2A8VA

Rho transcription termination factor/rna complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
118
structure length
118
Chain Sequence
MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for terminator recognition by the Rho transcription termination factor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein/rna
molecule keywords 5'-R(P*CP*CP*C)-3'
total genus 33
structure length 118
sequence length 118
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07498 Rho_N Rho termination factor, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.10 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 2a8vA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2a8vA02
2ZTDA 1XMOL 1G291 1L2FA 2KHIA 2VW9A 1MKHA 2UXDQ 4AQYQ 4YCWA 1PV4A 4BY1H 1PFSA 2RHSB 2ZTEA 3PSIA 2RHQB 3AYHB 4BBRG 5AJ3L 1IBML 2JA7H 3E9IA 3J80i 4A3LG 1YVCA 5IP7G 4P73A 4AQYL 1X3EA 3TQYA 2ES2A 2R6GA 2UUCL 4B3SQ 1OXUA 3L7ZC 4A75A 1SFOH 1VQNA 2OTJA 4IFDI 5JJLA 4X64Q 3PO2H 4GKJL 3JAMi 3F2BA 1Y1VH 2PMZE 4IJLA 3H0GH 3J81j 5JEAG 1Q82C 2VZAA 4B3SL 2ASBA 3W5OA 2ID0A 1E3PA 4IPHA 1XNRQ 2UXBQ 4DV0Q 2PQAB 1I5FA 4LF9Q 4UY8C 3J81c 4DV6L 3JC66 1Q81C 3D0FA 3HOZG 4HJ9A 4ALPA 1PH4A 4JI0Q 3S17H 2XTIA 4GNXB 1PH3A 3GTGH 1XPOA 3CC4A 3CC2A 4DV4Q 1PH7A 4DV6Q 5C0XJ 2EIFA 4YWKA 4DR5Q 4P75A 2ZM6Q 4B3MQ 3MEFA 3NEMA 3GTKH 3PV0A 2VQFL 4A3KH 3UDFA 1VQGA 4GN3B 1GVPA 4NXNL 1K3RA 3CMAA 3E0EA 4JI1L 4QY7A 3TRZA 1K9MC 1VQ8A 2IY5B 3PGZA 5IE8A 1QZGA 1M90C 4A3BH 2VQFQ 2UXCL 2NN6I 2OCEA 5C0XG 1I50H 3AFPA 4POGA 3D31A 1VQHA 4A4IA 4KLKA 2B29A 3BZKA 2HJQA 4B3RQ 1PH2A 3HKZG 5FJ8G 1C7YA 3FHWA 4A93G 3M4PA 3ULJA 2AMCB 5M5WH 4DR4L 1X65A 3MXNB 1HZAA 4RG1A 1D7QA 1KXLA 3CQZH 2ALYB 1SR3A 2AWOA 2CFMA 4KI0A 3RNUA 4BXXH 5IP9H 2MO1A 1WYDA 3KDFB 2NN6G 5IYDG 4UPAA 5C0XI 4A3EG 5LMUQ 1CKNB 2NVTH 3PF4A 4IOAA 4K0KL 3UE1A 4B3TQ 5JJIA 1E1OA 1VQ6A 1Q46A 3UE0A 2N3SA 4LF9L 4DK6C 4JBMA 2K4KA 1V9PA 2D62A 4DV3Q 4A3EH 4B3RL 3ULPA 4IO9A 3T1HL 5C44H 1VQMA 4PMWA 1PH8A 5IT9c 2CCZA 1A62A 4NPSA 4C2MH 1K8AC 3M7NA 3KYHC 3ER0A 4JI4Q 2EQSA 3CD6A 1XMOQ 5GROA 4YHHQ 4DUZQ 3HOUH 4OWWB 1Y1VG 3RLOA 4EQ5A 1CSPA 1PH9A 4DR4Q 5M3MG 1N8RC 2Z6KA 4JI7Q 3EIVA 4EX5A 3PO3G 4JYAL 4LUZA 1S40A 4YWMA 4DK3C 4JOIC 2KENA 4DR3Q 1SE8A 1JMCA 1X55A 4AYBG 2Q2IA 1G51A 4X62Q 4YCUA 1HR0Q 3I4MH 1K8GA 4DV4L 1UE5A 1PYBA 5IYCH 1RL2A 1OXVA 3CC7A 1IXRA 1W3SA 4QJFA 3PO3H 4JI1Q 3F8TA 3I56A 1X9NA 1XPUA 2JA5G 4YY3L 4BY7H 1YNXA 5GQOA 2MQHA 4DV0L 4K0KQ 4GKKL 1EFWA 2V1CC 2WB1G 4UP7A 4KHPQ 5EAYA 1PH6A 4DR5L 4WJ3M 1WCMH 2UUBL 3I2ZA 2R92H 1N32Q 3UDGA 2YYZA 2OQ0A 4A3FH 1EIYB 2JA6G 1ASYA 1W2BA 4BBRH 3PF5A 2YV5A 4JI0L 4A3IG 2KCMA 4DPGA 3CF5A 1TWAH 4R4TA 1HR0L 4QGUA 3K81C 4X65Q 4A3CG 3S1NH 2CQOA 1Z9FA 1Y1WG 1IBMQ 4DR1L 4OWTB 4JCVE 3OTOL 4DR2Q 2E8GA 1CKOA 1HZCA 4JI8L 3W1GA 2ZTCA 3A0JA 5LMUL 2WB1E 4GOPA 5JEAJ 3CCQA 1GKHA 3HOXH 3RN5A 3AEVA 2IT1A 1B8AA 2KBNA 1V1QA 3T1HQ 1P8LA 4GOPB 1PVOA 1XMQQ 4KHPL 1GM5A 1VQDA 4HIKA 3IRBA 2K75A 3NBHB 1UE1A 4Y7NH 1FGUA 1U0LA 2IHFA 3CAMA 5FLMH 4DV7L 2PI2A 1E7LA 4DV2Q 3I4NH 3HOZH 3KOJA 4A3GG 1X3GA 2JJQA 2NZHA 2D0PA 2I5HA 2JA8H 2PQAA 1TWCH 2NVXH 1VQBA 1G6PA 1VS0A 4O0AA 3AQQA 2VUMH 1XTDA 4P71A 4X64L 1EOVA 3G48A 3HOXG 1K73C 1HNZL 2C35B 2HHHQ 2N8NA 4ME3A 4C3JH 3H3VI 4A3GH 1S72A 2UUCQ 3TS2A 3L2PA 3T1YQ 3K80C 2H5XA 3M85A 5K36G 4X66Q 4AIMA 1TXYA 5C3EH 5IP7H 1JB7A 5FJ8H 3M3YH 4OO1G 2D0OA 1A8VA 1N36L 3I4NG 4PG3A 1YEZA 4JI3Q 2MO0A 4GN5A 4LF7Q 4OO1I 4JI5Q 3EN2A 3VDYA 2HT1A 1GO3E 5IP9G 4JV5L 2VY3A 4BY7G 3F1ZA 4POFA 4OXPA 3GTOH 3HFZB 2A1AA 1HNWL 1WFQA 3E9HA 4L5TA 4C3IH 4WJ4A 5M5YH 1XNRL 2ZM6L 5ELOA 1VQ9A 4A3IH 4LF5L 3A5UA 3NENA 4HJ7A 1Q7YC 5GAHC 3CCMA 1VCIA 4APVA 1VQLA 2E2HH 4DUYL 1SLJA 3H0GG 2NVYH 3HKSA 4HIMA 4DR6Q 3Q8DA 2JA9A 5HY6A 2L15A 2VUMG 4LFAQ 1FJGQ 3FKIH 4R4OA 3CCSA 1PH1A 4H02A 3PUVA 5IWAQ 2UXBL 1Q8KA 2B3GA 4OWXB 4A76A 1YJWA 1XNQL 1NMFA 3KJOA 1VQPA 4X6AH 2UU9L 1P16A 3A74A 3CP0A 1J6QA 1CKNA 2VL6A 4DV5L 1IBLL 1WI5A 2K50A 4JBWA 2JQOA 2A8VA 1Q1EA 1T9HA 4IPGA 5IYBG 3BJUA 4C3HH 5IYCG 2MNAA 4UP9A 4DAYB 4LUVA 3F2CA 3A5ZB 2JA7G 2Y0SE 3GTJH 4LF6Q 2F4VL 3G71A 4FDBA 3JAMc 1KIXA 4BXXG 1VQJA 2DUDA 3K7UC 1H95A 1KD1C 1SROA 1SMXA 1IBKL 4DR7Q 1WCMG 2XGTA 1HNXL 3S1RH 5E7NA 2E2IH 3FKIG 4A93H 2BA1A 1NBWA 1YIJA 3AFQA 2R93H 3CCLA 2PNHA 5HGQA 2LXKA 2HIXA 1YJNA 3RZDH 3HOWG 2VQEL 4IOCA 1YITA 2AHOB 1I3QH 4LFCQ 1LTLA 4LFAL 4QQBX 2UUAL 2I0QA 1B70B 2AKWB 5GAGC 2I5LX 3KFUA 2F4VQ 1I94Q 3S16H 2WFWA 4LFBQ 2Y0SG 1Z47A 3H3VH 4LF5Q 2N49A 5M3MH 1KC8C 2UUAQ 4A3DH 4DV1Q 3PIOA 3HOVG 3CCVA 4LFCL 3ULLA 3B6YA 5C44G 2IX0A 1KL9A 4LF8Q 2KCTA 1OXSC 1U5KA 1WJJA 2I5MX 4YHHL 1LUZA 4A3BG 3I4OA 4JI4L 3HOWH 1HZ9A 4PZ8A 1VQKA 3J7A5 4UP8A 1HNXQ 1EN7A 4LF4Q 2N78A 4RMFA 3L0OA 1GD7A 3DM3A 4MNOA 4X66L 2BH2A 2AWNA 1JE5A 2OWOA 4OX9L 3TS0A 3DLLA 4HIOA 3HOYG 4HJ8A 1BBUA 2YTXA 5LMNQ 4GLXA 3GD7A 1VQEA 2Q2UA 1JJ2A 3KLWA 4GOPC 1J5EQ 1TWGH 4IPCA 4HJAA 2Q2TA 2RCNA 1UEBA 5M5XH 3M9BA 3J80c 2E5LL 2YTVA 1JJCB 