2A8VA

Rho transcription termination factor/rna complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
118
structure length
118
Chain Sequence
MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein/rna
molecule keywords 5'-R(P*CP*CP*C)-3'
publication title The structural basis for terminator recognition by the Rho transcription termination factor.
pubmed doi rcsb
source organism Escherichia coli
total genus 33
structure length 118
sequence length 118
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07498 Rho_N Rho termination factor, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.10 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 2a8vA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2a8vA02
4DV2L 5C44G 1KQSA 2F4VL 1PYSB 2Q2TA 1L1OB 4JI4Q 1BBUA 4A93G 4LF6Q 5GADC 3CF5A 5JEAG 4OO1G 4DR3L 1HZCA 4XTCS 3AEVA 2VQFQ 2E5LL 3BZCA 4A3LH 2R93G 1M1KC 1MJCA 2F3IA 2VW9A 4DUYL 4HJ7A 3G71A 1VQPA 1SLJA 2R7FA 2VS1A 1N36Q 4JI7L 1X6OA 1IXRA 3S2HH 3KDFB 3CCMA 4IPDA 4AQYQ 2KCTA 3TRZA 2JEAI 1Y1VG 3M85A 2IX1A 3A74A 1HZBA 4GKKL 3M4OH 4IOCA 1G291 4YY3Q 4QY7A 4BY1G 4DV7Q 2VNUD 3PV0A 4PG3A 3F1ZA 1G6PA 3CC7A 4K0KQ 5GAEC 1KHIA 2GN5A 1L1OC 4OWXB 3TREA 3HOZH 1WJJA 5ELOA 1C0AA 4BBSG 4C3IH 2EXDA 2I5MX 3CW2C 4NXNL 4HJ9A 4A3DH 3GD7A 4TVAB 3U4VA 1GVPA 4DV6Q 1VQDA 2CKZB 1S3OA 4LNQA 1W3SA 4JV5Q 3ULPA 1HR0L 2JA8G 3PUVA 4YHHQ 1HJPA 4X66L 1HR0W 2LSSA 3J80c 1CKNB 2WAQG 1DGSA 1PH6A 2AKWB 4IFDG 3CCRA 2VUMG 4AYBE 5LMUQ 4ALPA 4NXML 2N8NA 4P73A 3CMEA 3HKZE 2JA6H 3M9BA 1PFSA 1N33Q 3H3VH 1Z47A 1VQAA 4DR6Q 2OQ0A 1FL0A 4DR7L 4DR2Q 1VCIA 4A76A 1QVFA 1NMFA 2YYZA 2A8VA 2DGYA 3L7ZC 5C44H 3KF6B 2IY5B 3PUYA 5LMNQ 4FDBA 2XGTA 3K8AA 5IP7G 1I94L 2V1CC 3CAMA 1P16A 5EAYA 2R93H 1VQHA 3M4QA 1E24A 1V1QA 2EQSA 2YTVA 2JA9A 1OXUA 3PSIA 5GROA 4DR1Q 4IPCA 2NVQH 2RHQB 2UUBQ 4DV5Q 2OWOA 2C35B 4A3IH 3AYHB 1B8AA 4LFCL 4OWWB 4C3HH 3S14H 2KHJA 1IBKL 3S15H 2UXBL 3DM3A 3GTJH 3I4MG 2JK8A 4QIWE 1WOCA 4QQBX 3K0XA 1CSPA 1TXYA 1TWCH 1C9OA 3CCEA 4HIKA 3T1HQ 4JI0L 4JOIC 3GTGH 4B3RQ 4NPSA 4DV2Q 4NB3A 5IT9c 4BBRH 2F4VQ 3CCUA 4QL5A 3UDXA 1YJ9A 1MIUA 5C3EG 1Y1WG 2R7ZH 3D0FA 5M3MG 2R92G 4BA1I 2YV5A 4GS3A 4DR3Q 3RZOH 4ME3A 4POGA 5M5XH 2Y0SG 3F2BA 4AIMA 1PA6A 1N34L 2I5HA 1X3GA 2JA5H 2E5LQ 1K83H 3CP0A 4JI5L 3HOVH 1OTCA 4DUYQ 1LUZA 2Q2HA 3Q8DA 1I6HH 2VUMH 4JI7Q 4R4TA 4EQ5A 4BA2I 4YWMA 4LF5L 1HZ9A 2D0PA 5C4XG 1EFWA 2ZTCA 3CC4A 2Z0SA 1Q12A 4IJLA 2WAQE 4GKKQ 2JA7G 1JMCA 1PYBA 2A19A 4L5TA 3U50C 1X54A 2UXCL 2PMZE 2Q2IA 4PZ8A 4A3FG 1U0LA 1WCMH 5GQOA 3PO3G 4NXNQ 3U4ZA 3K80C 2Z6KC 3BZKA 2B29A 5IYBG 3ERSX 3W5OA 1BBWA 4C2MH 2WB1G 1HR0Q 1JB7A 4X64L 5C0XG 3K81C 4X66Q 3A5ZB 3AFPA 2VZAA 2IT1A 3J81c 3KLWA 1TWAH 2Z6KA 4NXMQ 1MKHA 3EN2A 3A0JA 3S1QH 2N3SA 1JJCB 5IP9G 2RHSB 2PI2E 4O0AA 3I4MH 1YI2A 2IX0A 3T1HL 4A3EH 3E9IA 3PF4A 2HHHL 2E2HH 4APVA 1PHJA 4DR7Q 3S16H 3RNUA 1YNXA 5JJLA 3NEMA 4GLAC 4X6AH 5H1SE 1AE3A 2ZJPA 3H15A 5C3EH 1SR3A 1PVOA 3PUZA 1I94Q 2N49A 1P8LA 4LFBL 5M5WH 3J7A5 4P75A 4DV4L 3TEHB 2N78A 3UDGA 2WP8J 3RZDH 2YU9H 4LUVA 3ICEA 1IBML 2Y0SE 4A3MG 1GM5A 3M3YH 4JBMA 4LFCQ 3I4NH 3CCLA 1UE5A 1NY4A 2KENA 1IBKQ 2UXBQ 1EYGA 2JA7H 4QJFA 1PH2A 4BY7H 2BA1A 3PF5A 2KBNA 1VQ6A 4JI0Q 1IYJB 3WWVA 5M3FH 1X3EA 4OX9L 1K3RA 1OXTA 1SRUA 3PIPA 1VQOA 4DR5L 1PH3A 2OTLA 2ID0A 4UP8A 3PO3H 5IYDG 2QGQA 3KFUA 2K52A 5AJ3L 4JCVE 3BU2A 3RLOA 3ER0A 1OXXK 5IYBH 3PO2G 4DR4L 1NBWA 5IWAL 1ASYA 4A3CH 1N34Q 3W1BA 1V9PA 4Y7NH 4JI5Q 4WJ3M 1YHQA 1X55A 3HOUH 5K36G 1K0RA 1Q8KA 5FJ8H 4GN5A 2WB1E 2LXKA 1TWGH 2UXDQ 5M5YH 1NMGA 3FKIG 4LF5Q 4XIGS 2HIXA 2MQHA 5J3BA 2ZTEA 5IP9H 4HIMA 3S17H 4L5RC 2PQAA 4PZ6A 3JAMc 4LFAL 1PH1A 2K5VA 2I0QA 4A3GG 2UXCQ 5JJIA 4X62L 4LW1A 2ASBA 2ZJRA 1SROA 2ALYB 3RR5A 1A62A 5IYCH 3CCVA 1IBLL 1KRTA 1VQNA 4R1JA 1HH2P 4B3SL 3UDFA 2K5HA 1XPRA 3GTQH 4GNXA 1VQFA 2KCMA 3D31A 2AHOB 4A93H 2CFMA 5FLMG 1OXSC 5GAGC 1VQKA 2YTYA 4UP9A 4X64Q 3HKSA 4P72A 4JI1L 1EIYB 2K14A 2HJQA 1IZ6A 4JI3L 2L15A 2RF4A 1XPOA 1E22A 1X9NA 4Y52H 4GN3B 1K9MC 4UPAA 3NBHB 1Y1VH 3L2PA 2HHHQ 2NVXH 1N8RC 1XNRL 1VQGA 4A3KG 4IO9A 4BY1H 4KLKA 3GO5A 3UDIA 3EIVA 3CXCA 4PMWA 3HOXG 3CCJA 3S2DH 4A3BG 1WFQA 1YZ6A 1LTLA 2CWPA 4BBSH 2K75A 3F2DA 1V43A 3IRBA 1VQBA 4LFBQ 4LF8L 3KF8B 4DV4Q 1X65A 4IPHA 1KAWA 2JA8H 1IBMQ 3CPFA 1YITA 2IHFA 2CQOA 2ATWA 3OW2A 4MZ9A 3RLNA 1K73C 3E9HA 2D0OA 1VQLA 4R4CA 1G51A 1FJGL 1IL2A 2AWOA 3PIOA 1VQCA 4IFDJ 1XMOL 1HNWL 4JI6L 4YCWA 1S40A 4DKAC 5FLXc 1BKBA 1AH9A 2PI2A 2OQKA 2BH8A 3W1GA 3I4OA 1I50H 4MTNA 4OX9Q 1H95A 4DR5Q 1XNQL 1FGUA 5IY0A 3J81j 3F8TA 5AJ3Q 1NE3A 3F2CA 2K50A 4P71A 1OXVA 2HT1A 4DR4Q 5IWAQ 2E8GA 5IP7H 3STBC 1NJIC 1RL2A 1Q46A 2F52A 2PNHA 1A8VA 1N9WA 2XTIA 4P74A 4DV0L 1N33L 3SGIA 3T1YL 3MEFA 2UUAL 4L5SA 1TWFH 3AQQA 4A3LG 2R7DA 1A0IA 2K5NA 4LFAQ 3OYYA 1BVSA 4BXXH 3J80i 1B70B 4HJAA 1HNZL 1EIFA 3LGJA 4X62Q 4DR6L 2JJQA 1IBLQ 2VQEL 3HOXH 3EBEA 4B3SQ 1EQRA 1W2BA 1A63A 3UE1A 3HOZG 1X56A 1XPUA 1VQ4A 1Y1WH 1VQJA 4A3DG 1XJVA 5M3MH 2ES2A 1L0WA 3I55A 2R92H 3HOWG 2NVTH 3FHWA 5DLQE 1M90C 2VL6A 3PCOB 5HGQA 4KHZA 3ZJYC 4JI1Q 3PGZA 4JI2L 2JQOA 4JI3Q 1ASZA 4GN4B 4JC0A 1KRSA 3MXNB 2AWNA 1PH4A 2PQAB 4LF7L 1PH7A 4HJ8A 2K4KA 2RCNA 1UEBA 3GTOH 2EIFA 4KHPL 5C4XH 3VDYA 1AE2A 4O2DA 1YJNA 1XNRQ 2JA6G 3KJOA 1UE7A 4LF4L 3FP9A 4OONA 3B6YA 4TQUS 1KD1C 2ZM6L 1EN7A 2ZTDA 1VQ7A 4GNXB 2QNCA 1EWIA 4A3FH 3UE0A 2NZHA 3H0GG 2I5LX 1E7DA 4A4IA 3HFZB 2UUCL 3M7NA 4GOPC 4LF8Q 2E2IH 3GTPH 2A1AA 1C7YA 3I56A 4DV3L 2YTXA 4LF9L 2BH2A 1O7IA 2UU9L 3A5UA 3BJUA 4B3ML 1E7ZA 3H3VI 2QEXA 4JBJA 4IPGA 2HQLA 5C0XJ 5BR8L 4L5QA 4GOPA 1FJGQ 4A3IG 1PH8A 1XMOQ 4IJHA 1HNWQ 1EOVA 1Y14B 1E1OA 4JI6Q 1VQ8A 1SMXA 4JBWA 1QUQA 1Q86C 4GNXC 1QVGA 1VQIA 4JYAL 4GKJL 4B3TL 3OTOL 3TS2A 3PUWA 3NELA 1XNQQ 3S24A 3K7AH 4J15A 4OO1I 1JE5A 4R4OA 1UE6A 1LYLA 1HNXL 1JT8A 2JEBI 4BBRG 1XMQL 3HOWH 1EUJA 4HJ5A 3I7FA 1N32L 3KJPA 2E2JH 2R7ZG 4YWLA 4UY8C 3ULJA 1UE1A 2KHIA 4DV1L 4BXXG 1K8AC 2DUDA 3PUXA 4UP7A 4DV0Q 1S72A 2JA5G 1L1OA 4MNOA 3CMAA 3T1YQ 4PZ7A 3KYHC 4R4QA 2UUAQ 3HOVG 5JEAJ 1VQ5A 4A3MH 2QNFA 1CUKA 2B63G 4DK3C 3JC66 4H02A 3J81i 4C3JH 3I2ZA 1HNZQ 1EQQA 4X65L 1YEZA 3TQYA 4A3JG 1JJGA 3G48A 3M4PA 1E3PA 3AFQA 1UWVA 1I5FA 3CQZH 3KDFA 1QVCA 2VQEQ 3S1RH 1MJEA 1YJWA 1PH9A 1Q82C 3H0GH 2IHEA 3L0OA 1J5EL 4DUZL 4JI8L 4A75A 5IYDH 1WCMG 1YHBA 4GLVB 2MFIA 2B3GA 1D7QA 3ULLA 4IFDI 3PO2H 4HIDA 4DAYB 4JI2Q 4JI4L 1KC8C 3HOYG 4GLXA 4LF6L 4POFA 3J7ZC 3GDEA 2ZJQA 1QZGA 4LF7Q 4DNIA 3CPWA 2VQFL 1VQMA 4HIOA 2BA0A 3DLLA 1SE8A 2CWAA 1GD7A 3FKIH 4KHPQ 2OTJA 3GTKH 4AH6A 1N36L 4IOAA 5C4JH 2HIVA 4LF4Q 2NVYH 1Q1BA 1CKNA 4AQYL 2GVBA 2ZM6Q 1U5KA 4A3EG 4A3GH 4DPGA 1CSQA 4YY3L 1Q81C 5HY6A 4KI0A 4LUZA 4DV7L 1PH5A 4K0KL 1VS0A 1QZHA 3NENA 2UUCQ 4RMFA 3KOJA 4JBKA 2NZOA 5FLMH 4DV3Q 1VQEA 3KF6A 1I3QH 4LF9Q 4JOIA 3CD6A 2UU9Q 4DV6L 2JE6I 4B3MQ 1KIXA 3U58A 4OXPA 1Q1EA 1WYDA 2FXQA 3S1MH 2B63H 4JV5L 5BR8Q 2H5XA 2AMCB 4YHHL 2UXDL 4WJ4A 4QGUA 1XTDA 3GTMH 4RG1A 5IE8A 1R9TH 1PV4A 3I4NG 3S1NH 4A3JH 1T9HA 3G4SA 3GTLH 5LMUL 2OCEA 4JG2A 4YWKA 1E7LA 4BY7G 4JYAQ 3CC2A 3JAMi 3OTOQ 4A3KH 1K8GA 4B3TQ 4GKJQ 1SFOH 2CCZA 4DAMA 1KXLA 1HNXQ 5M3FG 3STBD 4YCVA 5JJKA 2MNAA 1YIJA 1GO3E 1Z9FA 1XMQQ 4DR2L 5E7NA 4A3BH 1KL9A 2MO1A 1N32Q 2Q2UA 3RN2A 4LUOA 4R4IA 4YCUA 3G6EA 1YVCA 1YHAA 4DV1Q 2NN6G 2WFWA 5LMNL 1J6QA 3HOYH 5C0XI 3RN5A 4A3CG 1FVIA 1VQ9A 1B7YB 1TWHH 1D8LA 2D62A 1CKMA 1CKOA 3RLFA 5LMNW 4GOPB 3TS0A 1Q7YC 1JJ2A 3HOUG 1NTGA 1X3FA 1E1TA 4AYBG 5FJ8G 3CCQA 3K7UC 1SN8A 3HKZG 4DR1L 4OWTB 1QUQB 2UUBL 3E0EA 4X65Q 5GAHC 4DV5L 2QA4A 2MO0A 1HZAA 1WI5A 4DK6C 2VY3A 2GVAA 2LXJA 2R6GA 2NN6I 4LWCA 1GKHA 1L2FA 1LM0A 3CCSA 5IYCG 1J5EQ 4DUZQ 4JI8Q 4B3RL 4EX5A 5ELNA 1YBYA 1RIPA
chains in the Genus database with same CATH superfamily
1LTAD 1RTOA 5A2QE 4K2KA 4A93G 1GOZA 5IGEA 5EGTA 3SE0A 5JEAG 4OO1G 1HZCA 3NE5B 3AEVA 4I7AA 3BZCA 3PIP3 1MJCA 1VQPA 3G71A 3R2TA 1SLJA 1JB3A 2JSOA 2R7FA 1Z7TA 1X6OA 2VB2X 3KDFB 3S2HH 2WAQB 1HA6A 3M85A 4GKKL 4RH6A 2FJ2A 4QY7A 1CZWA 3T13A 4DV7Q 3PV0A 3DUZA 4PG3A 2VNUD 1ONLA 3CC7A 2PZTA 4OWXB 1I50B 1EFID 1WJJA 2QKIC 5EKIA 2KVEA 4CJ1B 1S3OA 4OELB 3MXPA 1HR0L 1KNAA 4YHHQ 4X66L 3V05A 5E3FA 1PH6A 2AKWB 1F77A 1H9KA 4AYBE 3P75A 4P73A 2JA6H 3M9BA 3H3VH 3URYA 2CW0C 4KJNA 4CHTB 2JYOA 4DR6Q 1F2ZA 1HFGA 3I4MB 2B2UC 1VCIA 2FMCA 1QVFA 2A8VA 2IY5B 3HOXB 2K6AA 1FNWA 1I94L 2EY5A 2IJ0A 1Y1WB 4MTKA 2R92B 2LKVA 1VQHA 4NDXA 5GROA 1OXUA 2LS01 2NVQH 2RHQB 2OWOA 3VR6A 4A3IH 5DM63 4X3KA 2F03A 1JJRA 4R9WA 1JWUD 3GTOB 3M3YB 4QQBX 3K0XA 1TXYA 4B3RQ 4HIKA 4OHJA 4JOIC 4DV2Q 5KRUA 2F4VQ 3CCUA 2CQAA 4QL5A 4A3FB 1YJ9A 5DAUA 2R7ZH 1F9SA 1W6KA 2F4IA 5M3MG 1EIHA 4BA1I 2YV5A 2JA5H 1PA6A 3GTPB 3CP0A 1OTCA 4DUYQ 3SK5A 4IFDH 3KBGA 1AZQA 4YWMA 1PRTB 3BDOA 2EY6A 2Z0SA 4IQZA 2JA7G 3BZDB 2EJFC 3CRKC 3U50C 1VF7A 4IUNA 3PO3G 1O7YA 1ICWA 3K80C 3FPUB 4K14A 2WB1G 2E2JB 1JB7A 4IURA 5C0XG 1ZXTA 3A5ZB 2VZAA 5JPMC 2B2YA 2PI2E 1O7ZA 2DJFC 4A3EH 2SNSA 4C3JB 2KUMA 3S16H 5J22A 1Y8OB 3NEMA 5D14A 3CQZB 4YIJA 2ZJPA 1XYIA 2RDHA 1P8LA 1I4RA 1WTWA 4P75A 3I73A 2YU9H 4LUVA 3ND9A 1WTRA 4A3MG 1E2ZA 3TSSA 4DNRB 4LFCQ 1UE5A 1VMCA 5JOBA 2RKSA 5C4ZA 2QCPX 2X6LA 2NZ1D 3GTKB 3E3XA 1IYJB 3WWVA 4A3GB 1AP0A 1LTSD 1EY0A 2MPMA 3ER0A 1NBWA 1AZPA 1ASYA 1N34Q 3W1BA 4Y7NH 1YHQA 1HXYD 2WB1E 1DONA 4KMUC 5M5YH 2EY2A 2F0WA 3S1MB 2MQHA 5J3BA 3MXNA 3VA5A 1PDQA 3VR2A 2JXMB 4LJZC 3S1NB 2Z4HA 5EPLA 3SEBA 1WTHA 3GQBA 1KRTA 1HQRD 4XQNA 1CI3M 4K8JA 3HZXA 1HH2P 4B3SL 1C48A 4F7XA 4A3BB 4A93H 2BOSA 5GAGC 2J4XA 4UHVA 5JEAH 4UP9A 3K58A 4X64Q 3HKSA 5CV6A 3HOYB 2K14A 3Q24A 1G2TA 2M2LA 2BDNA 