3T1H L;  5JJL A;  3PUV A;  3CF5 A;  3H3V I;  4A3L H;  3HOU G;  1N36 Q;  2OWO A;  2K52 A;  1XPR A;  1I94 L;  2VQF L;  4L5R C;  5M3M G;  2XGT A;  1C9O A;  1X56 A;  4YWL A;  4BBR H;  3CCM A;  3S16 H;  1WOC A;  5C4J H;  4DUZ L;  1K73 C;  1MJE A;  3M7N A;  1YJN A;  3KDF A;  3HOV H;  3TS2 A;  2YU9 H;  4DV0 Q;  3OTO L;  3ULL A;  4P72 A;  1PFS A;  1LUZ A;  1Q7Y C;  1XTD A;  2ALY B;  1IBM Q;  1UWV A;  2JE6 I;  3PF5 A;  3F2D A;  2UUC L;  4O0A A;  3M4O H;  2KFV A;  4HIM A;  2YTV A;  1HH2 P;  4BBS G;  1GKH A;  2MNA A;  1PH9 A;  1VQ8 A;  1IL2 A;  3GTL H;  1IYJ B;  4A3F H;  4UY8 C;  1E24 A;  1Y1V G;  4DUZ Q;  2B63 H;  4DV5 L;  2F3I A;  1HNX L;  1KRS A;  3F2B A;  1M90 C;  1IBL L;  3FHW A;  5IP7 G;  3HOY G;  5C0X G;  3HOX G;  2CWP A;  2R7Z G;  1W2B A;  3HFZ B;  1CSP A;  3U4V A;  2PQA B;  3PO2 G;  4JBW A;  4A3I H;  4X6A H;  2WAQ E;  2K5N A;  1PH3 A;  4JI1 Q;  1WJJ A;  1YEZ A;  3W1B A;  5IP9 G;  4DV4 L;  2ZTD A;  4BY7 G;  2R92 H;  1KL9 A;  1EQR A;  4A3C H;  2B3G A;  4GKJ L;  4A3M G;  4LF7 L;  1V9P A;  1IBK L;  1D7Q A;  5EAY A;  1H9F A;  5E7N A;  4HJ5 A;  5HGQ A;  4L5T A;  4AH6 A;  1XMO L;  4A93 G;  1ZS9 A;  1TWC H;  1RL2 A;  1NTG A;  1WFQ A;  4OX9 Q;  4DV2 Q;  2Q2U A;  1PVO A;  5JJI A;  3PGZ A;  2ZJP A;  4A3K H;  1JJ2 A;  4LFB Q;  3T1Y L;  1TXY A;  1MJC A;  2NZH A;  1GKU B;  4LUV A;  3CCQ A;  2DK4 A;  1YNX A;  4A3L G;  1LM0 A;  4NXN L;  3HKZ E;  1NBW A;  2NVX H;  4MNO A;  2YV5 A;  1B8A A;  3L2P A;  1P8L A;  1SRO A;  4PZ7 A;  4UP9 A;  1PH5 A;  3GTQ H;  4DR7 L;  4DR2 L;  5GRO A;  4LF8 Q;  3BJU A;  3J7A 5;  4BBR G;  4JG2 A;  3RZD H;  1HNW Q;  2GVA A;  4YY3 Q;  2WFW A;  4IPD A;  1PHJ A;  1FJG Q;  2VS1 A;  1WYD A;  4HIO A;  3HOV G;  4QIW E;  3UDI A;  2R93 H;  4DKA C;  1Y14 B;  3CW2 C;  1A63 A;  2GN5 A;  4P74 A;  4IPC A;  4AQY L;  3HOW G;  4IOA A;  1SE8 A;  2V1C C;  2PI2 A;  2UXC L;  5LMN W;  1NY4 A;  1AE3 A;  1TWG H;  3A0J A;  2EXD A;  5FLM H;  2JEB I;  4OXP A;  1JB7 A;  3CC4 A;  2Q2H A;  4R4O A;  3SGI A;  1YIJ A;  4LF9 Q;  2UU9 Q;  4LW1 A;  5BR8 Q;  2JK8 A;  5M5W H;  2NN6 I;  4QJF A;  1GVP A;  4YHH Q;  4A3F G;  2B63 G;  3DLL A;  1X65 A;  5IWA Q;  2BA1 A;  2GVB A;  2RHS B;  3HOZ H;  3K7U C;  5JJK A;  1VQH A;  4GS3 A;  2CCZ A;  4A3I G;  4R4Q A;  5FJ8 G;  4NXM Q;  2RHQ B;  1HR0 W;  1VQE A;  4YWM A;  1FGU A;  3I2Z A;  3UE0 A;  4LFA Q;  2R92 G;  4PG3 A;  2Y0S E;  1UEB A;  5LMN L;  1CUK A;  1OXS C;  1KIX A;  1PH2 A;  1ASZ A;  3J80 c;  4IFD J;  3L0O A;  2NVT H;  3K8A A;  1J5E L;  5C4X G;  2MFI A;  3F1Z A;  4IJL A;  4GOP C;  3GTO H;  4LF5 Q;  1CSQ A;  1E7Z A;  2Z6K C;  5IYB H;  1RIP A;  3CPW A;  4JI5 Q;  5C44 H;  1Q82 C;  1OXU A;  4RG1 A;  4DV3 L;  1X54 A;  3S17 H;  2CWA A;  2YTX A;  1HR0 L;  4DUY L;  3UDG A;  4X66 L;  4OON A;  3S15 H;  5C0X I;  4ME3 A;  2VQF Q;  1I6H H;  1BKB A;  4DV6 Q;  1PH4 A;  2R93 G;  4B3T L;  1MIU A;  4A3G G;  3KF8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...