4AH6A 2OQKA 3KF6B 1QUQA 1IBLQ 4YWLA 1FL0A 4TQUS 4HJ5A 3ERSX 4LF4L 3PUXA 2Q2HA 1D8LA 1J5EL 2R7ZG 4A3FG 3BU2A 1BVSA 1QVFA 1NTGA 4GS3A 2JA6H 1AH9A 1YZ6A 1KAWA 1VQAA 3KDFA 2DGYA 3CMEA 2IX1A 4AYBE 1IZ6A 3GTPH 4GLVB 2WP8J 2F52A 3HOYH 1K83H 4NXMQ 1LM0A 2JK8A 3PUWA 4BA2I 1YBYA 4DR2L 3OYYA 5ELNA 2K5HA 2UU9Q 3STBC 2GN5A 4JC0A 5BR8L 2Z0SA 1YI2A 1XJVA 4JI2L 2B63H 1VQFA 2QA4A 3S15H 2QNCA 3NELA 3CCJA 1ASZA 4IFDJ 4YY3Q 1HH2P 3KF8B 4DNIA 3WWVA 1YHBA 2EXDA 2MFIA 4A3KG 1CUKA 1N33Q 1M1KC 1KRSA 4JI5L 2BA0A 1BKBA 1PHJA 2VS1A 4JI6L 2B63G 1KRTA 3U58A 4GLAC 1N36Q 4IPDA 4DR3L 4DKAC 5BR8Q 4NB3A 4JYAQ 2HQLA 3K7AH 4LUOA 2JEAI 3SGIA 5C3EG 2ATWA 3I4MG 4DR7L 1NMGA 1S3OA 1O7IA 3LGJA 4XTCS 4P72A 5C4XH 5J3BA 2K52A 2ZJQA 1BBWA 1IYJB 4A3MG 4R4CA 3OTOQ 2BH8A 2JA5H 1DGSA 4DR1Q 3HKZE 1HJPA 1LYLA 5IYBH 1C9OA 5IWAL 3FP9A 5AJ3Q 1MIUA 3CCRA 3HOUG 5IYDH 4DV3L 1AE3A 4O2DA 3T1YL 1VQ5A 1FJGL 1FVIA 3K0XA 3PCOB 1VQ7A 4DR6L 4B3TL 1XMQL 2K14A 2RF4A 1NJIC 1N34L 5LMNW 1VQOA 4GN4B 1Q1BA 1X6OA 1N9WA 1Y14B 1PYSB 4JG2A 2WAQE 5H1SE 3RN2A 3RR5A 4OX9Q 3PUZA 4A3MH 4LNQA 1A0IA 3UDXA 3G4SA 5C4XG 3G6EA 1VQIA 5DLQE 5FLMG 4A3DG 1E24A 4LWCA 3RLNA 3M4OH 2JEBI 3S2HH 4IJHA 4R1JA 1A63A 4P74A 2WAQG 1EQRA 2CWAA 4IFDG 2QNFA 5FLXc 2UXCQ 1E22A 1E7DA 1SRUA 2YTYA 3S2DH 3BZCA 3PUYA 2Z6KC 4NXNQ 1YJ9A 1HNZQ 1KHIA 1Y1WH 2GVAA 3H15A 4JBKA 1EYGA 2A19A 3I7FA 2KHJA 3PO2G 1I6HH 1VQCA 4BBSH 3TREA 1I94L 3GTMH 2ZJRA 2R7ZH 2NVQH 4PZ6A 4MTNA 1UWVA 3KJPA 3S1QH 3RLFA 1X56A 3J81i 3GO5A 1MJCA 3K8AA 4GNXC 2R92G 1L1OA 1CKMA 1UE6A 4YCVA 4JI3L 2VQEQ 4LF6L 1N32L 4DAMA 1EIFA 4MZ9A 1L1OB 3J7ZC 1AE2A 3CPFA 3TEHB 1CSQA 4LF8L 4LW1A 1JJGA 4L5QA 2E5LQ 2FXQA 4JI8Q 4HIDA 1V43A 3PIPA 3U4VA 2GVBA 4DV5Q 3CXCA 1NY4A 3GDEA 2CWPA 1EUJA 1KQSA 2HIVA 5IY0A 1WOCA 3CW2C 1IL2A 4BA1I 4BY1G 5JJKA 1NE3A 5LMNL 3S14H 1JT8A 4R4IA 1E7ZA 1Q86C 4DV7Q 1SN8A 3S24A 3KF6A 1OXXK 3GTQH 2UXDL 2CKZB 1OTCA 4QL5A 1PH5A 2HHHL 1QUQB 4DUZL 4DUYQ 1X54A 1YHAA 2JE6I 4A3LH 2R7FA 1N34Q 1XNQQ 5M3FH 1R9TH 3U4ZA 4DV2L 4KHZA 3W1BA 4GNXA 3UDIA 1HNWQ 1B7YB 2IHEA 1E1TA 4JV5Q 1EQQA 1QVGA 4XIGS 1Q12A 2NZOA 3GTLH 1MJEA 2QEXA 3U50C 4L5RC 4JOIA 4A3JH 1X3FA 3OW2A 4LFBL 2UUBQ 4Y52H 4L5SA 1QVCA 3RZOH 3ICEA 2F3IA 2E2JH 1QZHA 4GKKQ 4A3CH 2R93G 3CCUA 4J15A 1EWIA 1L0WA 5M3FG 4R4QA 4BBSG 4A3JG 4GKJQ 2PI2E 4DV1L 2LSSA 3EBEA 2K5NA 1TWFH 2ZJPA 4LF7L 4OONA 2QGQA 4X62L 4QIWE 1L1OC 4JI6Q 4JBJA 4X65L 3STBD 5C4JH 1TWHH 1HZBA 3CCEA 1YHQA 1IBKQ 4PZ7A 2YU9H 1RIPA 1N33L 2VNUD 1OXTA 3M4QA 1C0AA 1K0RA 2LXJA 3ZJYC 3F2DA 1XPRA 1PA6A 4JI2Q 2JA8G 5GAEC 4TVAB 2OTLA 4B3ML 3HOVH 3S1MH 3I55A 4JI7L 2R7DA 5GADC 4NXML 1VQ4A 2K5VA 1UE7A 1HR0W 3CPWA
chains in the Genus database with same CATH superfamily
1STEA 1PMRA 2K03A 4IUVA 4YCWA 1PV4A 4LMQD 2RHSB 3DMUA 3AYHB 2JA7H 4G4KA 2EXZA 2HUGA 1YVCA 4P73A 4E6IA 4RGOS 2F0GA 5KEEA 1WTRA 4GKJL 2R7ZH 1HTLD 4Y7NB 2VZAA 4B3SL 2ASBA 2D5DA 2WAQB 1XNRQ 2UXBQ 3T53B 3C1EA 3JC66 4KY7A 4HJ9A 1L0YB 4GNXB 1SYFA 4CJ2C 1XPOA 3CC2A 4DV4Q 4DV6Q 4KHVA 4YWKA 4DR5Q 1AFPA 3NEMA 3PV0A 2VQFL 1ICFB 4NXNL 1V1PA 4JI1L 1K9MC 1QCBD 2K04A 3LNNA 4X3SA 3OSOA 5C0XG 1I50H 4NKLA 3D31A 1BNZA 4A4IA 2F4IA 2PYKA 3BZKA 4B3RQ 3R93A 5FJ8G 4A93G 4A3MB 3SVMA 1X65A 1T5XD 3MXNB 4DA2A 1K8MA 2ODGC 2AWOA 1CQVA 2CFMA 4KI0A 4PMBA 5JVG3 4UPAA 3HZXA 3PF4A 2M9VA 5BN5A 5LMUQ 3I4MB 4HSVA 2Z1CA 3UE1A 2F0WA 3K5OA 1E1OA 4ZKCB 3HKZB 3PO3B 5DAUA 1EQVA 4JBMA 4DV3Q 1V9PA 2D62A 3KBGA 3VA5A 3T1HL 1PH8A 4NPSA 4XYQA 4N9TA 3FMCA 4WRDA 2PZUA 4IUTA 1Y1VG 5FLXE 1CSPA 1ZKOA 5M3MG 3Q24A 3PO3G 3EIVA 1EU3A 1GUGA 4JOIC 4DR3Q 1X55A 2Q2IA 1BUVT 1QB5D 4DV4L 4XDXA 4H0LC 5E4XA 1GXDC 1LACA 1IKMA 1OXVA 1W3SA 1FYCA 2EYOA 1QNKA 4DF7A 3I56A 1YNXA 4N8FA 1GOZA 3S16B 2V1CC 4UP7A 3H09A 5EAYA 4WJ3M 1TIID 2A6HD 5EBCA 1V66A 4KK7A 3R8BA 2R92H 2OQ0A 2O2LD 2B2TA 3VR6A 3PF5A 4JI0L 4A3IG 2KCMA 5D3IB 4R4TA 3FDTA 1ENAA 4X65Q 2A69C 3C46A 4DU9A 1Z9FA 1Y1WG 1TY0A 2XSCA 4S3SA 4OWTB 2YU9B 4DR2Q 1SYGA 4RA8A 3G7LA 5LMUL 4Z9CB 1DONA 5JEAJ 3RN5A 3HOXH 1CTMA 5G3LF 2KBNA 2ZXOA 1P8LA 3K0YA 4KHPL 1CI3M 1VQDA 3NBHB 1FGUA 4XXEA 3I4NH 5FLMH 4AYBB 2PI2A 5ISRA 3HOZH 4A3GG 3KOJA 1SE4A 2HDMA 1QE6A 4CKCA 3AQQA 1XTDA 4H7BA 4X64L 1EOVA 3G48A 3N6RA 2C35B 2HHHQ 3OWFA 4ME3A 4C3JH 4A3GH 2H5XA 5K36G 2DY8A 4KD3A 1EY0A 1N36L 3I4NG 3SK5A 1IHZA 4PG3A 2MO0A 4OHJA 2B2YA 4ZRZA 4EQOA 5IP9G 4V190 2A1AA 3E9HA 4L5TA 4L6TB 4C3IH 2JA7B 1H9SA 3MWYW 2ZM6L 1HFNA 2NBFA 4HJ7A 3URYA 4A93B 2IW3A 3P20A 2EZVA 1I3QB 1RJTA 3HKSA 4HIMA 3Q8DA 3R2IA 4DFAA 3FKIH 3CCSA 3QWNA 2XRSD 3OMGA 5L37A 4A76A 3KF8A 1RODA 1CKNA 3NHHA 1T5EA 5NUCA 1SNMA 3HOZB 5IYBG 1B9NA 4C3HH 2ODCI 2MNAA 4UP9A 2K33A 4B9XA 4XT3B 4KV6A 2SNMA 4FDBA 3JAMc 1VQJA 1SJED 2O5JC 1KD1C 1SMXA 2K5WA 1IBKL 1HNXL 5E7NA 1X3PA 1H9JA 1EU4A 1NBWA 2PNHA 5HGQA 2HIXA 2PW7A 4IOCA 2Z8LA 3U9OA 1LTLA 3I8ZA 1SNOA 2D2CC 2H4OA 2I5LX 1JWUD 1F2ZA 3H3VH 2VUMB 2N49A 2HD3A 3CRKC 2VB2X 5G3LD 3CCVA 3DWQA 4LF8Q 1HQRD 4O42A 5JVH3 4JI4L 1HZ9A 2K05A 3GTMB 2B2VA 2B63B 4CHTB 1EY5A 2KVEA 