1A8VA

Structure of the rna-binding domain of the rho transcription terminator
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
120
structure length
115
Chain Sequence
GHMNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSAAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION TERMINATION FACTOR RHO
publication title The structural basis for terminator recognition by the Rho transcription termination factor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription termination
total genus 29
structure length 115
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07498 Rho_N Rho termination factor, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.10 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 1a8vA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1a8vA02
1X3EA 4O0AA 4UP8A 4DR2L 4HJ7A 1KD1C 3CC7A 1O7IA 4MNOA 3EIVA 1N32Q 1YZ6A 2ZJPA 4A3GH 1E1TA 1A8VA 2KCTA 2MFIA 4JOIC 1VQAA 1IYJB 2OQKA 4GS3A 3PO3H 4A3EG 1HNZQ 3AFPA 2K5HA 2B29A 1Q46A 1YI2A 3H3VH 1KRSA 4A3JH 4DR7Q 1K9MC 3CQZH 2PI2A 3PV0A 2Y0SE 3H15A 3HKZG 2R93G 1X9NA 1XJVA 1GM5A 5GAEC 2B63G 1CKNA 1TWCH 5DLQE 1UWVA 5C3EH 2E5LQ 2JEAI 5AJ3L 1W2BA 1IZ6A 2L15A 2PNHA 4NPSA 2IX1A 4K0KL 1CKMA 1XPOA 4JG2A 3RLFA 4EQ5A 4JI7L 1EWIA 3SGIA 4HJAA 2CFMA 3CF5A 3EBEA 3HOVG 1L0WA 4C3IH 1VQJA 4A3MH 2AKWB 3TEHB 1X56A 1YEZA 1N34Q 1FJGL 3U4VA 1S72A 5M5YH 1VQOA 4R4CA 4OONA 1UE7A 3I55A 1E7LA 1IBLL 3NEMA 1TWAH 2RHQB 1M90C 1KL9A 4AYBG 2BH8A 3CCSA 1S3OA 4BBSH 4OWTB 1TWGH 2EIFA 2I5HA 4GNXA 4X65L 3PF5A 2UUAQ 4Y7NH 1I3QH 3I4MH 3PUZA 5LMNL 4A3GG 4A3CH 4IOAA 4L5TA 2OWOA 1V9PA 4HIMA 1UE6A 2Z6KC 2K75A 4GN4B 3CCMA 4DV5L 1OXTA 1XMQL 4DAMA 2Q2UA 3U58A 4NXML 4GLVB 1B70B 4YY3Q 1G291 3CC2A 2AWNA 4A93H 4DR4Q 1XMOL 2IY5B 3RZOH 3CCRA 4LF5Q 3K8AA 1VQEA 1BBWA 4JI4Q 3TS2A 5ELNA 1B8AA 1PYBA 4LNQA 3PUYA 2UUBL 3CAMA 3GTMH 1VQHA 1PFSA 4DR3Q 3M4QA 5IYBG 3CXCA 3KFUA 1HNXQ 3GTQH 5K36G 3HOZG 2BA1A 1OTCA 4A3LG 4LFAL 3KF6A 5IY0A 3CCQA 2MO0A 3MXNB 3HOWH 1IBKL 4X6AH 3I7FA 3HOUG 4DV6Q 1AE3A 4NXNQ 4A4IA 4JC0A 3HOYH 2K4KA 3RNUA 4JI5Q 3ICEA 4IO9A 5C44H 1EQQA 4IPHA 3L0OA 1BBUA 4DR5L 1X3GA 1HNWQ 2QA4A 2KHJA 3GD7A 5JEAJ 4R4QA 4JI0L 3G6EA 1X65A 5BR8L 2VW9A 4GKJL 3F8TA 2IHFA 2OTJA 4DR1Q 4DV3L 3T1HQ 5JJKA 2B63H 1Y1WG 5LMUL 4DV4L 4IFDJ 4YWKA 3FKIG 1C7YA 2WP8J 1WFQA 1ASYA 2OQ0A 3TRZA 4OO1G 1HH2P 4IJLA 4KHPL 4JI2Q 3U50C 1VQ7A 1NY4A 4X66Q 3MEFA 4LF8Q 4LFCL 2B3GA 3E9IA 3HOVH 1PV4A 2CQOA 2VL6A 3PCOB 4LF9L 3JAMi 4YHHQ 1XNQQ 3S17H 4DV0Q 1VQBA 1XNRQ 2UXBQ 4YWLA 3ZJYC 3PIOA 2NVQH 1PH9A 4C2MH 4QY7A 2K52A 1JB7A 3M3YH 3A74A 3J80i 2VNUD 5C0XI 1TWHH 3CPFA 3UDXA 4A3IG 2ZTDA 3PGZA 4HJ8A 4B3SL 2Q2IA 3M85A 4DUYL 4QIWE 3PUWA 3PO3G 1U0LA 4R4TA 4JBKA 1K73C 3BU2A 4DV7Q 1SFOH 2LSSA 2ZTEA 1N36Q 3LGJA 2CKZB 3G71A 1PA6A 2VZAA 3J81c 5FJ8H 4QGUA 4DUZQ 5HGQA 2HHHL 3S2HH 2K14A 3HFZB 2Y0SG 4R1JA 1NTGA 1QZGA 1N33L 1R9TH 3H3VI 5JEAG 1PH3A 2R92G 1OXSC 4AQYL 4DV2L 1Z47A 1HR0Q 2JEBI 3HOZH 1EIYB 2ZJQA 4DPGA 2MQHA 2VY3A 1JJ2A 1FGUA 4BY1H 4OX9Q 3HOUH 1LTLA 3PIPA 2R7ZG 4IFDG 5IYCG 3RLOA 4DAYB 5FLXc 3AEVA 4APVA 2XGTA 3S15H 1V1QA 1E24A 3K81C 3L2PA 1EUJA 4IOCA 1EYGA 1HZCA 4P72A 5C4XH 3OTOQ 3OW2A 1VQPA 4JI6L 2HQLA 4JI8Q 3M7NA 2MO1A 1X3FA 1FL0A 1WOCA 4GN5A 4P71A 4BBRG 1K8AC 4A3KH 4LW1A 4QJFA 3KJOA 3KDFB 1CSQA 4KLKA 4L5SA 1X6OA 2PQAB 1PVOA 2EXDA 4JI1Q 3CCUA 3M4OH 4GKKL 4YCWA 2NN6G 4IPDA 4LF6Q 4L5QA 2WB1E 3FHWA 4LF4Q 5IP9H 5IP7G 1C0AA 4LFBQ 4B3RQ 1J5EL 3NELA 5GQOA 2UU9L 3K80C 3HOXH 4UP9A 5E7NA 4A76A 1YVCA 3D0FA 1JT8A 1WCMH 4KHZA 4LWCA 3S1NH 1X55A 4DR2Q 4NB3A 5JJIA 3M9BA 4HIDA 3PO2G 5IYDG 3UE0A 1L1OC 4A3IH 4WJ3M 3AFQA 2PI2E 4JI3L 2Q2HA 2VUMH 1DGSA 2YTYA 2CCZA 2VQEL 5M3FH 1YJ9A 4POGA 4UY8C 2I0QA 1VQNA 2ATWA 1NMFA 2F52A 4POFA 1NBWA 4GNXC 4A3FG 1HNXL 1Q1EA 3S2DH 4BXXG 3H0GG 4BA1I 4P73A 3CCVA 3NENA 4GOPA 3T1YL 1VQMA 4A75A 2F4VL 2NVXH 4JBJA 5GROA 1PH2A 4JI5L 3UE1A 2YU9H 2R6GA 3K0XA 1QZHA 2AHOB 1Q8KA 5M5XH 1OXUA 5AJ3Q 4K0KQ 3UDGA 3I2ZA 2H5XA 3Q8DA 2D0OA 3G48A 2Z6KA 4JI7Q 2R7ZH 2D0PA 1I94L 3S16H 4DR6L 1C9OA 1PH6A 2E2JH 1UEBA 1E1OA 1SRUA 3GDEA 1FJGQ 3KJPA 3TS0A 3K7UC 4A3EH 4P74A 1IBLQ 2JA8G 3GTKH 1QVGA 2UXCL 1AH9A 4A3BG 4MZ9A 2N78A 2QNFA 2HIVA 3ULPA 1VQGA 1WI5A 2RF4A 5M3MG 4X65Q 2E2HH 5LMNQ 4LF7L 3CD6A 3GTLH 4A3DG 3F2BA 2R93H 4JCVE 3PF4A 2QEXA 5J3BA 4DV5Q 1Y1VG 2KENA 4NXMQ 3CCLA 2UXBL 3F1ZA 4LUZA 3TQYA 1D7QA 3GTPH 1XMOQ 3IRBA 1MJCA 2R7FA 4B3TL 2C35B 4TQUS 1GKHA 2KCMA 1VQ4A 3A0JA 3KDFA 1WJJA 1NMGA 1UE5A 4OWXB 3STBD 2A1AA 1SR3A 4IPGA 4YCUA 2PQAA 1G51A 3U4ZA 2JA5G 2K5VA 1PHJA 2UUBQ 3FP9A 4O2DA 2UXDL 1IBML 3GTGH 1YNXA 5IWAL 3ULJA 4BA2I 4EX5A 1CKNB 3HKSA 4GLAC 2VQFL 1K8GA 2IX0A 2WAQE 1N9WA 1QVFA 4DV1Q 4HIKA 1VQIA 2K50A 5IYDH 1CSPA 2YYZA 3CW2C 1IBKQ 1VQLA 3S24A 3RZDH 2ZM6L 2JA6G 1YIJA 1JJCB 4DNIA 3J7A5 4BY7H 1VQ9A 3CPWA 4JYAL 3CP0A 1VQDA 2ZJRA 2UUCL 5IE8A 2N49A 5C3EG 1L1OB 1A63A 1K3RA 3WWVA 4DR5Q 2LXJA 1SROA 1Q86C 1TXYA 4MTNA 1BVSA 4JI0Q 1E7DA 5BR8Q 2YV5A 1N32L 1KXLA 4GKJQ 4GNXB 5ELOA 1MIUA 3M4PA 4DK6C 2IHEA 4DV4Q 5M5WH 1J6QA 4PZ6A 1Y14B 3OTOL 2CWPA 4X62Q 2CWAA 5IYBH 3DLLA 3RN5A 1KHIA 1HNZL 1VQ8A 4B3MQ 4DR7L 1XPUA 1YHBA 2AWOA 2PMZE 4A3LH 2WB1G 4BBSG 1VQKA 1EQRA 3PUXA 3TREA 4LFCQ 3ERSX 2HT1A 1EIFA 1PYSB 2Q2TA 4L5RC 4LF9Q 1ASZA 3W1BA 2GN5A 1XTDA 2A8VA 3E0EA 4OWWB 3S1MH 2NVYH 1Q1BA 5IT9c 1HR0W 4JI1L 4OO1I 4A93G 3JAMc 1EN7A 2V1CC 2E5LL 4LF6L 4A3BH 4RMFA 1VS0A 4B3RL 4B3SQ 3KF6B 3I4OA 2NZHA 5M3MH 3J80c 4DUYQ 1PH8A 2QGQA 2I5LX 3DM3A 3UDFA 4DK3C 1N34L 4YCVA 1Y1WH 3CMAA 2ZTCA 1MJEA 1OXXK 1OXVA 3FKIH 3RN2A 2HHHQ 1L2FA 3KF8B 1JE5A 4JOIA 1HZ9A 3HOWG 1YHQA 1K83H 3BJUA 2NVTH 1T9HA 5GAHC 3HOYG 1GD7A 1VQ5A 3ER0A 2JA5H 1N33Q 2UUAL 1SN8A 1TWFH 4JV5Q 1CUKA 4XIGS 4AQYQ 2E8GA 5H1SE 5C44G 1LM0A 2JJQA 4FDBA 4DV2Q 5C0XJ 1EFWA 4YY3L 2A19A 2JE6I 4DR4L 4QQBX 1KQSA 1YJNA 4Y52H 3CMEA 2I5MX 2JA6H 4LF5L 4JI4L 5FLMG 2HJQA 4R4IA 3AYHB 1W3SA 1MKHA 2N8NA 4PMWA 1Q82C 4GLXA 1VCIA 4DR3L 1PH5A 4JI6Q 2D62A 1LUZA 4IFDI 1CKOA 3STBC 1I5FA 2XTIA 2Z0SA 5C4JH 2OCEA 4HJ5A 1M1KC 1V43A 2ASBA 2JA7G 1IL2A 1JJGA 2EQSA 1QUQB 2ID0A 2R7DA 1Q12A 4DV6L 4NXNL 4HJ9A 1HJPA 1KC8C 2FXQA 4GOPC 4QL5A 1L1OA 1RL2A 4RG1A 4GKKQ 2R92H 1Z9FA 2AMCB 4DKAC 1LYLA 1SE8A 3PSIA 4KI0A 1N8RC 3NBHB 1YITA 3W1GA 3HKZE 4C3JH 1J5EQ 1I6HH 1HNWL 4LUVA 2UU9Q 3E9HA 5GAGC 4BY7G 4ME3A 1RIPA 4IPCA 5IYCH 4IJHA 2IT1A 1H95A 2NN6I 4DR1L 2JK8A 3T1HL 3GTOH 3F2DA 5FJ8G 2VS1A 2YTVA 3RLNA 4LUOA 1K0RA 2WAQG 4H02A 2ES2A 2DUDA 4R4OA 3AQQA 4JI3Q 1YBYA 2K5NA 4JI2L 2VQEQ 4X66L 4BBRH 5C0XG 1X54A 4LF8L 3ULLA 2BA0A 2LXKA 5EAYA 3I4NG 2YTXA 4YHHL 2RCNA 1XNQL 5HY6A 4DV0L 1XMQQ 2KHIA 1XNRL 1G6PA 1A0IA 4DV1L 3GTJH 1B7YB 1GO3E 4AYBE 3F2CA 3T1YQ 4BY1G 3K7AH 3GO5A 5LMNW 5IP7H 2F4VQ 3D31A 3OYYA 4HIOA 1KAWA 4XTCS 4OXPA 1FVIA 1XPRA 4UP7A 2GVAA 3J81i 3VDYA 1IXRA 2WFWA 1PH7A 4AH6A 4X64L 4GN3B 5C4XG 4DV7L 2RHSB 3J81j 1N36L 1VQFA 3BZKA 5GADC 4A3JG 1PH4A 3BZCA 1I94Q 4DUZL 4JBWA 4LFAQ 3PO2H 4DR6Q 2F3IA 1S40A 4A3KG 1P8LA 4PZ7A 2N3SA 1KIXA 5FLMH 1YJWA 3J7ZC 3A5UA 3EN2A 3KOJA 2UXCQ 4X62L 1NJIC 2NZOA 4A3FH 4B3ML 4BXXH 2ALYB 1A62A 4PZ8A 5IP9G 1HR0L 3H0GH 1P16A 2JA7H 3JC66 2OTLA 1Q81C 4LF7Q 4JBMA 3KLWA 3HOXG 4OX9L 3CCJA 1HZAA 3UDIA 4A3MG 1WCMG 3W5OA 4DV3Q 1U5KA 4YWMA 5LMUQ 1VQCA 3L7ZC 2KBNA 1AE2A 4JI8L 2JQOA 4B3TQ 1QUQA 5JJLA 2VUMG 4GOPB 1SMXA 4X64Q 1SLJA 4AIMA 4KHPQ 5M3FG 1VQ6A 3I4MG 2UXDQ 2QNCA 3I56A 3S14H 2MNAA 1E22A 2JA9A 1NE3A 3A5ZB 1IBMQ 5IWAQ 4P75A 4ALPA 2BH2A 4A3CG 1JMCA 1HZBA 1E7ZA 1YHAA 2VQFQ 1QVCA 1Q7YC 1KRTA 4J15A 4PG3A 2JA8H 2DGYA 1EOVA 4C3HH 4TVAB 4LF4L 2ZM6Q 1E3PA 1I50H 2HIXA 2E2IH 4LFBL 3CCEA 3KYHC 3S1QH 1D8LA 2GVBA 3S1RH 4WJ4A 3RR5A 4JYAQ 3PUVA 4A3DH 1GVPA 2UUCQ 4JV5L 1WYDA 3B6YA 1PH1A 3I4NH 1UE1A 3G4SA 4UPAA 1BKBA 1Y1VH 3CC4A
chains in the Genus database with same CATH superfamily
4UP8A 4RKBA 1O7IA 2C9OA 1CHQD 1R9TB 2KCTA 5FO7B 4DGZA 4FF4A 1S5ED 3AFPA 4A3JH 1K9MC 1JEQA 3CQZH 3PV0A 1WTWA 1EY6A 2FJ2A 1X9NA 1CZWA 3S15B 1PRTF 3BYYB 2J7ZA 4ZQ3A 3J81E 1BF4A 1EY7A 5AJ3L 4K0KL 1UUPA 3H09A 2IX1A 1EWCA 4KY7A 2RNOA 1XPOA 4JI7L 3NBIA 4HJAA 2EYLA 1CT1D 1JJRA 1F2MA 1SNDA 4CKCA 1E7LA 3V05A 2XRSD 5IGGA 1KL9A 3VR4A 4OWTB 1TWGH 4BY7G 5J1ZA 4X65L 3T56B 3VR6A 2Z1CA 4HIMA 2Q2UA 2K75A 4DV5L 3X3MA 1U4PA 5IGBA 1XMQL 2IPKD 1G291 1LT4D 4DAPA 4A93H 1STEA 2MJ8A 2F0UA 4JI4Q 5M3FB 2KHSA 2B2UA 2R3ZA 1KAAA 1G2TA 1PFSA 3M4QA 4J6HA 3S2DB 2E74C 1HNXQ 3BVGA 1BCPF 1OTCA 3KF6A 3I90A 4KHVA 1IBKL 1X32A 1Z7TA 4KD3A 1JB3A 4A4IA 1ML0D 1VMCA 2K4KA 4JI5Q 1GUGA 1IW7D 5C44H 4WJWA 2O5IC 4WORA 4IUUA 1X65A 3G6EA 2CVRA 2VW9A 3DHQA 1F9QA 3GTKB 2AQ2B 1Y1WG 2G9HD 4IN3A 3RMHA 1C7YA 1WFQA 2OQ0A 4OO1G 2E2HB 4X66Q 3HOVH 1PV4A 5JJZA 4YHHQ 1VQBA 3FPPA 4YWLA 2XVSA 3OWEB 5EBDA 1PH9A 1JB7A 2K52A 3M3YH 3Q6SA 1BO0A 4UDUC 2ENBA 3PUWA 4R4TA 3BU2A 2LSSA 3LGJA 1MSHA 5FJ8H 2EJMA 2DY7A 4I65A 1PFMA 3L3OC 1CI3M 4BY7B 4JK1C 1NTGA 1K28A 5C0XH 5JVH3 1R9TH 2V4DA 1O80A 5CBAE 3SEBA 1T5EA 5K36H 3MWYW 4AQYL 1Z47A 2JEBI 1PZKD 3IL8A 4DPGA 2MQHA 1LTLA 5IYCG 3AEVA 2ICEC 1PTOC 5M5WB 2FMCA 1V1QA 3S15H 4CDFC 1HA6A 1SYCA 1EZ6A 2LFNA 3MFYA 3OTOQ 3OW2A 1EYGA 4K5WA 4JI6L 4IUTA 2A69D 1WOCA 4GN5A 4ZAIA 4LAAA 1CTMA 3KDFB 1YNNC 1DOKA 4L5SA 1X6OA 5IGFA 1PVOA 1ET6A 4KKSA 1SJED 4GKKL 1GJJA 4Q5VA 2TSSA 5IP7G 5M3MB 3K80C 1TIID 5E7NA 1LTID 4A76A 1YVCA 1JT8A 1Y1WB 4IUNA 4LWCA 1SE4A 2XSCA 3MAQA 3D6WA 3MXUA 1EU4A 1K83B 3OOCA 1ICWA 3I4LA 1L1OC 1EOTA 2PI2E 2BE5D 1BUVT 5M3FH 1PRTD 2KQ3A 3JAME 1PZJD 3S2DH 2JA6B 3OHXC 3CCVA 4GOPA 2IX3A 5JPNC 4RHSA 2AHOB 1Q8KA 4H0LC 4F8MA 3DWAA 1D5XC 3G48A 4JVZA 4DR6L 1C9OA 2RBMA 