1K9MC 1H9EA 4IO9A 3K6OA 3UDIA 1V1OA 4PMWA 4CDFC 3HOXG 3S2DH 1WFQA 1LTLA 1VQBA 4LFBQ 1A15A 2KQ3A 2HCIA 3KF8B 4IPHA 1U9RA 5I6YA 3Q6SA 1YITA 1B44D 2ATWA 3RLNA 1VQLA 1FJGL 2AWOA 1VQCA 5J1ZA 3P7JA 4YCWA 4DKAC 1BKBA 2PI2A 2OQKA 3S2HB 4MTNA 1DD2A 1K8OA 4DR5Q 2QDBA 1WD0A 1QNKA 1YNND 3F8TA 1MD2D 2PW7A 5AJ3Q 3ITPA 1FYCA 4P71A 4DR4Q 2HT1A 1Q8IA 3STBC 3P1HA 4HN7A 1R4QB 1CHPD 1QCBD 1N9WA 5CC4A 4DAYA 1TWFH 4A3LG 3H91A 2E75C 4K2LA 2R7DA 2QEJC 2KW9A 2F0GA 2RQXA 4DAPA 1GXDC 3RUZA 3VA7A 3LGJA 2KFVA 2JA6B 1IBLQ 4B08A 1C8CA 2VQEL 1TKWB 5E4XA 1A63A 3UE1A 1XPUA 1VQ4A 1A2UA 1VQJA 5M3MH 2ES2A 3FEWX 2EYJA 3GV6A 1L0WA 2XNAC 2NVTH 2F3WA 2JVWA 3PCOB 2EYHA 4KHZA 4JI1Q 2KVMA 4JI2L 1BQQT 4GN4B 4C56C 2EYPA 2PZUA 1PH4A 2PQAB 4ODGA 4LF7L 1PH7A 4EGVA 1RJTA 1UEBA 2NVQB 2X6GA 3VDYA 4C3JG 2F0JA 3DXJC 4O2DA 4A3IB 3FP9A 1DXMA 4OEMB 2ZTDA 1VQ7A 1GHJA 2UUCL 3M7NA 4GOPC 4F87A 1F2MA 2TMPA 2A1AA 1H9SB 3TP5A 2R7ZB 5CMDA 1O7IA 2UU9L 3NPPA 3QR8A 2JA5B 1HUMA 3IKJA 4GZYC 1U4RA 3G7LA 1HNWQ 1Y14B 1E1OA 1VQ8A 2O4XA 1ML0D 2PMZB 5DM73 1XNQQ 3NELA 3W3AA 1S5FD 1JOOA 1JT8A 5ELDA 3J80L 1EUJA 2E2DC 4HJ5A 3I7FA 4MN3A 4YWLA 1TY0A 4KD3A 1K8AC 2DUDA 4DV0Q 4U68A 1N33Q 3CMAA 2JN4A 5CV8A 4A3MH 1CUKA 1JEIA 3QOLA 2F1MA 4J1MA 4JPBW 3I2ZA 1HTPA 1II3A 3F2UA 1YEZA 4A3JG 1L0YB 1EWCA 3G48A 3M4PA 1EWHA 1Y8PB 3KDFA 4TKOB 4WRDA 2F3VA 1ZS9A 1EOTA 4A3EB 1B9MA 1RDPD 1EY4A 3CKIB 3S16B 2RDFA 4A75A 4JI8L 1CA6A 1YHBA 2B3GA 1RHPA 3TP6A 1JC7A 3HOYG 3T16A 3J7ZC 3D4RA 1HQMC 3NSWA 1DOKA 4DNIA 2H1EA 2VQFL 4HIOA 4X3UA 2YU9B 2AUKA 2OT2A 3NUCA 4IUTA 1DM0B 2F0EA 1I4XA 1I6VC 2HIVA 4LF4Q 4DPGA 3P20A 4KI0A 4LUZA 1K28A 5EKKA 1QWYA 2F0HA 4ZUJA 3MEHA 5EBDA 2E74C 2EDGA 3U58A 1WYDA 4CDCC 2B63H 4Y7NB 4ZCKA 5I2YA 3I4LA 1XTDA 5IE8A 1R9TH 4AYBB 1PV4A 3GTLH 5LMUL 5M5YB 1Y69U 1MBYA 3H6MA 1JEQA 2EOTA 1HNXQ 4YCVA 1KDCA 4IUVA 2EY1A 5M9OA 3DEPA 5CR3A 1YHAA 3G6EA 2NN6G 4DV1Q 1GHKA 4A3CG 3ND8A 3TS0A 4GOPB 1CKOA 4A93B 4G7ZC 1X3FA 3CCQA 1E1TA 2LY7A 3K7UC 2LC3A 3HKZG 4DR1L 1AW7A 3E0EA 4DV5L 2QA4A 2XRQD 4DK6C 3OWEB 2VY3A 3W2DA 1LTBD 2LXJA 2NN6I 1GKHA 2RA4A 5IYCG 5T1GA 1J5EQ 1YBYA 5C3WA 1RIPA 2XN9C 5KYLA 1PXUA 1KQSA 1EZ8A 1PYSB 2Q2TA 1L1OB 3S2DB 1CK1A 3J7YW 3SR1A 1PZKD 2G80A 3MA2B 4DR3L 1RODA 2E5LL 4A3LH 2VW9A 2F3IA 4HJ7A 2K01A 3I91A 1IW7D 1ENAA 4IPDA 3TRZA 2JEAI 1SE4A 5I9OA 2IX1A 3A74A 1HZBA 3I3CA 4IOCA 1G291 4BY1G 1G6PA 1BCPF 1L0XB 1KHIA 2GN5A 3TREA 4G7HC 5FK9C 2EXDA 4HJ9A 4TVAB 2L5TA 2WACA 3JAML 3U4VA 1GVPA 1O80A 2CKZB 1SNMA 1W3SA 4JV5Q 4QUCA 3NQTA 1HJPA 1JCKB 1HCZA 1HR0W 2LSSA 3MZ5A 4IFDG 2ENBA 3CCRA 3HKZE 1GUSA 4DU9A 5KIXA 1VQAA 1GUNA 4RCNA 1KNEA 1ENFA 2IW3A 4DR7L 2QF7A 3KBXA 4B9XA 1NMFA 3L7ZC 5C44H 4A76A 4BS9A 2XGTA 3IFTA 1LO5D 1TS2A 4V190 1P16A 5M3MB 5EAYA 2NVTB 4KN7C 1LT5D 1V1QA 2JA9A 2KCCA 3PSIA 2A6HD 5KEEA 5NUCA 2UUBQ 2C35B 1F2LA 1B8AA 3S14H 1IHZA 2KHJA 2UXBL 5J39A 3WDNA 2JK8A 4QIWE 5K5PA 1STAA 1CSPA 3L3OC 1KDBA 1YNJD 4I7ZC 2SEBD 3MXUA 1T5XD 3PQIA 1V8QA 1YNNC 4POGA 5FLXL 2Y0SG 4AIMA 1B9NA 4FNFA 1D6EC 2WB1B 4R4TA 4EQ5A 4BA2I 2XVSA 1AH9A 2ZTCA 4GKKQ 1Q12A 4IJLA 4NKLA 4L5TA 4HAEA 2UXCL 2PMZE 1S4ZA 1PTOF 5DNFA 2VB3X 3C3LA 2Z6KC 3D6CA 2B29A 4C2MH 2FFKB 1QNUA 3R2IA 1HR0Q 3VR5A 3K81C 4X66Q 3KF8A 3N6RA 1J9OA 2IPKD 2PQEA 3AFPA 4DNTB 3EN2A 4FF1A 2PPBC 4A3MB 3DWQA 3KLRA 4HMJA 3S1QH 1YI2A 3PF4A 2HHHL 4PMCA 5T1IA 1SAPA 5LL6S 1YNXA 4G4KA 2L12A 4GLAC 4X6AH 1Z6HA 3H15A 3MHBA 4RCOA 2AUJD 1I94Q 4V0BA 3K5LA 3J7A5 4DV4L 2N78A 4PNYA 1NAPA 4XXEA 3RZDH 3ICEA 4DAVA 1IBML 2Y0SE 3Q22A 3CCLA 1NY4A 1PLFA 2BA1A 4CKCA 2F0SA 1RTNA 3SXHA 2C9OA 4HMIA 1K3RA 1PH3A 1VQOA 1EIGA 2OTLA 5IYDG 5KNDA 3KFUA 2K52A 5KYIA 4XQQA 1ESFA 4JCVE 5G3LF 5IYBH 1HRJA 2F0TA 2NN6H 3PO2G 2PW5A 4A3CH 5IWAL 1V9PA 2M00A 1LLRD 4WJ3M 2A73B 4N9TA 1K0RA 1I4QA 1Q8KA 1SE3A 4GN5A 2P5ZX 2LXKA 2UXDQ 5C5MA 2NTTA 3FKIG 2FINB 4XIGS 2HIXA 2NBFA 2B63B 2ZTEA 4HIMA 2GA4B 2PQAA 1IYVA 2K5VA 1R9TB 1RF2D 3A7AB 3GTLB 3EQLC 2ASBA 2ZJRA 1SROA 4H7BA 5IYCH 1VQNA 1QJOA 3D4DA 3UDFA 2K5HA 1XPRA 2DY7A 2B2WA 2B2VC 1OXSC 1VQKA 1V66A 2YTYA 3FVQA 4P72A 1EIYB 1EYCA 1H9SA 1IZ6A 1XPOA 4ZK9B 1E22A 3IFDA 4TSSA 4Y52H 4GN3B 2A6EC 1XNRL 1VQGA 1Q90A 4K5VA 4BY1H 1B3QA 2KECA 3CCJA 2MHVA 3WOEA 1YZ6A 3F2DA 3IRBA 5IODA 4LF8L 4PQXA 1RD9D 3FMCA 1WTOA 2F0UA 3CPFA 1BBXC 4MZ9A 1LTID 2D0OA 3E9HA 4R4CA 3U9SA 1TIID 4L63B 3HGBA 3PIOA 1XMOL 1FR3A 2F0DA 2Z9HA 1X3PA 4JI6L 2BH8A 3NK9A 3I4OA 4E6IA 1E2WA 1FGUA 3LX0A 2RBMA 1NE3A 2RNNA 2JP1A 2K50A 3H94A 2K28A 1XTCD 1NJIC 1RL2A 4XT3B 1SJED 3BVMA 4P74A 2KVDA 1UEAB 3SGIA 1WTQA 3MEFA 1IYUA 1SNOA 4P2CB 4L5SA 2Z4IA 1DCZA 3VR4A 5JVG3 1PTOH 1SJHD 1BVSA 3OYYA 3J80i 4DR6L 2JJQA 5A35A 2DN8A 4B3SQ 2F0OA 3TP7A 3HOZG 4JVZA 2G5DA 3G6JB 2X69A 3I55A 1M90C 2Z6BA 3CRLC 3PGZA 2JQOA 4CJ2C 3EA6A 2K4KA 1B2TA 4KHPL 2EIFA 5CGKA 4KKUA 3H3VC 3DWAA 4OONA 2Q8IB 2ZM6L 3S14B 1IW7C 1XX8A 4KV6A 3TBIB 3UE0A 3DHQA 4NMZA 4K5WA 1E7DA 1LT3D 4A4IA 1FNUA 4HSVA 2E2IH 2QILA 4M8AA 1CQFA 1GUGA 4LF9L 4XQJA 3T4AC 1SNQA 2QEXA 4OIJA 4IPGA 1EY6A 1GJXA 1TT2A 4L5QA 4GOPA 1FJGQ 4H0LC 3LNNA 1B1ZA 1BF4A 4JBWA 3WOFA 4Z9CB 1QVGA 1VQIA 1TS5A 2B2WC 4A3JB 1SSOA 4XYOA 5KGUA 1JOQA 4R4OA 3NXWA 4Q0FA 3HOWH 1N32L 1H9RA 4R8NA 5LHY1 3S9WA 1WTXA 4UY8C 3ULJA 1ET9A 2KHIA 5I2XA 1L1OA 5IGFA 3A54A 1M4VA 3HOVG 4C2MB 4K6DA 2B63G 2C5CA 3JC66 2A6HC 3OOCA 2XIWA 1I5FA 4RHRA 3S1QB 1UAPA 2VQEQ 3FLGA 1PH9A 1Q82C 3H0GH 3L0OA 5I4DA 2BE5D 2EJMA 5IYDH 1WCMG 2HQEA 4GLVB 1D7QA 3ULLA 3PO2H 2NWGA 3TMEA 2KJXA 4KKTA 4JI2Q 4JI4L 4LF6L 1YNJC 4MIUA 1PFNA 2ZJQA 3I72A 4LF7Q 1MI2A 2BA0A 2OXPA 4L6TB 3FKIH 1K8MA 3DLLA 3RZDB 4IUQA 4AH6A 3T51B 3QJYA 1N36L 4IOAA 4AQYL 1G8ZD 4KY6A 1SMYD 4YY3L 1Q81C 2WINB 5HY6A 3SK8A 4K0KL 4N8X1 3EJIA 1STEA 4RGTA 2UUCQ 2LD7A 4JBKA 1S5ED 3LLRA 4N9PA 2UU9Q 4DV6L 2IL8A 4DGZA 5IIFA 1EU3A 4DK0A 4LK1C 4RG1A 1EU4A 1T9HA 3HKZB 2OCEA 4JG2A 4ZRZA 4YWKA 4BY7G 3JAMi 2L9HA 4DAMA 2MNAA 4QF4A 1GO3E 3J81L 4DR2L 1KL9A 2EPBA 1JICA 5LMNL 2I46A 1FVIA 1TWHH 2D62A 1CKMA 1MSGA 3HOUG 1NTGA 5FJ8G 1CT1D 1G6ZA 1V1PB 4OWTB 1E0BA 2MO0A 2O5JC 4QIWB 1AEXA 5CBEE 2GVAA 1L2FA 2J7ZA 2EYMA 4JI8Q 2A68D 1BDOA 3T1HL 4BY1B 1TWCH 5C44G 4HR7B 4CBVA 1SYEA 2CVRA 3MTSA 3NWTA 5FKAC 1BBUA 4BITA 1TY2A 1CTMA 4XTCS 3VYSA 2VQFQ 1M1KC 2VS1A 1SEBD 3GP7A 4JI7L 1IXRA 3LWUA 1Y1VG 2N55A 1PRTF 2K5QA 3F1ZA 3TN2A 3R3OA 5GAEC 2NTSA 1L1OC 5HGTA 5C5LA 3HOZH 5ELOA 4BBSG 1I4GA 4NXNL 4ILWA 5LL6X 3FPPA 2W51A 4MHEA 4O42A 3ULPA 2JA8G 2V4DA 3PUVA 2KOLA 3J80c 1DGSA 2F0NA 4DFAA 5LMUQ 4NXML 2N8NA 2EYOA 3NQIA 4F8MA 1CA5A 2OQ0A 2Q8TA 4ZKCB 3CU7A 2YYZA 3PUYA 1KLUD 2K03A 1K0SA 4FDBA 5IP7G 2V1CC 1S5CD 2SDFA 2L4NA 1EYDA 3M4QA 2R93H 1E24A 3NHHA 2A6ED 2Y0SB 4DR1Q 4DV5Q 5I9PA 3R93A 1X32A 4O1NA 4C3HH 5FO8B 1IBKL 4OWWB 4K5XA 1T5EA 2G9DA 3D6WA 2F0QA 1GJJA 4JI0L 3GTGH 4KJOA 4NPSA 4X3SA 5AFWA 4NB3A 5CORA 2PO4A 3D0FA 1NCVA 2K32A 3QIAA 3RZOH 4DR3Q 1ICFB 4ME3A 3F2BA 2E2IB 2CHBD 2E5LQ 4JI5L 3HOVH 1STHA 3ZYYX 1LUZA 3X3NA 3VR3A 3Q8DA 2VXWA 2VUMH 4WJWA 3BS1A 1B4OA 4LF5L 2ICEC 2D0PA 2HDMA 5C4XG 3CC4A 3BVGA 3J80E 1JMCA 1PYBA 1JR0D 4K6LA 3J7AF 2A19A 1SDFA 1X54A 2Q2IA 4PZ8A 1B53A 1STYA 1U0LA 1WCMH 3SDZA 2DNEA 3U4ZA 3A8KE 5IYBG 3W5OA 3HOWB 1BBWA 1A2TA 1PZID 2TSSA 1H1JS 3KLWA 1HA5A 4NW2A 1TWAH 2Z6KA 4IZ8A 2F0IA 4FYDA 1MKHA 1SYCA 3A0JA 2N3SA 1JJCB 2RHSB 4O0AA 3I4MH 4QB4A 1BXTA 2IX0A 3E9IA 3VYRA 1FNVA 4DR7Q 4LAAA 1UUPA 1C4QA 1PFMA 1X3QA 3NBIA 5C3EH 1PVOA 1EL0A 3HRZC 1GUOA 3DWPA 1RKNA 5M5WH 2ZT9C 5FOBB 3TEHB 3PO2B 4M1UB 1GM5A 2EVBA 3M3YH 2PYKA 4JBMA 2KENA 2UXBQ 2EZVA 3FKIB 4QJFA 1PH2A 4BY7H 2A74C 1XWEA 5IGCA 1WTPA 1JE4A 4HTHA 1A3TA 4S3SA 1X3EA 4OX9L 1BR9A 3PIPA 1SRUA 2RVLA 2ID0A 2O5IC 3RLOA 3NTIA 1SXTA 1TR5A 3EROA 1B50A 3A8IE 2E76C 3HOUH 5FJ8H 1U4PA 5FO7B 1D2BA 1TWGH 1NMGA 5IP9H 1TWFB 4PZ6A 4RA8A 3JAMc 4LFAL 3PMFA 2UXCQ 2QDLA 5JJIA 4X62L 4LW1A 2Z1CA 3CCVA 4R1JA 1EY8A 3A56A 2WIIB 2KCMA 4WFN3 2AHOB 1STGA 2O2LD 2KEEA 2BE5C 3E6ZX 2CH4W 2HJQA 4UAIA 4JI3L 1TWHB 2L15A 2RF4A 1TS3A 3K5OA 1O78A 1F9QA 1ENCA 1X9NA 2B2VA 4UPAA 3NBHB 1Y1VH 2HHHQ 2PCFB 2NVXH 1SYBA 4A3KG 3DM1A 5BN3A 3GO5A 3CXCA 5CIUA 1SMYC 2CWPA 4BBSH 1TWCB 1MHWC 3VYTA 4DV4Q 4R8IA 1X65A 1H9FA 1JWSD 2K05A 5ELBA 1PTOD 2JA8H 1IBMQ 5A2QL 2CQOA 3EVQA 3I70A 3Q0AA 3OW2A 1G51A 1HUNA 2FHTA 5IGGA 3OMCA 5FLXc 3OPOA 1LT4D 3JAME 3OW7A 4G7OC 4QUFA 2F0PA 2A69D 3F2CA 3UI2A 4I65A 5IWAQ 3HOZB 5IP7H 2DNCA 4OGQC 3Q23A 3X3MA 1Q46A 2PNHA 1A8VA 1NUCA 2XTIA 3T1YL 2UUAL 2MP1A 4OIKA 1ILQA 3BDLA 2K5NA 3MAQA 1HNZL 2OEOA 1EIFA 4N8FA 1F9PA 4J6HA 3K5MA 3IAYA 3M7GA 2EXZA 2K7VA 3EBEA 5CV5A 1EQRA 4IALA 1X56A 5HURA 4A3DG 3HOWG 2F0LA 3KUPA 4KK7A 2A68C 3FHWA 5DLQE 3RD4A 3ZJYC 3R8BA 1ZKOA 3BYYB 1JOKA 1KRSA 5G3LD 1A6XA 2R93B 5C4XH 3OMGA 1YJNA 1XNRQ 3KJOA 1UE7A 1KD1C 4C3HB 4ZYSA 4GNXB 5FLXE 2QNCA 1EWIA 3BYTB 3H0GG 3C46A 2I5LX 4J8QA 4RWSC 5KNCA 3GTGB 4LF8Q 1C7YA 3I56A 1NR2A 4DV3L 3NP8A 4B3ML 3RZOB 2N88A 5C0XJ 2HQLA 5BR8L 1WVLA 3HOVB 1PZJD 1PH8A 1XMOQ 2H4OA 1EOVA 1KHCA 4JI6Q 2VUMB 1NR4A 1V1PA 1SMXA 2L11A 1ZYRD 3KLSA 3T53B 5JJZA 4JYAL 4GKJL 3U9OA 1D5XC 4L8JA 2ZXOA 3OTOL 3PUWA 4LMQD 4B3TL 3S24A 3K7AH 4J15A 4OO1I 1UE6A 2JEBI 4BBRG 5C3XA 1XMQL 5EQ0A 1KLGD 3KJPA 5E4WC 1WCMB 1EQVA 4BXXG 3PUXA 3C1FA 3V96A 4PZ7A 2QNFA 4DK3C 3QKJA 3FRPB 4PV1C 3J81i 2F0KA 4C1NI 2EYFA 1EQQA 4X65L 1TWAB 1JJGA 4H13C 1CZGA 3OSOA 1E3PA 1UWVA 3AFQA 1QVCA 3S1RH 1MJEA 3D4WA 1YJWA 3DEOA 3I90A 4DUZL 2XSCA 1G2SA 4KKSA 5C3EB 3KK7A 3GDEA 5M5WB 5EKLA 3E5SA 1SE8A 2NB0A 1GD7A 4KHPQ 4CGYB 3D8GA 4JK1C 5C4JH 2NVYH 2B8FA 3T56B 2GVBA 2ZM6Q 1CSQA 5EJWA 4BY7B 2NYZD 1UNSA 4DV7L 4EQPA 2PZWA 5L37A 4EQNA 1Q3LA 4RMFA 2B39A 