2IL8A 4MNOA 4FO2A 4OELB 2A6EC 2B8FA 1JE5A 4OX9L 1QG7A 3HOYG 2YTXA 2NN6H 1JJ2A 1ONLA 2F0TA 1ZYRC 2Q2TA 3H94A 1UAPA 1UEBA 5M5XH 3J80c 1JOQA 1JJCB 4AH6A 3KF6B 2RQXA 3P7JA 1QUQA 1IBLQ 4YWLA 3LLRA 2MJ8A 3EJIA 1D1IA 4LF4L 3PUXA 2Q2HA 1J5EL 4KTAA 2F0FA 2F0IA 5KYLA 5EKKA 1IZ6A 1SNQA 3C2PA 2WP8J 1HXYD 2NTSA 4NXMQ 3KBXA 1LM0A 4BA2I 4BS9A 1F9SA 3OYYA 5ELNA 2UU9Q 1EEFD 3A8KE 3BG3A 4MHEA 4F88A 2XWBB 4B9WA 2MGSA 4YY3Q 1HH2P 4PNYA 4DXGA 1RTNA 1M4VA 3MXPA 4DGZA 2F0NA 2VS1A 3AU7A 4J8QA 3FPUB 5EPJA 4JI6L 5I2YA 4GLAC 1XWEA 4IPDA 1I4XA 3A7AB 4DR3L 4DKAC 1U4MA 4KMUC 5E3FA 1BOSA 5BR8Q 4ZKBB 2XNAC 2HQLA 3K7AH 1IYVA 5CIUA 2RDFA 5EBDA 3SGIA 5HGTA 1SAPA 5J3BA 3HEJA 1BBWA 3OTOQ 2AUJD 4L8JA 4QMGA 4C3HB 1BR9A 2ZXPA 1WCMB 3CCRA 1LYLA 5IYBH 3FP9A 5AJ3Q 1SSOA 4MTKA 1KDAA 1FJGL 1FVIA 2HDLA 1TY2A 5CV9A 1VQ7A 4B3TL 2K14A 1NJIC 1TT2A 4ZUIA 4JG2A 2CW0C 3RR5A 3MZ5A 3UDXA 4PV1C 3RMHA 1E24A 4LWCA 2CH4A 2JA5B 4IJHA 1EY7A 1EQRA 2YTYA 3S2DH 2Z6KC 4HN7A 2F0SA 1YJ9A 4IQZA 1KHIA 4JBKA 5JPNC 1GUNA 2EY6A 3GTMH 2NVQH 1HA6A 4MTNA 1UWVA 3TBIB 3RLFA 1X56A 4RGMA 3GO5A 2EYJA 1UE6A 2VXWA 4JI3L 4IN3A 3ERQA 3TEHB 2KHSA 1CHQD 4L5QA 1STHA 3PIPA 2GVBA 3CXCA 1NY4A 3GDEA 2K7VA 2G9DA 2CWPA 3BDCA 1EY9A 3FRPB 2HIVA 1IL2A 1F9PA 4BY1G 1S5BD 3S14H 1JJRA 3M4OB 4R4IA 4ZQ3A 2EY2A 1SN8A 4ZK9B 2BCOA 3GTQH 5K36H 1RD9D 4R8IA 3J80E 4DUZL 3MFYA 4DUYQ 2R7FA 5IGCA 3IFDA 2R93B 5M3FH 2J7ZA 1TWHB 1SBBB 4KHZA 3W1BA 1DD2A 1B7YB 2IHEA 4IURA 1H9RA 5C3WA 2NZOA 1MJEA 4G7HC 1X3FA 2ZXRA 4Y52H 3E3XA 4L5SA 3TP8A 1JORA 3S2HB 1VMPA 5FKAC 2Q8IB 5M3FG 1LLRD 1CQFA 4R4QA 4A3JG 1ENFA 2LSSA 2K5NA 1TWFH 2ZJPA 4LF7L 2QGQA 2QDBA 4X62L 3RZOB 1F2LA 4JBJA 3CCEA 1YHQA 1HZBA 5M9OA 1BXTA 1LTAD 1OXTA 2Z4IA 3FEWX 2LXJA 4CDEC 3F2DA 5GAEC 4TVAB 3BDOA 3U9SA 3HOVH 3H6MA 5J22A 1VQ4A 5A2QL 4C1NK 1JOKA 1XMOL 3L9AX 2B2UA 2UXDQ 1EIHA 1U4LA 4AQYQ 3PSIA 2RHQB 1IBML 5M5YB 2EPBA 1YNND 2R3ZA 1X3EA 1O7YA 3TQYA 1O80A 3HOYB 3L7ZC 4A75A 1SFOH 2OTJA 3F2BA 3J81j 4IJLA 5JEAG 2PQAB 2PZWA 2KUMA 1ZS9A 1PH4A 4JI0Q 2R7ZB 3CC4A 1K83B 3QOLA 3TDQA 2BDNA 2EIFA 4P75A 3T16A 1QNUA 1F77A 2I46A 3H91A 4FXDA 1VQGA 3CMAA 4TKOB 1K3RA 2IY5B 3TRZA 4QY7A 1MD2D 5FO8B 2HCIA 1QZGA 5JPMC 2NN6I 3HOWB 3AFPA 3NWSA 2B29A 2HJQA 1ILQA 1B44D 1ZXTA 3M4PA 4NDXA 3ULJA 2AMCB 1I50B 3RNUA 1FD7D 5LL6X 5BN3A 5IYDG 2NVTH 4HMIA 1BCPF 4IOAA 4PMCA 3K5LA 4O1NA 5JJIA 1VQ6A 2OEOA 4LF9L 4DK6C 2K4KA 2Z9HA 1XXGA 1V1PB 4B3RL 4IO9A 1K8AC 4C2MH 1VF7A 2EQSA 1KNEA 3D6CA 1XMOQ 3NP8A 3NXWA 4YHHQ 4L63B 1KTKA 4EQ5A 4DR4Q 1NSNS 3V96A 2Z6KA 2Q8RE 3VA7A 4RCOA 2JYOA 4LUZA 3BVGA 1U4PA 4AYBG 5EJWA 3IL8A 3AB9A 5EKIA 1PYBA 3OW7A 2C9OA 4JI1Q 1TS3A 2JA5G 1XPUA 4BY7H 5GQOA 3NK9A 1GUOA 1S5DD 1EFWA 2WB1G 3D3RA 1WCMH 3J7AF 2UUBL 1N32Q 1EIYB 1W2BA 1X32A 4ME5A 3CF5A 4DPGA 1DXMA 2B2WC 4A3CG 1MGSA 2RCFA 1WTXA 1E2WA 2CQOA 1ET6A 4A3KB 1TWGB 1CKOA 1HZCA 2ICEC 1EZ8A 2WB1E 3AEVA 2IT1A 1A2TA 4IUPA 3VR4A 2M00A 3T1HQ 1GM5A 2EOTA 2K75A 1UE1A 2KVDA 4Y7NH 3CAMA 4DV7L 1TVXA 1E7LA 4BY1B 3SXHA 5EPLA 3TP7A 2JJQA 4A3IB 2D0PA 2I5HA 1G6PA 2PQAA 3DWPA 2NVXH 3OHXC 2JXMB 2DNCA 4HR7B 1PFNA 4PQXA 1FNVA 1V8QA 1R4QB 5EPKA 1KXLA 3L2PA 1R4PB 1EEID 2EYHA 5FJ8H 2F0EA 1H9FA 5ELCA 4LF7Q 4GN5A 1EQTA 1EYAA 3EN2A 2L5TA 2RDGA 3HFZB 1HNWL 1WFQA 5M5YH 2KEEA 5ELOA 4LF5L 4H44C 3A5UA 2E2HH 1BDOA 3ZYYX 4DUYL 2F0OA 3H0GG 1HTPA 4DR6Q 1CZWA 3NQIA 5HY6A 2PZTA 4HTHA 2L12A 1CM9A 2G5DA 2UXBL 1XTCD 2B3GA 1EY8A 1XNQL 3KJOA 1B2TA 4X6AH 3OPOA 2UU9L 1J6QA 4KD4A 1EFID 1IBLL 2JQOA 3FKIB 3ND9A 1Q1EA 3R2TA 3BJUA 1IW7D 1GL9B 2F0LA 4DAYB 3VYRA 3F2CA 2B39A 2EYLA 2Y0SE 2JA7G 4LF6Q 3G71A 1KIXA 4BXXG 3S1NB 4CDFC 3I90A 2PW5A 3FKIG 3ND8A 1YIJA 3HOWG 4ZUJA 3SE0A 4KKTA 2VQEL 1YITA 4OO1H 4LFCQ 1K0SA 3IKJA 2L1BA 5E1FA 2SDFA 1B70B 3S16H 2F3VA 2Y0SG 2P5ZX 1LTID 2UUAQ 4C1NI 2L9HA 1CZGA 5F2DA 1EOTA 1GHJA 1KL9A 1PFBA 1U5KA 3QOJA 1LUZA 1LABA 4A3BG 2F0UA 2K28A 3K5MA 3EA6A 2FMCA 1HNXQ 1SMYD 3DM3A 4X66L 1VF5C 1SE3A 3TS0A 2FINB 4HJ8A 4HMJA 4GLXA 1VQEA 2Q2UA 4QB4A 1WTPA 2XN9C 3MEHA 5D14A 1TS2A 4OL7A 1NNXA 3I70A 3K5NA 2L0CA 5IGBA 1FL0A 1QJOA 1Q3LA 3EQLC 5C5LA 3MVVA 1D8LA 4A3FG 1A15A 1BVSA 2JA6H 1NTGA 3BYTB 2DGYA 4AYBE 2LC3A 1NR4A 1EY4A 3PUWA 5CV7A 2PPBC 2K5HA 2MPMA 2DJFC 5KYIA 4JI2L 1VQFA 3S15H 4DK0A 4IFDJ 4DNIA 1YHBA 3OIPA 2SEBD 4A3KG 3VR5A 3SDZA 1M1KC 3TMEA 1KRSA 1BKBA 1PHJA 3GV6A 2B63G 1KRTA 3U58A 1O7ZA 1UUPA 4NB3A 4ABNA 4U68A 4JYAQ 4DR7L 3D4RA 3LGJA 1A3UA 3MC0B 1IYJB 1G6ZA 3HKZE 3KK7A 4YIJA 1HJPA 1DCZA 5IWAL 2PMZB 5IYDH 4X3TA 4O2DA 1ICWA 3K0XA 2JVWA 1DZ1A 3PCOB 3WOFA 3A55A 3SR1A 3D8GA 3OOCA 5M5XB 1HCZA 1BO0A 3RN2A 1D5ZC 1WTQA 4LNQA 3G6EA 1VQIA 1S5CD 4BY7B 3M4OH 3S14B 1LT4D 2JEBI 4R1JA 2J0TD 2IJ0A 1AP0A 5J39A 2UXCQ 1E22A 1E7DA 1SRUA 3PUYA 4NXNQ 3E6ZX 2KFVA 2PNRC 3H15A 1EYGA 2A19A 3PO2G 1PZKD 3T4AC 4HAEA 5CR3A 4JW0A 2ZJRA 5DEHA 3S1QH 1SDFA 3J81i 1MJCA 5TSSA 1B4OA 1CKMA 2LS01 4DAMA 1EIFA 4MZ9A 4TSSA 4IFDH 3CPFA 1CSQA 1LT5D 3SK6A 4FF3A 1JJGA 2E5LQ 2FXQA 4JI8Q 1V43A 2A68C 1A6XA 4DXFA 3J7YW 