4FXKC 1FJGQ 3KJPA 2SNMA 1WTXA 2F0VA 3K7UC 1IBLQ 3GTKH 1AH9A 2WB1B 5I9OA 3TMEA 3FEWX 1GHJA 1PTOB 3ULPA 2NBFA 2RF4A 5FLXL 2E2HH 3CD6A 1HHVA 4JCVE 3K58A 2QEXA 5J3BA 3GTOB 1R4PB 4ABNA 4DA2A 1XMOQ 4RH6A 2R7FA 2F1MA 1QCBD 2KCMA 4A3GG 1S5CD 4X64L 2JA5G 2A1AA 1XPUA 1QWYA 2EE1A 2PQAA 3U4ZA 4OEMB 1IBML 3ULJA 3GTJB 4DV1Q 1VQIA 3H3VC 3CW2C 1DCZA 1YIJA 1PDQA 4BY7H 3MHBA 4JYAL 1SMYD 3FPUB 1B3AA 5IE8A 1O7LA 1LT5D 1A63A 1L1OB 2F0GA 3EJIA 4DR5Q 1TXYA 4MTNA 1MD2D 3BDLA 2YV5A 2N55A 1MIUA 3M4PA 3P75A 5M5WH 4RGMA 2JA7B 2WINB 4NP5A 2IL8A 2PMZE 3FRPB 1EQRA 4LFCQ 3ERSX 1PYSB 1CHPD 1H9RA 3QOLA 2Z4IA 3DWQA 5CBEE 1ASZA 2GN5A 2A8VA 5IT9c 4JI1L 2B2YA 2TMPA 4LF6L 1VS0A 4O42A 3MA2B 3KF6B 5M3MH 3S14B 2OXPA 3J80c 4DUYQ 1K8MA 2RSOA 3GV3A 3TBIB 1H9JA 4YCVA 1Y1WH 2B2VC 2ZTCA 1OXXK 1J8IA 1OXVA 3KF8B 1HZ9A 3HOWG 1K83H 4CHTB 3S1QB 4OO1H 1GD7A 3ER0A 3I4NB 1YNSA 4NMZA 4HR7B 1JEIA 4XIGS 1JR0D 2VXWA 1EFWA 2OT2A 2BDNA 2JA6H 4A3GB 4JI4L 3A7LA 3SK5A 5DAUA 3L9AX 4R4IA 2PO4A 2KOLA 2XWJB 2RNNA 1PTOF 5I9PA 3T13A 3STBC 2ASBA 1BXTA 3I91A 1H9EA 2EQSA 2ID0A 1TWCB 1MSGA 1GUNA 4GOPC 1RL2A 2CW0C 4K2KA 2JYOA 2JVWA 1VF7A 1N8RC 1YITA 2UU9Q 3E9HA 1PTOH 1RIPA 5IYCH 4NDXA 2IT1A 1GKUB 1H95A 2NN6I 2JK8A 5C5MA 2WV6D 3GTOH 2RVLA 4JI3Q 1SNOA 2RQXA 4X66L 1X54A 1E0BA 3ULLA 2QF7A 4YHHL 1ILPA 1XMQQ 1EL0A 3GTJH 3RZOB 2PW5A 4AYBE 3QO2A 3T1YQ 3GO5A 5IP7H 2RA4A 3WDNA 1KAWA 3GTMB 1SNPA 3HG9A 5CV5A 1FVIA 1XPRA 2GVAA 1IXRA 2WFWA 3GTQB 4GN3B 2KVMA 3BZKA 4X3KA 4A3JG 3HOWB 1B1ZA 2A68C 4ZYSA 4OHJA 1S40A 1S5FD 4H13C 4GZYC 3PQIA 3SK6A 4X62L 1NJIC 2NZOA 4KTAA 1RKNA 2Z6BA 1P16A 2JA7H 1WTRA 5CV9A 4LF7Q 1KLGD 3KLWA 3NSWA 1GL9B 2QCPX 2B63B 3NPPA 1WCMG 2FFKB 4E6IA 1HTLD 3RD4A 1QNUA 1DD2A 5CV8A 3K6OA 2KEEA 2BDOA 4B3TQ 2LMCB 5EKIA 2KCNA 4GOPB 2Q8TA 4FNFA 2QNCA 3S14H 2WQGA 3S17B 2RCFA 5IWAQ 2BH2A 2KJXA 1HZBA 1JMCA 1E7ZA 1YHAA 2NVQB 1JORA 1QVCA 3R8BA 2F0EA 2DGYA 4DU9A 2EDGA 4TVAB 3A54A 4LK1C 1DXMA 3KYHC 3S1QH 4WJ4A 2AUJD 4R8IA 4N9TA 3I4NH 2DK4A 5CV4A 3G4SA 4UPAA 3OWFA 2Q8IB 2PQEA 4HJ7A 3NQTA 1KD1C 3CC7A 2F3WA 2EOTA 3DWPA 2ZJPA 5CC4A 4K5VA 4A3GH 1LLRD 1E1TA 1A8VA 2F0JA 2MFIA 1VQAA 2OQKA 1JWUD 1NAPA 3HOZB 2K5HA 1YI2A 4ZKBB 3H3VH 2NTSA 2PI2A 2Y0SE 4HMIA 3H15A 3HKZG 1EYDA 3A8KE 4L6TB 1XJVA 1GM5A 5GAEC 4UZWA 1TWCH 1UWVA 3MZ5A 1D5MC 2E5LQ 2EYFA 2JEAI 1QE6A 1W2BA 1IZ6A 5BN4A 2G80A 1EWIA 2CFMA 3CF5A 3HOVG 1VQJA 4BITA 1STBA 1YEZA 2PYKA 1FJGL 3M4OB 4R4CA 1XYIA 4OONA 2N88A 1IBLL 1FNWA 1M90C 2BH8A 3GP7A 1S3OA 3CCSA 2EIFA 2I5HA 1L0XB 3I4MH 1WCMB 1UEAB 5ELCA 4A3CH 3TP8A 3VA5A 3S1NB 4GN4B 1ZBHA 2IW3A 1PTOD 5DM73 2NWGA 4YY3Q 4DR4Q 4A3IB 1XMOL 4EQOA 3HZXA 3J7AF 3RZOH 3CCRA 1A15A 1CZGA 2DY8A 1HRJA 3TS2A 5ELNA 4X3SA 4LNQA 1EQTA 2G9DA 3GTMH 5ISRA 2LD7A 2X6LA 3CXCA 4KN4C 5JPMC 3GTQH 3ND8A 5K36G 3CCQA 3HOWH 4F7XA 3I7FA 2YU9B 4NXNQ 2F0NA 2WKDA 2QDLA 4ODGA 4IO9A 4X3UA 1EQQA 5ELFA 3S16B 3NHHA 4FP5D 4DR5L 1X3GA 2E2JB 3A55A 1HNWQ 3J7AV 1HUMA 4KMUC 3P20A 2OTJA 3F8TA 4DR1Q 4BWGB 2B63H 3FKIG 2WP8J 3N52A 3GTLB 1HH2P 1STNA 3HKZB 4JI2Q 2HCIA 3NWTA 4LF8Q 4LFCL 2B3GA 2VL6A 3S17H 4DV0Q 4H7BA 1Q8IA 4KJNA 2NVQH 4DNRB 1S4ZA 3A74A 4K8JA 3UDXA 5DEHA 3VR2A 2Q2IA 4DUYL 4UHVA 3PO3G 2EY1A 1K73C 1TQOA 4RFBA 4N9PA 4DUZQ 4XYQA 2K14A 3T16A 2SEBD 4KK7A 3H3VI 1KDBA 3BG3A 1QG7A 2R92G 2JSOA 3QR8A 1OXSC 4HCSA 2KUMA 3NTHA 3HOZH 1HCZA 2ZJQA 2A5HA 1EEFD 1H9SA 1TS5A 1FGUA 3PIPA 3RLOA 4APVA 1EYAA 1W6JA 3LWUA 1I6VC 1EUJA 4IOCA 3U9SA 2HQLA 2M9VA 4ILWA 1EU3A 2EYPA 4RGTA 3M7NA 1X3FA 2HCCA 3E0JA 1FL0A 3MEHA 1SE3A 5E3FA 1K8AC 3F2UA 4LW1A 4QJFA 1I4PA 2AQ1B 2NVYB 4KLKA 1SYGA 1JQYD 4S3SA 4JI1Q 3CCUA 3M4OH 1KNEA 4YCWA 2NN6G 3V96A 4LF6Q 4L5QA 1MI2A 2UU9L 2CQAA 1WCMH 1FNUA 4NW2A 4KHZA 3S1NH 1X55A 2J4XA 3FKIB 4MN3A 4NB3A 1H9KA 2FHTA 2F4IA 3K5LA 4DR2Q 3TN2A 1DOMA 4WJ3M 4A3IH 2FMMA 4JI3L 3D4WA 2DNCA 2YTYA 3DM1A 1YJ9A 5IT9E 4UY8C 2I0QA 1KHCA 1EWHA 1NMFA 2F52A 4POFA 1NBWA 4A3FG 3J80E 4P73A 5G3LF 3T1YL 1VQMA 3T53B 2K04A 3DEOA 1STYA 2YU9H 3PO3B 2R6GA 3EQLC 3D8GA 3J81L 1NR4A 1G2SA 2JN4A 3I2ZA 5EBCA 2Z6KA 3S16H 1SBBB 2E2JH 1PH6A 4IALA 4CBVA 1XWEA 2R92B 1TR5A 2JA8G 2F3VA 2D5DA 2XN9C 1I6HB 1I4XA 3CRKC 1BR9A 4MZ9A 2N78A 5KNDA 2DJFC 1VQGA 1WI5A 3GTLH 5M3MG 4LF7L 1Y02A 4A3DG 4IQZA 3F2BA 1D5ZC 3PF4A 1HPCA 3I3CA 3K5NA 4NXMQ 3F1ZA 1EFID 1MJCA 1F9RA 1BQQT 2E75C 4B3TL 2IJ0A 2F0WA 5A2QE 1UE5A 4PV1C 3STBD 1SR3A 2DN8A 4IPGA 2UUBQ 1LTRD 3FP9A 4OIJA 5ELDA 1ENCA 2F0IA 5IWAL 1K8GA 4GLAC 3W2DA 3I70A 2WAQE 1N9WA 4X3TA 3SXHA 2K50A 5IYDH 1VQLA 3S24A 3RZDH 4N8X1 2JA6G 4ZCKA 1V1PA 1JJCB 4DNIA 3J7A5 1W6KA 3TDQA 3CPWA 1VQDA 2N49A 4FXDA 1EY5A 3WWVA 4RKLA 1G6ZA 4QUFA 4JI0Q 1E7DA 2KVUA 1QILA 4C3IG 2QKIC 1EIHA 1GUOA 4DK6C 2IHEA 2NYZD 4A3FB 1SAPA 2HDMA 1EYCA 1Y14B 4X62Q 1VQ8A 4N8FA 1TVXA 1RD9D 1YHBA 2WB1G 1STHA 5COYA 1VQKA 1I4HA 1WTHA 4QB4A 5FO8B 4L5RC 4TKOB 4LF9Q 2NVYH 5LHY1 5C6AA 2V1CC 2E5LL 4A3BH 3MC0B 4B3SQ 1ENAA 2QGQA 2I5LX 3EROA 3ND9A 2JA8B 4OELB 1SEBD 3FKIH 2HHHQ 2QW7A 5CV6A 3KUPA 4A3DB 3HOYG 3HS0C 4CKBA 1Y8PB 1SN8A 4J8QA 1MHWC 2K1BA 4QIWB 2SDFA 4MHEA 5H1SE 4DV2Q 4FDBA 1K0SA 5CORA 4YY3L 4DR4L 4OGQC 1KQSA 1SXTA 1JOOA 1F77A 5T1GA 4FF3A 3OIPA 3PO3H 1Q82C 1VCIA 4XQQA 4M8AA 2D62A 1LUZA 4IFDI 1CKOA 5DM63 3OW7A 4HJ5A 2JA7G 2OCEA 5IODA 1IL2A 2ODGC 2OEOA 4KN7C 1JJGA 1QUQB 2RSNA 4HJ9A 4NXNL 4KY5A 3D6CA 5C5LA 1RODA 2R92H 3A8IE 3SK8A 1LYLA 2B2UC 2K6AA 1SE8A 1I6HH 3PIP3 1HNWL 4LUVA 4C3IB 4A3MB 2CH4A 1CK1A 4ME3A 4IPCA 5M5YB 4DR1L 1KABA 2EYHA 3F2DA 2AQ3B 1KDCA 2YTVA 4MTKA 4LUOA 1EQVA 1K0RA 3MFGA 2ES2A 5J39A 4JI2L 4DAYA 2VQEQ 2KFVA 4LF8L 2LXKA 4CJ1B 5CV7A 3I4NG 1HFGA 3NK9A 1SYEA 3JAML 5HY6A 4DV0L 4HMJA 3SR1A 1F9SA 1B7YB 1GO3E 2NN6H 1BCPD 1LTBD 1ZXTA 4BY1G 3J7YW 4CDCC 2HD3A 1WTQA 4XYOA 4UP7A 3VDYA 3J81i 3C46A 4KKUA 5C4XG 4DAVA 2PNRC 2RHSB 4R8NA 1VQFA 5EGTA 4FYDA 4DUZL 4JBWA 3HOYB 4A3KG 1KIXA 4QMGA 5FLMH 4DF7A 4LJZC 2UXCQ 5EPLA 4A3FH 1A62A 4PZ8A 2O5JC 1PMRA 3JC66 2OTLA 4QCLA 2H1EA 3HOXG 4XT1B 3UDIA 5I2XA 3W5OA 4RCNA 4WRDA 3NTKA 4YWMA 1OO9B 2F0KA 3V2TA 2JQOA 2M2LA 1ZYRD 3PMFA 4AIMA 3QKJA 1WD0A 3I4MG 2UXDQ 4U673 1E22A 2MNAA 4A3CG 3A5ZB 4ALPA 1LTAD 1RTOA 4K5XA 5D14A 4HSPA 1A3TA 1KTKA 4PG3A 3NBHA 2JA8H 1TWHB 3P7JA 3BYTB 3QIAA 1EOVA 5EPKA 2ZM6Q 5KYIA 1E3PA 2HIXA 2GVBA 3PUVA 4A3DH 1SFOB 4JV5L 1TY2A 1UE1A 3BDCA 3ONAB 4RGOS 1WVLA 2VB2X 1BKBA 1V1OA 1X3EA 3OIQA 4O0AA 2Z4HA 2L12A 4DR2L 3HEJA 2Q8RE 2PW7A 4QUCA 2BOSA 1N32Q 1YZ6A 2X6GA 1PYWD 4A3EG 1HNZQ 2B29A 1Q46A 3D4DA 4IURA 4BY1B 3HOUB 3CHBD 2B63G 5C4XB 4Q0FA 3U9OA 4ZUJA 1V8QA 1H9MA 4NPSA 1CKMA 3R93A 4C1NK 4A3KB 3SGIA 1F2LA 1IW7C 3EBEA 1V1PB 4C3IH 4A3MH 1IYUA 3X3NA 4FXGC 5ELEA 1N34Q 1S72A 5M5YH 1I4GA 4XDXA 1RCVD 2O2LD 1CQFA 1GOZA 3HOXB 3PF5A 4KJOA 2UUAQ 1Y8OB 3PUZA 4IOAA 2OWOA 1UE6A 1E2ZA 1OXTA 4DAMA 3VR5A 1DOLA 3U58A 4NXML 1B70B 3CC2A 2MHVA 2IY5B 4LF5Q 4CJ0B 3K8AA 1BBWA 2RDFA 3NQIA 1B8AA 1PYBA 4HTHA 3I4MB 2XNAC 5TSSA 3PUYA 3A56A 3CAMA 2UUBL 1VQHA 3K5OA 4DR3Q 5IYBG 1SYDA 3HOZG 1O78A 2BA1A 2Z8LA 1ZKOA 5IY0A 4LFAL 5IGDA 5IIFA 3HOYH 5BN5A 2ZXRA 1U9RA 3I73A 3ICEA 2QEJC 4IPHA 3L0OA 1BBUA 2R7ZB 2DJGC 3BZDB 4JI0L 3GD7A 4R4QA 2QDBA 3IKJA 5JJKA 2IHFA 3T1HQ 1H1JS 2EY5A 4A3EB 4OL7A 2L4NA 5LMUL 4IFDJ 1IKLA 2XWBB 1ASYA 1TU2B 3EVQA 2LS01 1Q3LA 3TRZA 1CA6A 4KHPL 1VQ7A 1EY9A 3MEFA 4DXFA 3E9IA 3URYA 1E2VA 2CQOA 3PCOB 4LF9L 3JAMi 2A69C 1D2BA 1XNRQ 3GTPB 4XQNA 3ZJYC 3PIOA 4QY7A 2G5DA 2VNUD 5C3XA 1TWHH 3CPFA 3ERQA 5IGEA 4A3IG 2ZTDA 1R4QB 1ONLA 4B3SL 5C4ZA 5FK9C 4EVOA 4B9WA 4JBKA 1SFOH 3H6MA 1N36Q 3DXJC 2CKZB 4CGYB 2VZAA 4QGUA 2HHHL 2A6HC 1KNAA 2B2YC 2B8FA 1QZGA 1PH3A 3BDOA 3Q24A 2BE5C 4DV2L 3A8JE 1HR0Q 1EIYB 2VY3A 4BY1H 1U4RA 3K59A 3HOUH 2QILA 2B2TA 4IFDG 1ESRA 4DAYB 5FLXc 4ME5A 2XGTA 4HSVA 1E24A 3L2PA 4P72A 5C4XH 1EY0A 4YIJA 4DK0A 4P71A 4BBRG 4FF2A 2EPBA 4A3KH 3KJOA 1NUCA 2K5DA 3S1MB 1CSQA 2PQAB 4NKLA 3R3OA 1WTOA 5KIXA 4LFBQ 3TZDA 2MPHA 3HOXH 1LV9A 2F0SA 2PZTA 3OPOA 3H91A 5E4XA 3KLSX 3M9BA 2NVTB 4JPBW 4HIDA 5IYDG 1KDAA 1JE4A 1H9FA 3AFQA 1TWFB 1GUTA 2VQEL 3CRLC 2F0QA 4POGA 2SOBA 3ZYYX 4KKTA 3I72A 3NENA 1HFNA 1A2TA 2F0LA 4JBJA 1GUSA 3LX0A 4HEDA 1PH2A 3UE1A 1WTVA 4K2LA 2B39A 2KVEA 1D1IA 1QZHA 1YNND 2H5XA 2D0OA 2R7ZH 2D0PA 1LT6D 4MIUA 1UEBA 3QB3A 5A35A 1QOHA 5FO9B 2W51A 4A3EH 4P74A 2UXCL 3VYUA 4C3HG 4A3BG 2NTTA 3E6ZX 2QNFA 3OMCA 4V190 5LMNQ 4DNTB 1LTTD 1BDOA 3LWEA 1G8ZD 3QWNA 1SSOA 3MVVA 1Y1VG 2UXBL 3H94A 4LUZA 3VYTA 3GTPH 3K0YA 4TQUS 3VYRA 4BBRB 3KDFA 3R2IA 4OWXB 1NMGA 5JAVA 2UXDL 2K5VA 1PHJA 4HN7A 4BA2I 1NCVA 1X3PA 3HKSA 1B2TA 4K6LA 2IX0A 5LL6X 3K7AB 1ICFB 4FO2A 4DN4M 2PZUA 4J1MA 1SNQA 2ZM6L 1ESFA 3GV6A 2PCFB 1VQ9A 3CP0A 3LNNA 2E2DC 1A2UA 4PQXA 5C3EG 1CA5A 1K3RA 2NUCA 2LXJA 1SROA 3KBXA 1VDZA 1BVSA 4B08A 3RZDB 5BR8Q 1N32L 3T4AC 1KXLA 4GKJQ 5ELOA 3FLGA 2F0TA 1XX8A 4DV4Q 1J6QA 3BVMA 3ITPA 2CWPA 2L0CA 2CWAA 5IYBH 1HNZL 1BBXC 1KHIA 1AN8A 1LTSD 2AWOA 4BBSG 2EYOA 1LO5D 1F9PA 3PUXA 3TREA 1QJOA 3W1BA 5D3IB 4OWWB 3S1MH 1Q1BA 2B2TC 1EZ8A 4RMFA 3MXNA 5I2YA 4B3RL 2MUYA 3I4OA 3AMUA 1PH8A 3DM3A 1II3A 1EIGA 2KW9A 4ZRZA 1N34L 4DFAA 4HCEA 2WAQB 4C3HB 4A3BB 1L2FA 1I50B 4JOIA 1YHQA 2NVTH 3BJUA 5KRUA 1T9HA 2K33A 1N33Q 2UUAL 1TWFH 4JV5Q 1CUKA 4PNYA 1Y1VB 3PIO3 2E8GA 1LM0A 2JJQA 2K7VA 3EFXD 4QQBX 4P2CB 3VA7A 1YJNA 4Y52H 5I6YA 1LACA 4LF5L 5FLMG 5IOCA 3C1EA 3AYHB 1ZS9A 4GLXA 4DR3L 3NE5B 1PH5A 4K8IA 4CJ2C 2A73B 1I5FA 2J0TD 1M1KC 2F03A 1YNJC 4FF1A 2R7DA 4KY6A 1FNVA 1L1OA 5C3EB 3G7LA 1JOKA 1Z9FA 2AMCB 3C1FA 2XRQD 5I6WA 4KI0A 3HKZE 1Y69U 1J5EQ 5GAGC 4IFDH 3P1HA 3T1HL 1O7YA 2KA7A 1TWAB 2CHBD 3RLNA 5KNCA 4BBSB 2DUDA 4R4OA 3AQQA 2F0PA 1I3QB 1YBYA 4Y7NB 1G91A 