2K33A 3C2PA 3BG3A 1LV9A 1I3QH 4LF9Q 3CD6A 1EQTA 2XWJB 2JE6I 1LT6D 3MFGA 4OXPA 2H5XA 2AMCB 4RGNA 4YHHL 2UXDL 1CFMA 4QGUA 3SVMA 3GTMH 3HOUB 3I4NG 2SNMA 1TWGB 3G4SA 1ZEQX 3CC2A 4F88A 4A3KH 4C1NK 1SFOH 2CCZA 5M3FG 5JJKA 1YIJA 1HPCA 1HFNA 2B2TC 4XT1B 1N32Q 2Q2UA 2EE1A 4YCUA 2K5DA 1H9MA 3I8ZA 5C44B 3A55A 3RN5A 2XRSD 2IWHA 4HEDA 1D8LA 3RLFA 5LMNW 1JJ2A 2HCCA 2MJ8A 5D3IB 3HS0C 1SNCA 3ONAB 4KN4C 1BCPC 1SN8A 5JPNC 1EEFD 4UZWA 1QUQB 3VYUA 1F2YA 2AQ1B 1ZBHA 1Y8NB 2K1BA 3AMUA 2R6GA 2WV6D 1Y1VB 3CCSA 2NVXB 4B3RL 5C0XI 5ELNA 2PNRC 5EPKA 4DV2L 2F4VL 4IUPA 4JI4Q 1D1KA 4LF6Q 5GADC 3CF5A 4BBSB 3TP8A 2L55A 2R93G 3H09A 4DUYL 1KABA 2JA8B 1EY5A 1D5ZC 1N36Q 1FD7D 3CCMA 4AQYQ 2KCTA 2XWBB 4C3HG 3M4OH 2MUYA 4YY3Q 4K0KQ 3IL8A 2WQGA 3L9AX 4KTAA 1GL9B 3LWEA 1C0AA 4C3IH 2I5MX 3CW2C 3NWSA 4A3DH 2EJGC 3GD7A 3FDTA 2K04A 2D5DA 1VQDA 4DV6Q 3DMUA 4LNQA 4HCEA 4ULLA 1EYAA 1LACA 2G9HD 1CKNB 2WAQG 4FF3A 3SK6A 2VUMG 4ALPA 3ERQA 4DXFA 3CMEA 1PFSA 1Z47A 4RKLA 1FL0A 2I07B 1EY9A 1ESRA 4DR2Q 4RAUC 2DGYA 3KF6B 3C1EA 4QMGA 1QB5D 5LMNQ 3K8AA 1AN8A 1BO0A 4ME5A 4OO1H 3CAMA 4RKBA 2AQ2B 5F2DA 2EQSA 5E1FA 2YTVA 1CQVA 3TZUA 4IPCA 4JW0A 4KY7A 5COYA 5IT9L 3BVZA 1PTOC 4Q5VA 3AYHB 4LFCL 3QWNA 5IGDA 3S15H 3DM3A 3GTJH 3I4MG 1O7LA 1WOCA 5CYUA 5C4XB 3CCEA 1C9OA 5KNBA 3T1HQ 3MC0B 2D2CC 3QO2A 2CH4A 5IT9c 4BBRH 1DOMA 3UDXA 3PIO3 1MIUA 5C3EG 1Y1WG 2DY8A 1VF5C 4DA2A 2R92G 4BXXH 4GS3A 5M5XH 3AU7A 1N34L 2KVUA 2I5HA 1X3GA 2A69C 1DYQA 1K83H 2F0VA 4FXKC 5BN5A 1IKLA 1KDAA 2Q2HA 4FXGC 1I6HH 4JI7Q 1AFPA 1HZ9A 1EFWA 1EZ6A 1BCPB 2WAQE 1RCVD 4X3TA 3NBHA 4CJ0B 4CDDC 4A3FG 5GQOA 2ODGC 3K7AB 4NXNQ 2Z8LA 3BZKA 1B3AA 3ERSX 2B2YC 4IN3A 2R61A 1GUTA 4X64L 2WKCA 3GV3A 3J81c 2IT1A 4NXMQ 2F0FA 4UDUC 4XDXA 5IP9G 5ISRA 1Y02A 2E2HH 4APVA 1PHJA 5CV9A 3RNUA 1STNA 5JJLA 5JAVA 1PMRA 1F9RA 3S1RB 5H1SE 1M8AA 1AE3A 3TZDA 2NUCA 1SR3A 2DJGC 3PUZA 1PRTD 2N49A 5IT9E 4LFBL 1CM9A 3J7AV 1MGSA 3UDGA 2WP8J 4HSPA 5D3DA 1BUVT 2KHSA 1LTGD 3KLSX 3I4NH 3TDQA 1IBKQ 1EYGA 2JA7H 3OIQA 3MVVA 3PF5A 1SYGA 2KBNA 5C4JB 4JI0Q 1TU2B 2NVYB 1VQ6A 5M3FH 4B9WA 1OXTA 4RGMA 2A5HA 3PO3H 4DR5L 4UP8A 1ZYRC 2QGQA 4FF2A 2RNOA 5AJ3L 3BU2A 5D65A 1OXXK 4DR4L 4IUUA 1QG7A 4CKEA 1HHVA 3MFYA 5C0XH 4JI5Q 4BWGB 1I4HA 1X55A 5CV7A 5K36G 1I3QB 1U4MA 5BN4A 4RGOS 4LF5Q 1H9JA 3A8JE 2L0CA 3S17H 3J81E 4L5RC 3D3RA 1PH1A 2I0QA 3GTMB 1S5BD 4A3GG 1PTOB 3RR5A 2ALYB 1A62A 1LTTD 1IBLL 4A3KB 1SFOB 3GTQH 4ZAIA 1XXGA 4DK1A 4GNXA 1VQFA 4G57A 2K5WA 3D31A 2LFNA 3V2TA 2CFMA 5FLMG 1VMPA 5CV4A 1EEID 4JI1L 3SK4A 1PFBA 2CW0D 1ET6A 3K5NA 3L2PA 1JQYD 3CHBD 1N8RC 4FO2A 4KLKA 2WKDA 2BCOA 1KAAA 3EIVA 4WORA 5IOCA 1WD1A 4QCLA 1SYDA 4A3BG 2QW7A 2K75A 5EPJA 1V43A 1S5DD 3A7LA 4FP5D 4TRDA 1KAWA 1D1IA 1QOHA 2HDLA 2LMCB 2IHFA 4H44C 2RDGA 1EY7A 1K73C 1IL2A 1SNDA 4IFDJ 1J8IA 1HNWL 1S40A 3W1GA 1I50H 4OX9Q 1H95A 1KTKA 3M4OB 1XNQL 2Q8RE 5IY0A 3J81j 3BDCA 1OXVA 1DJRD 2E8GA 2D9UA 5TSSA 4ZQ3A 2M9VA 2F52A 4C3IB 4A3DB 4DV0L 1N33L 3AQQA 3SHLA 3MWYW 5ELEA 4EQOA 1A0IA 4CKBA 1BNZA 4LFAQ 1W6JA 1B70B 4HJAA 4X62Q 1GKUB 4RFBA 2IX3A 3HOXH 1DZ1A 3OIPA 1W2BA 1Y1WH 1ILPA 1XJVA 2R92H 3H0GB 4K8IA 1R4PB 2VL6A 5HGQA 1BCPD 4DN4M 5ELFA 4ZLTF 4JI3Q 1ASZA 4JC0A 3MXNB 4ZUIA 2AWNA 5I6WA 4HJ8A 2RCNA 1TS4A 3GTOH 4OL7A 1AE2A 2JA6G 4LF4L 3B6YA 4TQUS 3OHXC 1EN7A 1A3VA 2HUGA 3S15B 1JORA 3GTJB 4A3FH 3QOJA 3HG9A 2R3ZA 2NZHA 3HFZB 4EVOA 3GTPH 1OO9B 4BBRB 2YTXA 2BH2A 3RMHA 3A5UA 3BJUA 2ODCI 1E7ZA 3H3VI 4JBJA 5M5XB 1K83B 2ICIA 3K59A 4A3IG 5CBAE 4IJHA 4KHVA 1I6HB 2OF1A 1QUQA 3E0JA 4GNXC 1Q86C 5JVH3 1YNSA 3TS2A 1JE5A 1FGBD 1K3BC 1LYLA 1HNXL 1TVXA 3NTHA 2E2JH 2R7ZG 1U4LA 1UE1A 4DV1L 1QE6A 3MXGA 4UP7A 1S72A 4KD4A 2JA5G 4MNOA 3T1YQ 2UUAQ 1IKMA 3KYHC 4R4QA 1STBA 1LABA 2ZXRA 3O13A 5JEAJ 1VQ5A 5DEHA 3K57A 3QB3A 4H02A 1SBBB 4C3JH 1HNZQ 2RCFA 3TQYA 4DF7A 3CQZH 1LTRD 3M4YA 2IHEA 4FXDA 2E2HB 1J5EL 5FO9B 2L1BA 2MFIA 1TQOA 4IFDI 4HIDA 4DAYB 3QG1A 2MPHA 2B2UA 2FMMA 1KC8C 4GLXA 1MSHA 4POFA 4ID6A 5K36H 2F0MA 1QZGA 4FF4A 3CPWA 1VQMA 2CWAA 1IL8A 2BDOA 1CHQD 2OTJA 3GTKH 1PYWD 2J0TD 1Q1BA 1CKNA 4XYQA 4PMBA 3I4NB 1U5KA 4A3EG 4A3GH 2RSNA 1NSNS 2JA7B 4U673 5C4HA 1PH5A 1VS0A 2ZXPA 2EYLA 1QZHA 3NENA 5M3FB 2KA7A 3KOJA 3PO3B 2NZOA 1HTLD 5FLMH 4DV3Q 1VQEA 3KF6A 4JOIA 2KCNA 4ZKBB 1SE2A 4B3MQ 1GUWA 1SYFA 1KIXA 1Q1EA 2FXQA 4ABNA 3S1MH 4JV5L 4NP5A 5BR8Q 4WJ4A 3AB9A 3S1NH 4A3JH 3K0YA 1A3UA 1I4PA 1E7LA 1E2VA 4JYAQ 4GKJQ 1K8GA 3OTOQ 4B3TQ 3S17B 2RSOA 2KEDA 1KXLA 3N52A 3STBD 1XMQQ 1Z9FA 2SOBA 4A3BH 5E7NA 1SNPA 2MO1A 3RN2A 1NNXA 4LUOA 4R4IA 5EBCA 1YVCA 4C3IG 2WFWA 1J6QA 1QILA 3HOYH 3GTQB 1DOLA 1D5MC 1VQ9A 1B7YB 1JWMD 1Q7YC 2B2TA 3HEJA 3HP3A 4AYBG 1PRTC 1WTVA 1G91A 2DK4A 2UUBL 3EFXD 4X65Q 5GAHC 5ELCA 4DXGA 2B8GA 1HZAA 3NTKA 4RHSA 1VDZA 1WI5A 2MGSA 4KY5A 5C6AA 4LWCA 4CDEC 1BOSA 1LM0A 4FVMA 2HD3A 2AQ3B 4DUZQ 4HCSA 4EX5A 3OWFA 5IGBA
chains in the Genus database with same CATH topology
4DV2L 5C44G 1KQSA 2F4VL 1PYSB 2Q2TA 1L1OB 4JI4Q 1BBUA 4A93G 2G80A 5GADC 3CF5A 4LF6Q 5JEAG 4OO1G 4DR3L 1HZCA 4XTCS 3AEVA 2VQFQ 2E5LL 3BZCA 4A3LH 2R93G 1M1KC 1MJCA 2F3IA 2VW9A 4DUYL 4HJ7A 3G71A 1VQPA 1SLJA 2R7FA 2VS1A 1N36Q 4JI7L 1X6OA 1IXRA 3S2HH 3KDFB 3CCMA 4IPDA 4AQYQ 2KCTA 3TRZA 2JEAI 1Y1VG 3M85A 2IX1A 3A74A 1HZBA 4GKKL 3M4OH 4IOCA 1G291 4YY3Q 4QY7A 4BY1G 4DV7Q 2VNUD 3PV0A 4PG3A 3F1ZA 1G6PA 3CC7A 4K0KQ 5GAEC 1KHIA 2GN5A 1L1OC 4OWXB 1GL9B 3TREA 3HOZH 1WJJA 5ELOA 1C0AA 4BBSG 4C3IH 2EXDA 2I5MX 3CW2C 4NXNL 4HJ9A 4A3DH 3GD7A 4TVAB 3U4VA 1GVPA 4DV6Q 1VQDA 2CKZB 2W51A 1S3OA 4LNQA 1W3SA 4JV5Q 3ULPA 1HR0L 2JA8G 3PUVA 4YHHQ 1HJPA 4X66L 1HR0W 2LSSA 3J80c 1CKNB 2WAQG 1DGSA 1PH6A 2AKWB 4IFDG 3CCRA 2VUMG 4AYBE 5LMUQ 4ALPA 4NXML 2N8NA 4P73A 3CMEA 3HKZE 2JA6H 3M9BA 1PFSA 1N33Q 3H3VH 1Z47A 1VQAA 4DR6Q 2OQ0A 1FL0A 4DR7L 4DR2Q 1VCIA 4A76A 1QVFA 1NMFA 2YYZA 2A8VA 2DGYA 3L7ZC 5C44H 3KF6B 2IY5B 3PUYA 5LMNQ 4FDBA 2XGTA 3K8AA 5IP7G 1I94L 2V1CC 3CAMA 1P16A 5EAYA 2R93H 1VQHA 3M4QA 1E24A 1V1QA 2EQSA 2JA9A 2YTVA 1OXUA 3PSIA 5GROA 4DR1Q 4IPCA 2NVQH 2RHQB 2UUBQ 4DV5Q 2OWOA 2C35B 4A3IH 3AYHB 1B8AA 4LFCL 4OWWB 4C3HH 3S14H 2KHJA 1IBKL 3S15H 2UXBL 3DM3A 3GTJH 3I4MG 2JK8A 4QIWE 1WOCA 1GJJA 4QQBX 3K0XA 1CSPA 1TXYA 1TWCH 1C9OA 3CCEA 4HIKA 3T1HQ 4JI0L 4JOIC 3GTGH 4B3RQ 4NPSA 4DV2Q 4NB3A 5IT9c 4BBRH 2F4VQ 3CCUA 4QL5A 3UDXA 1YJ9A 1MIUA 5C3EG 1Y1WG 2R7ZH 3D0FA 5M3MG 2R92G 4BA1I 2YV5A 4GS3A 4DR3Q 3RZOH 4ME3A 4POGA 5M5XH 2Y0SG 3F2BA 4AIMA 1PA6A 1N34L 2I5HA 1X3GA 2JA5H 2E5LQ 1K83H 3CP0A 4JI5L 3HOVH 1OTCA 4DUYQ 1LUZA 2Q2HA 3Q8DA 1I6HH 2VUMH 4JI7Q 4R4TA 4EQ5A 4BA2I 4YWMA 4LF5L 1HZ9A 2D0PA 5C4XG 1EFWA 2ZTCA 3CC4A 2Z0SA 1Q12A 4IJLA 2WAQE 4GKKQ 2JA7G 1JMCA 1PYBA 2A19A 4L5TA 3U50C 1X54A 2UXCL 2PMZE 2Q2IA 4PZ8A 4A3FG 1U0LA 1WCMH 5GQOA 2ODGC 3PO3G 4NXNQ 3U4ZA 3K80C 2Z6KC 3BZKA 2B29A 5IYBG 3ERSX 3W5OA 1BBWA 4C2MH 2WB1G 1HR0Q 1JB7A 4X64L 5C0XG 3K81C 4X66Q 3A5ZB 3AFPA 2VZAA 2IT1A 3J81c 3KLWA 1TWAH 2Z6KA 4NXMQ 1MKHA 3EN2A 3A0JA 3S1QH 2N3SA 1JJCB 5IP9G 2RHSB 2PI2E 4O0AA 3I4MH 1YI2A 2IX0A 3T1HL 4A3EH 1Y02A 3E9IA 3PF4A 2HHHL 2E2HH 4APVA 1PHJA 4DR7Q 3S16H 3RNUA 1YNXA 5JJLA 3NEMA 4GLAC 4X6AH 5H1SE 1AE3A 2ZJPA 3H15A 5C3EH 1SR3A 1PVOA 3PUZA 1I94Q 2N49A 1P8LA 4LFBL 5M5WH 3J7A5 4P75A 4DV4L 3TEHB 2N78A 3UDGA 2WP8J 3RZDH 2YU9H 4LUVA 3ICEA 1IBML 2Y0SE 4A3MG 1GM5A 3M3YH 4JBMA 4LFCQ 3I4NH 3CCLA 1UE5A 1NY4A 2KENA 1IBKQ 2UXBQ 1EYGA 2JA7H 4QJFA 1PH2A 4BY7H 2BA1A 3PF5A 2KBNA 1VQ6A 4JI0Q 1IYJB 3WWVA 5M3FH 1X3EA 4OX9L 1K3RA 1OXTA 1SRUA 3PIPA 1VQOA 4DR5L 1PH3A 2OTLA 2ID0A 4UP8A 3PO3H 5IYDG 2QGQA 3KFUA 2K52A 5AJ3L 4JCVE 3BU2A 3RLOA 3ER0A 1OXXK 5IYBH 3PO2G 4DR4L 1NBWA 5IWAL 1ASYA 4A3CH 1N34Q 3W1BA 1V9PA 4Y7NH 4JI5Q 4WJ3M 1YHQA 1X55A 3HOUH 5K36G 1K0RA 1Q8KA 5FJ8H 4GN5A 2LXKA 2WB1E 1TWGH 2UXDQ 5M5YH 1NMGA 3FKIG 4LF5Q 4XIGS 2HIXA 2MQHA 5J3BA 2ZTEA 5IP9H 4HIMA 3S17H 4L5RC 2PQAA 4PZ6A 3JAMc 4LFAL 1PH1A 2K5VA 2I0QA 4A3GG 2UXCQ 5JJIA 4X62L 4LW1A 2ASBA 2ZJRA 1SROA 2ALYB 3RR5A 1A62A 5IYCH 3CCVA 1IBLL 1KRTA 1VQNA 4R1JA 1HH2P 4B3SL 3UDFA 2K5HA 1XPRA 3GTQH 4GNXA 1VQFA 2KCMA 3D31A 2AHOB 4A93H 2CFMA 5FLMG 1OXSC 5GAGC 1VQKA 2YTYA 4UP9A 4X64Q 3HKSA 4P72A 4JI1L 1EIYB 2K14A 2HJQA 1IZ6A 4JI3L 2L15A 2RF4A 1XPOA 1E22A 1X9NA 4Y52H 4GN3B 1K9MC 4UPAA 3NBHB 1Y1VH 3L2PA 2HHHQ 2NVXH 1N8RC 1XNRL 1H9EA 1VQGA 4A3KG 4IO9A 4BY1H 4KLKA 3GO5A 3UDIA 3EIVA 3CXCA 4PMWA 3HOXG 3CCJA 3S2DH 4A3BG 1WFQA 1YZ6A 1LTLA 2CWPA 4BBSH 2K75A 3F2DA 1V43A 3IRBA 1VQBA 4LFBQ 4LF8L 3KF8B 4DV4Q 1X65A 4IPHA 1KAWA 1H9FA 2JA8H 1IBMQ 3CPFA 1YITA 2IHFA 2CQOA 2ATWA 3OW2A 4MZ9A 3RLNA 1K73C 3E9HA 2D0OA 1VQLA 4R4CA 1G51A 1FJGL 1IL2A 2AWOA 3PIOA 1VQCA 4IFDJ 1XMOL 1HNWL 4JI6L 4YCWA 1S40A 4DKAC 5FLXc 1BKBA 1AH9A 2PI2A 2OQKA 2BH8A 3W1GA 3I4OA 1I50H 4MTNA 4OX9Q 1H95A 4DR5Q 1XNQL 1FGUA 5IY0A 3J81j 3F8TA 5AJ3Q 1NE3A 3F2CA 2K50A 4P71A 1OXVA 2HT1A 4DR4Q 5IWAQ 2E8GA 5IP7H 3STBC 1NJIC 1RL2A 1Q46A 2F52A 2PNHA 1A8VA 1N9WA 2XTIA 4P74A 4DV0L 1N33L 3SGIA 3T1YL 3MEFA 2UUAL 4L5SA 1TWFH 3AQQA 4A3LG 2R7DA 1A0IA 2K5NA 4LFAQ 3OYYA 1BVSA 4BXXH 3J80i 1B70B 4HJAA 1HNZL 1EIFA 3LGJA 4X62Q 4DR6L 2JJQA 1GKUB 2KFVA 1IBLQ 2VQEL 3HOXH 3EBEA 4B3SQ 1EQRA 1W2BA 1A63A 3UE1A 3HOZG 1X56A 1XPUA 1VQ4A 1Y1WH 1VQJA 4A3DG 1XJVA 5M3MH 2ES2A 1L0WA 3I55A 2R92H 3HOWG 2NVTH 3FHWA 5DLQE 1M90C 2VL6A 3PCOB 5HGQA 4KHZA 3ZJYC 4JI1Q 3PGZA 4JI2L 2JQOA 4JI3Q 1ASZA 4GN4B 4JC0A 1KRSA 3MXNB 2AWNA 1PH4A 2PQAB 4LF7L 1PH7A 4HJ8A 2K4KA 2RCNA 1UEBA 3GTOH 2EIFA 4KHPL 5C4XH 3VDYA 1AE2A 4O2DA 1YJNA 1XNRQ 2JA6G 3KJOA 1UE7A 4LF4L 3FP9A 4OONA 3B6YA 4TQUS 1KD1C 2ZM6L 1EN7A 2ZTDA 1VQ7A 4GNXB 2QNCA 1EWIA 4A3FH 3UE0A 2NZHA 