1JT8A 1NE3A 1E7ZA 4DK1A 4P2CB 3KF6A 3TP6A 2J4XA 2EY5A 1OTCA 2O5IC 2A5HA 2Z6BA 1TQOA 1HPCA 1YHAA 2B2TC 4A3LH 3QB3A 3R3OA 5CV4A 1J9OA 1XNQQ 3U4ZA 3I72A 4DV2L 1HNWQ 4KJOA 3P75A 5DNFA 1EQQA 1QVGA 2QDLA 5C3EB 2QEXA 3U50C 4B08A 3EROA 5ELFA 2CVRA 4X3KA 1QZHA 2A74C 3S1QB 4FF1A 2NB0A 3ONAB 1EWIA 1L0WA 1CA5A 4BBSG 1RKNA 2PI2E 5JAVA 3EBEA 3RUZA 1CK1A 1CA6A 4OONA 5ELDA 4DAVA 4X65L 5C4JH 1WTHA 3DM1A 4PZ7A 4R8NA 4KN7C 2YU9H 1N33L 1A2UA 3VR3A 4HEDA 3NE5B 3CU7A 3CQZB 1K0RA 3ZJYC 2G80A 2OTLA 1R9TB 3A7LA 3W3AA 4A3FB 4NXML 1HR0W 4LF9Q 3PQIA 2KHIA 2VW9A 1MKHA 5IGGA 1PFSA 2ZTEA 1S5ED 1W6KA 4FXKC 1II3A 1Y69U 2UUCL 4B3SQ 2ES2A 2R6GA 1OXUA 4IUUA 1SNDA 1VQNA 4IFDI 4C3JB 2KVUA 4X64Q 1WD0A 3JAMi 4V0BA 3GTGB 1Y1VH 2PMZE 1Q82C 3H0GH 3W5OA 2ID0A 3VYSA 5COYA 1KDBA 1I5FA 3J81c 4DV6L 1YNJD 3D0FA 3HOZG 3HP3A 3J81L 1JC7A 2CQAA 4M1UB 2F0MA 2HCCA 5C0XJ 4Q0FA 2ZM6Q 1M8AA 3MEFA 4EQNA 3GTKH 2EYMA 3UDFA 2QW7A 4GN3B 1GVPA 2EVBA 1VQ8A 3PGZA 5C4HA 5IE8A 2EYPA 3C1FA 5T1GA 4A3BH 2VQFQ 2OCEA 4RGTA 3HOXB 1SYDA 2EJFC 1D6EC 2NVXB 3HKZG 2WB1B 3HRZC 2WQGA 4BBRB 1G2SA 3TSSA 2ALYB 2G9HD 1SE2A 1WYDA 3KDFB 5C0XI 3HOVB 5FLXL 4K0KL 1MBYA 2JP1A 5I9PA 4B3TQ 3MFGA 4G57A 3S17B 1PTOB 1IW7C 1Q46A 2I07B 3UE0A 2N3SA 1MSGA 1EWHA 2LMCB 5C44H 1VQMA 4PMWA 5IT9c 1A3VA 2DNEA 3OIQA 1K28A 1E2VA 3ER0A 3CD6A 4UZWA 4J6HA 3OWEB 4BITA 1B1ZA 4N9PA 4OWWB 3RLOA 4N8X1 3QJYA 1ESFA 4JI7Q 4JYAL 2NYZD 1S40A 4DK3C 1SE8A 1G51A 4YCUA 1HR0Q 3I4MH 1K8GA 1UE5A 1STAA 1STNA 3CC7A 4OEMB 1IXRA 4QJFA 5DM73 1E2ZA 3PO3H 1NUCA 3KUPA 3F8TA 1BCPC 1WVLA 4GKKL 1RF2D 4ID6A 1SNPA 3I2ZA 3KLRA 4RKBA 3UDGA 4A3FH 2JA6G 2SNSA 3NBIA 1ASYA 1PFMA 2K01A 4BBRH 2KJXA 3S1NH 4OIKA 4DR1L 1LTGD 2WIIB 3GTQB 2E8GA 4JI8L 4A3GB 3HOUB 2ZTCA 3A0JA 4GOPA 1LTBD 3CCQA 1GKHA 1STYA 3A8JE 1V1QA 2F0KA 1FR3A 3TZUA 4GOPB 1PVOA 1XMQQ 1KABA 1WTOA 2CH4W 5IOCA 4HIKA 3IRBA 4CDCC 4RHSA 3IFTA 1U0LA 2IHFA 1E0BA 2HQEA 4HCEA 2B2VC 1VS0A 5CORA 5KIXA 2VUMH 3HOXG 1JE4A 1HNZL 2XVSA 1G2TA 5M5WB 3GV3A 1F2YA 1S72A 3T1YQ 3K80C 3M85A 3ITPA 4X66Q 4IUQA 5C3XA 5LL6S 4AIMA 1KLGD 1I6HB 1RCVD 3M3YH 4OO1G 2D0OA 1A8VA 3I91A 4GZYC 4UDUC 3K6OA 2ENBA 4OO1I 2LD7A 3VDYA 1XYIA 2VY3A 3F1ZA 4POFA 1WD1A 4KKSA 4XQQA 1ML0D 4K5VA 1PXUA 1XNRL 1AZPA 3NENA 3K57A 4IALA 5GAHC 1VCIA 4APVA 1VQLA 2NVYH 2JA9A 4RKLA 3TN2A 1FJGQ 5KNBA 4R4OA 4XQNA 3PUVA 5IWAQ 1Q8KA 1YJWA 1F9QA 5IGFA 3A74A 2VL6A 4DV5L 1WI5A 4JBWA 4UAIA 5KGUA 3Q23A 1PRTB 3EVQA 2A8VA 1T9HA 3QIAA 1Z7TA 5IYCG 4LUVA 1AEXA 3A5ZB 3GTJH 2F4VL 2LFNA 1F2MA 1H95A 1SROA 2RNNA 4DR7Q 1WCMG 2XGTA 4JPBW 3PIO3 2FHTA 2TMPA 3S1RH 3V05A 1MI2A 1AW7A 5EGTA 3AFQA 3PIP3 3NTKA 2BDOA 1GHKA 1I4RA 1WTWA 4QQBX 1PTOC 1KHCA 5GAGC 3KFUA 2WFWA 2B2WA 5KRUA 4LFBQ 2JA6B 4LF5Q 1QOHA 5M3MH 2QF7A 4DV1Q 3HOVG 1RHPA 4LFCL 5IODA 3B6YA 2IX0A 1TS5A 5A35A 1X3QA 5C6AA 3GP7A 1OXSC 1TU2B 1Y1WB 2I5MX 2QILA 2XIWA 3HOWH 1TWCB 1A3TA 3T51B 3J7A5 2NVTB 3QR8A 3L0OA 1GD7A 2BH2A 2AWNA 2OWOA 1BBUA 1SXTA 5I9OA 4GOPC 3NUCA 4IPCA 3NSWA 4HJAA 1K8OA 3SHLA 3RZDB 2B2YC 3A56A 5I2XA 3L3OC 1YNJC 4HJ5A 1EZ6A 2R7ZG 4KHPQ 1AH9A 3BU2A 3M3YB 3G6JB 2KCNA 1HFGA 1KAWA 1S4ZA 3KDFA 4DN4M 3CMEA 3F2UA 2EY1A 4GLVB 1U9RA 2F52A 1LTRD 4FYDA 5IGEA 4ZAIA 4DR2L 1TWFB 2EE1A 5BR8L 2Z0SA 5K5PA 1XJVA 3CCJA 1ASZA 3KF8B 3WWVA 1CUKA 4JI5L 4ZYSA 1HA5A 1N36Q 4K8IA 5CV5A 1D5MC 4LUOA 2VB3X 2JEAI 2X69A 2ATWA 2KOLA 1NMGA 2F03A 1FGBD 5FOBB 2K52A 2IWHA 4X3UA 4C3IB 4MN3A 1PZJD 4A3MG 1IYUA 1GJXA 5IIFA 1DGSA 2JA5H 4DR1Q 3BVMA 2A69D 5IGDA 1C9OA 5M3FB 1MIUA 4DV3L 2WV6D 1AE3A 1PRTC 3GQBA 1VQ5A 3MXGA 5C5MA 4DR6L 1Y8NB 3VYTA 4C3IG 4FNFA 1VQOA 1TKWB 4GN4B 1Q1BA 2KQ3A 2A73B 2DJGC 1X6OA 1N9WA 1Y14B 2WAQE 5CV6A 1VDZA 1A0IA 5C4XG 5DLQE 4A3DG 3A54A 1H9MA 3RLNA 1A63A 1H9KA 1FNUA 4IFDG 2L11A 3MTSA 5FLXc 1W6JA 3KLSA 3BZCA 3DEOA 1Y1WH 2GVAA 1J8IA 2K5DA 5AFWA 1PYWD 3N52A 4BBSH 3TREA 1I94L 5IT9L 4PZ6A 3KJPA 2EJMA 4GNXC 2TSSA 3K8AA 2R92G 5T1IA 1L1OA 4IZ8A 1LT6D 4QF4A 2VQEQ 1JEIA 1PZID 1JQYD 1AE2A 4H13C 3M7GA 4LF8L 4LW1A 1WTVA 1SJHD 4J1MA 4HIDA 3E0JA 1SFOB 4DV5Q 4I65A 3S1RB 5I4DA 1YNNC 2NWGA 5BN4A 1WOCA 4NW2A 3BYYB 4BA1I 5CMDA 5LMNL 1JCKB 2F3WA 1HQMC 4OIJA 3S24A 1STBA 1OXXK 4QL5A 3QG1A 1QUQB 4K5WA 4UHVA 4EVOA 1N34Q 1UNSA 1R9TH 1SNCA 4GNXA 3UDIA 2EYFA 2PCFB 4JV5Q 1IKLA 4I7ZC 4FP5D 1DM0B 3GTLH 1GUWA 1JICA 4A3EB 4A3JH 3I4LA 3OW2A 4Q5VA 3WDNA 5JJZA 1EL0A 1Y02A 2E2JH 4DNTB 4A3CH 2R93G 2A68D 3NTHA 1CFMA 4FF2A 4DV1L 1FNWA 3FLGA 1DYQA 5D3DA 1V1OA 1BCPB 3SEBA 3STBD 1TWHH 3J7AV 1ET9A 4G7ZC 4JVZA 1JEQA 1JOOA 1XPRA 1PA6A 2JA8G 5CC4A 3S1MB 4B3ML 3IAYA 3S1MH 3I55A 4JI7L 4A3DB 2H1EA 2FFKB 1UE7A 3M4YA 3EFXD 5KNCA 2ZTDA 1G291 1L2FA 1LV9A 1AZQA 1BF4A 2RNOA 4BY1H 2DK4A 1OO9B 4BBRG 5AJ3L 3E9IA 3J80i 1PRTD 4A3LG 5IP7G 5CV8A 4AQYL 1SYEA 1I6VC 1ZYRD 4F7XA 5JJLA 3QO2A 3PO2H 2LKVA 2MP1A 1NCVA 1EWCA 1GKUB 4IPHA 1E3PA 1B53A 2F0JA 1PDQA 2KVMA 4NP5A 4DV0Q 1DOKA 4UY8C 4BBSB 3I73A 1Q81C 4ALPA 4XT1B 2DN8A 2WACA 3S17H 2XTIA 1PH3A 2F0PA 3GTGH 4K2LA 4RH6A 1KAAA 1PH7A 5C44B 2PO4A 1EYCA 