1F2ZA 2L9HA 4BBRH 5EAYA 4HAEA 5IT9L 3SE0A 1TKWB 1XNRL 1G6PA 1S5DD 2ZXOA 2D2CC 3K7AH 5C3WA 2F4VQ 3J80L 4XTCS 3A7AB 1TT2A 4OXPA 1UAPA 1PH7A 4IZ8A 2HDLA 3KF8A 1N36L 1PH4A 3BZCA 2WIIB 1I94Q 4LFAQ 1C8CA 4L63B 2CW0D 1FR3A 5C4HA 4ZKCB 5KEEA 1VMPA 3EN2A 1CM9A 3T51B 4B3ML 2ALYB 5IP9G 1CFMA 1HR0L 3E3XA 1Q81C 3OSOA 4UAIA 1D6EC 4A3MG 1HZAA 5FKAC 3WOFA 5LMUQ 3L7ZC 2KBNA 1AE2A 3SHLA 5JJLA 2VUMG 4KHPQ 1SMXA 3QOJA 1VQ6A 5A2QL 1LABA 3I56A 3KLSA 2JA9A 2EY2A 1NE3A 3IFDA 2VQFQ 4C2MB 4V0BA 1VF5C 4C3HH 3Q23A 1I50H 4QF4A 4LFBL 3I8ZA 1AW7A 3CCEA 1D8LA 1SJHD 2A74C 1GVPA 4O1NA 4Z9CB 5JVG3 2UUCQ 3OMGA 3B6YA 1U4LA 1WYDA 1RJTA 1Y8NB 2A6EC 2A68D 1PH1A 1PLFA 4C56C 1Y1VH 1LT3D 3CC4A 3S2HB 4MNOA 1M4VA 5F2DA 3EIVA 3BVZA 4ZLTF 4JOIC 1IYJB 4GS3A 4H44C 3NWSA 4L8JA 2LY7A 4DR7Q 1RHPA 1KRSA 1NSNS 3CKIB 4R9WA 2R93G 2B2VA 1TS4A 4IUPA 5CGKA 4ULLA 4BS9A 1CKNA 5DLQE 5C3EH 2XIWA 2L15A 2PNHA 3HGBA 1GUWA 2PMZB 4JG2A 3N6RA 3S9WA 2EVBA 3RLFA 4EQ5A 3M4YA 1L0WA 2AKWB 1QB5D 3TEHB 4ZK9B 1X56A 2A6HD 2KECA 1I4QA 2F0FA 3U4VA 1VQOA 2ZXPA 1UE7A 3I55A 3NEMA 1TWAH 2F0HA 2RHQB 4LMQD 4AYBG 1Q90A 5FLXE 4BBSH 4GNXA 4Y7NH 1I3QH 5LMNL 5D3DA 3TZUA 1JICA 4L5TA 1V9PA 2Z6KC 3CCMA 4C1NI 4GLVB 1D1KA 4XT3B 2AWNA 2Z9HA 1DJRD 2VUMB 1VQEA 5G3LD 1H9SB 5KYLA 3DMUA 1JWSD 4I7AA 5E4WC 5DNFA 3KFUA 1T5XD 4A3LG 1HQRD 1FGBD 2VB3X 3UI2A 2MO0A 3MXNB 2NVXB 4X6AH 3HOUG 1EEID 1AE3A 4G57A 4DV6Q 4JC0A 1MBYA 1QNKA 3RNUA 2F0OA 2HUGA 5M5XB 3G6JB 2IWHA 1X3QA 1BNZA 3W3AA 2K5WA 2QA4A 2F0MA 2KHJA 5JEAJ 5D65A 5BR8L 1ET9A 4GKJL 2M00A 4JW0A 4DV3L 1F2YA 1A3UA 4DV4L 1AEXA 4YWKA 1DZ1A 2LC3A 5JOBA 2RDGA 1TS2A 4IJLA 2R93B 3U50C 1NY4A 1TY0A 3KLRA 5E1FA 3VR3A 2WKCA 2JP1A 4U68A 1XNQQ 1EY4A 2UXBQ 4C2MH 3J80i 5C0XI 3NXWA 3QG1A 3PGZA 4HJ8A 4EQPA 3AU7A 1AZQA 2K01A 3M85A 2F0DA 3GTGB 4QIWE 1PFNA 2FINB 1U0LA 2AUKA 4DV7Q 2ZTEA 4IUQA 1ENFA 3G71A 3Q22A 5J22A 1PA6A 3J81c 4K6DA 4RGNA 5HGQA 4AYBB 3S2HH 3HFZB 3MXPA 1HA5A 2Y0SG 4R1JA 3WOEA 1XXGA 4G7ZC 1N33L 3M7GA 5JEAG 3FDTA 4TSSA 4C3JG 2EZVA 2R7ZG 1JJ2A 2CH4W 4OX9Q 1DM0B 3HP3A 2L5TA 5FOBB 2C5CA 4G7OC 3K81C 1HZCA 1AFPA 1PZID 1VQPA 4JI8Q 4ZUIA 1TS3A 2MO1A 3IAYA 1IKMA 2K5QA 1J9OA 1SYFA 2GA4B 3CU7A 2EXDA 3RUZA 3C2PA 4IPDA 1UNSA 5ELBA 2WB1E 3FHWA 4B9XA 4LF4Q 5IP9H 1U4MA 5KGUA 1C0AA 4B3RQ 3K5MA 1J5EL 1STAA 3NELA 5GQOA 1GJXA 4UP9A 5CR3A 3D0FA 2DNEA 2LKVA 2MPMA 5JJIA 3PO2G 1SE2A 3UE0A 2JA5B 2Q2HA 2VUMH 1DGSA 5EKLA 2CCZA 5NUCA 1VQNA 1ZEQX 2ATWA 4GNXC 2L1BA 3NTIA 4BXXG 1HNXL 1Q1EA 2EYMA 3H0GG 5EPJA 3C3LA 5M9OA 4BA1I 3LLRA 5AFWA 4A75A 2F4VL 2NVXH 5GROA 4JI5L 2R61A 3K0XA 4KD4A 1SYBA 5M5XH 1OXUA 5AJ3Q 3TSSA 5C4JB 4K0KQ 3UDGA 3Q8DA 3D4RA 2ODCI 2EJFC 4JI7Q 1I94L 4KV6A 2BCOA 2Y0SB 1E1OA 1SRUA 2EY6A 3GDEA 1EY8A 2EJGC 3TS0A 5T1IA 1QVGA 4C3JB 1AP0A 3TP7A 2HIVA 4X65Q 1GHKA 2R93H 4CDDC 1AZPA 1WTPA 2I07B 4DV5Q 3FMCA 2KENA 3CCLA 3TQYA 1FYCA 1D7QA 2B2WA 3IRBA 3DEPA 3MTSA 2C35B 1VQ4A 1GKHA 1VQ5A 3A0JA 1WJJA 1DONA 4YCUA 1G51A 1KLUD 4O2DA 1YNJD 1B9MA 1O7ZA 3GTGH 1YNXA 4EX5A 1CKNB 2VQFL 2L11A 1QVFA 1NR2A 1HUNA 4HIKA 1HXYD 1WD1A 1CSPA 2YYZA 1IBKQ 4RAUC 2OF1A 1PXUA 3SVMA 3TP6A 4XXEA 2ZJRA 2UUCL 2P5ZX 4RWSC 2RDHA 1C48A 1RF2D 1Q86C 3PO2B 1A6XA 2H4OA 3EA6A 2PPBC 3HRZC 4GNXB 2D9UA 2K28A 4M1UB 1L0YB 2MP1A 4PZ6A 4F88A 3OTOL 3RN5A 3DLLA 4IUVA 2NZ1D 3H0GB 4B3MQ 4DR7L 4A3LH 1PRTC 2HT1A 1B44D 1E2WA 1EIFA 2Q2TA 2K03A 1XTDA 3E0EA 1A3VA 1HR0W 4OO1I 4FVMA 4A93G 3JAMc 2JXMB 1EN7A 2SNSA 3DUZA 2EYJA 2NZHA 2WACA 3UDFA 3GQBA 4DK3C 1C4QA 3CMAA 1MJEA 1HQMC 1RDPD 3RN2A 1JE5A 2E2IB 1BOSA 3S1RB 1HTPA 5GAHC 2JA5H 3K57A 5L37A 4AQYQ 5C44G 4CDEC 5C0XJ 2A19A 2JE6I 5HGTA 1B53A 3CMEA 2I5MX 2NB0A 1B3QA 2HJQA 2KVDA 1BCPC 1B9NA 1GXDC 1MKHA 1W3SA 2N8NA 4RHRA 4PMWA 4A3JB 4JI6Q 2E76C 3CQZB 3O13A 3R2TA 5C4JH 2XTIA 2Z0SA 1IL8A 1STGA 1V43A 1MGSA 2ZT9C 5EQ0A 3E5SA 2ICIA 1Q12A 4DV6L 1HJPA 1KC8C 2FXQA 1SDFA 1ILQA 4QL5A 1JC7A 1IHZA 4RG1A 5JEAH 4GKKQ 1B4OA 4DKAC 1CQVA 2A6ED 4K14A 3PSIA 3NBHB 3W1GA 4C3JH 2HQEA 1SMYC 5EJWA 4DXGA 1M8AA 3QJYA 1JOQA 3SDZA 4IJHA 3SK4A 1K8OA 3BS1A 1NNXA 5FJ8G 2VS1A 1PFBA 1PRTB 3Q0AA 4H02A 2WAQG 3KBGA 5CIUA 1TWGB 4I7ZC 2K5NA 1FD7D 4DK1A 5C0XG 2B8GA 2BA0A 3TP5A 1I4RA 2YTXA 2RCNA 1JCKB 3D3RA 1ZYRC 5K5PA 1XNQL 2KHIA 4TRDA 4A93B 1A0IA 4DV1L 3F2CA 4F87A 5LMNW 3D31A 3OYYA 4HIOA 2B2WC 2X69A 1K3BC 3VYSA 4AH6A 4DV7L 1IYVA 5CYUA 3J81j 5GADC 1B50A 3PO2H 4DR6Q 2KEDA 2F3IA 1P8LA 4PZ7A 2K05A 2N3SA 3IFTA 4ID6A 1YJWA 3J7ZC 3A5UA 3KOJA 5LL6S 5C44B 4CKEA 4BXXH 5CMDA 2PZWA 4RA8A 2KCCA 3H0GH 1SNMA 5BN3A 1JWMD 4JBMA 4OX9L 1BCPB 4G7HC 2RKSA 3CCJA 1Z6HA 4DV3Q 1U5KA 5I4DA 5IGCA 2EXZA 3AB9A 1VQCA 4PMBA 4EQNA 4PMCA 4EGVA 4JI8L 1RTNA 1QUQA 1S5BD 3HOVB 4X64Q 1SLJA 3FVQA 3NP8A 5M3FG 1IBMQ 1V66A 1XTCD 4RCOA 4P75A 4G4KA 5KNBA 2MGSA 3KK7A 1Q7YC 1KRTA 3M3YB 5HURA 4J15A 2I46A 4WFN3 1LTGD 1SNCA 4OIKA 2O4XA 3MXGA 4LF4L 4XQJA 2E2IH 5EKKA 3S1RH 3RR5A 4JYAQ 2L55A 3NUCA 1DYQA 2K32A
chains in the Genus database with same CATH topology
1X3EA 4O0AA 4UP8A 4DR2L 4HJ7A 1KD1C 3CC7A 1O7IA 4MNOA 3EIVA 1N32Q 1YZ6A 2ZJPA 4A3GH 1E1TA 1A8VA 2KCTA 2MFIA 4JOIC 1VQAA 1IYJB 2OQKA 4GS3A 3PO3H 4A3EG 1HNZQ 3AFPA 2K5HA 2B29A 1Q46A 1YI2A 3H3VH 1KRSA 4A3JH 4DR7Q 1K9MC 3CQZH 2PI2A 3PV0A 2Y0SE 3H15A 3HKZG 2R93G 1X9NA 1XJVA 1GM5A 5GAEC 2B63G 1CKNA 1TWCH 5DLQE 1UWVA 5C3EH 2E5LQ 2JEAI 5AJ3L 1W2BA 1IZ6A 2L15A 2PNHA 4NPSA 2IX1A 4K0KL 2G80A 1CKMA 1XPOA 4JG2A 3RLFA 4EQ5A 4JI7L 1EWIA 3SGIA 4HJAA 2CFMA 3CF5A 3EBEA 3HOVG 1L0WA 4C3IH 1VQJA 4A3MH 2AKWB 3TEHB 1X56A 1YEZA 1N34Q 1FJGL 3U4VA 1S72A 5M5YH 1VQOA 4R4CA 4OONA 1UE7A 3I55A 1E7LA 1IBLL 3NEMA 1TWAH 2RHQB 1M90C 1KL9A 4AYBG 2BH8A 3CCSA 1S3OA 4BBSH 4OWTB 1TWGH 2EIFA 2I5HA 4GNXA 4X65L 3PF5A 2UUAQ 4Y7NH 1I3QH 3I4MH 3PUZA 5LMNL 4A3GG 4A3CH 4IOAA 4L5TA 2OWOA 1V9PA 4HIMA 1UE6A 2Z6KC 2K75A 4GN4B 3CCMA 4DV5L 1OXTA 1XMQL 4DAMA 2Q2UA 3U58A 4NXML 4GLVB 1B70B 4YY3Q 1G291 3CC2A 2AWNA 4A93H 4DR4Q 1XMOL 2IY5B 3RZOH 3CCRA 4LF5Q 3K8AA 1VQEA 1BBWA 4JI4Q 3TS2A 5ELNA 1B8AA 1PYBA 4LNQA 3PUYA 2UUBL 3CAMA 3GTMH 1VQHA 1PFSA 4DR3Q 2LD7A 3M4QA 5IYBG 3CXCA 3KFUA 1HNXQ 3GTQH 5K36G 3HOZG 2BA1A 1OTCA 4A3LG 4LFAL 3KF6A 5IY0A 3CCQA 2MO0A 3MXNB 3HOWH 1IBKL 4X6AH 3I7FA 3HOUG 4DV6Q 1AE3A 4NXNQ 4A4IA 4JC0A 3HOYH 2K4KA 3RNUA 4JI5Q 3ICEA 4IO9A 5C44H 1EQQA 4IPHA 3L0OA 1BBUA 4DR5L 1X3GA 1HNWQ 2QA4A 2KHJA 3GD7A 5JEAJ 4R4QA 4JI0L 3G6EA 1X65A 5BR8L 2VW9A 4GKJL 3F8TA 2IHFA 2OTJA 4DR1Q 4DV3L 3T1HQ 5JJKA 2B63H 1Y1WG 5LMUL 4DV4L 4IFDJ 4YWKA 3FKIG 1C7YA 2WP8J 1WFQA 1ASYA 2LC3A 2OQ0A 3TRZA 4OO1G 1HH2P 4IJLA 4KHPL 4JI2Q 3U50C 1VQ7A 1NY4A 4X66Q 3MEFA 4LF8Q 4LFCL 2B3GA 3E9IA 3HOVH 1PV4A 2CQOA 2VL6A 3PCOB 4LF9L 3JAMi 4YHHQ 1XNQQ 3S17H 4DV0Q 1VQBA 1XNRQ 2UXBQ 4YWLA 3ZJYC 3PIOA 2NVQH 1PH9A 4C2MH 4QY7A 2K52A 1JB7A 3M3YH 3A74A 3J80i 2VNUD 5C0XI 1TWHH 3CPFA 3UDXA 4A3IG 2ZTDA 3PGZA 4HJ8A 4B3SL 2Q2IA 3M85A 4DUYL 4QIWE 3PUWA 3PO3G 1U0LA 4R4TA 4JBKA 1K73C 3BU2A 4DV7Q 1SFOH 2LSSA 2ZTEA 1N36Q 3LGJA 2CKZB 3G71A 1PA6A 2VZAA 3J81c 5FJ8H 4QGUA 4DUZQ 5HGQA 2HHHL 3S2HH 2K14A 3HFZB 2Y0SG 4R1JA 1NTGA 1QZGA 1N33L 1R9TH 3H3VI 5JEAG 1PH3A 2R92G 1OXSC 4AQYL 4DV2L 1Z47A 1HR0Q 2JEBI 3HOZH 1EIYB 2ZJQA 4DPGA 2MQHA 2VY3A 1JJ2A 1FGUA 4BY1H 4OX9Q 3HOUH 1LTLA 3PIPA 2R7ZG 4IFDG 5IYCG 3RLOA 4DAYB 5FLXc 3AEVA 4APVA 2XGTA 3S15H 1V1QA 1E24A 3K81C 3L2PA 1EUJA 4IOCA 1EYGA 1HZCA 4P72A 5C4XH 3OTOQ 3OW2A 1VQPA 4JI6L 2HQLA 4JI8Q 3M7NA 2MO1A 1X3FA 1FL0A 1WOCA 4GN5A 4P71A 4BBRG 1K8AC 4A3KH 4LW1A 4QJFA 3KJOA 3KDFB 1CSQA 4KLKA 4L5SA 1X6OA 2PQAB 1PVOA 2EXDA 4JI1Q 3CCUA 3M4OH 4GKKL 1GJJA 2NN6G 4IPDA 4YCWA 4L5QA 4LF6Q 2WB1E 3FHWA 4LF4Q 5IP9H 5IP7G 1C0AA 4LFBQ 4B3RQ 1J5EL 3NELA 2MPHA 5GQOA 2UU9L 3K80C 3HOXH 4UP9A 5E7NA 4A76A 1YVCA 3D0FA 1JT8A 1WCMH 4KHZA 4LWCA 3S1NH 1X55A 4DR2Q 4NB3A 5JJIA 3M9BA 4HIDA 3PO2G 5IYDG 3UE0A 1L1OC 4A3IH 4WJ3M 1H9FA 2PI2E 3AFQA 2Q2HA 4JI3L 2VUMH 1DGSA 2YTYA 2CCZA 2VQEL 5M3FH 1YJ9A 4POGA 4UY8C 2I0QA 1VQNA 2ATWA 1NMFA 2F52A 4POFA 1NBWA 4GNXC 4A3FG 1HNXL 1Q1EA 3S2DH 4BXXG 3H0GG 4BA1I 4P73A 3CCVA 3NENA 4GOPA 3T1YL 1VQMA 4A75A 2F4VL 2NVXH 4JBJA 5GROA 1PH2A 4JI5L 3UE1A 2YU9H 2R6GA 3K0XA 1QZHA 2AHOB 1Q8KA 5M5XH 1OXUA 5AJ3Q 4K0KQ 3UDGA 3I2ZA 2H5XA 3Q8DA 2D0OA 2ODCI 3G48A 2Z6KA 4JI7Q 2R7ZH 2D0PA 1I94L 3S16H 4DR6L 1C9OA 1PH6A 2E2JH 1UEBA 1E1OA 1SRUA 3GDEA 2W51A 1FJGQ 3KJPA 3TS0A 3K7UC 4A3EH 4P74A 1IBLQ 2JA8G 3GTKH 1QVGA 2UXCL 1AH9A 4A3BG 4MZ9A 2N78A 2QNFA 2HIVA 3ULPA 1VQGA 1WI5A 2RF4A 5M3MG 4X65Q 2E2HH 1Y02A 5LMNQ 4LF7L 3CD6A 4A3DG 3F2BA 2R93H 4JCVE 3PF4A 2QEXA 5J3BA 4DV5Q 1Y1VG 2KENA 4NXMQ 3CCLA 2UXBL 3F1ZA 4LUZA 3TQYA 1D7QA 3GTPH 1XMOQ 3IRBA 1MJCA 2R7FA 4B3TL 2C35B 4TQUS 1GKHA 2KCMA 1VQ4A 3A0JA 3KDFA 1WJJA 1NMGA 1UE5A 4OWXB 3STBD 2A1AA 1SR3A 4IPGA 4YCUA 2PQAA 1G51A 3U4ZA 2JA5G 2K5VA 1PHJA 2UUBQ 3FP9A 4O2DA 2UXDL 1IBML 3GTGH 1YNXA 5IWAL 3ULJA 4BA2I 4EX5A 1CKNB 3HKSA 4GLAC 2VQFL 1K8GA 2IX0A 2WAQE 1N9WA 1QVFA 4DV1Q 4HIKA 1VQIA 2K50A 5IYDH 1CSPA 2YYZA 3CW2C 1IBKQ 1VQLA 3S24A 3RZDH 2ZM6L 2JA6G 1YIJA 1JJCB 4DNIA 3J7A5 4BY7H 1VQ9A 3CPWA 4JYAL 3CP0A 1VQDA 2ZJRA 2UUCL 5IE8A 2N49A 5C3EG 1A63A 1L1OB 1K3RA 3WWVA 4DR5Q 2LXJA 1SROA 1Q86C 1TXYA 4MTNA 1BVSA 4JI0Q 1E7DA 5BR8Q 2YV5A 1N32L 1KXLA 4GKJQ 4GNXB 5ELOA 1MIUA 3M4PA 4DK6C 2IHEA 4DV4Q 5M5WH 1J6QA 4PZ6A 1Y14B 3OTOL 2CWPA 4X62Q 2CWAA 5IYBH 3DLLA 3RN5A 1KHIA 1HNZL 1VQ8A 4B3MQ 4DR7L 1XPUA 1YHBA 2AWOA 2PMZE 4A3LH 2WB1G 4BBSG 1VQKA 1EQRA 3PUXA 3TREA 4LFCQ 3ERSX 2HT1A 1EIFA 1PYSB 2Q2TA 4L5RC 4LF9Q 1ASZA 3W1BA 2GN5A 1XTDA 2A8VA 3E0EA 4OWWB 3S1MH 2NVYH 1Q1BA 5IT9c 1HR0W 4JI1L 4OO1I 4A93G 3JAMc 1EN7A 2V1CC 2E5LL 4LF6L 4A3BH 4RMFA 1VS0A 4B3RL 4B3SQ 3KF6B 3I4OA 2NZHA 5M3MH 3J80c 4DUYQ 1PH8A 2QGQA 2I5LX 3DM3A 3UDFA 4DK3C 1N34L 4YCVA 1Y1WH 3CMAA 2ZTCA 1MJEA 1OXXK 1OXVA 3FKIH 3RN2A 2HHHQ 1L2FA 3KF8B 1JE5A 4JOIA 1HZ9A 3HOWG 1YHQA 1K83H 3BJUA 2NVTH 1T9HA 5GAHC 3HOYG 1GD7A 1VQ5A 3ER0A 2JA5H 1N33Q 2UUAL 1SN8A 1TWFH 4JV5Q 1CUKA 1YNSA 1JEIA 4XIGS 4AQYQ 2E8GA 5H1SE 5C44G 1LM0A 2JJQA 4FDBA 4DV2Q 5C0XJ 1EFWA 4YY3L 2A19A 2JE6I 4DR4L 4QQBX 1KQSA 1YJNA 4Y52H 3CMEA 2I5MX 2JA6H 4LF5L 4JI4L 5FLMG 2HJQA 4R4IA 3AYHB 1W3SA 1MKHA 2N8NA 1ZS9A 4PMWA 4GLXA 1VCIA 4DR3L 1Q82C 1PH5A 4JI6Q 2D62A 1LUZA 4IFDI 1CKOA 3STBC 1I5FA 2XTIA 2Z0SA 5C4JH 2OCEA 4HJ5A 1M1KC 1V43A 2ASBA 2JA7G 1IL2A 2ODGC 1JJGA 1H9EA 1QUQB 2EQSA 2ID0A 1Q12A 2R7DA 4NXNL 4DV6L 1HJPA 4HJ9A 1KC8C 2FXQA 4GOPC 4QL5A 1L1OA 1RL2A 4RG1A 4GKKQ 2R92H 1Z9FA 2AMCB 4DKAC 1LYLA 1SE8A 3PSIA 4KI0A 1N8RC 3NBHB 1YITA 3W1GA 3HKZE 4C3JH 1J5EQ 1I6HH 1HNWL 4LUVA 2UU9Q 3E9HA 5GAGC 4BY7G 4ME3A 1RIPA 4IPCA 5IYCH 4IJHA 2IT1A 1GKUB 1H95A 2NN6I 4DR1L 2JK8A 3T1HL 3GTOH 3F2DA 5FJ8G 2VS1A 2YTVA 3RLNA 4LUOA 1K0RA 2WAQG 4H02A 2ES2A 2DUDA 4R4OA 3AQQA 4JI3Q 1YBYA 2K5NA 4JI2L 2VQEQ 4X66L 4BBRH 5C0XG 2KFVA 1X54A 4LF8L 3ULLA 2BA0A 2LXKA 5EAYA 3I4NG 2YTXA 4YHHL 2RCNA 1XNQL 5HY6A 4DV0L 1XMQQ 2KHIA 1XNRL 1G6PA 1A0IA 4DV1L 3GTJH 1B7YB 1GO3E 4AYBE 3F2CA 3T1YQ 4BY1G 3K7AH 3GO5A 5LMNW 5IP7H 2F4VQ 3D31A 3OYYA 4HIOA 1KAWA 4XTCS 4OXPA 3GTLH 1FVIA 1XPRA 4UP7A 2GVAA 3J81i 3VDYA 1IXRA 2WFWA 1PH7A 4AH6A 4X64L 4GN3B 5C4XG 4DV7L 2RHSB 3J81j 1N36L 1VQFA 3BZKA 5GADC 4A3JG 1PH4A 3BZCA 1I94Q 4DUZL 4JBWA 4LFAQ 3PO2H 4DR6Q 2F3IA 1S40A 4A3KG 1P8LA 4PZ7A 2N3SA 1KIXA 5FLMH 1YJWA 3J7ZC 3A5UA 3EN2A 3KOJA 2UXCQ 4X62L 1NJIC 2NZOA 4A3FH 4B3ML 4BXXH 2ALYB 1A62A 4PZ8A 5IP9G 1HR0L 3H0GH 1P16A 2JA7H 3JC66 2OTLA 1Q81C 4LF7Q 4JBMA 3KLWA 3HOXG 4OX9L 1GL9B 3CCJA 1HZAA 3UDIA 4A3MG 1WCMG 3W5OA 4DV3Q 1U5KA 4YWMA 5LMUQ 1VQCA 3L7ZC 2KBNA 1AE2A 4JI8L 2JQOA 4B3TQ 1QUQA 5JJLA 2VUMG 4GOPB 1SMXA 4X64Q 1SLJA 4AIMA 4KHPQ 5M3FG 1VQ6A 3I4MG 2UXDQ 2QNCA 3I56A 3S14H 2MNAA 1E22A 2JA9A 1NE3A 3A5ZB 1IBMQ 5IWAQ 4P75A 4ALPA 2BH2A 4A3CG 1JMCA 1HZBA 1E7ZA 1YHAA 2VQFQ 1QVCA 1Q7YC 1KRTA 4J15A 4PG3A 2JA8H 2DGYA 1EOVA 4C3HH 4TVAB 4LF4L 2ZM6Q 1E3PA 1I50H 2HIXA 2E2IH 4LFBL 3CCEA 3KYHC 3S1QH 1D8LA 2GVBA 3S1RH 4WJ4A 3RR5A 4JYAQ 3PUVA 4A3DH 1GVPA 2UUCQ 4JV5L 1WYDA 3B6YA 1PH1A 3I4NH 2DK4A 1UE1A 3G4SA 4UPAA 1BKBA 1Y1VH 3CC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3E A;  4O0A A;  4UP8 A;  4DR2 L;  4HJ7 A;  1KD1 C;  3CC7 A;  1O7I A;  4MNO A;  3EIV A;  1N32 Q;  1YZ6 A;  2ZJP A;  4A3G H;  1E1T A;  1A8V A;  2KCT A;  2MFI A;  4JOI C;  1VQA A;  1IYJ B;  2OQK A;  4GS3 A;  3PO3 H;  4A3E G;  1HNZ Q;  3AFP A;  2K5H A;  2B29 A;  1Q46 A;  1YI2 A;  3H3V H;  1KRS A;  4A3J H;  4DR7 Q;  1K9M C;  3CQZ H;  2PI2 A;  3PV0 A;  2Y0S E;  3H15 A;  3HKZ G;  2R93 G;  1X9N A;  1XJV A;  1GM5 A;  5GAE C;  2B63 G;  1CKN A;  1TWC H;  5DLQ E;  1UWV A;  5C3E H;  2E5L Q;  2JEA I;  5AJ3 L;  1W2B A;  1IZ6 A;  2L15 A;  2PNH A;  4NPS A;  2IX1 A;  4K0K L;  1CKM A;  1XPO A;  4JG2 A;  3RLF A;  4EQ5 A;  4JI7 L;  1EWI A;  3SGI A;  4HJA A;  2CFM A;  3CF5 A;  3EBE A;  3HOV G;  1L0W A;  4C3I H;  1VQJ A;  4A3M H;  2AKW B;  3TEH B;  1X56 A;  1YEZ A;  1N34 Q;  1FJG L;  3U4V A;  1S72 A;  5M5Y H;  1VQO A;  4R4C A;  4OON A;  1UE7 A;  3I55 A;  1E7L A;  1IBL L;  3NEM A;  1TWA H;  2RHQ B;  1M90 C;  1KL9 A;  4AYB G;  2BH8 A;  3CCS A;  1S3O A;  4BBS H;  4OWT B;  1TWG H;  2EIF A;  2I5H A;  4GNX A;  4X65 L;  3PF5 A;  2UUA Q;  4Y7N H;  1I3Q H;  3I4M H;  3PUZ A;  5LMN L;  4A3G G;  4A3C H;  4IOA A;  4L5T A;  2OWO A;  1V9P A;  4HIM A;  1UE6 A;  2Z6K C;  2K75 A;  4GN4 B;  3CCM A;  4DV5 L;  1OXT A;  1XMQ L;  4DAM A;  2Q2U A;  3U58 A;  4NXM L;  4GLV B;  1B70 B;  4YY3 Q;  1G29 1;  3CC2 A;  2AWN A;  4A93 H;  4DR4 Q;  1XMO L;  2IY5 B;  3RZO H;  3CCR A;  4LF5 Q;  3K8A A;  1VQE A;  1BBW A;  4JI4 Q;  3TS2 A;  5ELN A;  1B8A A;  1PYB A;  4LNQ A;  3PUY A;  2UUB L;  3CAM A;  3GTM H;  1VQH A;  1PFS A;  4DR3 Q;  3M4Q A;  5IYB G;  3CXC A;  3KFU A;  1HNX Q;  3GTQ H;  5K36 G;  3HOZ G;  2BA1 A;  1OTC A;  4A3L G;  4LFA L;  3KF6 A;  5IY0 A;  3CCQ A;  2MO0 A;  3MXN B;  3HOW H;  1IBK L;  4X6A H;  3I7F A;  3HOU G;  4DV6 Q;  1AE3 A;  4NXN Q;  4A4I A;  4JC0 A;  3HOY H;  2K4K A;  3RNU A;  4JI5 Q;  3ICE A;  4IO9 A;  5C44 H;  1EQQ A;  4IPH A;  3L0O A;  1BBU A;  4DR5 L;  1X3G A;  1HNW Q;  2QA4 A;  2KHJ A;  3GD7 A;  5JEA J;  4R4Q A;  4JI0 L;  3G6E A;  1X65 A;  5BR8 L;  2VW9 A;  4GKJ L;  3F8T A;  2IHF A;  2OTJ A;  4DR1 Q;  4DV3 L;  3T1H Q;  5JJK A;  2B63 H;  1Y1W G;  5LMU L;  4DV4 L;  4IFD J;  4YWK A;  3FKI G;  1C7Y A;  2WP8 J;  1WFQ A;  1ASY A;  2OQ0 A;  3TRZ A;  4OO1 G;  1HH2 P;  4IJL A;  4KHP L;  4JI2 Q;  3U50 C;  1VQ7 A;  1NY4 A;  4X66 Q;  3MEF A;  4LF8 Q;  4LFC L;  2B3G A;  3E9I A;  3HOV H;  1PV4 A;  2CQO A;  2VL6 A;  3PCO B;  4LF9 L;  3JAM i;  4YHH Q;  1XNQ Q;  3S17 H;  4DV0 Q;  1VQB A;  1XNR Q;  2UXB Q;  4YWL A;  3ZJY C;  3PIO A;  2NVQ H;  1PH9 A;  4C2M H;  4QY7 A;  2K52 A;  1JB7 A;  3M3Y H;  3A74 A;  3J80 i;  2VNU D;  5C0X I;  1TWH H;  3CPF A;  3UDX A;  4A3I G;  2ZTD A;  3PGZ A;  4HJ8 A;  4B3S L;  2Q2I A;  3M85 A;  4DUY L;  4QIW E;  3PUW A;  3PO3 G;  1U0L A;  4R4T A;  4JBK A;  1K73 C;  3BU2 A;  4DV7 Q;  1SFO H;  2LSS A;  2ZTE A;  1N36 Q;  3LGJ A;  2CKZ B;  3G71 A;  1PA6 A;  2VZA A;  3J81 c;  5FJ8 H;  4QGU A;  4DUZ Q;  5HGQ A;  2HHH L;  3S2H H;  2K14 A;  3HFZ B;  2Y0S G;  4R1J A;  1NTG A;  1QZG A;  1N33 L;  1R9T H;  3H3V I;  5JEA G;  1PH3 A;  2R92 G;  1OXS C;  4AQY L;  4DV2 L;  1Z47 A;  1HR0 Q;  2JEB I;  3HOZ H;  1EIY B;  2ZJQ A;  4DPG A;  2MQH A;  2VY3 A;  1JJ2 A;  1FGU A;  4BY1 H;  4OX9 Q;  3HOU H;  1LTL A;  3PIP A;  2R7Z G;  4IFD G;  5IYC G;  3RLO A;  4DAY B;  5FLX c;  3AEV A;  4APV A;  2XGT A;  3S15 H;  1V1Q A;  1E24 A;  3K81 C;  3L2P A;  1EUJ A;  4IOC A;  1EYG A;  1HZC A;  4P72 A;  5C4X H;  3OTO Q;  3OW2 A;  1VQP A;  4JI6 L;  2HQL A;  4JI8 Q;  3M7N A;  2MO1 A;  1X3F A;  1FL0 A;  1WOC A;  4GN5 A;  4P71 A;  4BBR G;  1K8A C;  4A3K H;  4LW1 A;  4QJF A;  3KJO A;  3KDF B;  1CSQ A;  4KLK A;  4L5S A;  1X6O A;  2PQA B;  1PVO A;  2EXD A;  4JI1 Q;  3CCU A;  3M4O H;  4GKK L;  4YCW A;  2NN6 G;  4IPD A;  4LF6 Q;  4L5Q A;  2WB1 E;  3FHW A;  4LF4 Q;  5IP9 H;  5IP7 G;  1C0A A;  4LFB Q;  4B3R Q;  1J5E L;  3NEL A;  5GQO A;  2UU9 L;  3K80 C;  3HOX H;  4UP9 A;  5E7N A;  4A76 A;  1YVC A;  3D0F A;  1JT8 A;  1WCM H;  4KHZ A;  4LWC A;  3S1N H;  1X55 A;  4DR2 Q;  4NB3 A;  5JJI A;  3M9B A;  4HID A;  3PO2 G;  5IYD G;  3UE0 A;  1L1O C;  4A3I H;  4WJ3 M;  3AFQ A;  2PI2 E;  4JI3 L;  2Q2H A;  2VUM H;  1DGS A;  2YTY A;  2CCZ A;  2VQE L;  5M3F H;  1YJ9 A;  4POG A;  4UY8 C;  2I0Q A;  1VQN A;  2ATW A;  1NMF A;  2F52 A;  4POF A;  1NBW A;  4GNX C;  4A3F G;  1HNX L;  1Q1E A;  3S2D H;  4BXX G;  3H0G G;  4BA1 I;  4P73 A;  3CCV A;  3NEN A;  4GOP A;  3T1Y L;  1VQM A;  4A75 A;  2F4V L;  2NVX H;  4JBJ A;  5GRO A;  1PH2 A;  4JI5 L;  3UE1 A;  2YU9 H;  2R6G A;  3K0X A;  1QZH A;  2AHO B;  1Q8K A;  5M5X H;  1OXU A;  5AJ3 Q;  4K0K Q;  3UDG A;  3I2Z A;  2H5X A;  3Q8D A;  2D0O A;  3G48 A;  2Z6K A;  4JI7 Q;  2R7Z H;  2D0P A;  1I94 L;  3S16 H;  4DR6 L;  1C9O A;  1PH6 A;  2E2J H;  1UEB A;  1E1O A;  1SRU A;  3GDE A;  1FJG Q;  3KJP A;  3TS0 A;  3K7U C;  4A3E H;  4P74 A;  1IBL Q;  2JA8 G;  3GTK H;  1QVG A;  2UXC L;  1AH9 A;  4A3B G;  4MZ9 A;  2N78 A;  2QNF A;  2HIV A;  3ULP A;  1VQG A;  1WI5 A;  2RF4 A;  5M3M G;  4X65 Q;  2E2H H;  5LMN Q;  4LF7 L;  3CD6 A;  3GTL H;  4A3D G;  3F2B A;  2R93 H;  4JCV E;  3PF4 A;  2QEX A;  5J3B A;  4DV5 Q;  1Y1V G;  2KEN A;  4NXM Q;  3CCL A;  2UXB L;  3F1Z A;  4LUZ A;  3TQY A;  1D7Q A;  3GTP H;  1XMO Q;  3IRB A;  1MJC A;  2R7F A;  4B3T L;  2C35 B;  4TQU S;  1GKH A;  2KCM A;  1VQ4 A;  3A0J A;  3KDF A;  1WJJ A;  1NMG A;  1UE5 A;  4OWX B;  3STB D;  2A1A A;  1SR3 A;  4IPG A;  4YCU A;  2PQA A;  1G51 A;  3U4Z A;  2JA5 G;  2K5V A;  1PHJ A;  2UUB Q;  3FP9 A;  4O2D A;  2UXD L;  1IBM L;  3GTG H;  1YNX A;  5IWA L;  3ULJ A;  4BA2 I;  4EX5 A;  1CKN B;  3HKS A;  4GLA C;  2VQF L;  1K8G A;  2IX0 A;  2WAQ E;  1N9W A;  1QVF A;  4DV1 Q;  4HIK A;  1VQI A;  2K50 A;  5IYD H;  1CSP A;  2YYZ A;  3CW2 C;  1IBK Q;  1VQL A;  3S24 A;  3RZD H;  2ZM6 L;  2JA6 G;  1YIJ A;  1JJC B;  4DNI A;  3J7A 5;  4BY7 H;  1VQ9 A;  3CPW A;  4JYA L;  3CP0 A;  1VQD A;  2ZJR A;  2UUC L;  5IE8 A;  2N49 A;  5C3E G;  1L1O B;  1A63 A;  1K3R A;  3WWV A;  4DR5 Q;  2LXJ A;  1SRO A;  1Q86 C;  1TXY A;  4MTN A;  1BVS A;  4JI0 Q;  1E7D A;  5BR8 Q;  2YV5 A;  1N32 L;  1KXL A;  4GKJ Q;  4GNX B;  5ELO A;  1MIU A;  3M4P A;  4DK6 C;  2IHE A;  4DV4 Q;  5M5W H;  1J6Q A;  4PZ6 A;  1Y14 B;  3OTO L;  2CWP A;  4X62 Q;  2CWA A;  5IYB H;  3DLL A;  3RN5 A;  1KHI A;  1HNZ L;  1VQ8 A;  4B3M Q;  4DR7 L;  1XPU A;  1YHB A;  2AWO A;  2PMZ E;  4A3L H;  2WB1 G;  4BBS G;  1VQK A;  1EQR A;  3PUX A;  3TRE A;  4LFC Q;  3ERS X;  2HT1 A;  1EIF A;  1PYS B;  2Q2T A;  4L5R C;  4LF9 Q;  1ASZ A;  3W1B A;  2GN5 A;  1XTD A;  2A8V A;  3E0E A;  4OWW B;  3S1M H;  2NVY H;  1Q1B A;  5IT9 c;  1HR0 W;  4JI1 L;  4OO1 I;  4A93 G;  3JAM c;  1EN7 A;  2V1C C;  2E5L L;  4LF6 L;  4A3B H;  4RMF A;  1VS0 A;  4B3R L;  4B3S Q;  3KF6 B;  3I4O A;  2NZH A;  5M3M H;  3J80 c;  4DUY Q;  1PH8 A;  2QGQ A;  2I5L X;  3DM3 A;  3UDF A;  4DK3 C;  1N34 L;  4YCV A;  1Y1W H;  3CMA A;  2ZTC A;  1MJE A;  1OXX K;  1OXV A;  3FKI H;  3RN2 A;  2HHH Q;  1L2F A;  3KF8 B;  1JE5 