3H0GG 2I5LX 1E7DA 4A4IA 3HFZB 2UUCL 3M7NA 4GOPC 4LF8Q 2E2IH 3GTPH 2A1AA 1C7YA 3I56A 4DV3L 2YTXA 4LF9L 2BH2A 1O7IA 2UU9L 3A5UA 3BJUA 2ODCI 1E7ZA 4B3ML 2QEXA 3H3VI 4JBJA 4IPGA 2HQLA 5C0XJ 5BR8L 4L5QA 4GOPA 1FJGQ 4A3IG 1PH8A 1XMOQ 4IJHA 1HNWQ 1EOVA 1Y14B 1E1OA 4JI6Q 1VQ8A 1SMXA 4JBWA 1QUQA 1Q86C 4GNXC 1QVGA 1VQIA 4JYAL 4GKJL 1YNSA 3OTOL 4B3TL 3TS2A 3PUWA 3NELA 1XNQQ 3S24A 3K7AH 4J15A 4OO1I 1JE5A 4R4OA 1UE6A 1LYLA 1HNXL 1JT8A 2JEBI 4BBRG 1XMQL 3HOWH 1EUJA 4HJ5A 3I7FA 1N32L 3KJPA 2E2JH 2R7ZG 4YWLA 4UY8C 3ULJA 1UE1A 2KHIA 4DV1L 4BXXG 1K8AC 2DUDA 3PUXA 4UP7A 4DV0Q 1S72A 2JA5G 1L1OA 4MNOA 3CMAA 3T1YQ 4PZ7A 3KYHC 4R4QA 2UUAQ 3HOVG 5JEAJ 1VQ5A 4A3MH 2QNFA 1CUKA 1JEIA 2B63G 4DK3C 3JC66 4H02A 3J81i 4C3JH 3I2ZA 1HNZQ 1EQQA 4X65L 1YEZA 3TQYA 4A3JG 1JJGA 3G48A 3M4PA 1E3PA 3AFQA 1UWVA 1I5FA 3CQZH 3KDFA 1QVCA 2VQEQ 3S1RH 1MJEA 1YJWA 1ZS9A 1PH9A 1Q82C 3H0GH 2IHEA 3L0OA 1J5EL 4DUZL 4JI8L 4A75A 5IYDH 1WCMG 1YHBA 4GLVB 2MFIA 2B3GA 1D7QA 3ULLA 4IFDI 3PO2H 4HIDA 4DAYB 4JI2Q 2MPHA 1KC8C 4JI4L 3HOYG 4GLXA 4LF6L 4POFA 3J7ZC 3GDEA 2ZJQA 1QZGA 4LF7Q 4DNIA 3CPWA 2VQFL 1VQMA 4HIOA 2BA0A 3DLLA 1SE8A 2CWAA 1GD7A 3FKIH 4KHPQ 2OTJA 3GTKH 4AH6A 1N36L 4IOAA 5C4JH 2HIVA 4LF4Q 2NVYH 1Q1BA 1CKNA 4AQYL 2GVBA 2ZM6Q 1U5KA 4A3EG 4A3GH 4DPGA 1CSQA 4YY3L 1Q81C 5HY6A 4KI0A 4LUZA 4DV7L 1PH5A 4K0KL 1VS0A 1QZHA 3NENA 2UUCQ 2LD7A 4RMFA 3KOJA 4JBKA 2NZOA 5FLMH 4DV3Q 1VQEA 3KF6A 1I3QH 4LF9Q 4JOIA 3CD6A 2UU9Q 4DV6L 2JE6I 4B3MQ 1KIXA 3U58A 4OXPA 1Q1EA 1WYDA 2FXQA 3S1MH 2B63H 4JV5L 5BR8Q 2H5XA 2AMCB 4YHHL 2UXDL 4WJ4A 4QGUA 1XTDA 3GTMH 4RG1A 5IE8A 1R9TH 1PV4A 3I4NG 3S1NH 4A3JH 1T9HA 3G4SA 3GTLH 5LMUL 2OCEA 4JG2A 4YWKA 1E7LA 4BY7G 4JYAQ 3CC2A 3JAMi 3OTOQ 4A3KH 1K8GA 4B3TQ 4GKJQ 1SFOH 2CCZA 4DAMA 1KXLA 1HNXQ 5M3FG 3STBD 4YCVA 5JJKA 2MNAA 1YIJA 1GO3E 1Z9FA 1XMQQ 4DR2L 5E7NA 4A3BH 1KL9A 2MO1A 1N32Q 2Q2UA 3RN2A 4LUOA 4R4IA 4YCUA 3G6EA 1YVCA 1YHAA 4DV1Q 2NN6G 2WFWA 5LMNL 1J6QA 3HOYH 5C0XI 3RN5A 4A3CG 1FVIA 1VQ9A 1B7YB 1TWHH 1D8LA 2D62A 1CKMA 1CKOA 3RLFA 5LMNW 4GOPB 3TS0A 1Q7YC 1JJ2A 3HOUG 1NTGA 1X3FA 1E1TA 4AYBG 5FJ8G 3CCQA 3K7UC 2DK4A 2LC3A 1SN8A 3HKZG 4DR1L 4OWTB 1QUQB 2UUBL 3E0EA 4X65Q 5GAHC 4DV5L 2QA4A 2MO0A 1HZAA 1WI5A 4DK6C 2VY3A 2GVAA 2LXJA 2R6GA 2NN6I 4LWCA 1GKHA 1L2FA 1LM0A 3CCSA 5IYCG 1J5EQ 4DUZQ 4JI8Q 4B3RL 4EX5A 5ELNA 1YBYA 1RIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 L;  5C44 G;  1KQS A;  2F4V L;  1PYS B;  2Q2T A;  1L1O B;  4JI4 Q;  1BBU A;  4A93 G;  4LF6 Q;  5GAD C;  3CF5 A;  5JEA G;  4OO1 G;  4DR3 L;  1HZC A;  4XTC S;  3AEV A;  2VQF Q;  2E5L L;  3BZC A;  4A3L H;  2R93 G;  1M1K C;  1MJC A;  2F3I A;  2VW9 A;  4DUY L;  4HJ7 A;  3G71 A;  1VQP A;  1SLJ A;  2R7F A;  2VS1 A;  1N36 Q;  4JI7 L;  1X6O A;  1IXR A;  3S2H H;  3KDF B;  3CCM A;  4IPD A;  4AQY Q;  2KCT A;  3TRZ A;  2JEA I;  1Y1V G;  3M85 A;  2IX1 A;  3A74 A;  1HZB A;  4GKK L;  3M4O H;  4IOC A;  1G29 1;  4YY3 Q;  4QY7 A;  4BY1 G;  4DV7 Q;  2VNU D;  3PV0 A;  4PG3 A;  3F1Z A;  1G6P A;  3CC7 A;  4K0K Q;  5GAE C;  1KHI A;  2GN5 A;  1L1O C;  4OWX B;  3TRE A;  3HOZ H;  1WJJ A;  5ELO A;  1C0A A;  4BBS G;  4C3I H;  2EXD A;  2I5M X;  3CW2 C;  4NXN L;  4HJ9 A;  4A3D H;  3GD7 A;  4TVA B;  3U4V A;  1GVP A;  4DV6 Q;  1VQD A;  2CKZ B;  1S3O A;  4LNQ A;  1W3S A;  4JV5 Q;  3ULP A;  1HR0 L;  2JA8 G;  3PUV A;  4YHH Q;  1HJP A;  4X66 L;  1HR0 W;  2LSS A;  3J80 c;  1CKN B;  2WAQ G;  1DGS A;  1PH6 A;  2AKW B;  4IFD G;  3CCR A;  2VUM G;  4AYB E;  5LMU Q;  4ALP A;  4NXM L;  2N8N A;  4P73 A;  3CME A;  3HKZ E;  2JA6 H;  3M9B A;  1PFS A;  1N33 Q;  3H3V H;  1Z47 A;  1VQA A;  4DR6 Q;  2OQ0 A;  1FL0 A;  4DR7 L;  4DR2 Q;  1VCI A;  4A76 A;  1QVF A;  1NMF A;  2YYZ A;  2A8V A;  2DGY A;  3L7Z C;  5C44 H;  3KF6 B;  2IY5 B;  3PUY A;  5LMN Q;  4FDB A;  2XGT A;  3K8A A;  5IP7 G;  1I94 L;  2V1C C;  3CAM A;  1P16 A;  5EAY A;  2R93 H;  1VQH A;  3M4Q A;  1E24 A;  1V1Q A;  2EQS A;  2YTV A;  2JA9 A;  1OXU A;  3PSI A;  5GRO A;  4DR1 Q;  4IPC A;  2NVQ H;  2RHQ B;  2UUB Q;  4DV5 Q;  2OWO A;  2C35 B;  4A3I H;  3AYH B;  1B8A A;  4LFC L;  4OWW B;  4C3H H;  3S14 H;  2KHJ A;  1IBK L;  3S15 H;  2UXB L;  3DM3 A;  3GTJ H;  3I4M G;  2JK8 A;  4QIW E;  1WOC A;  4QQB X;  3K0X A;  1CSP A;  1TXY A;  1TWC H;  1C9O A;  3CCE A;  4HIK A;  3T1H Q;  4JI0 L;  4JOI C;  3GTG H;  4B3R Q;  4NPS A;  4DV2 Q;  4NB3 A;  5IT9 c;  4BBR H;  2F4V Q;  3CCU A;  4QL5 A;  3UDX A;  1YJ9 A;  1MIU A;  5C3E G;  1Y1W G;  2R7Z H;  3D0F A;  5M3M G;  2R92 G;  4BA1 I;  2YV5 A;  4GS3 A;  4DR3 Q;  3RZO H;  4ME3 A;  4POG A;  5M5X H;  2Y0S G;  3F2B A;  4AIM A;  1PA6 A;  1N34 L;  2I5H A;  1X3G A;  2JA5 H;  2E5L Q;  1K83 H;  3CP0 A;  4JI5 L;  3HOV H;  1OTC A;  4DUY Q;  1LUZ A;  2Q2H A;  3Q8D A;  1I6H H;  2VUM H;  4JI7 Q;  4R4T A;  4EQ5 A;  4BA2 I;  4YWM A;  4LF5 L;  1HZ9 A;  2D0P A;  5C4X G;  1EFW A;  2ZTC A;  3CC4 A;  2Z0S A;  1Q12 A;  4IJL A;  2WAQ E;  4GKK Q;  2JA7 G;  1JMC A;  1PYB A;  2A19 A;  4L5T A;  3U50 C;  1X54 A;  2UXC L;  2PMZ E;  2Q2I A;  4PZ8 A;  4A3F G;  1U0L A;  1WCM H;  5GQO A;  3PO3 G;  4NXN Q;  3U4Z A;  3K80 C;  2Z6K C;  3BZK A;  2B29 A;  5IYB G;  3ERS X;  3W5O A;  1BBW A;  4C2M H;  2WB1 G;  1HR0 Q;  1JB7 A;  4X64 L;  5C0X G;  3K81 C;  4X66 Q;  3A5Z B;  3AFP A;  2VZA A;  2IT1 A;  3J81 c;  3KLW A;  1TWA H;  2Z6K A;  4NXM Q;  1MKH A;  3EN2 A;  3A0J A;  3S1Q H;  2N3S A;  1JJC B;  5IP9 G;  2RHS B;  2PI2 E;  4O0A A;  3I4M H;  1YI2 A;  2IX0 A;  3T1H L;  4A3E H;  3E9I A;  3PF4 A;  2HHH L;  2E2H H;  4APV A;  1PHJ A;  4DR7 Q;  3S16 H;  3RNU A;  1YNX A;  5JJL A;  3NEM A;  4GLA C;  4X6A H;  5H1S E;  1AE3 A;  2ZJP A;  3H15 A;  5C3E H;  1SR3 A;  1PVO A;  3PUZ A;  1I94 Q;  2N49 A;  1P8L A;  4LFB L;  5M5W H;  3J7A 5;  4P75 A;  4DV4 L;  3TEH B;  2N78 A;  3UDG A;  2WP8 J;  3RZD H;  2YU9 H;  4LUV A;  3ICE A;  1IBM L;  2Y0S E;  4A3M G;  1GM5 A;  3M3Y H;  4JBM A;  4LFC Q;  3I4N H;  3CCL A;  1UE5 A;  1NY4 A;  2KEN A;  1IBK Q;  2UXB Q;  1EYG A;  2JA7 H;  4QJF A;  1PH2 A;  4BY7 H;  2BA1 A;  3PF5 A;  2KBN A;  1VQ6 A;  4JI0 Q;  1IYJ B;  3WWV A;  5M3F H;  1X3E A;  4OX9 L;  1K3R A;  1OXT A;  1SRU A;  3PIP A;  1VQO A;  4DR5 L;  1PH3 A;  2OTL A;  2ID0 A;  4UP8 A;  3PO3 H;  5IYD G;  2QGQ A;  3KFU A;  2K52 A;  5AJ3 L;  4JCV E;  3BU2 A;  3RLO A;  3ER0 A;  1OXX K;  5IYB H;  3PO2 G;  4DR4 L;  1NBW A;  5IWA L;  1ASY A;  4A3C H;  1N34 Q;  3W1B A;  1V9P A;  4Y7N H;  4JI5 Q;  4WJ3 M;  1YHQ A;  1X55 A;  3HOU H;  5K36 G;  1K0R A;  1Q8K A;  5FJ8 H;  4GN5 A;  2WB1 E;  2LXK A;  1TWG H;  2UXD Q;  5M5Y H;  1NMG A;  3FKI G;  4LF5 Q;  4XIG S;  2HIX A;  2MQH A;  5J3B A;  2ZTE A;  5IP9 H;  4HIM A;  3S17 H;  4L5R C;  2PQA A;  4PZ6 A;  3JAM c;  4LFA L;  1PH1 A;  2K5V A;  2I0Q A;  4A3G G;  2UXC Q;  5JJI A;  4X62 L;  4LW1 A;  2ASB A;  2ZJR A;  1SRO A;  2ALY B;  3RR5 A;  1A62 A;  5IYC H;  3CCV A;  1IBL L;  1KRT A;  1VQN A;  4R1J A;  1HH2 P;  4B3S L;  3UDF A;  2K5H A;  1XPR A;  3GTQ H;  4GNX A;  1VQF A;  2KCM A;  3D31 A;  2AHO B;  4A93 H;  2CFM A;  5FLM G;  1OXS C;  5GAG C;  1VQK A;  2YTY A;  4UP9 A;  4X64 Q;  3HKS A;  4P72 A;  4JI1 L;  1EIY B;  2K14 A;  2HJQ A;  1IZ6 A;  4JI3 L;  2L15 A;  2RF4 A;  1XPO A;  1E22 A;  1X9N A;  4Y52 H;  4GN3 B;  1K9M C;  4UPA A;  3NBH B;  1Y1V H;  3L2P A;  2HHH Q;  2NVX H;  1N8R C;  1XNR L;  1VQG A;  4A3K G;  4IO9 A;  4BY1 H;  4KLK A;  3GO5 A;  3UDI A;  3EIV A;  3CXC A;  4PMW A;  3HOX G;  3CCJ A;  3S2D H;  4A3B G;  1WFQ A;  1YZ6 A;  1LTL A;  2CWP A;  4BBS H;  2K75 A;  3F2D A;  1V43 A;  3IRB A;  1VQB A;  4LFB Q;  4LF8 L;  3KF8 B;  4DV4 Q;  1X65 A;  4IPH A;  1KAW A;  2JA8 H;  1IBM Q;  3CPF A;  1YIT A;  2IHF A;  2CQO A;  2ATW A;  3OW2 A;  4MZ9 A;  3RLN A;  1K73 C;  3E9H A;  2D0O A;  1VQL A;  4R4C A;  1G51 A;  1FJG L;  1IL2 A;  2AWO A;  3PIO A;  1VQC A;  4IFD J;  1XMO L;  1HNW L;  4JI6 L;  4YCW A;  1S40 A;  4DKA C;  5FLX c;  1BKB A;  1AH9 A;  2PI2 A;  2OQK A;  2BH8 A;  3W1G A;  3I4O A;  1I50 H;  4MTN A;  4OX9 Q;  1H95 A;  4DR5 Q;  1XNQ L;  1FGU A;  5IY0 A;  3J81 j;  3F8T A;  5AJ3 Q;  1NE3 A;  3F2C A;  2K50 A;  4P71 A;  1OXV A;  2HT1 A;  4DR4 Q;  5IWA Q;  2E8G A;  5IP7 H;  3STB C;  1NJI C;  1RL2 A;  1Q46 A;  2F52 A;  2PNH A;  1A8V A;  1N9W A;  2XTI A;  4P74 A;  4DV0 L;  1N33 L;  3SGI A;  3T1Y L;  3MEF A;  2UUA L;  4L5S A;  1TWF H;  3AQQ A;  4A3L G;  2R7D A;  1A0I A;  2K5N A;  4LFA Q;  3OYY A;  1BVS A;  4BXX H;  3J80 i;  1B70 B;  4HJA A;  1HNZ L;  1EIF A;  3LGJ A;  4X62 Q;  4DR6 L;  2JJQ A;  1IBL Q;  2VQE L;  3HOX H;  3EBE A;  4B3S Q;  1EQR A;  1W2B A;  1A63 A;  3UE1 A;  3HOZ G;  1X56 A;  1XPU A;  1VQ4 A;  1Y1W H;  1VQJ A;  4A3D G;  1XJV A;  5M3M H;  2ES2 A;  1L0W A;  3I55 A;  2R92 H;  3HOW G;  2NVT H;  3FHW A;  5DLQ E;  1M90 C;  2VL6 A;  3PCO B;  5HGQ A;  4KHZ A;  3ZJY C;  4JI1 Q;  3PGZ A;  4JI2 L;  2JQO A;  4JI3 Q;  1ASZ A;  4GN4 B;  4JC0 A;  1KRS A;  3MXN B;  2AWN A;  1PH4 A;  2PQA B;  4LF7 L;  1PH7 A;  4HJ8 A;  2K4K A;  2RCN A;  1UEB A;  3GTO H;  2EIF A;  4KHP L;  5C4X H;  3VDY A;  1AE2 A;  4O2D A;  1YJN A;  1XNR Q;  2JA6 G;  3KJO A;  1UE7 A;  4LF4 L;  3FP9 A;  4OON A;  3B6Y A;  4TQU S;  1KD1 C;  2ZM6 L;  1EN7 A;  2ZTD A;  1VQ7 A;  4GNX B;  2QNC A;  1EWI A;  4A3F H;  3UE0 A;  2NZH A;  3H0G G;  2I5L X;  1E7D A;  4A4I A;  3HFZ B;  2UUC L;  3M7N A;  4GOP C;  4LF8 Q;  2E2I H;  3GTP H;  2A1A A;  1C7Y A;  3I56 A;  4DV3 L;  2YTX A;  4LF9 L;  2BH2 A;  1O7I A;  2UU9 L;  3A5U A;  3BJU A;  4B3M L;  1E7Z A;  3H3V I;  2QEX A;  4JBJ A;  4IPG A;  2HQL A;  5C0X J;  5BR8 L;  4L5Q A;  4GOP A;  1FJG Q;  4A3I G;  1PH8 A;  1XMO Q;  4IJH A;  1HNW Q;  1EOV A;  1Y14 B;  1E1O A;  4JI6 Q;  1VQ8 A;  1SMX A;  4JBW A;  1QUQ A;  1Q86 C;  4GNX C;  1QVG A;  1VQI A;  4JYA L;  4GKJ L;  4B3T L;  3OTO L;  3TS2 A;  3PUW A;  3NEL A;  1XNQ Q;  3S24 A;  3K7A H;  4J15 A;  4OO1 I;  1JE5 A;  4R4O A;  1UE6 A;  1LYL A;  1HNX L;  1JT8 A;  2JEB I;  4BBR G;  1XMQ L;  3HOW H;  1EUJ A;  4HJ5 A;  3I7F A;  1N32 L;  3KJP A;  2E2J H;  2R7Z G;  4YWL A;  4UY8 C;  3ULJ A;  1UE1 A;  2KHI A;  4DV1 L;  4BXX G;  1K8A C;  2DUD A;  3PUX A;  4UP7 A;  4DV0 Q;  1S72 A;  2JA5 G;  1L1O A;  4MNO A;  3CMA A;  3T1Y Q;  4PZ7 A;  3KYH C;  4R4Q A;  2UUA Q;  3HOV G;  5JEA J;  1VQ5 A;  4A3M H;  2QNF A;  1CUK A;  2B63 G;  4DK3 C;  3JC6 6;  4H02 A;  3J81 i;  4C3J H;  3I2Z A;  1HNZ Q;  1EQQ A;  4X65 L;  1YEZ A;  3TQY A;  4A3J G;  1JJG A;  3G48 A;  3M4P A;  1E3P A;  3AFQ A;  1UWV A;  1I5F A;  3CQZ H;  3KDF A;  1QVC A;  2VQE Q;  3S1R H;  1MJE A;  1YJW A;  1PH9 A;  1Q82 C;  3H0G H;  2IHE A;  3L0O A;  1J5E L;  4DUZ L;  4JI8 L;  4A75 A;  5IYD H;  1WCM G;  1YHB A;  4GLV B;  2MFI A;  2B3G A;  1D7Q A;  3ULL A;  4IFD I;  3PO2 H;  4HID A;  4DAY B;  4JI2 Q;  4JI4 L;  1KC8 C;  3HOY G;  4GLX A;  4LF6 L;  4POF A;  3J7Z C;  3GDE A;  2ZJQ A;  1QZG A;  4LF7 Q;  4DNI A;  3CPW A;  2VQF L;  1VQM A;  4HIO A;  2BA0 A;  3DLL A;  1SE8 A;  2CWA A;  1GD7 A;  3FKI H;  4KHP Q;  2OTJ A;  3GTK H;  4AH6 A;  1N36 L;  4IOA A;  5C4J H;  2HIV A;  4LF4 Q;  2NVY H;  1Q1B A;  1CKN A;  4AQY L;  2GVB A;  2ZM6 Q;  1U5K A;  4A3E G;  4A3G H;  4DPG A;  1CSQ A;  4YY3 L;  1Q81 C;  5HY6 A;  4KI0 A;  4LUZ A;  4DV7 L;  1PH5 A;  4K0K L;  1VS0 A;  1QZH A;  3NEN A;  2UUC Q;  4RMF A;  3KOJ A;  4JBK A;  2NZO A;  5FLM H;  4DV3 Q;  1VQE A;  3KF6 A;  1I3Q H;  4LF9 Q;  4JOI A;  3CD6 A;  2UU9 Q;  4DV6 L;  2JE6 I;  4B3M Q;  1KIX A;  3U58 A;  4OXP A;  1Q1E A;  1WYD A;  2FXQ A;  3S1M H;  2B63 H;  4JV5 L;  5BR8 Q;  2H5X A;  2AMC B;  4YHH L;  2UXD L;  4WJ4 A;  4QGU A;  1XTD A;  3GTM H;  4RG1 A;  5IE8 A;  1R9T H;  1PV4 A;  3I4N G;  3S1N H;  4A3J H;  1T9H A;  3G4S A;  3GTL H;  5LMU L;  2OCE A;  4JG2 A;  4YWK A;  1E7L A;  4BY7 G;  4JYA Q;  3CC2 A;  3JAM i;  3OTO Q;  4A3K H;  1K8G A;  4B3T Q;  4GKJ Q;  1SFO H;  2CCZ A;  4DAM A;  1KXL A;  1HNX Q;  5M3F G;  3STB D;  4YCV A;  5JJK A;  2MNA A;  1YIJ A;  1GO3 E;  1Z9F A;  1XMQ Q;  4DR2 L;  5E7N A;  4A3B H;  1KL9 A;  2MO1 A;  1N32 Q;  2Q2U A;  3RN2 A;  4LUO A;  4R4I A;  4YCU A;  3G6E A;  1YVC A;  1YHA A;  4DV1 Q;  2NN6 G;  2WFW A;  5LMN L;  1J6Q A;  3HOY H;  5C0X I;  3RN5 A;  4A3C G;  1FVI A;  1VQ9 A;  1B7Y B;  1TWH H;  1D8L A;  2D62 A;  1CKM A;  1CKO A;  3RLF A;  5LMN W;  4GOP B;  3TS0 A;  1Q7Y C;  1JJ2 A;  3HOU G;  1NTG A;  1X3F A;  1E1T A;  4AYB G;  5FJ8 G;  3CCQ A;  3K7U C;  1SN8 A;  3HKZ G;  4DR1 L;  4OWT B;  1QUQ B;  2UUB L;  3E0E A;  4X65 Q;  5GAH C;  4DV5 L;  2QA4 A;  2MO0 A;  1HZA A;  1WI5 A;  4DK6 C;  2VY3 A;  2GVA A;  2LXJ A;  2R6G A;  2NN6 I;  4LWC A;  1GKH A;  1L2F A;  1LM0 A;  3CCS A;  5IYC G;  1J5E Q;  4DUZ Q;  4JI8 Q;  4B3R L;  4EX5 A;  5ELN A;  1YBY A;  1RIP A; 
#chains in the Genus database with same CATH topology
 1LTA D;  1RTO A;  5A2Q E;  4K2K A;  4A93 G;  1GOZ A;  5IGE A;  5EGT A;  3SE0 A;  5JEA G;  4OO1 G;  1HZC A;  3NE5 B;  3AEV A;  4I7A A;  3BZC A;  3PIP 3;  1MJC A;  1VQP A;  3G71 A;  3R2T A;  1SLJ A;  1JB3 A;  2JSO A;  2R7F A;  1Z7T A;  1X6O A;  2VB2 X;  3KDF B;  3S2H H;  2WAQ B;  1HA6 A;  3M85 A;  4GKK L;  4RH6 A;  2FJ2 A;  4QY7 A;  1CZW A;  3T13 A;  4DV7 Q;  3PV0 A;  3DUZ A;  4PG3 A;  2VNU D;  1ONL A;  3CC7 A;  2PZT A;  4OWX B;  1I50 B;  1EFI D;  1WJJ A;  2QKI C;  5EKI A;  2KVE A;  4CJ1 B;  1S3O A;  4OEL B;  3MXP A;  1HR0 L;  1KNA A;  4YHH Q;  4X66 L;  3V05 A;  5E3F A;  1PH6 A;  2AKW B;  1F77 A;  1H9K A;  4AYB E;  3P75 A;  4P73 A;  2JA6 H;  3M9B A;  3H3V H;  3URY A;  2CW0 C;  4KJN A;  4CHT B;  2JYO A;  4DR6 Q;  1F2Z A;  1HFG A;  3I4M B;  2B2U C;  1VCI A;  2FMC A;  1QVF A;  2A8V A;  2IY5 B;  3HOX B;  2K6A A;  1FNW A;  1I94 L;  2EY5 A;  2IJ0 A;  1Y1W B;  4MTK A;  2R92 B;  2LKV A;  1VQH A;  4NDX A;  5GRO A;  1OXU A;  2LS0 1;  2NVQ H;  2RHQ B;  2OWO A;  3VR6 A;  4A3I H;  5DM6 3;  4X3K A;  2F03 A;  1JJR A;  4R9W A;  1JWU D;  3GTO B;  3M3Y B;  4QQB X;  3K0X A;  1TXY A;  4B3R Q;  4HIK A;  4OHJ A;  4JOI C;  4DV2 Q;  5KRU A;  2F4V Q;  3CCU A;  2CQA A;  4QL5 A;  4A3F B;  1YJ9 A;  5DAU A;  2R7Z H;  1F9S A;  1W6K A;  2F4I A;  5M3M G;  1EIH A;  4BA1 I;  2YV5 A;  2JA5 H;  1PA6 A;  3GTP B;  3CP0 A;  1OTC A;  4DUY Q;  3SK5 A;  4IFD H;  3KBG A;  1AZQ A;  4YWM A;  1PRT B;  3BDO A;  2EY6 A;  2Z0S A;  4IQZ A;  2JA7 G;  3BZD B;  2EJF C;  3CRK C;  3U50 C;  1VF7 A;  4IUN A;  3PO3 G;  1O7Y A;  1ICW A;  3K80 C;  3FPU B;  4K14 A;  2WB1 G;  2E2J B;  1JB7 A;  4IUR A;  5C0X G;  1ZXT A;  3A5Z B;  2VZA A;  5JPM C;  2B2Y A;  2PI2 E;  1O7Z A;  2DJF C;  4A3E H;  2SNS A;  4C3J B;  2KUM A;  3S16 H;  5J22 A;  1Y8O B;  3NEM A;  5D14 A;  3CQZ B;  4YIJ A;  2ZJP A;  1XYI A;  2RDH A;  1P8L A;  1I4R A;  1WTW A;  4P75 A;  3I73 A;  2YU9 H;  4LUV A;  3ND9 A;  1WTR A;  4A3M G;  1E2Z A;  3TSS A;  4DNR B;  4LFC Q;  1UE5 A;  1VMC A;  5JOB A;  2RKS A;  5C4Z A;  2QCP X;  2X6L A;  2NZ1 D;  3GTK B;  3E3X A;  1IYJ B;  3WWV A;  4A3G B;  1AP0 A;  1LTS D;  1EY0 A;  2MPM A;  3ER0 A;  1NBW A;  1AZP A;  1ASY A;  1N34 Q;  3W1B A;  4Y7N H;  1YHQ A;  1HXY D;  2WB1 E;  1DON A;  4KMU C;  5M5Y H;  2EY2 A;  2F0W A;  3S1M B;  2MQH A;  5J3B A;  3MXN A;  3VA5 A;  1PDQ A;  3VR2 A;  2JXM B;  4LJZ C;  3S1N B;  2Z4H A;  5EPL A;  3SEB A;  1WTH A;  3GQB A;  1KRT A;  1HQR D;  4XQN A;  1CI3 M;  4K8J A;  3HZX A;  1HH2 P;  4B3S L;  1C48 A;  4F7X A;  4A3B B;  4A93 H;  2BOS A;  5GAG C;  2J4X A;  4UHV A;  5JEA H;  4UP9 A;  3K58 A;  4X64 Q;  3HKS A;  5CV6 A;  3HOY B;  2K14 A;  3Q24 A;  1G2T A;  2M2L A;  2BDN A;  1K9M C;  1H9E A;  4IO9 A;  3K6O A;  3UDI A;  1V1O A;  4PMW A;  4CDF C;  3HOX G;  3S2D H;  1WFQ A;  1LTL A;  1VQB A;  4LFB Q;  1A15 A;  2KQ3 A;  2HCI A;  3KF8 B;  4IPH A;  1U9R A;  5I6Y A;  3Q6S A;  1YIT A;  1B44 D;  2ATW A;  3RLN A;  1VQL A;  1FJG L;  2AWO A;  1VQC A;  5J1Z A;  3P7J A;  4YCW A;  4DKA C;  1BKB A;  2PI2 A;  2OQK A;  3S2H B;  4MTN A;  1DD2 A;  1K8O A;  4DR5 Q;  2QDB A;  1WD0 A;  1QNK A;  1YNN D;  3F8T A;  1MD2 D;  2PW7 A;  5AJ3 Q;  3ITP A;  1FYC A;  4P71 A;  4DR4 Q;  2HT1 A;  1Q8I A;  3STB C;  3P1H A;  4HN7 A;  1R4Q B;  1CHP D;  1QCB D;  1N9W A;  5CC4 A;  4DAY A;  1TWF H;  4A3L G;  3H91 A;  2E75 C;  4K2L A;  2R7D A;  2QEJ C;  2KW9 A;  2F0G A;  2RQX A;  4DAP A;  1GXD C;  3RUZ A;  3VA7 A;  3LGJ A;  2KFV A;  2JA6 B;  1IBL Q;  4B08 A;  1C8C A;  2VQE L;  1TKW B;  5E4X A;  1A63 A;  3UE1 A;  1XPU A;  1VQ4 A;  1A2U A;  1VQJ A;  5M3M H;  2ES2 A;  3FEW X;  2EYJ A;  3GV6 A;  1L0W A;  2XNA C;  2NVT H;  2F3W A;  2JVW A;  3PCO B;  2EYH A;  4KHZ A;  4JI1 Q;  2KVM A;  4JI2 L;  1BQQ T;  4GN4 B;  4C56 C;  2EYP A;  2PZU A;  1PH4 A;  2PQA B;  4ODG A;  4LF7 L;  1PH7 A;  4EGV A;  1RJT A;  1UEB A;  2NVQ B;  2X6G A;  3VDY A;  4C3J G;  2F0J A;  3DXJ C;  4O2D A;  4A3I B;  3FP9 A;  1DXM A;  4OEM B;  2ZTD A;  1VQ7 A;  1GHJ A;  2UUC L;  3M7N A;  4GOP C;  4F87 A;  1F2M A;  2TMP A;  2A1A A;  1H9S B;  3TP5 A;  2R7Z B;  5CMD A;  1O7I A;  2UU9 L;  3NPP A;  3QR8 A;  2JA5 B;  1HUM A;  3IKJ A;  4GZY C;  1U4R A;  3G7L A;  1HNW Q;  1Y14 B;  1E1O A;  1VQ8 A;  2O4X A;  1ML0 D;  2PMZ B;  5DM7 3;  1XNQ Q;  3NEL A;  3W3A A;  1S5F D;  1JOO A;  1JT8 A;  5ELD A;  3J80 L;  1EUJ A;  2E2D C;  4HJ5 A;  3I7F A;  4MN3 A;  4YWL A;  1TY0 A;  4KD3 A;  1K8A C;  2DUD A;  4DV0 Q;  4U68 A;  1N33 Q;  3CMA A;  2JN4 A;  5CV8 A;  4A3M H;  1CUK A;  1JEI A;  3QOL A;  2F1M A;  4J1M A;  4JPB W;  3I2Z A;  1HTP A;  1II3 A;  3F2U A;  1YEZ A;  4A3J G;  1L0Y B;  1EWC A;  3G48 A;  3M4P A;  1EWH A;  1Y8P B;  3KDF A;  4TKO B;  4WRD A;  2F3V A;  1ZS9 A;  1EOT A;  4A3E B;  1B9M A;  1RDP D;  1EY4 A;  3CKI B;  3S16 B;  2RDF A;  4A75 A;  4JI8 L;  1CA6 A;  1YHB A;  2B3G A;  1RHP A;  3TP6 A;  1JC7 A;  3HOY G;  3T16 A;  3J7Z C;  3D4R A;  1HQM C;  3NSW A;  1DOK A;  4DNI A;  2H1E A;  2VQF L;  4HIO A;  4X3U A;  2YU9 B;  2AUK A;  2OT2 A;  3NUC A;  4IUT A;  1DM0 B;  2F0E A;  1I4X A;  1I6V C;  2HIV A;  4LF4 Q;  4DPG A;  3P20 A;  4KI0 A;  4LUZ A;  1K28 A;  5EKK A;  1QWY A;  2F0H A;  4ZUJ A;  3MEH A;  5EBD A;  2E74 C;  2EDG A;  3U58 A;  1WYD A;  4CDC C;  2B63 H;  4Y7N B;  4ZCK A;  5I2Y A;  3I4L A;  1XTD A;  5IE8 A;  1R9T H;  4AYB B;  1PV4 A;  3GTL H;  5LMU L;  5M5Y B;  1Y69 U;  1MBY A;  3H6M A;  1JEQ A;  2EOT A;  1HNX Q;  4YCV A;  1KDC A;  4IUV A;  2EY1 A;  5M9O A;  3DEP A;  5CR3 A;  1YHA A;  3G6E A;  2NN6 G;  4DV1 Q;  1GHK A;  4A3C G;  3ND8 A;  3TS0 A;  4GOP B;  1CKO A;  4A93 B;  4G7Z C;  1X3F A;  3CCQ A;  1E1T A;  2LY7 A;  3K7U C;  2LC3 A;  3HKZ G;  4DR1 L;  1AW7 A;  3E0E A;  4DV5 L;  2QA4 A;  2XRQ D;  4DK6 C;  3OWE B;  2VY3 A;  3W2D A;  1LTB D;  2LXJ A;  2NN6 I;  1GKH A;  2RA4 A;  5IYC G;  5T1G A;  1J5E Q;  1YBY A;  5C3W A;  1RIP A;  2XN9 C;  5KYL A;  1PXU A;  1KQS A;  1EZ8 A;  1PYS B;  2Q2T A;  1L1O B;  3S2D B;  1CK1 A;  3J7Y W;  3SR1 A;  1PZK D;  2G80 A;  3MA2 B;  4DR3 L;  1ROD A;  2E5L L;  4A3L H;  2VW9 A;  2F3I A;  4HJ7 A;  2K01 A;  3I91 A;  1IW7 D;  1ENA A;  4IPD A;  3TRZ A;  2JEA I;  1SE4 A;  5I9O A;  2IX1 A;  3A74 A;  1HZB A;  3I3C A;  4IOC A;  1G29 1;  4BY1 