4FF4A 1QWYA 1PLFA 5EQ0A 4B3MQ 4A3KH 2R92B 1D2BA 3Q6SA 4WJWA 3E0EA 3S2DB 3NTIA 4CKBA 2F0DA 1M90C 2UXCL 3D6WA 2BE5C 5DM63 4POGA 4C3JG 4QUCA 1VQHA 5E4WC 4KLKA 1LO5D 1PH2A 5JOBA 1C7YA 3FHWA 1BQQT 1JB3A 4TRDA 5EKLA 5M5WH 4DR4L 1TS4A 4RG1A 1D7QA 1HZAA 4NMZA 3CQZH 2RBMA 1SR3A 4BXXH 5IP9H 1GUSA 3J80L 2MO1A 4A3EG 2NN6G 1CKNB 1BCPD 2ZT9C 2WINB 4K6DA 1BBXC 2L55A 3Q0AA 4OGQC 4A3EH 3ULPA 2CCZA 2JSOA 3M7NA 1A62A 1LTSD 5CBAE 3KYHC 1KNAA 4JI4Q 1PRTF 5GROA 4DUZQ 3HOUH 3BVZA 4CJ0B 2NTTA 1PH9A 1F9RA 1N8RC 3O13A 4EX5A 4DAPA 2DY7A 4K6LA 4YWMA 1JMCA 2KENA 4ULLA 4IUNA 4X62Q 2RDHA 3CKIB 1IL8A 3DUZA 2F0HA 3E5SA 5IYCH 3MXUA 1RL2A 5I6WA 1H9SB 1C4QA 1X9NA 1QILA 2F0QA 4WFN3 4YY3L 4K0KQ 2MQHA 4DV0L 2E74C 2AUKA 1Y8PB 1MHWC 1O78A 1PH6A 4DR5L 2IX3A 1DJRD 2K5QA 2V4DA 2YYZA 3LWEA 2RA4A 5HURA 2YV5A 1TWAH 1HR0L 4QGUA 3K81C 2RVLA 3VYUA 1IBMQ 2A6ED 3S9WA 5FK9C 1STGA 4JCVE 1JWSD 3OTOL 3W1GA 1G8ZD 3FVQA 1CT1D 5FO9B 3I4NB 4RGNA 4QUFA 2X6GA 1B8AA 4F8MA 3HS0C 1HHVA 1YNSA 5M3MB 3QKJA 4FVMA 5D65A 3CHBD 4RHRA 4DV2Q 2K1BA 1B50A 1X3GA 4KN4C 2NZHA 1I4PA 2JA8H 1TWCH 4HSPA 1U4RA 1VQBA 4K14A 2RSNA 4O0AA 3A8IE 4XQJA 4P71A 1K73C 1EY6A 5C0XH 2WKDA 2N8NA 3H3VI 2UUCQ 3TS2A 4K8JA 2IPKD 1XX8A 5C3EH 1TXYA 1JB7A 5IP7H 3UI2A 4I7AA 3KLSX 1YEZA 4JI3Q 3PMFA 4JI5Q 3D4WA 1DOLA 2HT1A 1GO3E 4JV5L 4BY7G 4OXPA 3GTOH 1HUMA 2AQ3B 3T56B 4EQPA 4WJ4A 1VQ9A 3BDLA 4A3IH 4DNRB 3VR2A 1L0XB 3P1HA 1Q7YC 3CCMA 2M2LA 1SLJA 2VUMG 2L15A 4QIWB 4LFAQ 2D9UA 5KNDA 4RWSC 3JAME 1PH1A 4H02A 4OWXB 1NMFA 1VQPA 3LX0A 1P16A 3CP0A 3NPPA 2AQ2B 2XWJB 4MIUA 2K50A 2AQ1B 4ILWA 2C5CA 5CBEE 2KEDA 4IPGA 3GTLB 2EJGC 3I3CA 4CKEA 3AMUA 3C3LA 3JAML 4KJNA 4LAAA 1PTOF 1B9MA 2DUDA 3K7UC 4JK1C 4C56C 2Y0SB 4XYOA 3Q22A 2QKIC 2E2IH 3RD4A 3T13A 2EDGA 3NWTA 4U673 2BA1A 4A93H 1HUNA 4K2KA 2R93H 3CCLA 3NQTA 1SMYC 2LXKA 2X6LA 3RZDH 1YJNA 4R9WA 3D4DA 2RSOA 2AHOB 1I3QH 2JN4A 4LFAL 4A3BB 2UUAL 4CDDC 1I4HA 1TWAB 2I0QA 2AKWB 2F4VQ 1I94Q 1Z47A 1KC8C 4A3DH 3PIOA 3ULLA 5C44G 2A6HC 3V2TA 1Y8OB 2KCTA 3NBHA 1WJJA 2FJ2A 4YHHL 2MUYA 2PQEA 3I4OA 2E75C 4G7OC 4PZ8A 1VQKA 1GJJA 4UP8A 1EN7A 4LF4Q 2KECA 2N78A 2MHVA 4RMFA 1PTOH 1H9EA 5JEAH 3DLLA 4HIOA 5J1ZA 1C8CA 5ELEA 3PO2B 5LMNQ 3GD7A 3KLWA 1J5EQ 1B3AA 1MSHA 2OT2A 1TWGH 1JR0D 2RCNA 1JWMD 3DEPA 3M9BA 4C3HG 2E5LL 2YTVA 2OQKA 2NUCA 2KW9A 4TQUS 3MHBA 1D5XC 3ERSX 2LY7A 1QVFA 4GS3A 1YZ6A 1VQAA 4BWGB 2IX1A 3GTPH 1KDCA 5CYUA 3GTJB 5FO7B 4RAUC 4DAYA 2KA7A 3HOYH 1K83H 2JK8A 4HCSA 2R61A 2F0VA 1YBYA 2B8GA 3H3VC 3STBC 2GN5A 4JC0A 1CHPD 1YI2A 2B63H 5CGKA 2QA4A 2BE5D 5C4JB 2QNCA 3NELA 1VMCA 2SOBA 3K7AB 2CHBD 2MFIA 2EXDA 1N33Q 2BA0A 2CW0D 1SEBD 3BS1A 5IT9E 1G91A 2QEJC 4ZLTF 2NVYB 1C48A 1I4GA 1RTOA 5C3EG 3I4MG 1S3OA 1O7IA 5C4XB 4XTCS 2O4XA 4P72A 5C4XH 2ZJQA 4EGVA 4R4CA 2BH8A 4WORA 2Q8TA 1Q90A 3TZDA 2E2HB 1I4QA 3HOUG 3S15B 2L4NA 2N88A 3T1YL 2NZ1D 3HGBA 1LTTD 5C4ZA 1Y1VB 1XMQL 2RF4A 3BZDB 3SK4A 1N34L 5LMNW 1H1JS 4QCLA 1PYSB 3WOEA 3GTOB 5H1SE 3DWAA 4OX9Q 1NR2A 3PUZA 4A3MH 3G4SA 1RDPD 1UEAB 5FLMG 3DHQA 3S2HH 4ODGA 4C2MB 3GTKB 4P74A 2WAQG 2CWAA 1AN8A 2NVQB 2QNFA 4CGYB 1ILPA 1KLUD 2QCPX 1HNZQ 5A2QE 2K6AA 4K5XA 2N55A 2XRQD 3X3NA 3I7FA 2KHJA 3CRLC 1SYBA 1Z6HA 1VQCA 2E76C 2F1MA 1I6HH 1NAPA 4CJ1B 3MAQA 3TP5A 3FPPA 4YCVA 4LF6L 1N32L 4KKUA 4M8AA 4A3JB 2BOSA 1L1OB 3J7ZC 1ESRA 1O7LA 2E2JB 4ZCKA 2FMMA 4RFBA 3LWUA 1K3BC 3MXNA 3U4VA 2E2IB 1EUJA 1KQSA 5IY0A 3CW2C 4FXGC 3X3MA 3K59A 5JJKA 1SYCA 2WKCA 1Q86C 2JA8B 1GUTA 4DV7Q 2UXDL 1B3QA 2CKZB 1PH5A 1EIGA 2HHHL 3K58A 2ICIA 1ZBHA 1X54A 2JE6I 2KCCA 3DXJC 5LHY1 4LK1C 2K32A 2MPHA 1E1TA 2E2DC 1HRJA 1TR5A 1Q12A 4XIGS 5I6YA 3HG9A 4L5RC 4JOIA 4KY5A 1LT3D 4LFBL 2UUBQ 1QVCA 3W2DA 3RZOH 2GA4B 3ICEA 2F3IA 4F87A 4GKKQ 4KY6A 3CCUA 2RKSA 4J15A 2OF1A 4CBVA 1DOMA 4GKJQ 1ZEQX 1Q8IA 3J81E 4QIWE 1L1OC 4JI6Q 2B2UC 1IBKQ 1PTOD 1RIPA 5ELBA 4RCNA 1S5FD 1ENCA 2VNUD 3SK8A 3M4QA 3H0GB 1C0AA 4LJZC 4JI2Q 3MA2B 1EYDA 2OXPA 3GTPB 2R7DA 2Z4HA 5GADC 2W51A 2K5VA 3OMCA 3CPWA 1D1KA
chains in the Genus database with same CATH topology
2ZTDA 1XMOL 1G291 1L2FA 2KHIA 2VW9A 1MKHA 2UXDQ 4AQYQ 4YCWA 1PV4A 4BY1H 2DK4A 1PFSA 2RHSB 2ZTEA 3PSIA 2RHQB 3AYHB 4BBRG 5AJ3L 1IBML 2JA7H 3E9IA 3J80i 4A3LG 1YVCA 5IP7G 4P73A 4AQYL 1X3EA 3TQYA 2ES2A 2R6GA 2UUCL 4B3SQ 1OXUA 3L7ZC 4A75A 1SFOH 1VQNA 2OTJA 4IFDI 5JJLA 4X64Q 3PO2H 4GKJL 3JAMi 3F2BA 1Y1VH 2PMZE 4IJLA 3H0GH 3J81j 5JEAG 1Q82C 2VZAA 4B3SL 2ASBA 3W5OA 1GKUB 2ID0A 1E3PA 4IPHA 1XNRQ 2UXBQ 4DV0Q 2PQAB 1I5FA 4LF9Q 4UY8C 3J81c 4DV6L 1ZS9A 3JC66 3D0FA 1Q81C 3HOZG 4HJ9A 4ALPA 1PH4A 4JI0Q 3S17H 2XTIA 4GNXB 1PH3A 3GTGH 1XPOA 3CC4A 3CC2A 4DV4Q 1PH7A 4DV6Q 5C0XJ 2EIFA 4YWKA 4DR5Q 4P75A 2ZM6Q 4B3MQ 3MEFA 3NEMA 3GTKH 3PV0A 2VQFL 4A3KH 3UDFA 1VQGA 4GN3B 1GVPA 4NXNL 1K3RA 3CMAA 3E0EA 4JI1L 4QY7A 3TRZA 1K9MC 1VQ8A 2IY5B 3PGZA 5IE8A 1QZGA 1M90C 4A3BH 2VQFQ 2UXCL 2NN6I 2OCEA 5C0XG 1I50H 3AFPA 4POGA 3D31A 1VQHA 4A4IA 4KLKA 2B29A 3BZKA 2HJQA 4B3RQ 1PH2A 3HKZG 5FJ8G 1C7YA 3FHWA 4A93G 3M4PA 3ULJA 2AMCB 