A;  4JOI A;  1HZ9 A;  3HOW G;  1YHQ A;  1K83 H;  3BJU A;  2NVT H;  1T9H A;  5GAH C;  3HOY G;  1GD7 A;  1VQ5 A;  3ER0 A;  2JA5 H;  1N33 Q;  2UUA L;  1SN8 A;  1TWF H;  4JV5 Q;  1CUK A;  4XIG S;  4AQY Q;  2E8G A;  5H1S E;  5C44 G;  1LM0 A;  2JJQ A;  4FDB A;  4DV2 Q;  5C0X J;  1EFW A;  4YY3 L;  2A19 A;  2JE6 I;  4DR4 L;  4QQB X;  1KQS A;  1YJN A;  4Y52 H;  3CME A;  2I5M X;  2JA6 H;  4LF5 L;  4JI4 L;  5FLM G;  2HJQ A;  4R4I A;  3AYH B;  1W3S A;  1MKH A;  2N8N A;  4PMW A;  1Q82 C;  4GLX A;  1VCI A;  4DR3 L;  1PH5 A;  4JI6 Q;  2D62 A;  1LUZ A;  4IFD I;  1CKO A;  3STB C;  1I5F A;  2XTI A;  2Z0S A;  5C4J H;  2OCE A;  4HJ5 A;  1M1K C;  1V43 A;  2ASB A;  2JA7 G;  1IL2 A;  1JJG A;  2EQS A;  1QUQ B;  2ID0 A;  2R7D A;  1Q12 A;  4DV6 L;  4NXN L;  4HJ9 A;  1HJP A;  1KC8 C;  2FXQ A;  4GOP C;  4QL5 A;  1L1O A;  1RL2 A;  4RG1 A;  4GKK Q;  2R92 H;  1Z9F A;  2AMC B;  4DKA C;  1LYL A;  1SE8 A;  3PSI A;  4KI0 A;  1N8R C;  3NBH B;  1YIT A;  3W1G A;  3HKZ E;  4C3J H;  1J5E Q;  1I6H H;  1HNW L;  4LUV A;  2UU9 Q;  3E9H A;  5GAG C;  4BY7 G;  4ME3 A;  1RIP A;  4IPC A;  5IYC H;  4IJH A;  2IT1 A;  1H95 A;  2NN6 I;  4DR1 L;  2JK8 A;  3T1H L;  3GTO H;  3F2D A;  5FJ8 G;  2VS1 A;  2YTV A;  3RLN A;  4LUO A;  1K0R A;  2WAQ G;  4H02 A;  2ES2 A;  2DUD A;  4R4O A;  3AQQ A;  4JI3 Q;  1YBY A;  2K5N A;  4JI2 L;  2VQE Q;  4X66 L;  4BBR H;  5C0X G;  1X54 A;  4LF8 L;  3ULL A;  2BA0 A;  2LXK A;  5EAY A;  3I4N G;  2YTX A;  4YHH L;  2RCN A;  1XNQ L;  5HY6 A;  4DV0 L;  1XMQ Q;  2KHI A;  1XNR L;  1G6P A;  1A0I A;  4DV1 L;  3GTJ H;  1B7Y B;  1GO3 E;  4AYB E;  3F2C A;  3T1Y Q;  4BY1 G;  3K7A H;  3GO5 A;  5LMN W;  5IP7 H;  2F4V Q;  3D31 A;  3OYY A;  4HIO A;  1KAW A;  4XTC S;  4OXP A;  1FVI A;  1XPR A;  4UP7 A;  2GVA A;  3J81 i;  3VDY A;  1IXR A;  2WFW A;  1PH7 A;  4AH6 A;  4X64 L;  4GN3 B;  5C4X G;  4DV7 L;  2RHS B;  3J81 j;  1N36 L;  1VQF A;  3BZK A;  5GAD C;  4A3J G;  1PH4 A;  3BZC A;  1I94 Q;  4DUZ L;  4JBW A;  4LFA Q;  3PO2 H;  4DR6 Q;  2F3I A;  1S40 A;  4A3K G;  1P8L A;  4PZ7 A;  2N3S A;  1KIX A;  5FLM H;  1YJW A;  3J7Z C;  3A5U A;  3EN2 A;  3KOJ A;  2UXC Q;  4X62 L;  1NJI C;  2NZO A;  4A3F H;  4B3M L;  4BXX H;  2ALY B;  1A62 A;  4PZ8 A;  5IP9 G;  1HR0 L;  3H0G H;  1P16 A;  2JA7 H;  3JC6 6;  2OTL A;  1Q81 C;  4LF7 Q;  4JBM A;  3KLW A;  3HOX G;  4OX9 L;  3CCJ A;  1HZA A;  3UDI A;  4A3M G;  1WCM G;  3W5O A;  4DV3 Q;  1U5K A;  4YWM A;  5LMU Q;  1VQC A;  3L7Z C;  2KBN A;  1AE2 A;  4JI8 L;  2JQO A;  4B3T Q;  1QUQ A;  5JJL A;  2VUM G;  4GOP B;  1SMX A;  4X64 Q;  1SLJ A;  4AIM A;  4KHP Q;  5M3F G;  1VQ6 A;  3I4M G;  2UXD Q;  2QNC A;  3I56 A;  3S14 H;  2MNA A;  1E22 A;  2JA9 A;  1NE3 A;  3A5Z B;  1IBM Q;  5IWA Q;  4P75 A;  4ALP A;  2BH2 A;  4A3C G;  1JMC A;  1HZB A;  1E7Z A;  1YHA A;  2VQF Q;  1QVC A;  1Q7Y C;  1KRT A;  4J15 A;  4PG3 A;  2JA8 H;  2DGY A;  1EOV A;  4C3H H;  4TVA B;  4LF4 L;  2ZM6 Q;  1E3P A;  1I50 H;  2HIX A;  2E2I H;  4LFB L;  3CCE A;  3KYH C;  3S1Q H;  1D8L A;  2GVB A;  3S1R H;  4WJ4 A;  3RR5 A;  4JYA Q;  3PUV A;  4A3D H;  1GVP A;  2UUC Q;  4JV5 L;  1WYD A;  3B6Y A;  1PH1 A;  3I4N H;  1UE1 A;  3G4S A;  4UPA A;  1BKB A;  1Y1V H;  3CC4 A; 
#chains in the Genus database with same CATH topology
 4UP8 A;  4RKB A;  1O7I A;  2C9O A;  1CHQ D;  1R9T B;  2KCT A;  5FO7 B;  4DGZ A;  4FF4 A;  1S5E D;  3AFP A;  4A3J H;  1K9M C;  1JEQ A;  3CQZ H;  3PV0 A;  1WTW A;  1EY6 A;  2FJ2 A;  1X9N A;  1CZW A;  3S15 B;  1PRT F;  3BYY B;  2J7Z A;  4ZQ3 A;  3J81 E;  1BF4 A;  1EY7 A;  5AJ3 L;  4K0K L;  1UUP A;  3H09 A;  2IX1 A;  1EWC A;  4KY7 A;  2RNO A;  1XPO A;  4JI7 L;  3NBI A;  4HJA A;  2EYL A;  1CT1 D;  1JJR A;  1F2M A;  1SND A;  4CKC A;  1E7L A;  3V05 A;  2XRS D;  5IGG A;  1KL9 A;  3VR4 A;  4OWT B;  1TWG H;  4BY7 G;  5J1Z A;  4X65 L;  3T56 B;  3VR6 A;  2Z1C A;  4HIM A;  2Q2U A;  2K75 A;  4DV5 L;  3X3M A;  1U4P A;  5IGB A;  1XMQ L;  2IPK D;  1G29 1;  1LT4 D;  4DAP A;  4A93 H;  1STE A;  2MJ8 A;  2F0U A;  4JI4 Q;  5M3F B;  2KHS A;  2B2U A;  2R3Z A;  1KAA A;  1G2T A;  1PFS A;  3M4Q A;  4J6H A;  3S2D B;  2E74 C;  1HNX Q;  3BVG A;  1BCP F;  1OTC A;  3KF6 A;  3I90 A;  4KHV A;  1IBK L;  1X32 A;  1Z7T A;  4KD3 A;  1JB3 A;  4A4I A;  1ML0 D;  1VMC A;  2K4K A;  4JI5 Q;  1GUG A;  1IW7 D;  5C44 H;  4WJW A;  2O5I C;  4WOR A;  4IUU A;  1X65 A;  3G6E A;  2CVR A;  2VW9 A;  3DHQ A;  1F9Q A;  3GTK B;  2AQ2 B;  1Y1W G;  2G9H D;  4IN3 A;  3RMH A;  1C7Y A;  1WFQ A;  2OQ0 A;  4OO1 G;  2E2H B;  4X66 Q;  3HOV H;  1PV4 A;  5JJZ A;  4YHH Q;  1VQB A;  3FPP A;  4YWL A;  2XVS A;  3OWE B;  5EBD A;  1PH9 A;  1JB7 A;  2K52 A;  3M3Y H;  3Q6S A;  1BO0 A;  4UDU C;  2ENB A;  3PUW A;  4R4T A;  3BU2 A;  2LSS A;  3LGJ A;  1MSH A;  5FJ8 H;  2EJM A;  2DY7 A;  4I65 A;  1PFM A;  3L3O C;  1CI3 M;  4BY7 B;  4JK1 C;  1NTG A;  1K28 A;  5C0X H;  5JVH 3;  1R9T H;  2V4D A;  1O80 A;  5CBA E;  3SEB A;  1T5E A;  5K36 H;  3MWY W;  4AQY L;  1Z47 A;  2JEB I;  1PZK D;  3IL8 A;  4DPG A;  2MQH A;  1LTL A;  5IYC G;  3AEV A;  2ICE C;  1PTO C;  5M5W B;  2FMC A;  1V1Q A;  3S15 H;  4CDF C;  1HA6 A;  1SYC A;  1EZ6 A;  2LFN A;  3MFY A;  3OTO Q;  3OW2 A;  1EYG A;  4K5W A;  4JI6 L;  4IUT A;  2A69 D;  1WOC A;  4GN5 A;  4ZAI A;  4LAA A;  1CTM A;  3KDF B;  1YNN C;  1DOK A;  4L5S A;  1X6O A;  5IGF A;  1PVO A;  1ET6 A;  4KKS A;  1SJE D;  4GKK L;  1GJJ A;  4Q5V A;  2TSS A;  5IP7 G;  5M3M B;  3K80 C;  1TII D;  5E7N A;  1LTI D;  4A76 A;  1YVC A;  1JT8 A;  1Y1W B;  4IUN A;  4LWC A;  1SE4 A;  2XSC A;  3MAQ A;  3D6W A;  3MXU A;  1EU4 A;  1K83 B;  3OOC A;  1ICW A;  3I4L A;  1L1O C;  1EOT A;  2PI2 E;  2BE5 D;  1BUV T;  5M3F H;  1PRT D;  2KQ3 A;  3JAM E;  1PZJ D;  3S2D H;  2JA6 B;  3OHX C;  3CCV A;  4GOP A;  2IX3 A;  5JPN C;  4RHS A;  2AHO B;  1Q8K A;  4H0L C;  4F8M A;  3DWA A;  1D5X C;  3G48 A;  4JVZ A;  4DR6 L;  1C9O A;  2RBM A;  4FXK C;  1FJG Q;  3KJP A;  2SNM A;  1WTX A;  2F0V A;  3K7U C;  1IBL Q;  3GTK H;  1AH9 A;  2WB1 B;  5I9O A;  3TME A;  3FEW X;  1GHJ A;  1PTO B;  3ULP A;  2NBF A;  2RF4 A;  5FLX L;  2E2H H;  3CD6 A;  1HHV A;  4JCV E;  3K58 A;  2QEX A;  5J3B A;  3GTO B;  1R4P B;  4ABN A;  4DA2 A;  1XMO Q;  4RH6 A;  2R7F A;  2F1M A;  1QCB D;  2KCM A;  4A3G G;  1S5C D;  4X64 L;  2JA5 G;  2A1A A;  1XPU A;  1QWY A;  2EE1 A;  2PQA A;  3U4Z A;  4OEM B;  1IBM L;  3ULJ A;  3GTJ B;  4DV1 Q;  1VQI A;  3H3V C;  3CW2 C;  1DCZ A;  1YIJ A;  1PDQ A;  4BY7 H;  3MHB A;  4JYA L;  1SMY D;  3FPU B;  1B3A A;  5IE8 A;  1O7L A;  1LT5 D;  1A63 A;  1L1O B;  2F0G A;  3EJI A;  4DR5 Q;  1TXY A;  4MTN A;  1MD2 D;  3BDL A;  2YV5 A;  2N55 A;  1MIU A;  3M4P A;  3P75 A;  5M5W H;  4RGM A;  2JA7 B;  2WIN B;  4NP5 A;  2IL8 A;  2PMZ E;  3FRP B;  1EQR A;  4LFC Q;  3ERS X;  1PYS B;  1CHP D;  1H9R A;  3QOL A;  2Z4I A;  3DWQ A;  5CBE E;  1ASZ A;  2GN5 A;  2A8V A;  5IT9 c;  4JI1 L;  2B2Y A;  2TMP A;  4LF6 L;  1VS0 A;  4O42 A;  3MA2 B;  3KF6 B;  5M3M H;  3S14 B;  2OXP A;  3J80 c;  4DUY Q;  1K8M A;  2RSO A;  3GV3 A;  3TBI B;  1H9J A;  4YCV A;  1Y1W H;  2B2V C;  2ZTC A;  1OXX K;  1J8I A;  1OXV A;  3KF8 B;  1HZ9 A;  3HOW G;  1K83 H;  4CHT B;  3S1Q B;  4OO1 H;  1GD7 A;  3ER0 A;  3I4N B;  1YNS A;  4NMZ A;  4HR7 B;  1JEI A;  4XIG S;  1JR0 D;  2VXW A;  1EFW A;  2OT2 A;  2BDN A;  2JA6 H;  4A3G B;  4JI4 L;  3A7L A;  3SK5 A;  5DAU A;  3L9A X;  4R4I A;  2PO4 A;  2KOL A;  2XWJ B;  2RNN A;  1PTO F;  5I9P A;  3T13 A;  3STB C;  2ASB A;  1BXT A;  3I91 A;  1H9E A;  2EQS A;  2ID0 A;  1TWC B;  1MSG A;  1GUN A;  4GOP C;  1RL2 A;  2CW0 C;  4K2K A;  2JYO A;  2JVW A;  1VF7 A;  1N8R C;  1YIT A;  2UU9 Q;  3E9H A;  1PTO H;  1RIP A;  5IYC H;  4NDX A;  2IT1 A;  1GKU B;  1H95 A;  2NN6 I;  2JK8 A;  5C5M A;  2WV6 D;  3GTO H;  2RVL A;  4JI3 Q;  1SNO A;  2RQX A;  4X66 L;  1X54 A;  1E0B A;  3ULL A;  2QF7 A;  4YHH L;  1ILP A;  1XMQ Q;  1EL0 A;  3GTJ H;  3RZO B;  2PW5 A;  4AYB E;  3QO2 A;  3T1Y Q;  3GO5 A;  5IP7 H;  2RA4 A;  3WDN A;  1KAW A;  3GTM B;  1SNP A;  3HG9 A;  5CV5 A;  1FVI A;  1XPR A;  2GVA A;  1IXR A;  2WFW A;  3GTQ B;  4GN3 B;  2KVM A;  3BZK A;  4X3K A;  4A3J G;  3HOW B;  1B1Z A;  2A68 C;  4ZYS A;  4OHJ A;  1S40 A;  1S5F D;  4H13 C;  4GZY C;  3PQI A;  3SK6 A;  4X62 L;  1NJI C;  2NZO A;  4KTA A;  1RKN A;  2Z6B A;  1P16 A;  2JA7 H;  1WTR A;  5CV9 A;  4LF7 Q;  1KLG D;  3KLW A;  3NSW A;  1GL9 B;  2QCP X;  2B63 B;  3NPP A;  1WCM G;  2FFK B;  4E6I A;  1HTL D;  3RD4 A;  1QNU A;  1DD2 A;  5CV8 A;  3K6O A;  2KEE A;  2BDO A;  4B3T Q;  2LMC B;  5EKI A;  2KCN A;  4GOP B;  2Q8T A;  4FNF A;  2QNC A;  3S14 H;  2WQG A;  3S17 B;  2RCF A;  5IWA Q;  2BH2 A;  2KJX A;  1HZB A;  1JMC A;  1E7Z A;  1YHA A;  2NVQ B;  1JOR A;  1QVC A;  3R8B A;  2F0E A;  2DGY A;  4DU9 A;  2EDG A;  4TVA B;  3A54 A;  4LK1 C;  1DXM A;  3KYH C;  3S1Q H;  4WJ4 A;  2AUJ D;  4R8I A;  4N9T A;  3I4N H;  2DK4 A;  5CV4 A;  3G4S A;  4UPA A;  3OWF A;  2Q8I B;  2PQE A;  4HJ7 A;  3NQT A;  1KD1 C;  3CC7 A;  2F3W A;  2EOT A;  3DWP A;  2ZJP A;  5CC4 A;  4K5V A;  4A3G H;  1LLR D;  1E1T A;  1A8V A;  2F0J A;  2MFI A;  1VQA A;  2OQK A;  1JWU D;  1NAP A;  3HOZ B;  2K5H A;  1YI2 A;  4ZKB B;  3H3V H;  2NTS A;  2PI2 A;  2Y0S E;  4HMI A;  3H15 A;  3HKZ G;  1EYD A;  3A8K E;  4L6T B;  1XJV A;  1GM5 A;  5GAE C;  4UZW A;  1TWC H;  1UWV A;  3MZ5 A;  1D5M C;  2E5L Q;  2EYF A;  2JEA I;  1QE6 A;  1W2B A;  1IZ6 A;  5BN4 A;  2G80 A;  1EWI A;  2CFM A;  3CF5 A;  3HOV G;  1VQJ A;  4BIT A;  1STB A;  1YEZ A;  2PYK A;  1FJG