G;  1G6P A;  1BCP F;  1L0X B;  1KHI A;  2GN5 A;  3TRE A;  4G7H C;  5FK9 C;  2EXD A;  4HJ9 A;  4TVA B;  2L5T A;  2WAC A;  3JAM L;  3U4V A;  1GVP A;  1O80 A;  2CKZ B;  1SNM A;  1W3S A;  4JV5 Q;  4QUC A;  3NQT A;  1HJP A;  1JCK B;  1HCZ A;  1HR0 W;  2LSS A;  3MZ5 A;  4IFD G;  2ENB A;  3CCR A;  3HKZ E;  1GUS A;  4DU9 A;  5KIX A;  1VQA A;  1GUN A;  4RCN A;  1KNE A;  1ENF A;  2IW3 A;  4DR7 L;  2QF7 A;  3KBX A;  4B9X A;  1NMF A;  3L7Z C;  5C44 H;  4A76 A;  4BS9 A;  2XGT A;  3IFT A;  1LO5 D;  1TS2 A;  4V19 0;  1P16 A;  5M3M B;  5EAY A;  2NVT B;  4KN7 C;  1LT5 D;  1V1Q A;  2JA9 A;  2KCC A;  3PSI A;  2A6H D;  5KEE A;  5NUC A;  2UUB Q;  2C35 B;  1F2L A;  1B8A A;  3S14 H;  1IHZ A;  2KHJ A;  2UXB L;  5J39 A;  3WDN A;  2JK8 A;  4QIW E;  5K5P A;  1STA A;  1CSP A;  3L3O C;  1KDB A;  1YNJ D;  4I7Z C;  2SEB D;  3MXU A;  1T5X D;  3PQI A;  1V8Q A;  1YNN C;  4POG A;  5FLX L;  2Y0S G;  4AIM A;  1B9N A;  4FNF A;  1D6E C;  2WB1 B;  4R4T A;  4EQ5 A;  4BA2 I;  2XVS A;  1AH9 A;  2ZTC A;  4GKK Q;  1Q12 A;  4IJL A;  4NKL A;  4L5T A;  4HAE A;  2UXC L;  2PMZ E;  1S4Z A;  1PTO F;  5DNF A;  2VB3 X;  3C3L A;  2Z6K C;  3D6C A;  2B29 A;  4C2M H;  2FFK B;  1QNU A;  3R2I A;  1HR0 Q;  3VR5 A;  3K81 C;  4X66 Q;  3KF8 A;  3N6R A;  1J9O A;  2IPK D;  2PQE A;  3AFP A;  4DNT B;  3EN2 A;  4FF1 A;  2PPB C;  4A3M B;  3DWQ A;  3KLR A;  4HMJ A;  3S1Q H;  1YI2 A;  3PF4 A;  2HHH L;  4PMC A;  5T1I A;  1SAP A;  5LL6 S;  1YNX A;  4G4K A;  2L12 A;  4GLA C;  4X6A H;  1Z6H A;  3H15 A;  3MHB A;  4RCO A;  2AUJ D;  1I94 Q;  4V0B A;  3K5L A;  3J7A 5;  4DV4 L;  2N78 A;  4PNY A;  1NAP A;  4XXE A;  3RZD H;  3ICE A;  4DAV A;  1IBM L;  2Y0S E;  3Q22 A;  3CCL A;  1NY4 A;  1PLF A;  2BA1 A;  4CKC A;  2F0S A;  1RTN A;  3SXH A;  2C9O A;  4HMI A;  1K3R A;  1PH3 A;  1VQO A;  1EIG A;  2OTL A;  5IYD G;  5KND A;  3KFU A;  2K52 A;  5KYI A;  4XQQ A;  1ESF A;  4JCV E;  5G3L F;  5IYB H;  1HRJ A;  2F0T A;  2NN6 H;  3PO2 G;  2PW5 A;  4A3C H;  5IWA L;  1V9P A;  2M00 A;  1LLR D;  4WJ3 M;  2A73 B;  4N9T A;  1K0R A;  1I4Q A;  1Q8K A;  1SE3 A;  4GN5 A;  2P5Z X;  2LXK A;  2UXD Q;  5C5M A;  2NTT A;  3FKI G;  2FIN B;  4XIG S;  2HIX A;  2NBF A;  2B63 B;  2ZTE A;  4HIM A;  2GA4 B;  2PQA A;  1IYV A;  2K5V A;  1R9T B;  1RF2 D;  3A7A B;  3GTL B;  3EQL C;  2ASB A;  2ZJR A;  1SRO A;  4H7B A;  5IYC H;  1VQN A;  1QJO A;  3D4D A;  3UDF A;  2K5H A;  1XPR A;  2DY7 A;  2B2W A;  2B2V C;  1OXS C;  1VQK A;  1V66 A;  2YTY A;  3FVQ A;  4P72 A;  1EIY B;  1EYC A;  1H9S A;  1IZ6 A;  1XPO A;  4ZK9 B;  1E22 A;  3IFD A;  4TSS A;  4Y52 H;  4GN3 B;  2A6E C;  1XNR L;  1VQG A;  1Q90 A;  4K5V A;  4BY1 H;  1B3Q A;  2KEC A;  3CCJ A;  2MHV A;  3WOE A;  1YZ6 A;  3F2D A;  3IRB A;  5IOD A;  4LF8 L;  4PQX A;  1RD9 D;  3FMC A;  1WTO A;  2F0U A;  3CPF A;  1BBX C;  4MZ9 A;  1LTI D;  2D0O A;  3E9H A;  4R4C A;  3U9S A;  1TII D;  4L63 B;  3HGB A;  3PIO A;  1XMO L;  1FR3 A;  2F0D A;  2Z9H A;  1X3P A;  4JI6 L;  2BH8 A;  3NK9 A;  3I4O A;  4E6I A;  1E2W A;  1FGU A;  3LX0 A;  2RBM A;  1NE3 A;  2RNN A;  2JP1 A;  2K50 A;  3H94 A;  2K28 A;  1XTC D;  1NJI C;  1RL2 A;  4XT3 B;  1SJE D;  3BVM A;  4P74 A;  2KVD A;  1UEA B;  3SGI A;  1WTQ A;  3MEF A;  1IYU A;  1SNO A;  4P2C B;  4L5S A;  2Z4I A;  1DCZ A;  3VR4 A;  5JVG 3;  1PTO H;  1SJH D;  1BVS A;  3OYY A;  3J80 i;  4DR6 L;  2JJQ A;  5A35 A;  2DN8 A;  4B3S Q;  2F0O A;  3TP7 A;  3HOZ G;  4JVZ A;  2G5D A;  3G6J B;  2X69 A;  3I55 A;  1M90 C;  2Z6B A;  3CRL C;  3PGZ A;  2JQO A;  4CJ2 C;  3EA6 A;  2K4K A;  1B2T A;  4KHP L;  2EIF A;  5CGK A;  4KKU A;  3H3V C;  3DWA A;  4OON A;  2Q8I B;  2ZM6 L;  3S14 B;  1IW7 C;  1XX8 A;  4KV6 A;  3TBI B;  3UE0 A;  3DHQ A;  4NMZ A;  4K5W A;  1E7D A;  1LT3 D;  4A4I A;  1FNU A;  4HSV A;  2E2I H;  2QIL A;  4M8A A;  1CQF A;  1GUG A;  4LF9 L;  4XQJ A;  3T4A C;  1SNQ A;  2QEX A;  4OIJ A;  4IPG A;  1EY6 A;  1GJX A;  1TT2 A;  4L5Q A;  4GOP A;  1FJG Q;  4H0L C;  3LNN A;  1B1Z A;  1BF4 A;  4JBW A;  3WOF A;  4Z9C B;  1QVG A;  1VQI A;  1TS5 A;  2B2W C;  4A3J B;  1SSO A;  4XYO A;  5KGU A;  1JOQ A;  4R4O A;  3NXW A;  4Q0F A;  3HOW H;  1N32 L;  1H9R A;  4R8N A;  5LHY 1;  3S9W A;  1WTX A;  4UY8 C;  3ULJ A;  1ET9 A;  2KHI A;  5I2X A;  1L1O A;  5IGF A;  3A54 A;  1M4V A;  3HOV G;  4C2M B;  4K6D A;  2B63 G;  2C5C A;  3JC6 6;  2A6H C;  3OOC A;  2XIW A;  1I5F A;  4RHR A;  3S1Q B;  1UAP A;  2VQE Q;  3FLG A;  1PH9 A;  1Q82 C;  3H0G H;  3L0O A;  5I4D A;  2BE5 D;  2EJM A;  5IYD H;  1WCM G;  2HQE A;  4GLV B;  1D7Q A;  3ULL A;  3PO2 H;  2NWG A;  3TME A;  2KJX A;  4KKT A;  4JI2 Q;  4JI4 L;  4LF6 L;  1YNJ C;  4MIU A;  1PFN A;  2ZJQ A;  3I72 A;  4LF7 Q;  1MI2 A;  2BA0 A;  2OXP A;  4L6T B;  3FKI H;  1K8M A;  3DLL A;  3RZD B;  4IUQ A;  4AH6 A;  3T51 B;  3QJY A;  1N36 L;  4IOA A;  4AQY L;  1G8Z D;  4KY6 A;  1SMY D;  4YY3 L;  1Q81 C;  2WIN B;  5HY6 A;  3SK8 A;  4K0K L;  4N8X 1;  3EJI A;  1STE A;  4RGT A;  2UUC Q;  2LD7 A;  4JBK A;  1S5E D;  3LLR A;  4N9P A;  2UU9 Q;  4DV6 L;  2IL8 A;  4DGZ A;  5IIF A;  1EU3 A;  4DK0 A;  4LK1 C;  4RG1 A;  1EU4 A;  1T9H A;  3HKZ B;  2OCE A;  4JG2 A;  4ZRZ A;  4YWK A;  4BY7 G;  3JAM i;  2L9H A;  4DAM A;  2MNA A;  4QF4 A;  1GO3 E;  3J81 L;  4DR2 L;  1KL9 A;  2EPB A;  1JIC A;  5LMN L;  2I46 A;  1FVI A;  1TWH H;  2D62 A;  1CKM A;  1MSG A;  3HOU G;  1NTG A;  5FJ8 G;  1CT1 D;  1G6Z A;  1V1P B;  4OWT B;  1E0B A;  2MO0 A;  2O5J C;  4QIW B;  1AEX A;  5CBE E;  2GVA A;  1L2F A;  2J7Z A;  2EYM A;  4JI8 Q;  2A68 D;  1BDO A;  3T1H L;  4BY1 B;  1TWC H;  5C44 G;  4HR7 B;  4CBV A;  1SYE A;  2CVR A;  3MTS A;  3NWT A;  5FKA C;  1BBU A;  4BIT A;  1TY2 A;  1CTM A;  4XTC S;  3VYS A;  2VQF Q;  1M1K C;  2VS1 A;  1SEB D;  3GP7 A;  4JI7 L;  1IXR A;  3LWU A;  1Y1V G;  2N55 A;  1PRT F;  2K5Q A;  3F1Z A;  3TN2 A;  3R3O A;  5GAE C;  2NTS A;  1L1O C;  5HGT A;  5C5L A;  3HOZ H;  5ELO A;  4BBS G;  1I4G A;  4NXN L;  4ILW A;  5LL6 X;  3FPP A;  2W51 A;  4MHE A;  4O42 A;  3ULP A;  2JA8 G;  2V4D A;  3PUV A;  2KOL A;  3J80 c;  1DGS A;  2F0N A;  4DFA A;  5LMU Q;  4NXM L;  2N8N A;  2EYO A;  3NQI A;  4F8M A;  1CA5 A;  2OQ0 A;  2Q8T A;  4ZKC B;  3CU7 A;  2YYZ A;  3PUY A;  1KLU D;  2K03 A;  1K0S A;  4FDB A;  5IP7 G;  2V1C C;  1S5C D;  2SDF A;  2L4N A;  1EYD A;  3M4Q A;  2R93 H;  1E24 A;  3NHH A;  2A6E D;  2Y0S B;  4DR1 Q;  4DV5 Q;  5I9P A;  3R93 A;  1X32 A;  4O1N A;  4C3H H;  5FO8 B;  1IBK L;  4OWW B;  4K5X A;  1T5E A;  2G9D A;  3D6W A;  2F0Q A;  1GJJ A;  4JI0 L;  3GTG H;  4KJO A;  4NPS A;  4X3S A;  5AFW A;  4NB3 A;  5COR A;  2PO4 A;  3D0F A;  1NCV A;  2K32 A;  3QIA A;  3RZO H;  4DR3 Q;  1ICF B;  4ME3 A;  3F2B A;  2E2I B;  2CHB D;  2E5L Q;  4JI5 L;  3HOV H;  1STH A;  3ZYY X;  1LUZ A;  3X3N A;  3VR3 A;  3Q8D A;  2VXW A;  2VUM H;  4WJW A;  3BS1 A;  1B4O A;  4LF5 L;  2ICE C;  2D0P A;  2HDM A;  5C4X G;  3CC4 A;  3BVG A;  3J80 E;  1JMC A;  1PYB A;  1JR0 D;  4K6L A;  3J7A F;  2A19 A;  1SDF A;  1X54 A;  2Q2I A;  4PZ8 A;  1B53 A;  1STY A;  1U0L A;  1WCM H;  3SDZ A;  2DNE A;  3U4Z A;  3A8K E;  5IYB G;  3W5O A;  3HOW B;  1BBW A;  1A2T A;  1PZI D;  2TSS A;  1H1J S;  3KLW A;  1HA5 A;  4NW2 A;  1TWA H;  2Z6K A;  4IZ8 A;  2F0I A;  4FYD A;  1MKH A;  1SYC A;  3A0J A;  2N3S A;  1JJC B;  2RHS B;  4O0A A;  3I4M H;  4QB4 A;  1BXT A;  2IX0 A;  3E9I A;  3VYR A;  1FNV A;  4DR7 Q;  4LAA A;  1UUP A;  1C4Q A;  1PFM A;  1X3Q A;  3NBI A;  5C3E H;  1PVO A;  1EL0 A;  3HRZ C;  1GUO A;  3DWP A;  1RKN A;  5M5W H;  2ZT9 C;  5FOB B;  3TEH B;  3PO2 B;  4M1U B;  1GM5 A;  2EVB A;  3M3Y H;  2PYK A;  4JBM A;  2KEN A;  2UXB Q;  2EZV A;  3FKI B;  4QJF A;  1PH2 A;  4BY7 H;  2A74 C;  1XWE A;  5IGC A;  1WTP A;  1JE4 A;  4HTH A;  1A3T A;  4S3S A;  1X3E A;  4OX9 L;  1BR9 A;  3PIP A;  1SRU A;  2RVL A;  2ID0 A;  2O5I C;  3RLO A;  3NTI A;  1SXT A;  1TR5 A;  3ERO A;  1B50 A;  3A8I E;  2E76 C;  3HOU H;  5FJ8 H;  1U4P A;  5FO7 B;  1D2B A;  1TWG H;  1NMG A;  5IP9 H;  1TWF B;  4PZ6 A;  4RA8 A;  3JAM c;  4LFA L;  3PMF A;  2UXC Q;  2QDL A;  5JJI A;  4X62 L;  4LW1 A;  2Z1C A;  3CCV A;  4R1J A;  1EY8 A;  3A56 A;  2WII B;  2KCM A;  4WFN 3;  2AHO B;  1STG A;  2O2L D;  2KEE A;  2BE5 C;  3E6Z X;  2CH4 W;  2HJQ A;  4UAI A;  4JI3 L;  1TWH B;  2L15 A;  2RF4 A;  1TS3 A;  3K5O A;  1O78 A;  1F9Q A;  1ENC A;  1X9N A;  2B2V A;  4UPA A;  3NBH B;  1Y1V H;  2HHH Q;  2PCF B;  2NVX H;  1SYB A;  4A3K G;  3DM1 A;  5BN3 A;  3GO5 A;  3CXC A;  5CIU A;  1SMY C;  2CWP A;  4BBS H;  1TWC B;  1MHW C;  3VYT A;  4DV4 Q;  4R8I A;  1X65 A;  1H9F A;  1JWS D;  2K05 A;  5ELB A;  1PTO D;  2JA8 H;  1IBM Q;  5A2Q L;  2CQO A;  3EVQ A;  3I70 A;  3Q0A A;  3OW2 A;  1G51 A;  1HUN A;  2FHT A;  5IGG A;  3OMC A;  5FLX c;  3OPO A;  1LT4 D;  3JAM E;  3OW7 A;  4G7O C;  4QUF A;  2F0P A;  2A69 D;  3F2C A;  3UI2 A;  4I65 A;  5IWA Q;  3HOZ B;  5IP7 H;  2DNC A;  4OGQ C;  3Q23 A;  3X3M A;  1Q46 A;  2PNH A;  1A8V A;  1NUC A;  2XTI A;  3T1Y L;  2UUA L;  2MP1 A;  4OIK A;  1ILQ A;  3BDL A;  2K5N A;  3MAQ A;  1HNZ L;  2OEO A;  1EIF A;  4N8F A;  1F9P A;  4J6H A;  3K5M A;  3IAY A;  3M7G A;  2EXZ A;  2K7V A;  3EBE A;  5CV5 A;  1EQR A;  4IAL A;  1X56 A;  5HUR A;  4A3D G;  3HOW G;  2F0L A;  3KUP A;  4KK7 A;  2A68 C;  3FHW A;  5DLQ E;  3RD4 A;  3ZJY C;  3R8B A;  1ZKO A;  3BYY B;  1JOK A;  1KRS A;  5G3L D;  1A6X A;  2R93 B;  5C4X H;  3OMG A;  1YJN A;  1XNR Q;  3KJO A;  1UE7 A;  1KD1 C;  4C3H B;  4ZYS A;  4GNX B;  5FLX E;  2QNC A;  1EWI A;  3BYT B;  3H0G G;  3C46 