5M5WH 4DR4L 1X65A 3MXNB 1HZAA 4RG1A 1D7QA 1KXLA 3CQZH 2ODGC 2ALYB 1SR3A 2AWOA 2CFMA 4KI0A 3RNUA 4BXXH 5IP9H 2MO1A 1WYDA 3KDFB 2NN6G 5IYDG 4UPAA 5C0XI 4A3EG 5LMUQ 1CKNB 2NVTH 3PF4A 4IOAA 4K0KL 3UE1A 4B3TQ 5JJIA 1E1OA 1VQ6A 1Q46A 3UE0A 2N3SA 4LF9L 4DK6C 4JBMA 2K4KA 1V9PA 2D62A 4DV3Q 4A3EH 4B3RL 3ULPA 4IO9A 3T1HL 5C44H 1VQMA 4PMWA 1PH8A 5IT9c 2CCZA 1A62A 4NPSA 4C2MH 1K8AC 3M7NA 3KYHC 3ER0A 4JI4Q 2EQSA 3CD6A 1XMOQ 5GROA 4YHHQ 4DUZQ 3HOUH 4OWWB 1Y1VG 3RLOA 4EQ5A 1CSPA 1PH9A 4DR4Q 5M3MG 1N8RC 2Z6KA 4JI7Q 3EIVA 4EX5A 3PO3G 4JYAL 4LUZA 1S40A 4YWMA 4DK3C 4JOIC 2KENA 4DR3Q 1SE8A 1JMCA 1X55A 4AYBG 2Q2IA 1G51A 4X62Q 4YCUA 1HR0Q 3I4MH 1K8GA 4DV4L 1UE5A 1PYBA 5IYCH 1RL2A 1OXVA 3CC7A 1IXRA 1W3SA 4QJFA 3PO3H 4JI1Q 3F8TA 3I56A 1X9NA 1XPUA 2JA5G 4YY3L 4BY7H 1YNXA 5GQOA 2MQHA 4DV0L 4K0KQ 4GKKL 1EFWA 2V1CC 2WB1G 4UP7A 4KHPQ 5EAYA 1PH6A 4DR5L 4WJ3M 1WCMH 2UUBL 3I2ZA 2R92H 1N32Q 3UDGA 2YYZA 2OQ0A 4A3FH 1EIYB 2JA6G 1ASYA 1W2BA 4BBRH 3PF5A 2YV5A 4JI0L 4A3IG 2KCMA 4DPGA 3CF5A 1TWAH 4R4TA 1HR0L 4QGUA 3K81C 4X65Q 4A3CG 3S1NH 2CQOA 1Z9FA 1Y1WG 1IBMQ 4DR1L 4OWTB 4JCVE 3OTOL 4DR2Q 2E8GA 1CKOA 1HZCA 4JI8L 3W1GA 2ZTCA 3A0JA 5LMUL 2WB1E 4GOPA 5JEAJ 3CCQA 1GKHA 3HOXH 3RN5A 3AEVA 2IT1A 1B8AA 2KBNA 1V1QA 3T1HQ 1P8LA 4GOPB 1PVOA 1XMQQ 4KHPL 1GM5A 1YNSA 1VQDA 4HIKA 3IRBA 2K75A 3NBHB 1UE1A 4Y7NH 1FGUA 1U0LA 2IHFA 3CAMA 5FLMH 4DV7L 2PI2A 1E7LA 4DV2Q 3I4NH 3HOZH 3KOJA 4A3GG 1X3GA 2JJQA 2NZHA 2D0PA 2I5HA 2JA8H 2PQAA 1TWCH 2NVXH 1VQBA 1G6PA 1VS0A 4O0AA 3AQQA 2VUMH 1XTDA 4P71A 4X64L 1EOVA 3G48A 3HOXG 1K73C 1HNZL 2C35B 2HHHQ 2N8NA 4ME3A 4C3JH 3H3VI 4A3GH 1S72A 2UUCQ 3TS2A 3L2PA 3T1YQ 3K80C 2H5XA 3M85A 5K36G 4X66Q 4AIMA 1TXYA 5C3EH 5IP7H 1JB7A 5FJ8H 3M3YH 4OO1G 2D0OA 1A8VA 1N36L 1H9FA 3I4NG 4PG3A 1YEZA 4JI3Q 2MO0A 4GN5A 4LF7Q 4OO1I 2LD7A 3EN2A 4JI5Q 3VDYA 2HT1A 1GO3E 5IP9G 4JV5L 2VY3A 4BY7G 3F1ZA 4POFA 4OXPA 3GTOH 3HFZB 2A1AA 1HNWL 1WFQA 3E9HA 4L5TA 4C3IH 4WJ4A 5M5YH 1XNRL 2ZM6L 5ELOA 1VQ9A 4A3IH 4LF5L 3A5UA 3NENA 4HJ7A 1Q7YC 5GAHC 3CCMA 1VCIA 4APVA 1VQLA 2E2HH 4DUYL 1SLJA 3H0GG 2NVYH 3HKSA 4HIMA 4DR6Q 3Q8DA 2JA9A 5HY6A 2L15A 2VUMG 4LFAQ 1FJGQ 3FKIH 4R4OA 3CCSA 1PH1A 4H02A 3PUVA 5IWAQ 2UXBL 1Q8KA 2B3GA 4OWXB 4A76A 1YJWA 1XNQL 1NMFA 3KJOA 1VQPA 4X6AH 2UU9L 1P16A 3A74A 3CP0A 1J6QA 1CKNA 2VL6A 4DV5L 1IBLL 1WI5A 2K50A 4JBWA 2JQOA 2A8VA 1Q1EA 1T9HA 4IPGA 5IYBG 3BJUA 4C3HH 1GL9B 5IYCG 2ODCI 2MNAA 4UP9A 4DAYB 4LUVA 3F2CA 3A5ZB 2JA7G 2Y0SE 3GTJH 4LF6Q 2F4VL 3G71A 4FDBA 3JAMc 1KIXA 4BXXG 1VQJA 2DUDA 3K7UC 1H95A 1KD1C 1SROA 1SMXA 1IBKL 4DR7Q 1WCMG 2XGTA 1HNXL 3S1RH 5E7NA 2E2IH 3FKIG 4A93H 2BA1A 1NBWA 1YIJA 3AFQA 2R93H 3CCLA 2PNHA 5HGQA 2LXKA 2HIXA 1YJNA 3RZDH 3HOWG 2VQEL 4IOCA 1YITA 2AHOB 1I3QH 4LFCQ 1LTLA 4LFAL 4QQBX 2UUAL 2I0QA 1B70B 2AKWB 5GAGC 2I5LX 3KFUA 2F4VQ 1I94Q 3S16H 2WFWA 4LFBQ 2Y0SG 1Z47A 3H3VH 4LF5Q 2N49A 5M3MH 1KC8C 2UUAQ 4A3DH 4DV1Q 3PIOA 3HOVG 3CCVA 4LFCL 3ULLA 3B6YA 5C44G 2IX0A 1KL9A 4LF8Q 2KCTA 1OXSC 1U5KA 1WJJA 2I5MX 4YHHL 1LUZA 4A3BG 3I4OA 4JI4L 3HOWH 1HZ9A 4PZ8A 1VQKA 3J7A5 1GJJA 4UP8A 1HNXQ 1EN7A 4LF4Q 2N78A 4RMFA 3L0OA 1GD7A 3DM3A 4MNOA 4X66L 2BH2A 2AWNA 1JE5A 2OWOA 1H9EA 3TS0A 4OX9L 3DLLA 4HIOA 3HOYG 4HJ8A 1BBUA 2YTXA 5LMNQ 4GLXA 3GD7A 1VQEA 2Q2UA 1JJ2A 3KLWA 4GOPC 1J5EQ 1TWGH 4IPCA 4HJAA 2Q2TA 2RCNA 1UEBA 5M5XH 3M9BA 3J80c 2E5LL 2YTVA 1JJCB 4AH6A 2OQKA 3KF6B 1QUQA 1IBLQ 4YWLA 1FL0A 4TQUS 4HJ5A 3ERSX 4LF4L 3PUXA 2Q2HA 1D8LA 1J5EL 2R7ZG 4A3FG 3BU2A 1BVSA 1QVFA 1NTGA 4GS3A 2JA6H 1AH9A 1YZ6A 1KAWA 1VQAA 3KDFA 2DGYA 3CMEA 2IX1A 4AYBE 1IZ6A 3GTPH 2LC3A 4GLVB 2WP8J 2F52A 3HOYH 1K83H 4NXMQ 1LM0A 2JK8A 3PUWA 4BA2I 1YBYA 4DR2L 3OYYA 5ELNA 2K5HA 2UU9Q 3STBC 2GN5A 4JC0A 5BR8L 2Z0SA 1YI2A 1XJVA 4JI2L 2B63H 1VQFA 2QA4A 3S15H 2QNCA 3NELA 3CCJA 1ASZA 4IFDJ 4YY3Q 1HH2P 3KF8B 4DNIA 3WWVA 1YHBA 2EXDA 2MFIA 4A3KG 1CUKA 1N33Q 1M1KC 1KRSA 4JI5L 2BA0A 1BKBA 1PHJA 2VS1A 4JI6L 2B63G 1KRTA 3U58A 4GLAC 1N36Q 4IPDA 4DR3L 4DKAC 5BR8Q 4NB3A 4JYAQ 2HQLA 3K7AH 4LUOA 2JEAI 3SGIA 5C3EG 2ATWA 3I4MG 4DR7L 1NMGA 1S3OA 1O7IA 3LGJA 4XTCS 4P72A 5C4XH 5J3BA 2K52A 2ZJQA 1BBWA 1IYJB 4A3MG 4R4CA 3OTOQ 2BH8A 2JA5H 1DGSA 4DR1Q 3HKZE 1HJPA 1LYLA 5IYBH 1C9OA 5IWAL 3FP9A 5AJ3Q 1MIUA 3CCRA 3HOUG 5IYDH 4DV3L 1AE3A 4O2DA 3T1YL 1VQ5A 1FJGL 1FVIA 3K0XA 3PCOB 1VQ7A 4DR6L 4B3TL 1XMQL 2K14A 2RF4A 1NJIC 1N34L 5LMNW 1VQOA 4GN4B 1Q1BA 1X6OA 1N9WA 1Y14B 1PYSB 4JG2A 2WAQE 5H1SE 3RN2A 3RR5A 4OX9Q 3PUZA 4A3MH 4LNQA 1A0IA 3UDXA 3G4SA 5C4XG 3G6EA 1VQIA 5DLQE 5FLMG 4A3DG 1E24A 4LWCA 3RLNA 3M4OH 2JEBI 3S2HH 4IJHA 4R1JA 1A63A 4P74A 2WAQG 1EQRA 2CWAA 4IFDG 2QNFA 5FLXc 2UXCQ 1E22A 1E7DA 1SRUA 2YTYA 3S2DH 3BZCA 3PUYA 2Z6KC 4NXNQ 1YJ9A 1HNZQ 1KHIA 2KFVA 1Y1WH 2GVAA 3H15A 4JBKA 1EYGA 2A19A 3I7FA 2KHJA 3PO2G 1I6HH 1VQCA 4BBSH 3TREA 1I94L 3GTMH 2ZJRA 2R7ZH 2NVQH 4PZ6A 4MTNA 1UWVA 3KJPA 3S1QH 3RLFA 1X56A 3J81i 3GO5A 1MJCA 3K8AA 4GNXC 2R92G 1L1OA 1CKMA 1UE6A 4YCVA 4JI3L 2VQEQ 4LF6L 1N32L 4DAMA 1JEIA 1EIFA 4MZ9A 1L1OB 