L;  3M4O B;  4R4C A;  1XYI A;  4OON A;  2N88 A;  1IBL L;  1FNW A;  1M90 C;  2BH8 A;  3GP7 A;  1S3O A;  3CCS A;  2EIF A;  2I5H A;  1L0X B;  3I4M H;  1WCM B;  1UEA B;  5ELC A;  4A3C H;  3TP8 A;  3VA5 A;  3S1N B;  4GN4 B;  1ZBH A;  2IW3 A;  1PTO D;  5DM7 3;  2NWG A;  4YY3 Q;  4DR4 Q;  4A3I B;  1XMO L;  4EQO A;  3HZX A;  3J7A F;  3RZO H;  3CCR A;  1A15 A;  1CZG A;  2DY8 A;  1HRJ A;  3TS2 A;  5ELN A;  4X3S A;  4LNQ A;  1EQT A;  2G9D A;  3GTM H;  5ISR A;  2LD7 A;  2X6L A;  3CXC A;  4KN4 C;  5JPM C;  3GTQ H;  3ND8 A;  5K36 G;  3CCQ A;  3HOW H;  4F7X A;  3I7F A;  2YU9 B;  4NXN Q;  2F0N A;  2WKD A;  2QDL A;  4ODG A;  4IO9 A;  4X3U A;  1EQQ A;  5ELF A;  3S16 B;  3NHH A;  4FP5 D;  4DR5 L;  1X3G A;  2E2J B;  3A55 A;  1HNW Q;  3J7A V;  1HUM A;  4KMU C;  3P20 A;  2OTJ A;  3F8T A;  4DR1 Q;  4BWG B;  2B63 H;  3FKI G;  2WP8 J;  3N52 A;  3GTL B;  1HH2 P;  1STN A;  3HKZ B;  4JI2 Q;  2HCI A;  3NWT A;  4LF8 Q;  4LFC L;  2B3G A;  2VL6 A;  3S17 H;  4DV0 Q;  4H7B A;  1Q8I A;  4KJN A;  2NVQ H;  4DNR B;  1S4Z A;  3A74 A;  4K8J A;  3UDX A;  5DEH A;  3VR2 A;  2Q2I A;  4DUY L;  4UHV A;  3PO3 G;  2EY1 A;  1K73 C;  1TQO A;  4RFB A;  4N9P A;  4DUZ Q;  4XYQ A;  2K14 A;  3T16 A;  2SEB D;  4KK7 A;  3H3V I;  1KDB A;  3BG3 A;  1QG7 A;  2R92 G;  2JSO A;  3QR8 A;  1OXS C;  4HCS A;  2KUM A;  3NTH A;  3HOZ H;  1HCZ A;  2ZJQ A;  2A5H A;  1EEF D;  1H9S A;  1TS5 A;  1FGU A;  3PIP A;  3RLO A;  4APV A;  1EYA A;  1W6J A;  3LWU A;  1I6V C;  1EUJ A;  4IOC A;  3U9S A;  2HQL A;  2M9V A;  4ILW A;  1EU3 A;  2EYP A;  4RGT A;  3M7N A;  1X3F A;  2HCC A;  3E0J A;  1FL0 A;  3MEH A;  1SE3 A;  5E3F A;  1K8A C;  3F2U A;  4LW1 A;  4QJF A;  1I4P A;  2AQ1 B;  2NVY B;  4KLK A;  1SYG A;  1JQY D;  4S3S A;  4JI1 Q;  3CCU A;  3M4O H;  1KNE A;  4YCW A;  2NN6 G;  3V96 A;  4LF6 Q;  4L5Q A;  1MI2 A;  2UU9 L;  2CQA A;  1WCM H;  1FNU A;  4NW2 A;  4KHZ A;  3S1N H;  1X55 A;  2J4X A;  3FKI B;  4MN3 A;  4NB3 A;  1H9K A;  2FHT A;  2F4I A;  3K5L A;  4DR2 Q;  3TN2 A;  1DOM A;  4WJ3 M;  4A3I H;  2FMM A;  4JI3 L;  3D4W A;  2DNC A;  2YTY A;  3DM1 A;  1YJ9 A;  5IT9 E;  4UY8 C;  2I0Q A;  1KHC A;  1EWH A;  1NMF A;  2F52 A;  4POF A;  1NBW A;  4A3F G;  3J80 E;  4P73 A;  5G3L F;  3T1Y L;  1VQM A;  3T53 B;  2K04 A;  3DEO A;  1STY A;  2YU9 H;  3PO3 B;  2R6G A;  3EQL C;  3D8G A;  3J81 L;  1NR4 A;  1G2S A;  2JN4 A;  3I2Z A;  5EBC A;  2Z6K A;  3S16 H;  1SBB B;  2E2J H;  1PH6 A;  4IAL A;  4CBV A;  1XWE A;  2R92 B;  1TR5 A;  2JA8 G;  2F3V A;  2D5D A;  2XN9 C;  1I6H B;  1I4X A;  3CRK C;  1BR9 A;  4MZ9 A;  2N78 A;  5KND A;  2DJF C;  1VQG A;  1WI5 A;  3GTL H;  5M3M G;  4LF7 L;  1Y02 A;  4A3D G;  4IQZ A;  3F2B A;  1D5Z C;  3PF4 A;  1HPC A;  3I3C A;  3K5N A;  4NXM Q;  3F1Z A;  1EFI D;  1MJC A;  1F9R A;  1BQQ T;  2E75 C;  4B3T L;  2IJ0 A;  2F0W A;  5A2Q E;  1UE5 A;  4PV1 C;  3STB D;  1SR3 A;  2DN8 A;  4IPG A;  2UUB Q;  1LTR D;  3FP9 A;  4OIJ A;  5ELD A;  1ENC A;  2F0I A;  5IWA L;  1K8G A;  4GLA C;  3W2D A;  3I70 A;  2WAQ E;  1N9W A;  4X3T A;  3SXH A;  2K50 A;  5IYD H;  1VQL A;  3S24 A;  3RZD H;  4N8X 1;  2JA6 G;  4ZCK A;  1V1P A;  1JJC B;  4DNI A;  3J7A 5;  1W6K A;  3TDQ A;  3CPW A;  1VQD A;  2N49 A;  4FXD A;  1EY5 A;  3WWV A;  4RKL A;  1G6Z A;  4QUF A;  4JI0 Q;  1E7D A;  2KVU A;  1QIL A;  4C3I G;  2QKI C;  1EIH A;  1GUO A;  4DK6 C;  2IHE A;  2NYZ D;  4A3F B;  1SAP A;  2HDM A;  1EYC A;  1Y14 B;  4X62 Q;  1VQ8 A;  4N8F A;  1TVX A;  1RD9 D;  1YHB A;  2WB1 G;  1STH A;  5COY A;  1VQK A;  1I4H A;  1WTH A;  4QB4 A;  5FO8 B;  4L5R C;  4TKO B;  4LF9 Q;  2NVY H;  5LHY 1;  5C6A A;  2V1C C;  2E5L L;  4A3B H;  3MC0 B;  4B3S Q;  1ENA A;  2QGQ A;  2I5L X;  3ERO A;  3ND9 A;  2JA8 B;  4OEL B;  1SEB D;  3FKI H;  2HHH Q;  2QW7 A;  5CV6 A;  3KUP A;  4A3D B;  3HOY G;  3HS0 C;  4CKB A;  1Y8P B;  1SN8 A;  4J8Q A;  1MHW C;  2K1B A;  4QIW B;  2SDF A;  4MHE A;  5H1S E;  4DV2 Q;  4FDB A;  1K0S A;  5COR A;  4YY3 L;  4DR4 L;  4OGQ C;  1KQS A;  1SXT A;  1JOO A;  1F77 A;  5T1G A;  4FF3 A;  3OIP A;  3PO3 H;  1Q82 C;  1VCI A;  4XQQ A;  4M8A A;  2D62 A;  1LUZ A;  4IFD I;  1CKO A;  5DM6 3;  3OW7 A;  4HJ5 A;  2JA7 G;  2OCE A;  5IOD A;  1IL2 A;  2ODG C;  2OEO A;  4KN7 C;  1JJG A;  1QUQ B;  2RSN A;  4HJ9 A;  4NXN L;  4KY5 A;  3D6C A;  5C5L A;  1ROD A;  2R92 H;  3A8I E;  3SK8 A;  1LYL A;  2B2U C;  2K6A A;  1SE8 A;  1I6H H;  3PIP 3;  1HNW L;  4LUV A;  4C3I B;  4A3M B;  2CH4 A;  1CK1 A;  4ME3 A;  4IPC A;  5M5Y B;  4DR1 L;  1KAB A;  2EYH A;  3F2D A;  2AQ3 B;  1KDC A;  2YTV A;  4MTK A;  4LUO A;  1EQV A;  1K0R A;  3MFG A;  2ES2 A;  5J39 A;  4JI2 L;  4DAY A;  2VQE Q;  2KFV A;  4LF8 L;  2LXK A;  4CJ1 B;  5CV7 A;  3I4N G;  1HFG A;  3NK9 A;  1SYE A;  3JAM L;  5HY6 A;  4DV0 L;  4HMJ A;  3SR1 A;  1F9S A;  1B7Y B;  1GO3 E;  2NN6 H;  1BCP D;  1LTB D;  1ZXT A;  4BY1 G;  3J7Y W;  4CDC C;  2HD3 A;  1WTQ A;  4XYO A;  4UP7 A;  3VDY A;  3J81 i;  3C46 A;  4KKU A;  5C4X G;  4DAV A;  2PNR C;  2RHS B;  4R8N A;  1VQF A;  5EGT A;  4FYD A;  4DUZ L;  4JBW A;  3HOY B;  4A3K G;  1KIX A;  4QMG A;  5FLM H;  4DF7 A;  4LJZ C;  2UXC Q;  5EPL A;  4A3F H;  1A62 A;  4PZ8 A;  2O5J C;  1PMR A;  3JC6 6;  2OTL A;  4QCL A;  2H1E A;  3HOX G;  4XT1 B;  3UDI A;  5I2X A;  3W5O A;  4RCN A;  4WRD A;  3NTK A;  4YWM A;  1OO9 B;  2F0K A;  3V2T A;  2JQO A;  2M2L A;  1ZYR D;  3PMF A;  4AIM A;  3QKJ A;  1WD0 A;  3I4M G;  2UXD Q;  4U67 3;  1E22 A;  2MNA A;  4A3C G;  3A5Z B;  4ALP A;  1LTA D;  1RTO A;  4K5X A;  5D14 A;  4HSP A;  1A3T A;  1KTK A;  4PG3 A;  3NBH A;  2JA8 H;  1TWH B;  3P7J A;  3BYT B;  3QIA A;  1EOV A;  5EPK A;  2ZM6 Q;  5KYI A;  1E3P A;  2HIX A;  2GVB A;  3PUV A;  4A3D H;  1SFO B;  4JV5 L;  1TY2 A;  1UE1 A;  3BDC A;  3ONA B;  4RGO S;  1WVL A;  2VB2 X;  1BKB A;  1V1O A;  1X3E A;  3OIQ A;  4O0A A;  2Z4H A;  2L12 A;  4DR2 L;  3HEJ A;  2Q8R E;  2PW7 A;  4QUC A;  2BOS A;  1N32 Q;  1YZ6 A;  2X6G A;  1PYW D;  4A3E G;  1HNZ Q;  2B29 A;  1Q46 A;  3D4D A;  4IUR A;  4BY1 B;  3HOU B;  3CHB D;  2B63 G;  5C4X B;  4Q0F A;  3U9O A;  4ZUJ A;  1V8Q A;  1H9M A;  4NPS A;  1CKM A;  3R93 A;  4C1N K;  4A3K B;  3SGI A;  1F2L A;  1IW7 C;  3EBE A;  1V1P B;  4C3I H;  4A3M H;  1IYU A;  3X3N A;  4FXG C;  5ELE A;  1N34 Q;  1S72 A;  5M5Y H;  1I4G A;  4XDX A;  1RCV D;  2O2L D;  1CQF A;  1GOZ A;  3HOX B;  3PF5 A;  4KJO A;  2UUA Q;  1Y8O B;  3PUZ A;  4IOA A;  2OWO A;  1UE6 A;  1E2Z A;  1OXT A;  4DAM A;  3VR5 A;  1DOL A;  3U58 A;  4NXM L;  1B70 B;  3CC2 A;  2MHV A;  2IY5 B;  4LF5 Q;  4CJ0 B;  3K8A A;  1BBW A;  2RDF A;  3NQI A;  1B8A A;  1PYB A;  4HTH A;  3I4M B;  2XNA C;  5TSS A;  3PUY A;  3A56 A;  3CAM A;  2UUB L;  1VQH A;  3K5O A;  4DR3 Q;  5IYB G;  1SYD A;  3HOZ G;  1O78 A;  2BA1 A;  2Z8L A;  1ZKO A;  5IY0 A;  4LFA L;  5IGD A;  5IIF A;  3HOY H;  5BN5 A;  2ZXR A;  1U9R A;  3I73 A;  3ICE A;  2QEJ C;  4IPH A;  3L0O A;  1BBU A;  2R7Z B;  2DJG C;  3BZD B;  4JI0 L;  3GD7 A;  4R4Q A;  2QDB A;  3IKJ A;  5JJK A;  2IHF A;  3T1H Q;  1H1J S;  2EY5 A;  4A3E B;  4OL7 A;  2L4N A;  5LMU L;  4IFD J;  1IKL A;  2XWB B;  1ASY A;  1TU2 B;  3EVQ A;  2LS0 1;  1Q3L A;  3TRZ A;  1CA6 A;  4KHP L;  1VQ7 A;  1EY9 A;  3MEF A;  4DXF A;  3E9I A;  3URY A;  1E2V A;  2CQO A;  3PCO B;  4LF9 L;  3JAM i;  2A69 C;  1D2B A;  1XNR Q;  3GTP B;  4XQN A;  3ZJY C;  3PIO A;  4QY7 A;  2G5D A;  2VNU D;  5C3X A;  1TWH H;  3CPF A;  3ERQ A;  5IGE A;  4A3I G;  2ZTD A;  1R4Q B;  1ONL A;  4B3S L;  5C4Z A;  5FK9 C;  4EVO A;  4B9W A;  4JBK A;  1SFO H;  3H6M A;  1N36 Q;  3DXJ C;  2CKZ B;  4CGY B;  2VZA A;  4QGU A;  2HHH L;  2A6H C;  1KNA A;  2B2Y C;  2B8F A;  1QZG A;  1PH3 A;  3BDO A;  3Q24 A;  2BE5 C;  4DV2 L;  3A8J E;  1HR0 Q;  1EIY B;  2VY3 A;  4BY1 H;  1U4R A;  3K59 A;  3HOU H;  2QIL A;  2B2T A;  4IFD G;  1ESR A;  4DAY B;  5FLX c;  4ME5 A;  2XGT A;  4HSV A;  1E24 A;  3L2P A;  4P72 A;  5C4X H;  1EY0 A;  4YIJ A;  4DK0 A;  4P71 A;  4BBR G;  4FF2 A;  2EPB A;  4A3K H;  3KJO A;  1NUC A;  2K5D A;  3S1M B;  1CSQ A;  2PQA B;  4NKL A;  3R3O A;  1WTO A;  5KIX A;  4LFB Q;  3TZD A;  2MPH A;  3HOX H;  1LV9 A;  2F0S A;  2PZT A;  3OPO A;  3H91 A;  5E4X A;  3KLS X;  3M9B A;  2NVT B;  4JPB W;  4HID A;  5IYD G;  1KDA A;  1JE4 A;  1H9F A;  3AFQ A;  1TWF B;  1GUT A;  2VQE L;  3CRL C;  2F0Q A;  4POG A;  2SOB A;  3ZYY X;  4KKT A;  3I72 A;  3NEN A;  1HFN A;  1A2T A;  2F0L A;  4JBJ A;  1GUS A;  3LX0 A;  4HED A;  1PH2 A;  3UE1 A;  1WTV A;  4K2L A;  2B39 A;  2KVE A;  1D1I A;  1QZH A;  1YNN D;  2H5X A;  2D0O A;  2R7Z H;  2D0P A;  1LT6 D;  4MIU A;  1UEB A;  3QB3 A;  5A35 A;  1QOH A;  5FO9 B;  2W51 A;  4A3E H;  4P74 A;  2UXC L;  3VYU A;  4C3H G;  4A3B G;  2NTT A;  3E6Z X;  2QNF A;  3OMC A;  4V19 0;  5LMN Q;  4DNT B;  1LTT D;  1BDO A;  3LWE A;  1G8Z D;  3QWN A;  1SSO A;  3MVV A;  1Y1V G;  2UXB L;  3H94 A;  4LUZ A;  3VYT A;  3GTP H;  3K0Y A;  4TQU S;  3VYR A;  4BBR B;  3KDF A;  3R2I A;  4OWX B;  1NMG A;  5JAV A;  2UXD L;  2K5V A;  1PHJ A;  4HN7 A;  4BA2 I;  1NCV A;  1X3P A;  3HKS A;  1B2T A;  4K6L A;  2IX0 A;  5LL6 X;  3K7A B;  1ICF B;  4FO2 A;  4DN4 M;  2PZU A;  4J1M A;  1SNQ A;  2ZM6 L;  1ESF A;  3GV6 A;  2PCF B;  1VQ9 A;  3CP0 A;  3LNN A;  2E2D C;  1A2U A;  4PQX A;  5C3E G;  1CA5 A;  1K3R A;  2NUC A;  2LXJ A;  1SRO A;  3KBX A;  1VDZ A;  1BVS A;  4B08 A;  3RZD B;  5BR8 Q;  1N32 L;  3T4A C;  1KXL A;  4GKJ Q;  5ELO A;  3FLG A;  2F0T A;  1XX8 A;  4DV4 Q;  1J6Q A;  3BVM A;  3ITP A;  2CWP A;  2L0C A;  2CWA A;  5IYB H;  1HNZ L;  1BBX