A;  2I5L X;  4J8Q A;  4RWS C;  5KNC A;  3GTG B;  4LF8 Q;  1C7Y A;  3I56 A;  1NR2 A;  4DV3 L;  3NP8 A;  4B3M L;  3RZO B;  2N88 A;  5C0X J;  2HQL A;  5BR8 L;  1WVL A;  3HOV B;  1PZJ D;  1PH8 A;  1XMO Q;  2H4O A;  1EOV A;  1KHC A;  4JI6 Q;  2VUM B;  1NR4 A;  1V1P A;  1SMX A;  2L11 A;  1ZYR D;  3KLS A;  3T53 B;  5JJZ A;  4JYA L;  4GKJ L;  3U9O A;  1D5X C;  4L8J A;  2ZXO A;  3OTO L;  3PUW A;  4LMQ D;  4B3T L;  3S24 A;  3K7A H;  4J15 A;  4OO1 I;  1UE6 A;  2JEB I;  4BBR G;  5C3X A;  1XMQ L;  5EQ0 A;  1KLG D;  3KJP A;  5E4W C;  1WCM B;  1EQV A;  4BXX G;  3PUX A;  3C1F A;  3V96 A;  4PZ7 A;  2QNF A;  4DK3 C;  3QKJ A;  3FRP B;  4PV1 C;  3J81 i;  2F0K A;  4C1N I;  2EYF A;  1EQQ A;  4X65 L;  1TWA B;  1JJG A;  4H13 C;  1CZG A;  3OSO A;  1E3P A;  1UWV A;  3AFQ A;  1QVC A;  3S1R H;  1MJE A;  3D4W A;  1YJW A;  3DEO A;  3I90 A;  4DUZ L;  2XSC A;  1G2S A;  4KKS A;  5C3E B;  3KK7 A;  3GDE A;  5M5W B;  5EKL A;  3E5S A;  1SE8 A;  2NB0 A;  1GD7 A;  4KHP Q;  4CGY B;  3D8G A;  4JK1 C;  5C4J H;  2NVY H;  2B8F A;  3T56 B;  2GVB A;  2ZM6 Q;  1CSQ A;  5EJW A;  4BY7 B;  2NYZ D;  1UNS A;  4DV7 L;  4EQP A;  2PZW A;  5L37 A;  4EQN A;  1Q3L A;  4RMF A;  2B39 A;  2K33 A;  3C2P A;  3BG3 A;  1LV9 A;  1I3Q H;  4LF9 Q;  3CD6 A;  1EQT A;  2XWJ B;  2JE6 I;  1LT6 D;  3MFG A;  4OXP A;  2H5X A;  2AMC B;  4RGN A;  4YHH L;  2UXD L;  1CFM A;  4QGU A;  3SVM A;  3GTM H;  3HOU B;  3I4N G;  2SNM A;  1TWG B;  3G4S A;  1ZEQ X;  3CC2 A;  4F88 A;  4A3K H;  4C1N K;  1SFO H;  2CCZ A;  5M3F G;  5JJK A;  1YIJ A;  1HPC A;  1HFN A;  2B2T C;  4XT1 B;  1N32 Q;  2Q2U A;  2EE1 A;  4YCU A;  2K5D A;  1H9M A;  3I8Z A;  5C44 B;  3A55 A;  3RN5 A;  2XRS D;  2IWH A;  4HED A;  1D8L A;  3RLF A;  5LMN W;  1JJ2 A;  2HCC A;  2MJ8 A;  5D3I B;  3HS0 C;  1SNC A;  3ONA B;  4KN4 C;  1BCP C;  1SN8 A;  5JPN C;  1EEF D;  4UZW A;  1QUQ B;  3VYU A;  1F2Y A;  2AQ1 B;  1ZBH A;  1Y8N B;  2K1B A;  3AMU A;  2R6G A;  2WV6 D;  1Y1V B;  3CCS A;  2NVX B;  4B3R L;  5C0X I;  5ELN A;  2PNR C;  5EPK A;  4DV2 L;  2F4V L;  4IUP A;  4JI4 Q;  1D1K A;  4LF6 Q;  5GAD C;  3CF5 A;  4BBS B;  3TP8 A;  2L55 A;  2R93 G;  3H09 A;  4DUY L;  1KAB A;  2JA8 B;  1EY5 A;  1D5Z C;  1N36 Q;  1FD7 D;  3CCM A;  4AQY Q;  2KCT A;  2XWB B;  4C3H G;  3M4O H;  2MUY A;  4YY3 Q;  4K0K Q;  3IL8 A;  2WQG A;  3L9A X;  4KTA A;  1GL9 B;  3LWE A;  1C0A A;  4C3I H;  2I5M X;  3CW2 C;  3NWS A;  4A3D H;  2EJG C;  3GD7 A;  3FDT A;  2K04 A;  2D5D A;  1VQD A;  4DV6 Q;  3DMU A;  4LNQ A;  4HCE A;  4ULL A;  1EYA A;  1LAC A;  2G9H D;  1CKN B;  2WAQ G;  4FF3 A;  3SK6 A;  2VUM G;  4ALP A;  3ERQ A;  4DXF A;  3CME A;  1PFS A;  1Z47 A;  4RKL A;  1FL0 A;  2I07 B;  1EY9 A;  1ESR A;  4DR2 Q;  4RAU C;  2DGY A;  3KF6 B;  3C1E A;  4QMG A;  1QB5 D;  5LMN Q;  3K8A A;  1AN8 A;  1BO0 A;  4ME5 A;  4OO1 H;  3CAM A;  4RKB A;  2AQ2 B;  5F2D A;  2EQS A;  5E1F A;  2YTV A;  1CQV A;  3TZU A;  4IPC A;  4JW0 A;  4KY7 A;  5COY A;  5IT9 L;  3BVZ A;  1PTO C;  4Q5V A;  3AYH B;  4LFC L;  3QWN A;  5IGD A;  3S15 H;  3DM3 A;  3GTJ H;  3I4M G;  1O7L A;  1WOC A;  5CYU A;  5C4X B;  3CCE A;  1C9O A;  5KNB A;  3T1H Q;  3MC0 B;  2D2C C;  3QO2 A;  2CH4 A;  5IT9 c;  4BBR H;  1DOM A;  3UDX A;  3PIO 3;  1MIU A;  5C3E G;  1Y1W G;  2DY8 A;  1VF5 C;  4DA2 A;  2R92 G;  4BXX H;  4GS3 A;  5M5X H;  3AU7 A;  1N34 L;  2KVU A;  2I5H A;  1X3G A;  2A69 C;  1DYQ A;  1K83 H;  2F0V A;  4FXK C;  5BN5 A;  1IKL A;  1KDA A;  2Q2H A;  4FXG C;  1I6H H;  4JI7 Q;  1AFP A;  1HZ9 A;  1EFW A;  1EZ6 A;  1BCP B;  2WAQ E;  1RCV D;  4X3T A;  3NBH A;  4CJ0 B;  4CDD C;  4A3F G;  5GQO A;  2ODG C;  3K7A B;  4NXN Q;  2Z8L A;  3BZK A;  1B3A A;  3ERS X;  2B2Y C;  4IN3 A;  2R61 A;  1GUT A;  4X64 L;  2WKC A;  3GV3 A;  3J81 c;  2IT1 A;  4NXM Q;  2F0F A;  4UDU C;  4XDX A;  5IP9 G;  5ISR A;  1Y02 A;  2E2H H;  4APV A;  1PHJ A;  5CV9 A;  3RNU A;  1STN A;  5JJL A;  5JAV A;  1PMR A;  1F9R A;  3S1R B;  5H1S E;  1M8A A;  1AE3 A;  3TZD A;  2NUC A;  1SR3 A;  2DJG C;  3PUZ A;  1PRT D;  2N49 A;  5IT9 E;  4LFB L;  1CM9 A;  3J7A V;  1MGS A;  3UDG A;  2WP8 J;  4HSP A;  5D3D A;  1BUV T;  2KHS A;  1LTG D;  3KLS X;  3I4N H;  3TDQ A;  1IBK Q;  1EYG A;  2JA7 H;  3OIQ A;  3MVV A;  3PF5 A;  1SYG A;  2KBN A;  5C4J B;  4JI0 Q;  1TU2 B;  2NVY B;  1VQ6 A;  5M3F H;  4B9W A;  1OXT A;  4RGM A;  2A5H A;  3PO3 H;  4DR5 L;  4UP8 A;  1ZYR C;  2QGQ A;  4FF2 A;  2RNO A;  5AJ3 L;  3BU2 A;  5D65 A;  1OXX K;  4DR4 L;  4IUU A;  1QG7 A;  4CKE A;  1HHV A;  3MFY A;  5C0X H;  4JI5 Q;  4BWG B;  1I4H A;  1X55 A;  5CV7 A;  5K36 G;  1I3Q B;  1U4M A;  5BN4 A;  4RGO S;  4LF5 Q;  1H9J A;  3A8J E;  2L0C A;  3S17 H;  3J81 E;  4L5R C;  3D3R A;  1PH1 A;  2I0Q A;  3GTM B;  1S5B D;  4A3G G;  1PTO B;  3RR5 A;  2ALY B;  1A62 A;  1LTT D;  1IBL L;  4A3K B;  1SFO B;  3GTQ H;  4ZAI A;  1XXG A;  4DK1 A;  4GNX A;  1VQF A;  4G57 A;  2K5W A;  3D31 A;  2LFN A;  3V2T A;  2CFM A;  5FLM G;  1VMP A;  5CV4 A;  1EEI D;  4JI1 L;  3SK4 A;  1PFB A;  2CW0 D;  1ET6 A;  3K5N A;  3L2P A;  1JQY D;  3CHB D;  1N8R C;  4FO2 A;  4KLK A;  2WKD A;  2BCO A;  1KAA A;  3EIV A;  4WOR A;  5IOC A;  1WD1 A;  4QCL A;  1SYD A;  4A3B G;  2QW7 A;  2K75 A;  5EPJ A;  1V43 A;  1S5D D;  3A7L A;  4FP5 D;  4TRD A;  1KAW A;  1D1I A;  1QOH A;  2HDL A;  2LMC B;  2IHF A;  4H44 C;  2RDG A;  1EY7 A;  1K73 C;  1IL2 A;  1SND A;  4IFD J;  1J8I A;  1HNW L;  1S40 A;  3W1G A;  1I50 H;  4OX9 Q;  1H95 A;  1KTK A;  3M4O B;  1XNQ L;  2Q8R E;  5IY0 A;  3J81 j;  3BDC A;  1OXV A;  1DJR D;  2E8G A;  2D9U A;  5TSS A;  4ZQ3 A;  2M9V A;  2F52 A;  4C3I B;  4A3D B;  4DV0 L;  1N33 L;  3AQQ A;  3SHL A;  3MWY W;  5ELE A;  4EQO A;  1A0I A;  4CKB A;  1BNZ A;  4LFA Q;  1W6J A;  1B70 B;  4HJA A;  4X62 Q;  1GKU B;  4RFB A;  2IX3 A;  3HOX H;  1DZ1 A;  3OIP A;  1W2B A;  1Y1W H;  1ILP A;  1XJV A;  2R92 H;  3H0G B;  4K8I A;  1R4P B;  2VL6 A;  5HGQ A;  1BCP D;  4DN4 M;  5ELF A;  4ZLT F;  4JI3 Q;  1ASZ A;  4JC0 A;  3MXN B;  4ZUI A;  2AWN A;  5I6W A;  4HJ8 A;  2RCN A;  1TS4 A;  3GTO H;  4OL7 A;  1AE2 A;  2JA6 G;  4LF4 L;  3B6Y A;  4TQU S;  3OHX C;  1EN7 A;  1A3V A;  2HUG A;  3S15 B;  1JOR A;  3GTJ B;  4A3F H;  3QOJ A;  3HG9 A;  2R3Z A;  2NZH A;  3HFZ B;  4EVO A;  3GTP H;  1OO9 B;  4BBR B;  2YTX A;  2BH2 A;  3RMH A;  3A5U A;  3BJU A;  2ODC I;  1E7Z A;  3H3V I;  4JBJ A;  5M5X B;  1K83 B;  2ICI A;  3K59 A;  4A3I G;  5CBA E;  4IJH A;  4KHV A;  1I6H B;  2OF1 A;  1QUQ A;  3E0J A;  4GNX C;  1Q86 C;  5JVH 3;  1YNS A;  3TS2 A;  1JE5 A;  1FGB D;  1K3B C;  1LYL A;  1HNX L;  1TVX A;  3NTH A;  2E2J H;  2R7Z G;  1U4L A;  1UE1 A;  4DV1 L;  1QE6 A;  3MXG A;  4UP7 A;  1S72 A;  4KD4 A;  2JA5 G;  4MNO A;  3T1Y Q;  2UUA Q;  1IKM A;  3KYH C;  4R4Q A;  1STB A;  1LAB A;  2ZXR A;  3O13 A;  5JEA J;  1VQ5 A;  5DEH A;  3K57 A;  3QB3 A;  4H02 A;  1SBB B;  4C3J H;  1HNZ Q;  2RCF A;  3TQY A;  4DF7 A;  3CQZ H;  1LTR D;  3M4Y A;  2IHE A;  4FXD A;  2E2H B;  1J5E L;  5FO9 B;  2L1B A;  2MFI A;  1TQO A;  4IFD I;  4HID A;  4DAY B;  3QG1 A;  2MPH A;  2B2U A;  2FMM A;  1KC8 C;  4GLX A;  1MSH A;  4POF A;  4ID6 A;  5K36 H;  2F0M A;  1QZG A;  4FF4 A;  3CPW A;  1VQM A;  2CWA A;  1IL8 A;  2BDO A;  1CHQ D;  2OTJ A;  3GTK H;  1PYW D;  2J0T D;  1Q1B A;  1CKN A;  4XYQ A;  4PMB A;  3I4N B;  1U5K A;  4A3E G;  4A3G H;  2RSN A;  1NSN S;  2JA7 B;  4U67 3;  5C4H A;  1PH5 A;  1VS0 A;  2ZXP A;  2EYL A;  1QZH A;  3NEN A;  5M3F B;  2KA7 A;  3KOJ A;  3PO3 B;  2NZO A;  1HTL D;  5FLM H;  4DV3 Q;  1VQE A;  3KF6 A;  4JOI A;  2KCN A;  4ZKB B;  1SE2 A;  4B3M Q;  1GUW A;  1SYF A;  1KIX A;  1Q1E A;  2FXQ A;  4ABN A;  3S1M H;  4JV5 L;  4NP5 A;  5BR8 Q;  4WJ4 A;  3AB9 A;  3S1N H;  4A3J H;  3K0Y A;  1A3U A;  1I4P A;  1E7L A;  1E2V A;  4JYA Q;  4GKJ Q;  1K8G A;  3OTO Q;  4B3T Q;  3S17 B;  2RSO A;  2KED A;  1KXL A;  3N52 A;  3STB D;  1XMQ Q;  1Z9F A;  2SOB A;  4A3B H;  5E7N A;  1SNP A;  2MO1 A;  3RN2 A;  1NNX A;  4LUO A;  4R4I A;  5EBC A;  1YVC A;  4C3I G;  2WFW A;  1J6Q A;  1QIL A;  3HOY H;  3GTQ B;  1DOL A;  1D5M C;  1VQ9 A;  1B7Y B;  1JWM D;  1Q7Y C;  2B2T A;  3HEJ A;  3HP3 A;  4AYB G;  1PRT C;  1WTV A;  1G91 A;  2DK4 A;  2UUB L;  3EFX D;  4X65 Q;  5GAH C;  5ELC A;  4DXG A;  2B8G A;  1HZA A;  3NTK A;  4RHS A;  1VDZ A;  1WI5 A;  2MGS A;  4KY5 A;  5C6A A;  4LWC A;  4CDE C;  1BOS A;  1LM0 A;  4FVM A;  2HD3 A;  2AQ3 B;  4DUZ Q;  4HCS A;  4EX5 A;  3OWF A;  5IGB A; 
#chains in the Genus database with same CATH homology