3J7ZC 1AE2A 3CPFA 3TEHB 1CSQA 4LF8L 4LW1A 1JJGA 4L5QA 2E5LQ 2FXQA 4JI8Q 4HIDA 1V43A 3PIPA 3U4VA 2GVBA 4DV5Q 3CXCA 1NY4A 3GDEA 2CWPA 1EUJA 1KQSA 2HIVA 5IY0A 1WOCA 3CW2C 1IL2A 4BA1I 4BY1G 5JJKA 1NE3A 5LMNL 3S14H 1JT8A 4R4IA 1E7ZA 1Q86C 4DV7Q 1SN8A 3S24A 3KF6A 1OXXK 3GTQH 2UXDL 2CKZB 1OTCA 4QL5A 1PH5A 2HHHL 1QUQB 4DUZL 4DUYQ 1X54A 1YHAA 2JE6I 4A3LH 2R7FA 1N34Q 1XNQQ 5M3FH 1R9TH 3U4ZA 2MPHA 4DV2L 4KHZA 3W1BA 4GNXA 3UDIA 1HNWQ 1B7YB 2IHEA 1E1TA 4JV5Q 1EQQA 1QVGA 4XIGS 1Q12A 2NZOA 3GTLH 1MJEA 2QEXA 3U50C 4L5RC 4JOIA 4A3JH 1X3FA 3OW2A 4LFBL 2UUBQ 4Y52H 4L5SA 1QVCA 3RZOH 1Y02A 2F3IA 2E2JH 3ICEA 1QZHA 4GKKQ 4A3CH 2R93G 3CCUA 4J15A 1EWIA 1L0WA 5M3FG 4R4QA 4BBSG 4A3JG 4GKJQ 2PI2E 4DV1L 2LSSA 3EBEA 2K5NA 1TWFH 2ZJPA 4LF7L 4OONA 2QGQA 4X62L 4QIWE 1L1OC 4JI6Q 4JBJA 4X65L 3STBD 5C4JH 1TWHH 1HZBA 3CCEA 1YHQA 1IBKQ 4PZ7A 2YU9H 1RIPA 1N33L 2VNUD 1OXTA 3M4QA 1C0AA 1K0RA 2LXJA 3ZJYC 3F2DA 1XPRA 1PA6A 2G80A 4JI2Q 5GAEC 2JA8G 4TVAB 2OTLA 4B3ML 3HOVH 3S1MH 3I55A 4JI7L 2R7DA 5GADC 4NXML 2W51A 1VQ4A 2K5VA 1UE7A 1HR0W 3CPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZTD A;  1XMO L;  1G29 1;  1L2F A;  2KHI A;  2VW9 A;  1MKH A;  2UXD Q;  4AQY Q;  4YCW A;  1PV4 A;  4BY1 H;  1PFS A;  2RHS B;  2ZTE A;  3PSI A;  2RHQ B;  3AYH B;  4BBR G;  5AJ3 L;  1IBM L;  2JA7 H;  3E9I A;  3J80 i;  4A3L G;  1YVC A;  5IP7 G;  4P73 A;  4AQY L;  1X3E A;  3TQY A;  2ES2 A;  2R6G A;  2UUC L;  4B3S Q;  1OXU A;  3L7Z C;  4A75 A;  1SFO H;  1VQN A;  2OTJ A;  4IFD I;  5JJL A;  4X64 Q;  3PO2 H;  4GKJ L;  3JAM i;  3F2B A;  1Y1V H;  2PMZ E;  4IJL A;  3H0G H;  3J81 j;  5JEA G;  1Q82 C;  2VZA A;  4B3S L;  2ASB A;  3W5O A;  2ID0 A;  1E3P A;  4IPH A;  1XNR Q;  2UXB Q;  4DV0 Q;  2PQA B;  1I5F A;  4LF9 Q;  4UY8 C;  3J81 c;  4DV6 L;  3JC6 6;  1Q81 C;  3D0F A;  3HOZ G;  4HJ9 A;  4ALP A;  1PH4 A;  4JI0 Q;  3S17 H;  2XTI A;  4GNX B;  1PH3 A;  3GTG H;  1XPO A;  3CC4 A;  3CC2 A;  4DV4 Q;  1PH7 A;  4DV6 Q;  5C0X J;  2EIF A;  4YWK A;  4DR5 Q;  4P75 A;  2ZM6 Q;  4B3M Q;  3MEF A;  3NEM A;  3GTK H;  3PV0 A;  2VQF L;  4A3K H;  3UDF A;  1VQG A;  4GN3 B;  1GVP A;  4NXN L;  1K3R A;  3CMA A;  3E0E A;  4JI1 L;  4QY7 A;  3TRZ A;  1K9M C;  1VQ8 A;  2IY5 B;  3PGZ A;  5IE8 A;  1QZG A;  1M90 C;  4A3B H;  2VQF Q;  2UXC L;  2NN6 I;  2OCE A;  5C0X G;  1I50 H;  3AFP A;  4POG A;  3D31 A;  1VQH A;  4A4I A;  4KLK A;  2B29 A;  3BZK A;  2HJQ A;  4B3R Q;  1PH2 A;  3HKZ G;  5FJ8 G;  1C7Y A;  3FHW A;  4A93 G;  3M4P A;  3ULJ A;  2AMC B;  5M5W H;  4DR4 L;  1X65 A;  3MXN B;  1HZA A;  4RG1 A;  1D7Q A;  1KXL A;  3CQZ H;  2ALY B;  1SR3 A;  2AWO A;  2CFM A;  4KI0 A;  3RNU A;  4BXX H;  5IP9 H;  2MO1 A;  1WYD A;  3KDF B;  2NN6 G;  5IYD G;  4UPA A;  5C0X I;  4A3E G;  5LMU Q;  1CKN B;  2NVT H;  3PF4 A;  4IOA A;  4K0K L;  3UE1 A;  4B3T Q;  5JJI A;  1E1O A;  1VQ6 A;  1Q46 A;  3UE0 A;  2N3S A;  4LF9 L;  4DK6 C;  4JBM A;  2K4K A;  1V9P A;  2D62 A;  4DV3 Q;  4A3E H;  4B3R L;  3ULP A;  4IO9 A;  3T1H L;  5C44 H;  1VQM A;  4PMW A;  1PH8 A;  5IT9 c;  2CCZ A;  1A62 A;  4NPS A;  4C2M H;  1K8A C;  3M7N A;  3KYH C;  3ER0 A;  4JI4 Q;  2EQS A;  3CD6 A;  1XMO Q;  5GRO A;  4YHH Q;  4DUZ Q;  3HOU H;  4OWW B;  1Y1V G;  3RLO A;  4EQ5 A;  1CSP A;  1PH9 A;  4DR4 Q;  5M3M G;  1N8R C;  2Z6K A;  4JI7 Q;  3EIV A;  4EX5 A;  3PO3 G;  4JYA L;  4LUZ A;  1S40 A;  4YWM A;  4DK3 C;  4JOI C;  2KEN A;  4DR3 Q;  1SE8 A;  1JMC A;  1X55 A;  4AYB G;  2Q2I A;  1G51 A;  4X62 Q;  4YCU A;  1HR0 Q;  3I4M H;  1K8G A;  4DV4 L;  1UE5 A;  1PYB A;  5IYC H;  1RL2 A;  1OXV A;  3CC7 A;  1IXR A;  1W3S A;  4QJF A;  3PO3 H;  4JI1 Q;  3F8T A;  3I56 A;  1X9N A;  1XPU A;  2JA5 G;  4YY3 L;  4BY7 H;  1YNX A;  5GQO A;  2MQH A;  4DV0 L;  4K0K Q;  4GKK L;  1EFW A;  2V1C C;  2WB1 G;  4UP7 A;  4KHP Q;  5EAY A;  1PH6 A;  4DR5 L;  4WJ3 M;  1WCM H;  2UUB L;  3I2Z A;  2R92 H;  1N32 Q;  3UDG A;  2YYZ A;  2OQ0 A;  4A3F H;  1EIY B;  2JA6 G;  1ASY A;  1W2B A;  4BBR H;  3PF5 A;  2YV5 A;  4JI0 L;  4A3I G;  2KCM A;  4DPG A;  3CF5 A;  1TWA H;  4R4T A;  1HR0 L;  4QGU A;  3K81 C;  4X65 Q;  4A3C G;  3S1N H;  2CQO A;  1Z9F A;  1Y1W G;  1IBM Q;  4DR1 L;  4OWT B;  4JCV E;  3OTO L;  4DR2 Q;  2E8G A;  1CKO A;  1HZC A;  4JI8 L;  3W1G A;  2ZTC A;  3A0J A;  5LMU L;  2WB1 E;  4GOP A;  5JEA J;  3CCQ A;  1GKH A;  3HOX H;  3RN5 A;  3AEV A;  2IT1 A;  1B8A A;  2KBN A;  1V1Q A;  3T1H Q;  1P8L A;  4GOP B;  1PVO A;  1XMQ Q;  4KHP L;  1GM5 A;  1VQD A;  4HIK A;  3IRB A;  2K75 A;  3NBH B;  1UE1 A;  4Y7N H;  1FGU A;  1U0L A;  2IHF A;  3CAM A;  5FLM H;  4DV7 L;  2PI2 A;  1E7L A;  4DV2 Q;  3I4N H;  3HOZ H;  3KOJ A;  4A3G G;  1X3G A;  2JJQ A;  2NZH A;  2D0P A;  2I5H A;  2JA8 H;  2PQA A;  1TWC H;  2NVX H;  1VQB A;  1G6P A;  1VS0 A;  4O0A A;  3AQQ A;  2VUM H;  1XTD A;  4P71 A;  4X64 L;  1EOV A;  3G48 A;  3HOX G;  1K73 C;  1HNZ L;  2C35 B;  2HHH Q;  2N8N A;  4ME3 A;  4C3J H;  3H3V I;  4A3G H;  1S72 A;  2UUC Q;  3TS2 