C;  1KHI A;  1AN8 A;  1LTS D;  2AWO A;  4BBS G;  2EYO A;  1LO5 D;  1F9P A;  3PUX A;  3TRE A;  1QJO A;  3W1B A;  5D3I B;  4OWW B;  3S1M H;  1Q1B A;  2B2T C;  1EZ8 A;  4RMF A;  3MXN A;  5I2Y A;  4B3R L;  2MUY A;  3I4O A;  3AMU A;  1PH8 A;  3DM3 A;  1II3 A;  1EIG A;  2KW9 A;  4ZRZ A;  1N34 L;  4DFA A;  4HCE A;  2WAQ B;  4C3H B;  4A3B B;  1L2F A;  1I50 B;  4JOI A;  1YHQ A;  2NVT H;  3BJU A;  5KRU A;  1T9H A;  2K33 A;  1N33 Q;  2UUA L;  1TWF H;  4JV5 Q;  1CUK A;  4PNY A;  1Y1V B;  3PIO 3;  2E8G A;  1LM0 A;  2JJQ A;  2K7V A;  3EFX D;  4QQB X;  4P2C B;  3VA7 A;  1YJN A;  4Y52 H;  5I6Y A;  1LAC A;  4LF5 L;  5FLM G;  5IOC A;  3C1E A;  3AYH B;  1ZS9 A;  4GLX A;  4DR3 L;  3NE5 B;  1PH5 A;  4K8I A;  4CJ2 C;  2A73 B;  1I5F A;  2J0T D;  1M1K C;  2F03 A;  1YNJ C;  4FF1 A;  2R7D A;  4KY6 A;  1FNV A;  1L1O A;  5C3E B;  3G7L A;  1JOK A;  1Z9F A;  2AMC B;  3C1F A;  2XRQ D;  5I6W A;  4KI0 A;  3HKZ E;  1Y69 U;  1J5E Q;  5GAG C;  4IFD H;  3P1H A;  3T1H L;  1O7Y A;  2KA7 A;  1TWA B;  2CHB D;  3RLN A;  5KNC A;  4BBS B;  2DUD A;  4R4O A;  3AQQ A;  2F0P A;  1I3Q B;  1YBY A;  4Y7N B;  1G91 A;  1F2Z A;  2L9H A;  4BBR H;  5EAY A;  4HAE A;  5IT9 L;  3SE0 A;  1TKW B;  1XNR L;  1G6P A;  1S5D D;  2ZXO A;  2D2C C;  3K7A H;  5C3W A;  2F4V Q;  3J80 L;  4XTC S;  3A7A B;  1TT2 A;  4OXP A;  1UAP A;  1PH7 A;  4IZ8 A;  2HDL A;  3KF8 A;  1N36 L;  1PH4 A;  3BZC A;  2WII B;  1I94 Q;  4LFA Q;  1C8C A;  4L63 B;  2CW0 D;  1FR3 A;  5C4H A;  4ZKC B;  5KEE A;  1VMP A;  3EN2 A;  1CM9 A;  3T51 B;  4B3M L;  2ALY B;  5IP9 G;  1CFM A;  1HR0 L;  3E3X A;  1Q81 C;  3OSO A;  4UAI A;  1D6E C;  4A3M G;  1HZA A;  5FKA C;  3WOF A;  5LMU Q;  3L7Z C;  2KBN A;  1AE2 A;  3SHL A;  5JJL A;  2VUM G;  4KHP Q;  1SMX A;  3QOJ A;  1VQ6 A;  5A2Q L;  1LAB A;  3I56 A;  3KLS A;  2JA9 A;  2EY2 A;  1NE3 A;  3IFD A;  2VQF Q;  4C2M B;  4V0B A;  1VF5 C;  4C3H H;  3Q23 A;  1I50 H;  4QF4 A;  4LFB L;  3I8Z A;  1AW7 A;  3CCE A;  1D8L A;  1SJH D;  2A74 C;  1GVP A;  4O1N A;  4Z9C B;  5JVG 3;  2UUC Q;  3OMG A;  3B6Y A;  1U4L A;  1WYD A;  1RJT A;  1Y8N B;  2A6E C;  2A68 D;  1PH1 A;  1PLF A;  4C56 C;  1Y1V H;  1LT3 D;  3CC4 A;  3S2H B;  4MNO A;  1M4V A;  5F2D A;  3EIV A;  3BVZ A;  4ZLT F;  4JOI C;  1IYJ B;  4GS3 A;  4H44 C;  3NWS A;  4L8J A;  2LY7 A;  4DR7 Q;  1RHP A;  1KRS A;  1NSN S;  3CKI B;  4R9W A;  2R93 G;  2B2V A;  1TS4 A;  4IUP A;  5CGK A;  4ULL A;  4BS9 A;  1CKN A;  5DLQ E;  5C3E H;  2XIW A;  2L15 A;  2PNH A;  3HGB A;  1GUW A;  2PMZ B;  4JG2 A;  3N6R A;  3S9W A;  2EVB A;  3RLF A;  4EQ5 A;  3M4Y A;  1L0W A;  2AKW B;  1QB5 D;  3TEH B;  4ZK9 B;  1X56 A;  2A6H D;  2KEC A;  1I4Q A;  2F0F A;  3U4V A;  1VQO A;  2ZXP A;  1UE7 A;  3I55 A;  3NEM A;  1TWA H;  2F0H A;  2RHQ B;  4LMQ D;  4AYB G;  1Q90 A;  5FLX E;  4BBS H;  4GNX A;  4Y7N H;  1I3Q H;  5LMN L;  5D3D A;  3TZU A;  1JIC A;  4L5T A;  1V9P A;  2Z6K C;  3CCM A;  4C1N I;  4GLV B;  1D1K A;  4XT3 B;  2AWN A;  2Z9H A;  1DJR D;  2VUM B;  1VQE A;  5G3L D;  1H9S B;  5KYL A;  3DMU A;  1JWS D;  4I7A A;  5E4W C;  5DNF A;  3KFU A;  1T5X D;  4A3L G;  1HQR D;  1FGB D;  2VB3 X;  3UI2 A;  2MO0 A;  3MXN B;  2NVX B;  4X6A H;  3HOU G;  1EEI D;  1AE3 A;  4G57 A;  4DV6 Q;  4JC0 A;  1MBY A;  1QNK A;  3RNU A;  2F0O A;  2HUG A;  5M5X B;  3G6J B;  2IWH A;  1X3Q A;  1BNZ A;  3W3A A;  2K5W A;  2QA4 A;  2F0M A;  2KHJ A;  5JEA J;  5D65 A;  5BR8 L;  1ET9 A;  4GKJ L;  2M00 A;  4JW0 A;  4DV3 L;  1F2Y A;  1A3U A;  4DV4 L;  1AEX A;  4YWK A;  1DZ1 A;  2LC3 A;  5JOB A;  2RDG A;  1TS2 A;  4IJL A;  2R93 B;  3U50 C;  1NY4 A;  1TY0 A;  3KLR A;  5E1F A;  3VR3 A;  2WKC A;  2JP1 A;  4U68 A;  1XNQ Q;  1EY4 A;  2UXB Q;  4C2M H;  3J80 i;  5C0X I;  3NXW A;  3QG1 A;  3PGZ A;  4HJ8 A;  4EQP A;  3AU7 A;  1AZQ A;  2K01 A;  3M85 A;  2F0D A;  3GTG B;  4QIW E;  1PFN A;  2FIN B;  1U0L A;  2AUK A;  4DV7 Q;  2ZTE A;  4IUQ A;  1ENF A;  3G71 A;  3Q22 A;  5J22 A;  1PA6 A;  3J81 c;  4K6D A;  4RGN A;  5HGQ A;  4AYB B;  3S2H H;  3HFZ B;  3MXP A;  1HA5 A;  2Y0S G;  4R1J A;  3WOE A;  1XXG A;  4G7Z C;  1N33 L;  3M7G A;  5JEA G;  3FDT A;  4TSS A;  4C3J G;  2EZV A;  2R7Z G;  1JJ2 A;  2CH4 W;  4OX9 Q;  1DM0 B;  3HP3 A;  2L5T A;  5FOB B;  2C5C A;  4G7O C;  3K81 C;  1HZC A;  1AFP A;  1PZI D;  1VQP A;  4JI8 Q;  4ZUI A;  1TS3 A;  2MO1 A;  3IAY A;  1IKM A;  2K5Q A;  1J9O A;  1SYF A;  2GA4 B;  3CU7 A;  2EXD A;  3RUZ A;  3C2P A;  4IPD A;  1UNS A;  5ELB A;  2WB1 E;  3FHW A;  4B9X A;  4LF4 Q;  5IP9 H;  1U4M A;  5KGU A;  1C0A A;  4B3R Q;  3K5M A;  1J5E L;  1STA A;  3NEL A;  5GQO A;  1GJX A;  4UP9 A;  5CR3 A;  3D0F A;  2DNE A;  2LKV A;  2MPM A;  5JJI A;  3PO2 G;  1SE2 A;  3UE0 A;  2JA5 B;  2Q2H A;  2VUM H;  1DGS A;  5EKL A;  2CCZ A;  5NUC A;  1VQN A;  1ZEQ X;  2ATW A;  4GNX C;  2L1B A;  3NTI A;  4BXX G;  1HNX L;  1Q1E A;  2EYM A;  3H0G G;  5EPJ A;  3C3L A;  5M9O A;  4BA1 I;  3LLR A;  5AFW A;  4A75 A;  2F4V L;  2NVX H;  5GRO A;  4JI5 L;  2R61 A;  3K0X A;  4KD4 A;  1SYB A;  5M5X H;  1OXU A;  5AJ3 Q;  3TSS A;  5C4J B;  4K0K Q;  3UDG A;  3Q8D A;  3D4R A;  2ODC I;  2EJF C;  4JI7 Q;  1I94 L;  4KV6 A;  2BCO A;  2Y0S B;  1E1O A;  1SRU A;  2EY6 A;  3GDE A;  1EY8 A;  2EJG C;  3TS0 A;  5T1I A;  1QVG A;  4C3J B;  1AP0 A;  3TP7 A;  2HIV A;  4X65 Q;  1GHK A;  2R93 H;  4CDD C;  1AZP A;  1WTP A;  2I07 B;  4DV5 Q;  3FMC A;  2KEN A;  3CCL A;  3TQY A;  1FYC A;  1D7Q A;  2B2W A;  3IRB A;  3DEP A;  3MTS A;  2C35 B;  1VQ4 A;  1GKH A;  1VQ5 A;  3A0J A;  1WJJ A;  1DON A;  4YCU A;  1G51 A;  1KLU D;  4O2D A;  1YNJ D;  1B9M A;  1O7Z A;  3GTG H;  1YNX A;  4EX5 A;  1CKN B;  2VQF L;  2L11 A;  1QVF A;  1NR2 A;  1HUN A;  4HIK A;  1HXY D;  1WD1 A;  1CSP A;  2YYZ A;  1IBK Q;  4RAU C;  2OF1 A;  1PXU A;  3SVM A;  3TP6 A;  4XXE A;  2ZJR A;  2UUC L;  2P5Z X;  4RWS C;  2RDH A;  1C48 A;  1RF2 D;  1Q86 C;  3PO2 B;  1A6X A;  2H4O A;  3EA6 A;  2PPB C;  3HRZ C;  4GNX B;  2D9U A;  2K28 A;  4M1U B;  1L0Y B;  2MP1 A;  4PZ6 A;  4F88 A;  3OTO L;  3RN5 A;  3DLL A;  4IUV A;  2NZ1 D;  3H0G B;  4B3M Q;  4DR7 L;  4A3L H;  1PRT C;  2HT1 A;  1B44 D;  1E2W A;  1EIF A;  2Q2T A;  2K03 A;  1XTD A;  3E0E A;  1A3V A;  1HR0 W;  4OO1 I;  4FVM A;  4A93 G;  3JAM c;  2JXM B;  1EN7 A;  2SNS A;  3DUZ A;  2EYJ A;  2NZH A;  2WAC A;  3UDF A;  3GQB A;  4DK3 C;  1C4Q A;  3CMA A;  1MJE A;  1HQM C;  1RDP D;  3RN2 A;  1JE5 A;  2E2I B;  1BOS A;  3S1R B;  1HTP A;  5GAH C;  2JA5 H;  3K57 A;  5L37 A;  4AQY Q;  5C44 G;  4CDE C;  5C0X J;  2A19 A;  2JE6 I;  5HGT A;  1B53 A;  3CME A;  2I5M X;  2NB0 A;  1B3Q A;  2HJQ A;  2KVD A;  1BCP C;  1B9N A;  1GXD C;  1MKH A;  1W3S A;  2N8N A;  4RHR A;  4PMW A;  4A3J B;  4JI6 Q;  2E76 C;  3CQZ B;  3O13 A;  3R2T A;  5C4J H;  2XTI A;  2Z0S A;  1IL8 A;  1STG A;  1V43 A;  1MGS A;  2ZT9 C;  5EQ0 A;  3E5S A;  2ICI A;  1Q12 A;  4DV6 L;  1HJP A;  1KC8 C;  2FXQ A;  1SDF A;  1ILQ A;  4QL5 A;  1JC7 A;  1IHZ A;  4RG1 A;  5JEA H;  4GKK Q;  1B4O A;  4DKA C;  1CQV A;  2A6E D;  4K14 A;  3PSI A;  3NBH B;  3W1G A;  4C3J H;  2HQE A;  1SMY C;  5EJW A;  4DXG A;  1M8A A;  3QJY A;  1JOQ A;  3SDZ A;  4IJH A;  3SK4 A;  1K8O A;  3BS1 A;  1NNX A;  5FJ8 G;  2VS1 A;  1PFB A;  1PRT B;  3Q0A A;  4H02 A;  2WAQ G;  3KBG A;  5CIU A;  1TWG B;  4I7Z C;  2K5N A;  1FD7 D;  4DK1 A;  5C0X G;  2B8G A;  2BA0 A;  3TP5 A;  1I4R A;  2YTX A;  2RCN A;  1JCK B;  3D3R A;  1ZYR C;  5K5P A;  1XNQ L;  2KHI A;  4TRD A;  4A93 B;  1A0I A;  4DV1 L;  3F2C A;  4F87 A;  5LMN W;  3D31 A;  3OYY A;  4HIO A;  2B2W C;  2X69 A;  1K3B C;  3VYS A;  4AH6 A;  4DV7 L;  1IYV A;  5CYU A;  3J81 j;  5GAD C;  1B50 A;  3PO2 H;  4DR6 Q;  2KED A;  2F3I A;  1P8L A;  4PZ7 A;  2K05 A;  2N3S A;  3IFT A;  4ID6 A;  1YJW A;  3J7Z C;  3A5U A;  3KOJ A;  5LL6 S;  5C44 B;  4CKE A;  4BXX H;  5CMD A;  2PZW A;  4RA8 A;  2KCC A;  3H0G H;  1SNM A;  5BN3 A;  1JWM D;  4JBM A;  4OX9 L;  1BCP B;  4G7H C;  2RKS A;  3CCJ A;  1Z6H A;  4DV3 Q;  1U5K A;  5I4D A;  5IGC A;  2EXZ A;  3AB9 A;  1VQC A;  4PMB A;  4EQN A;  4PMC A;  4EGV A;  4JI8 L;  1RTN A;  1QUQ A;  1S5B D;  3HOV B;  4X64 Q;  1SLJ A;  3FVQ A;  3NP8 A;  5M3F G;  1IBM Q;  1V66 A;  1XTC D;  4RCO A;  4P75 A;  4G4K A;  5KNB A;  2MGS A;  3KK7 A;  1Q7Y C;  1KRT A;  3M3Y B;  5HUR A;  4J15 A;  2I46 A;  4WFN 3;  1LTG D;  1SNC A;  4OIK A;  2O4X A;  3MXG A;  4LF4 L;  4XQJ A;  2E2I H;  5EKK A;  3S1R H;  3RR5 A;  4JYA Q;  2L55 A;  3NUC A;  1DYQ A;  2K32 A; 
#chains in the Genus database with same CATH homology