 4DV2 L;  5C44 G;  1KQS A;  2F4V L;  1PYS B;  2Q2T A;  1L1O B;  4JI4 Q;  1BBU A;  4A93 G;  2G80 A;  5GAD C;  3CF5 A;  4LF6 Q;  5JEA G;  4OO1 G;  4DR3 L;  1HZC A;  4XTC S;  3AEV A;  2VQF Q;  2E5L L;  3BZC A;  4A3L H;  2R93 G;  1M1K C;  1MJC A;  2F3I A;  2VW9 A;  4DUY L;  4HJ7 A;  3G71 A;  1VQP A;  1SLJ A;  2R7F A;  2VS1 A;  1N36 Q;  4JI7 L;  1X6O A;  1IXR A;  3S2H H;  3KDF B;  3CCM A;  4IPD A;  4AQY Q;  2KCT A;  3TRZ A;  2JEA I;  1Y1V G;  3M85 A;  2IX1 A;  3A74 A;  1HZB A;  4GKK L;  3M4O H;  4IOC A;  1G29 1;  4YY3 Q;  4QY7 A;  4BY1 G;  4DV7 Q;  2VNU D;  3PV0 A;  4PG3 A;  3F1Z A;  1G6P A;  3CC7 A;  4K0K Q;  5GAE C;  1KHI A;  2GN5 A;  1L1O C;  4OWX B;  1GL9 B;  3TRE A;  3HOZ H;  1WJJ A;  5ELO A;  1C0A A;  4BBS G;  4C3I H;  2EXD A;  2I5M X;  3CW2 C;  4NXN L;  4HJ9 A;  4A3D H;  3GD7 A;  4TVA B;  3U4V A;  1GVP A;  4DV6 Q;  1VQD A;  2CKZ B;  2W51 A;  1S3O A;  4LNQ A;  1W3S A;  4JV5 Q;  3ULP A;  1HR0 L;  2JA8 G;  3PUV A;  4YHH Q;  1HJP A;  4X66 L;  1HR0 W;  2LSS A;  3J80 c;  1CKN B;  2WAQ G;  1DGS A;  1PH6 A;  2AKW B;  4IFD G;  3CCR A;  2VUM G;  4AYB E;  5LMU Q;  4ALP A;  4NXM L;  2N8N A;  4P73 A;  3CME A;  3HKZ E;  2JA6 H;  3M9B A;  1PFS A;  1N33 Q;  3H3V H;  1Z47 A;  1VQA A;  4DR6 Q;  2OQ0 A;  1FL0 A;  4DR7 L;  4DR2 Q;  1VCI A;  4A76 A;  1QVF A;  1NMF A;  2YYZ A;  2A8V A;  2DGY A;  3L7Z C;  5C44 H;  3KF6 B;  2IY5 B;  3PUY A;  5LMN Q;  4FDB A;  2XGT A;  3K8A A;  5IP7 G;  1I94 L;  2V1C C;  3CAM A;  1P16 A;  5EAY A;  2R93 H;  1VQH A;  3M4Q A;  1E24 A;  1V1Q A;  2EQS A;  2JA9 A;  2YTV A;  1OXU A;  3PSI A;  5GRO A;  4DR1 Q;  4IPC A;  2NVQ H;  2RHQ B;  2UUB Q;  4DV5 Q;  2OWO A;  2C35 B;  4A3I H;  3AYH B;  1B8A A;  4LFC L;  4OWW B;  4C3H H;  3S14 H;  2KHJ A;  1IBK L;  3S15 H;  2UXB L;  3DM3 A;  3GTJ H;  3I4M G;  2JK8 A;  4QIW E;  1WOC A;  1GJJ A;  4QQB X;  3K0X A;  1CSP A;  1TXY A;  1TWC H;  1C9O A;  3CCE A;  4HIK A;  3T1H Q;  4JI0 L;  4JOI C;  3GTG H;  4B3R Q;  4NPS A;  4DV2 Q;  4NB3 A;  5IT9 c;  4BBR H;  2F4V Q;  3CCU A;  4QL5 A;  3UDX A;  1YJ9 A;  1MIU A;  5C3E G;  1Y1W G;  2R7Z H;  3D0F A;  5M3M G;  2R92 G;  4BA1 I;  2YV5 A;  4GS3 A;  4DR3 Q;  3RZO H;  4ME3 A;  4POG A;  5M5X H;  2Y0S G;  3F2B A;  4AIM A;  1PA6 A;  1N34 L;  2I5H A;  1X3G A;  2JA5 H;  2E5L Q;  1K83 H;  3CP0 A;  4JI5 L;  3HOV H;  1OTC A;  4DUY Q;  1LUZ A;  2Q2H A;  3Q8D A;  1I6H H;  2VUM H;  4JI7 Q;  4R4T A;  4EQ5 A;  4BA2 I;  4YWM A;  4LF5 L;  1HZ9 A;  2D0P A;  5C4X G;  1EFW A;  2ZTC A;  3CC4 A;  2Z0S A;  1Q12 A;  4IJL A;  2WAQ E;  4GKK Q;  2JA7 G;  1JMC A;  1PYB A;  2A19 A;  4L5T A;  3U50 C;  1X54 A;  2UXC L;  2PMZ E;  2Q2I A;  4PZ8 A;  4A3F G;  1U0L A;  1WCM H;  5GQO A;  2ODG C;  3PO3 G;  4NXN Q;  3U4Z A;  3K80 C;  2Z6K C;  3BZK A;  2B29 A;  5IYB G;  3ERS X;  3W5O A;  1BBW A;  4C2M H;  2WB1 G;  1HR0 Q;  1JB7 A;  4X64 L;  5C0X G;  3K81 C;  4X66 Q;  3A5Z B;  3AFP A;  2VZA A;  2IT1 A;  3J81 c;  3KLW A;  1TWA H;  2Z6K A;  4NXM Q;  1MKH A;  3EN2 A;  3A0J A;  3S1Q H;  2N3S A;  1JJC B;  5IP9 G;  2RHS B;  2PI2 E;  4O0A A;  3I4M H;  1YI2 A;  2IX0 A;  3T1H L;  4A3E H;  1Y02 A;  3E9I A;  3PF4 A;  2HHH L;  2E2H H;  4APV A;  1PHJ A;  4DR7 Q;  3S16 H;  3RNU A;  1YNX A;  5JJL A;  3NEM A;  4GLA C;  4X6A H;  5H1S E;  1AE3 A;  2ZJP A;  3H15 A;  5C3E H;  1SR3 A;  1PVO A;  3PUZ A;  1I94 Q;  2N49 A;  1P8L A;  4LFB L;  5M5W H;  3J7A 5;  4P75 A;  4DV4 L;  3TEH B;  2N78 A;  3UDG A;  2WP8 J;  3RZD H;  2YU9 H;  4LUV A;  3ICE A;  1IBM L;  2Y0S E;  4A3M G;  1GM5 A;  3M3Y H;  4JBM A;  4LFC Q;  3I4N H;  3CCL A;  1UE5 A;  1NY4 A;  2KEN A;  1IBK Q;  2UXB Q;  1EYG A;  2JA7 H;  4QJF A;  1PH2 A;  4BY7 H;  2BA1 A;  3PF5 A;  2KBN A;  1VQ6 A;  4JI0 Q;  1IYJ B;  3WWV A;  5M3F H;  1X3E A;  4OX9 L;  1K3R A;  1OXT A;  1SRU A;  3PIP A;  1VQO A;  4DR5 L;  1PH3 A;  2OTL A;  2ID0 A;  4UP8 A;  3PO3 H;  5IYD G;  2QGQ A;  3KFU A;  2K52 A;  5AJ3 L;  4JCV E;  3BU2 A;  3RLO A;  3ER0 A;  1OXX K;  5IYB H;  3PO2 G;  4DR4 L;  1NBW A;  5IWA L;  1ASY A;  4A3C H;  1N34 Q;  3W1B A;  1V9P A;  4Y7N H;  4JI5 Q;  4WJ3 M;  1YHQ A;  1X55 A;  3HOU H;  5K36 G;  1K0R A;  1Q8K A;  5FJ8 H;  4GN5 A;  2LXK A;  2WB1 E;  1TWG H;  2UXD Q;  5M5Y H;  1NMG A;  3FKI G;  4LF5 Q;  4XIG S;  2HIX A;  2MQH A;  5J3B A;  2ZTE A;  5IP9 H;  4HIM A;  3S17 H;  4L5R C;  2PQA A;  4PZ6 A;  3JAM c;  4LFA L;  1PH1 A;  2K5V A;  2I0Q A;  4A3G G;  2UXC Q;  5JJI A;  4X62 L;  4LW1 A;  2ASB A;  2ZJR A;  1SRO A;  2ALY B;  3RR5 A;  1A62 A;  5IYC H;  3CCV A;  1IBL L;  1KRT A;  1VQN A;  4R1J A;  1HH2 P;  4B3S L;  3UDF A;  2K5H A;  1XPR A;  3GTQ H;  4GNX A;  1VQF A;  2KCM A;  3D31 A;  2AHO B;  4A93 H;  2CFM A;  5FLM G;  1OXS C;  5GAG C;  1VQK A;  2YTY A;  4UP9 A;  4X64 Q;  3HKS A;  4P72 A;  4JI1 L;  1EIY B;  2K14 A;  2HJQ A;  1IZ6 A;  4JI3 L;  2L15 A;  2RF4 A;  1XPO A;  1E22 A;  1X9N A;  4Y52 H;  4GN3 B;  1K9M C;  4UPA A;  3NBH B;  1Y1V H;  3L2P A;  2HHH Q;  2NVX H;  1N8R C;  1XNR L;  1H9E A;  1VQG A;  4A3K G;  4IO9 A;  4BY1 H;  4KLK A;  3GO5 A;  3UDI A;  3EIV A;  3CXC A;  4PMW A;  3HOX G;  3CCJ A;  3S2D H;  4A3B G;  1WFQ A;  1YZ6 A;  1LTL A;  2CWP A;  4BBS H;  2K75 A;  3F2D A;  1V43 A;  3IRB A;  1VQB A;  4LFB Q;  4LF8 L;  3KF8 B;  4DV4 Q;  1X65 A;  4IPH A;  1KAW A;  1H9F A;  2JA8 H;  1IBM Q;  3CPF A;  1YIT A;  2IHF A;  2CQO A;  2ATW A;  3OW2 A;  4MZ9 A;  3RLN A;  1K73 C;  3E9H A;  2D0O A;  1VQL A;  4R4C A;  1G51 A;  1FJG L;  1IL2 A;  2AWO A;  3PIO A;  1VQC A;  4IFD J;  1XMO L;  1HNW L;  4JI6 L;  4YCW A;  1S40 A;  4DKA C;  5FLX c;  1BKB A;  1AH9 A;  2PI2 A;  2OQK A;  2BH8 A;  3W1G A;  3I4O A;  1I50 H;  4MTN A;  4OX9 Q;  1H95 A;  4DR5 Q;  1XNQ L;  1FGU A;  5IY0 A;  3J81 j;  3F8T A;  5AJ3 Q;  1NE3 A;  3F2C A;  2K50 A;  4P71 A;  1OXV A;  2HT1 A;  4DR4 Q;  5IWA Q;  2E8G A;  5IP7 H;  3STB C;  1NJI C;  1RL2 A;  1Q46 A;  2F52 A;  2PNH A;  1A8V A;  1N9W A;  2XTI A;  4P74 A;  4DV0 L;  1N33 L;  3SGI A;  3T1Y L;  3MEF A;  2UUA L;  4L5S A;  1TWF H;  3AQQ A;  4A3L G;  2R7D A;  1A0I A;  2K5N A;  4LFA Q;  3OYY A;  1BVS A;  4BXX H;  3J80 i;  1B70 B;  4HJA A;  1HNZ L;  1EIF A;  3LGJ A;  4X62 Q;  4DR6 L;  2JJQ A;  1GKU B;  2KFV A;  1IBL Q;  2VQE L;  3HOX H;  3EBE A;  4B3S Q;  1EQR A;  1W2B A;  1A63 A;  3UE1 A;  3HOZ G;  1X56 A;  1XPU A;  1VQ4 A;  1Y1W H;  1VQJ A;  4A3D G;  1XJV A;  5M3M H;  2ES2 A;  1L0W A;  3I55 A;  2R92 H;  3HOW G;  2NVT H;  3FHW A;  5DLQ E;  1M90 C;  2VL6 A;  3PCO B;  5HGQ A;  4KHZ A;  3ZJY C;  4JI1 Q;  3PGZ A;  4JI2 L;  2JQO A;  4JI3 Q;  1ASZ A;  4GN4 B;  4JC0 A;  1KRS A;  3MXN B;  2AWN A;  1PH4 A;  2PQA B;  4LF7 L;  1PH7 A;  4HJ8 A;  2K4K A;  2RCN A;  1UEB A;  3GTO H;  2EIF A;  4KHP L;  5C4X H;  3VDY A;  1AE2 A;  4O2D A;  1YJN A;  1XNR Q;  2JA6 G;  3KJO A;  1UE7 A;  4LF4 L;  3FP9 A;  4OON A;  3B6Y A;  4TQU S;  1KD1 C;  2ZM6 L;  1EN7 A;  2ZTD A;  1VQ7 A;  4GNX B;  2QNC A;  1EWI A;  4A3F H;  3UE0 A;  2NZH A;  3H0G G;  2I5L X;  1E7D A;  4A4I A;  3HFZ B;  2UUC L;  3M7N A;  4GOP C;  4LF8 Q;  2E2I H;  3GTP H;  2A1A A;  1C7Y A;  3I56 A;  4DV3 L;  2YTX A;  4LF9 L;  2BH2 A;  1O7I A;  2UU9 L;  3A5U A;  3BJU A;  2ODC I;  1E7Z A;  4B3M L;  2QEX A;  3H3V I;  4JBJ A;  4IPG A;  2HQL A;  5C0X J;  5BR8 L;  4L5Q A;  4GOP A;  1FJG Q;  4A3I G;  1PH8 A;  1XMO Q;  4IJH A;  1HNW Q;  1EOV A;  1Y14 B;  1E1O A;  4JI6 Q;  1VQ8 A;  1SMX A;  4JBW A;  1QUQ A;  1Q86 C;  4GNX C;  1QVG A;  1VQI A;  4JYA L;  4GKJ L;  1YNS A;  3OTO L;  4B3T L;  3TS2 A;  3PUW A;  3NEL A;  1XNQ Q;  3S24 A;  3K7A H;  4J15 A;  4OO1 I;  1JE5 A;  4R4O A;  1UE6 A;  1LYL A;  1HNX L;  1JT8 A;  2JEB I;  4BBR G;  1XMQ L;  3HOW H;  1EUJ A;  4HJ5 A;  3I7F A;  1N32 L;  3KJP A;  2E2J H;  2R7Z G;  4YWL A;  4UY8 C;  3ULJ A;  1UE1 A;  2KHI A;  4DV1 L;  4BXX G;  1K8A C;  2DUD A;  3PUX A;  4UP7 A;  4DV0 Q;  1S72 A;  2JA5 G;  1L1O A;  4MNO A;  3CMA A;  3T1Y Q;  4PZ7 A;  3KYH C;  4R4Q A;  2UUA Q;  3HOV G;  5JEA J;  1VQ5 A;  4A3M H;  2QNF A;  1CUK A;  1JEI A;  2B63 G;  4DK3 C;  3JC6 6;  4H02 A;  3J81 i;  4C3J H;  3I2Z A;  1HNZ Q;  1EQQ A;  4X65 L;  1YEZ A;  3TQY A;  4A3J G;  1JJG A;  3G48 A;  3M4P A;  1E3P A;  3AFQ A;  1UWV A;  1I5F A;  3CQZ H;  3KDF A;  1QVC A;  2VQE Q;  3S1R H;  1MJE A;  1YJW A;  1ZS9 A;  1PH9 A;  1Q82 C;  3H0G H;  2IHE A;  3L0O A;  1J5E L;  4DUZ L;  4JI8 L;  4A75 A;  5IYD H;  1WCM G;  1YHB A;  4GLV B;  2MFI A;  2B3G A;  1D7Q A;  3ULL A;  4IFD I;  3PO2 H;  4HID A;  4DAY B;  4JI2 Q;  2MPH A;  1KC8 C;  4JI4 L;  3HOY G;  4GLX A;  4LF6 L;  4POF A;  3J7Z C;  3GDE A;  2ZJQ A;  1QZG A;  4LF7 Q;  4DNI A;  3CPW A;  2VQF L;  1VQM A;  4HIO A;  2BA0 A;  3DLL A;  1SE8 A;  2CWA A;  1GD7 A;  3FKI H;  4KHP Q;  2OTJ A;  3GTK H;  4AH6 A;  1N36 L;  4IOA A;  5C4J H;  2HIV A;  4LF4 Q;  2NVY H;  1Q1B A;  1CKN A;  4AQY L;  2GVB A;  2ZM6 Q;  1U5K A;  4A3E G;  4A3G H;  4DPG A;  1CSQ A;  4YY3 L;  1Q81 C;  5HY6 A;  4KI0 A;  4LUZ A;  4DV7 L;  1PH5 A;  4K0K L;  1VS0 A;  1QZH A;  3NEN A;  2UUC Q;  2LD7 A;  4RMF A;  3KOJ A;  4JBK A;  2NZO A;  5FLM H;  4DV3 Q;  1VQE A;  3KF6 A;  1I3Q H;  4LF9 Q;  4JOI A;  3CD6 A;  2UU9 Q;  4DV6 L;  2JE6 I;  4B3M Q;  1KIX A;  3U58 A;  4OXP A;  1Q1E A;  1WYD A;  2FXQ A;  3S1M H;  2B63 H;  4JV5 L;  5BR8 Q;  2H5X A;  2AMC B;  4YHH L;  2UXD L;  4WJ4 A;  4QGU A;  1XTD A;  3GTM H;  4RG1 A;  5IE8 A;  1R9T H;  1PV4 A;  3I4N G;  3S1N H;  4A3J H;  1T9H A;  3G4S A;  3GTL H;  5LMU L;  2OCE A;  4JG2 A;  4YWK A;  1E7L A;  4BY7 G;  4JYA Q;  3CC2 A;  3JAM i;  3OTO Q;  4A3K H;  1K8G A;  4B3T Q;  4GKJ Q;  1SFO H;  2CCZ A;  4DAM A;  1KXL A;  1HNX Q;  5M3F G;  3STB D;  4YCV A;  5JJK A;  2MNA A;  1YIJ A;  1GO3 E;  1Z9F A;  1XMQ Q;  4DR2 L;  5E7N A;  4A3B H;  1KL9 A;  2MO1 A;  1N32 Q;  2Q2U A;  3RN2 A;  4LUO A;  4R4I A;  4YCU A;  3G6E A;  1YVC A;  1YHA A;  4DV1 Q;  2NN6 G;  2WFW A;  5LMN L;  1J6Q A;  3HOY H;  5C0X I;  3RN5 A;  4A3C G;  1FVI A;  1VQ9 A;  1B7Y B;  1TWH H;  1D8L A;  2D62 A;  1CKM A;  1CKO A;  3RLF A;  5LMN W;  4GOP B;  3TS0 A;  1Q7Y C;  1JJ2 A;  3HOU G;  1NTG A;  1X3F A;  1E1T A;  4AYB G;  5FJ8 G;  3CCQ A;  3K7U C;  2DK4 A;  2LC3 A;  1SN8 A;  3HKZ G;  4DR1 L;  4OWT B;  1QUQ B;  2UUB L;  3E0E A;  4X65 Q;  5GAH C;  4DV5 L;  2QA4 A;  2MO0 A;  1HZA A;  1WI5 A;  4DK6 C;  2VY3 A;  2GVA A;  2LXJ A;  2R6G A;  2NN6 I;  4LWC A;  1GKH A;  1L2F A;  1LM0 A;  3CCS A;  5IYC G;  1J5E Q;  4DUZ Q;  4JI8 Q;  4B3R L;  4EX5 A;  5ELN A;  1YBY A;  1RIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...