 1X3E A;  4O0A A;  4UP8 A;  4DR2 L;  4HJ7 A;  1KD1 C;  3CC7 A;  1O7I A;  4MNO A;  3EIV A;  1N32 Q;  1YZ6 A;  2ZJP A;  4A3G H;  1E1T A;  1A8V A;  2KCT A;  2MFI A;  4JOI C;  1VQA A;  1IYJ B;  2OQK A;  4GS3 A;  3PO3 H;  4A3E G;  1HNZ Q;  3AFP A;  2K5H A;  2B29 A;  1Q46 A;  1YI2 A;  3H3V H;  1KRS A;  4A3J H;  4DR7 Q;  1K9M C;  3CQZ H;  2PI2 A;  3PV0 A;  2Y0S E;  3H15 A;  3HKZ G;  2R93 G;  1X9N A;  1XJV A;  1GM5 A;  5GAE C;  2B63 G;  1CKN A;  1TWC H;  5DLQ E;  1UWV A;  5C3E H;  2E5L Q;  2JEA I;  5AJ3 L;  1W2B A;  1IZ6 A;  2L15 A;  2PNH A;  4NPS A;  2IX1 A;  4K0K L;  2G80 A;  1CKM A;  1XPO A;  4JG2 A;  3RLF A;  4EQ5 A;  4JI7 L;  1EWI A;  3SGI A;  4HJA A;  2CFM A;  3CF5 A;  3EBE A;  3HOV G;  1L0W A;  4C3I H;  1VQJ A;  4A3M H;  2AKW B;  3TEH B;  1X56 A;  1YEZ A;  1N34 Q;  1FJG L;  3U4V A;  1S72 A;  5M5Y H;  1VQO A;  4R4C A;  4OON A;  1UE7 A;  3I55 A;  1E7L A;  1IBL L;  3NEM A;  1TWA H;  2RHQ B;  1M90 C;  1KL9 A;  4AYB G;  2BH8 A;  3CCS A;  1S3O A;  4BBS H;  4OWT B;  1TWG H;  2EIF A;  2I5H A;  4GNX A;  4X65 L;  3PF5 A;  2UUA Q;  4Y7N H;  1I3Q H;  3I4M H;  3PUZ A;  5LMN L;  4A3G G;  4A3C H;  4IOA A;  4L5T A;  2OWO A;  1V9P A;  4HIM A;  1UE6 A;  2Z6K C;  2K75 A;  4GN4 B;  3CCM A;  4DV5 L;  1OXT A;  1XMQ L;  4DAM A;  2Q2U A;  3U58 A;  4NXM L;  4GLV B;  1B70 B;  4YY3 Q;  1G29 1;  3CC2 A;  2AWN A;  4A93 H;  4DR4 Q;  1XMO L;  2IY5 B;  3RZO H;  3CCR A;  4LF5 Q;  3K8A A;  1VQE A;  1BBW A;  4JI4 Q;  3TS2 A;  5ELN A;  1B8A A;  1PYB A;  4LNQ A;  3PUY A;  2UUB L;  3CAM A;  3GTM H;  1VQH A;  1PFS A;  4DR3 Q;  2LD7 A;  3M4Q A;  5IYB G;  3CXC A;  3KFU A;  1HNX Q;  3GTQ H;  5K36 G;  3HOZ G;  2BA1 A;  1OTC A;  4A3L G;  4LFA L;  3KF6 A;  5IY0 A;  3CCQ A;  2MO0 A;  3MXN B;  3HOW H;  1IBK L;  4X6A H;  3I7F A;  3HOU G;  4DV6 Q;  1AE3 A;  4NXN Q;  4A4I A;  4JC0 A;  3HOY H;  2K4K A;  3RNU A;  4JI5 Q;  3ICE A;  4IO9 A;  5C44 H;  1EQQ A;  4IPH A;  3L0O A;  1BBU A;  4DR5 L;  1X3G A;  1HNW Q;  2QA4 A;  2KHJ A;  3GD7 A;  5JEA J;  4R4Q A;  4JI0 L;  3G6E A;  1X65 A;  5BR8 L;  2VW9 A;  4GKJ L;  3F8T A;  2IHF A;  2OTJ A;  4DR1 Q;  4DV3 L;  3T1H Q;  5JJK A;  2B63 H;  1Y1W G;  5LMU L;  4DV4 L;  4IFD J;  4YWK A;  3FKI G;  1C7Y A;  2WP8 J;  1WFQ A;  1ASY A;  2LC3 A;  2OQ0 A;  3TRZ A;  4OO1 G;  1HH2 P;  4IJL A;  4KHP L;  4JI2 Q;  3U50 C;  1VQ7 A;  1NY4 A;  4X66 Q;  3MEF A;  4LF8 Q;  4LFC L;  2B3G A;  3E9I A;  3HOV H;  1PV4 A;  2CQO A;  2VL6 A;  3PCO B;  4LF9 L;  3JAM i;  4YHH Q;  1XNQ Q;  3S17 H;  4DV0 Q;  1VQB A;  1XNR Q;  2UXB Q;  4YWL A;  3ZJY C;  3PIO A;  2NVQ H;  1PH9 A;  4C2M H;  4QY7 A;  2K52 A;  1JB7 A;  3M3Y H;  3A74 A;  3J80 i;  2VNU D;  5C0X I;  1TWH H;  3CPF A;  3UDX A;  4A3I G;  2ZTD A;  3PGZ A;  4HJ8 A;  4B3S L;  2Q2I A;  3M85 A;  4DUY L;  4QIW E;  3PUW A;  3PO3 G;  1U0L A;  4R4T A;  4JBK A;  1K73 C;  3BU2 A;  4DV7 Q;  1SFO H;  2LSS A;  2ZTE A;  1N36 Q;  3LGJ A;  2CKZ B;  3G71 A;  1PA6 A;  2VZA A;  3J81 c;  5FJ8 H;  4QGU A;  4DUZ Q;  5HGQ A;  2HHH L;  3S2H H;  2K14 A;  3HFZ B;  2Y0S G;  4R1J A;  1NTG A;  1QZG A;  1N33 L;  1R9T H;  3H3V I;  5JEA G;  1PH3 A;  2R92 G;  1OXS C;  4AQY L;  4DV2 L;  1Z47 A;  1HR0 Q;  2JEB I;  3HOZ H;  1EIY B;  2ZJQ A;  4DPG A;  2MQH A;  2VY3 A;  1JJ2 A;  1FGU A;  4BY1 H;  4OX9 Q;  3HOU H;  1LTL A;  3PIP A;  2R7Z G;  4IFD G;  5IYC G;  3RLO A;  4DAY B;  5FLX c;  3AEV A;  4APV A;  2XGT A;  3S15 H;  1V1Q A;  1E24 A;  3K81 C;  3L2P A;  1EUJ A;  4IOC A;  1EYG A;  1HZC A;  4P72 A;  5C4X H;  3OTO Q;  3OW2 A;  1VQP A;  4JI6 L;  2HQL A;  4JI8 Q;  3M7N A;  2MO1 A;  1X3F A;  1FL0 A;  1WOC A;  4GN5 A;  4P71 A;  4BBR G;  1K8A C;  4A3K H;  4LW1 A;  4QJF A;  3KJO A;  3KDF B;  1CSQ A;  4KLK A;  4L5S A;  1X6O A;  2PQA B;  1PVO A;  2EXD A;  4JI1 Q;  3CCU A;  3M4O H;  4GKK L;  1GJJ A;  2NN6 G;  4IPD A;  4YCW A;  4L5Q A;  4LF6 Q;  2WB1 E;  3FHW A;  4LF4 Q;  5IP9 H;  5IP7 G;  1C0A A;  4LFB Q;  4B3R Q;  1J5E L;  3NEL A;  2MPH A;  5GQO A;  2UU9 L;  3K80 C;  3HOX H;  4UP9 A;  5E7N A;  4A76 A;  1YVC A;  3D0F A;  1JT8 A;  1WCM H;  4KHZ A;  4LWC A;  3S1N H;  1X55 A;  4DR2 Q;  4NB3 A;  5JJI A;  3M9B A;  4HID A;  3PO2 G;  5IYD G;  3UE0 A;  1L1O C;  4A3I H;  4WJ3 M;  1H9F A;  2PI2 E;  3AFQ A;  2Q2H A;  4JI3 L;  2VUM H;  1DGS A;  2YTY A;  2CCZ A;  2VQE L;  5M3F H;  1YJ9 A;  4POG A;  4UY8 C;  2I0Q A;  1VQN A;  2ATW A;  1NMF A;  2F52 A;  4POF A;  1NBW A;  4GNX C;  4A3F G;  1HNX L;  1Q1E A;  3S2D H;  4BXX G;  3H0G G;  4BA1 I;  4P73 A;  3CCV A;  3NEN A;  4GOP A;  3T1Y L;  1VQM A;  4A75 A;  2F4V L;  2NVX H;  4JBJ A;  5GRO A;  1PH2 A;  4JI5 L;  3UE1 A;  2YU9 H;  2R6G A;  3K0X A;  1QZH A;  2AHO B;  1Q8K A;  5M5X H;  1OXU A;  5AJ3 Q;  4K0K Q;  3UDG A;  3I2Z A;  2H5X A;  3Q8D A;  2D0O A;  2ODC I;  3G48 A;  2Z6K A;  4JI7 Q;  2R7Z H;  2D0P A;  1I94 L;  3S16 H;  4DR6 L;  1C9O A;  1PH6 A;  2E2J H;  1UEB A;  1E1O A;  1SRU A;  3GDE A;  2W51 A;  1FJG Q;  3KJP A;  3TS0 A;  3K7U C;  4A3E H;  4P74 A;  1IBL Q;  2JA8 G;  3GTK H;  1QVG A;  2UXC L;  1AH9 A;  4A3B G;  4MZ9 A;  2N78 A;  2QNF A;  2HIV A;  3ULP A;  1VQG A;  1WI5 A;  2RF4 A;  5M3M G;  4X65 Q;  2E2H H;  1Y02 A;  5LMN Q;  4LF7 L;  3CD6 A;  4A3D G;  3F2B A;  2R93 H;  4JCV E;  3PF4 A;  2QEX A;  5J3B A;  4DV5 Q;  1Y1V G;  2KEN A;  4NXM Q;  3CCL A;  2UXB L;  3F1Z A;  4LUZ A;  3TQY A;  1D7Q A;  3GTP H;  1XMO Q;  3IRB A;  1MJC A;  2R7F A;  4B3T L;  2C35 B;  4TQU S;  1GKH A;  2KCM A;  1VQ4 A;  3A0J A;  3KDF A;  1WJJ A;  1NMG A;  1UE5 A;  4OWX B;  3STB D;  2A1A A;  1SR3 A;  4IPG A;  4YCU A;  2PQA A;  1G51 A;  3U4Z A;  2JA5 G;  2K5V A;  1PHJ A;  2UUB Q;  3FP9 A;  4O2D A;  2UXD L;  1IBM L;  3GTG H;  1YNX A;  5IWA L;  3ULJ A;  4BA2 I;  4EX5 A;  1CKN B;  3HKS A;  4GLA C;  2VQF L;  1K8G A;  2IX0 A;  2WAQ E;  1N9W A;  1QVF A;  4DV1 Q;  4HIK A;  1VQI A;  2K50 A;  5IYD H;  1CSP A;  2YYZ A;  3CW2 C;  1IBK Q;  1VQL A;  3S24 A;  3RZD H;  2ZM6 L;  2JA6 G;  1YIJ A;  1JJC B;  4DNI A;  3J7A 5;  4BY7 H;  1VQ9 A;  3CPW A;  4JYA L;  3CP0 A;  1VQD A;  2ZJR A;  2UUC L;  5IE8 A;  2N49 A;  5C3E G;  1A63 A;  1L1O B;  1K3R A;  3WWV A;  4DR5 Q;  2LXJ A;  1SRO A;  1Q86 C;  1TXY A;  4MTN A;  1BVS A;  4JI0 Q;  1E7D A;  5BR8 Q;  2YV5 A;  1N32 L;  1KXL A;  4GKJ Q;  4GNX B;  5ELO A;  1MIU A;  3M4P A;  4DK6 C;  2IHE A;  4DV4 Q;  5M5W H;  1J6Q A;  4PZ6 A;  1Y14 B;  3OTO L;  2CWP A;  4X62 Q;  2CWA A;  5IYB H;  3DLL A;  3RN5 A;  1KHI A;  1HNZ L;  1VQ8 A;  4B3M Q;  4DR7 L;  1XPU A;  1YHB A;  2AWO A;  2PMZ E;  4A3L H;  2WB1 G;  4BBS G;  1VQK A;  1EQR A;  3PUX A;  3TRE A;  4LFC Q;  3ERS X;  2HT1 A;  1EIF A;  1PYS B;  2Q2T A;  4L5R C;  4LF9 Q;  1ASZ A;  3W1B A;  2GN5 A;  1XTD A;  2A8V A;  3E0E A;  4OWW B;  3S1M H;  2NVY H;  1Q1B A;  5IT9 c;  1HR0 W;  4JI1 L;  4OO1 I;  4A93 G;  3JAM c;  1EN7 A;  2V1C C;  2E5L L;  4LF6 L;  4A3B H;  4RMF A;  1VS0 A;  4B3R L;  4B3S Q;  3KF6 B;  3I4O A;  2NZH A;  5M3M H;  3J80 c;  4DUY Q;  1PH8 A;  2QGQ A;  2I5L X;  3DM3 A;  3UDF A;  4DK3 C;  1N34 L;  4YCV A;  1Y1W H;  3CMA A;  2ZTC A;  1MJE A;  1OXX K;  1OXV A;  3FKI H;  3RN2 A;  2HHH Q;  1L2F A;  3KF8 B;  1JE5 A;  4JOI A;  1HZ9 A;  3HOW G;  1YHQ A;  1K83 H;  3BJU A;  2NVT H;  1T9H A;  5GAH C;  3HOY G;  1GD7 A;  1VQ5 A;  3ER0 A;  2JA5 H;  1N33 Q;  2UUA L;  1SN8 A;  1TWF H;  4JV5 Q;  1CUK A;  1YNS A;  1JEI A;  4XIG S;  4AQY Q;  2E8G A;  5H1S E;  5C44 G;  1LM0 A;  2JJQ A;  4FDB A;  4DV2 Q;  5C0X J;  1EFW A;  4YY3 L;  2A19 A;  2JE6 I;  4DR4 L;  4QQB X;  1KQS A;  1YJN A;  4Y52 H;  3CME A;  2I5M X;  2JA6 H;  4LF5 L;  4JI4 L;  5FLM G;  2HJQ A;  4R4I A;  3AYH B;  1W3S A;  1MKH A;  2N8N A;  1ZS9 A;  4PMW A;  4GLX A;  1VCI A;  4DR3 L;  1Q82 C;  1PH5 A;  4JI6 Q;  2D62 A;  1LUZ A;  4IFD I;  1CKO A;  3STB C;  1I5F A;  2XTI A;  2Z0S A;  5C4J H;  2OCE A;  4HJ5 A;  1M1K C;  1V43 A;  2ASB A;  2JA7 G;  1IL2 A;  2ODG C;  1JJG A;  1H9E A;  1QUQ B;  2EQS A;  2ID0 A;  1Q12 A;  2R7D A;  4NXN L;  4DV6 L;  1HJP A;  4HJ9 A;  1KC8 C;  2FXQ A;  4GOP C;  4QL5 A;  1L1O A;  1RL2 A;  4RG1 A;  4GKK Q;  2R92 H;  1Z9F A;  2AMC B;  4DKA C;  1LYL A;  1SE8 A;  3PSI A;  4KI0 A;  1N8R C;  3NBH B;  1YIT A;  3W1G A;  3HKZ E;  4C3J H;  1J5E Q;  1I6H H;  1HNW L;  4LUV A;  2UU9 Q;  3E9H A;  5GAG C;  4BY7 G;  4ME3 A;  1RIP A;  4IPC A;  5IYC H;  4IJH A;  2IT1 A;  1GKU B;  1H95 A;  2NN6 I;  4DR1 L;  2JK8 A;  3T1H L;  3GTO H;  3F2D A;  5FJ8 G;  2VS1 A;  2YTV A;  3RLN A;  4LUO A;  1K0R A;  2WAQ G;  4H02 A;  2ES2 A;  2DUD A;  4R4O A;  3AQQ A;  4JI3 Q;  1YBY A;  2K5N A;  4JI2 L;  2VQE Q;  4X66 L;  4BBR H;  5C0X G;  2KFV A;  1X54 A;  4LF8 L;  3ULL A;  2BA0 A;  2LXK A;  5EAY A;  3I4N G;  2YTX A;  4YHH L;  2RCN A;  1XNQ L;  5HY6 A;  4DV0 L;  1XMQ Q;  2KHI A;  1XNR L;  1G6P A;  1A0I A;  4DV1 L;  3GTJ H;  1B7Y B;  1GO3 E;  4AYB E;  3F2C A;  3T1Y Q;  4BY1 G;  3K7A H;  3GO5 A;  5LMN W;  5IP7 H;  2F4V Q;  3D31 A;  3OYY A;  4HIO A;  1KAW A;  4XTC S;  4OXP A;  3GTL H;  1FVI A;  1XPR A;  4UP7 A;  2GVA A;  3J81 i;  3VDY A;  1IXR A;  2WFW A;  1PH7 A;  4AH6 A;  4X64 L;  4GN3 B;  5C4X G;  4DV7 L;  2RHS B;  3J81 j;  1N36 L;  1VQF A;  3BZK A;  5GAD C;  4A3J G;  1PH4 A;  3BZC A;  1I94 Q;  4DUZ L;  4JBW A;  4LFA Q;  3PO2 H;  4DR6 Q;  2F3I A;  1S40 A;  4A3K G;  1P8L A;  4PZ7 A;  2N3S A;  1KIX A;  5FLM H;  1YJW A;  3J7Z C;  3A5U A;  3EN2 A;  3KOJ A;  2UXC Q;  4X62 L;  1NJI C;  2NZO A;  4A3F H;  4B3M L;  4BXX H;  2ALY B;  1A62 A;  4PZ8 A;  5IP9 G;  1HR0 L;  3H0G H;  1P16 A;  2JA7 H;  3JC6 6;  2OTL A;  1Q81 C;  4LF7 Q;  4JBM A;  3KLW A;  3HOX G;  4OX9 L;  1GL9 B;  3CCJ A;  1HZA A;  3UDI A;  4A3M G;  1WCM G;  3W5O A;  4DV3 Q;  1U5K A;  4YWM A;  5LMU Q;  1VQC A;  3L7Z C;  2KBN A;  1AE2 A;  4JI8 L;  2JQO A;  4B3T Q;  1QUQ A;  5JJL A;  2VUM G;  4GOP B;  1SMX A;  4X64 Q;  1SLJ A;  4AIM A;  4KHP Q;  5M3F G;  1VQ6 A;  3I4M G;  2UXD Q;  2QNC A;  3I56 A;  3S14 H;  2MNA A;  1E22 A;  2JA9 A;  1NE3 A;  3A5Z B;  1IBM Q;  5IWA Q;  4P75 A;  4ALP A;  2BH2 A;  4A3C G;  1JMC A;  1HZB A;  1E7Z A;  1YHA A;  2VQF Q;  1QVC A;  1Q7Y C;  1KRT A;  4J15 A;  4PG3 A;  2JA8 H;  2DGY A;  1EOV A;  4C3H H;  4TVA B;  4LF4 L;  2ZM6 Q;  1E3P A;  1I50 H;  2HIX A;  2E2I H;  4LFB L;  3CCE A;  3KYH C;  3S1Q H;  1D8L A;  2GVB A;  3S1R H;  4WJ4 A;  3RR5 A;  4JYA Q;  3PUV A;  4A3D H;  1GVP A;  2UUC Q;  4JV5 L;  1WYD A;  3B6Y A;  1PH1 A;  3I4N H;  2DK4 A;  1UE1 A;  3G4S A;  4UPA A;  1BKB A;  1Y1V H;  3CC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...