A;  3L2P A;  3T1Y Q;  3K80 C;  2H5X A;  3M85 A;  5K36 G;  4X66 Q;  4AIM A;  1TXY A;  5C3E H;  5IP7 H;  1JB7 A;  5FJ8 H;  3M3Y H;  4OO1 G;  2D0O A;  1A8V A;  1N36 L;  3I4N G;  4PG3 A;  1YEZ A;  4JI3 Q;  2MO0 A;  4GN5 A;  4LF7 Q;  4OO1 I;  4JI5 Q;  3EN2 A;  3VDY A;  2HT1 A;  1GO3 E;  5IP9 G;  4JV5 L;  2VY3 A;  4BY7 G;  3F1Z A;  4POF A;  4OXP A;  3GTO H;  3HFZ B;  2A1A A;  1HNW L;  1WFQ A;  3E9H A;  4L5T A;  4C3I H;  4WJ4 A;  5M5Y H;  1XNR L;  2ZM6 L;  5ELO A;  1VQ9 A;  4A3I H;  4LF5 L;  3A5U A;  3NEN A;  4HJ7 A;  1Q7Y C;  5GAH C;  3CCM A;  1VCI A;  4APV A;  1VQL A;  2E2H H;  4DUY L;  1SLJ A;  3H0G G;  2NVY H;  3HKS A;  4HIM A;  4DR6 Q;  3Q8D A;  2JA9 A;  5HY6 A;  2L15 A;  2VUM G;  4LFA Q;  1FJG Q;  3FKI H;  4R4O A;  3CCS A;  1PH1 A;  4H02 A;  3PUV A;  5IWA Q;  2UXB L;  1Q8K A;  2B3G A;  4OWX B;  4A76 A;  1YJW A;  1XNQ L;  1NMF A;  3KJO A;  1VQP A;  4X6A H;  2UU9 L;  1P16 A;  3A74 A;  3CP0 A;  1J6Q A;  1CKN A;  2VL6 A;  4DV5 L;  1IBL L;  1WI5 A;  2K50 A;  4JBW A;  2JQO A;  2A8V A;  1Q1E A;  1T9H A;  4IPG A;  5IYB G;  3BJU A;  4C3H H;  5IYC G;  2MNA A;  4UP9 A;  4DAY B;  4LUV A;  3F2C A;  3A5Z B;  2JA7 G;  2Y0S E;  3GTJ H;  4LF6 Q;  2F4V L;  3G71 A;  4FDB A;  3JAM c;  1KIX A;  4BXX G;  1VQJ A;  2DUD A;  3K7U C;  1H95 A;  1KD1 C;  1SRO A;  1SMX A;  1IBK L;  4DR7 Q;  1WCM G;  2XGT A;  1HNX L;  3S1R H;  5E7N A;  2E2I H;  3FKI G;  4A93 H;  2BA1 A;  1NBW A;  1YIJ A;  3AFQ A;  2R93 H;  3CCL A;  2PNH A;  5HGQ A;  2LXK A;  2HIX A;  1YJN A;  3RZD H;  3HOW G;  2VQE L;  4IOC A;  1YIT A;  2AHO B;  1I3Q H;  4LFC Q;  1LTL A;  4LFA L;  4QQB X;  2UUA L;  2I0Q A;  1B70 B;  2AKW B;  5GAG C;  2I5L X;  3KFU A;  2F4V Q;  1I94 Q;  3S16 H;  2WFW A;  4LFB Q;  2Y0S G;  1Z47 A;  3H3V H;  4LF5 Q;  2N49 A;  5M3M H;  1KC8 C;  2UUA Q;  4A3D H;  4DV1 Q;  3PIO A;  3HOV G;  3CCV A;  4LFC L;  3ULL A;  3B6Y A;  5C44 G;  2IX0 A;  1KL9 A;  4LF8 Q;  2KCT A;  1OXS C;  1U5K A;  1WJJ A;  2I5M X;  4YHH L;  1LUZ A;  4A3B G;  3I4O A;  4JI4 L;  3HOW H;  1HZ9 A;  4PZ8 A;  1VQK A;  3J7A 5;  4UP8 A;  1HNX Q;  1EN7 A;  4LF4 Q;  2N78 A;  4RMF A;  3L0O A;  1GD7 A;  3DM3 A;  4MNO A;  4X66 L;  2BH2 A;  2AWN A;  1JE5 A;  2OWO A;  4OX9 L;  3TS0 A;  3DLL A;  4HIO A;  3HOY G;  4HJ8 A;  1BBU A;  2YTX A;  5LMN Q;  4GLX A;  3GD7 A;  1VQE A;  2Q2U A;  1JJ2 A;  3KLW A;  4GOP C;  1J5E Q;  1TWG H;  4IPC A;  4HJA A;  2Q2T A;  2RCN A;  1UEB A;  5M5X H;  3M9B A;  3J80 c;  2E5L L;  2YTV A;  1JJC B;  4AH6 A;  2OQK A;  3KF6 B;  1QUQ A;  1IBL Q;  4YWL A;  1FL0 A;  4TQU S;  4HJ5 A;  3ERS X;  4LF4 L;  3PUX A;  2Q2H A;  1D8L A;  1J5E L;  2R7Z G;  4A3F G;  3BU2 A;  1BVS A;  1QVF A;  1NTG A;  4GS3 A;  2JA6 H;  1AH9 A;  1YZ6 A;  1KAW A;  1VQA A;  3KDF A;  2DGY A;  3CME A;  2IX1 A;  4AYB E;  1IZ6 A;  3GTP H;  4GLV B;  2WP8 J;  2F52 A;  3HOY H;  1K83 H;  4NXM Q;  1LM0 A;  2JK8 A;  3PUW A;  4BA2 I;  1YBY A;  4DR2 L;  3OYY A;  5ELN A;  2K5H A;  2UU9 Q;  3STB C;  2GN5 A;  4JC0 A;  5BR8 L;  2Z0S A;  1YI2 A;  1XJV A;  4JI2 L;  2B63 H;  1VQF A;  2QA4 A;  3S15 H;  2QNC A;  3NEL A;  3CCJ A;  1ASZ A;  4IFD J;  4YY3 Q;  1HH2 P;  3KF8 B;  4DNI A;  3WWV A;  1YHB A;  2EXD A;  2MFI A;  4A3K G;  1CUK A;  1N33 Q;  1M1K C;  1KRS A;  4JI5 L;  2BA0 A;  1BKB A;  1PHJ A;  2VS1 A;  4JI6 L;  2B63 G;  1KRT A;  3U58 A;  4GLA C;  1N36 Q;  4IPD A;  4DR3 L;  4DKA C;  5BR8 Q;  4NB3 A;  4JYA Q;  2HQL A;  3K7A H;  4LUO A;  2JEA I;  3SGI A;  5C3E G;  2ATW A;  3I4M G;  4DR7 L;  1NMG A;  1S3O A;  1O7I A;  3LGJ A;  4XTC S;  4P72 A;  5C4X H;  5J3B A;  2K52 A;  2ZJQ A;  1BBW A;  1IYJ B;  4A3M G;  4R4C A;  3OTO Q;  2BH8 A;  2JA5 H;  1DGS A;  4DR1 Q;  3HKZ E;  1HJP A;  1LYL A;  5IYB H;  1C9O A;  5IWA L;  3FP9 A;  5AJ3 Q;  1MIU A;  3CCR A;  3HOU G;  5IYD H;  4DV3 L;  1AE3 A;  4O2D A;  3T1Y L;  1VQ5 A;  1FJG L;  1FVI A;  3K0X A;  3PCO B;  1VQ7 A;  4DR6 L;  4B3T L;  1XMQ L;  2K14 A;  2RF4 A;  1NJI C;  1N34 L;  5LMN W;  1VQO A;  4GN4 B;  1Q1B A;  1X6O A;  1N9W A;  1Y14 B;  1PYS B;  4JG2 A;  2WAQ E;  5H1S E;  3RN2 A;  3RR5 A;  4OX9 Q;  3PUZ A;  4A3M H;  4LNQ A;  1A0I A;  3UDX A;  3G4S A;  5C4X G;  3G6E A;  1VQI A;  5DLQ E;  5FLM G;  4A3D G;  1E24 A;  4LWC A;  3RLN A;  3M4O H;  2JEB I;  3S2H H;  4IJH A;  4R1J A;  1A63 A;  4P74 A;  2WAQ G;  1EQR A;  2CWA A;  4IFD G;  2QNF A;  5FLX c;  2UXC Q;  1E22 A;  1E7D A;  1SRU A;  2YTY A;  3S2D H;  3BZC A;  3PUY A;  2Z6K C;  4NXN Q;  1YJ9 A;  1HNZ Q;  1KHI A;  1Y1W H;  2GVA A;  3H15 A;  4JBK A;  1EYG A;  2A19 A;  3I7F A;  2KHJ A;  3PO2 G;  1I6H H;  1VQC A;  4BBS H;  3TRE A;  1I94 L;  3GTM H;  2ZJR A;  2R7Z H;  2NVQ H;  4PZ6 A;  4MTN A;  1UWV A;  3KJP A;  3S1Q H;  3RLF A;  1X56 A;  3J81 i;  3GO5 A;  1MJC A;  3K8A A;  4GNX C;  2R92 G;  1L1O A;  1CKM A;  1UE6 A;  4YCV A;  4JI3 L;  2VQE Q;  4LF6 L;  1N32 L;  4DAM A;  1EIF A;  4MZ9 A;  1L1O B;  3J7Z C;  1AE2 A;  3CPF A;  3TEH B;  1CSQ A;  4LF8 L;  4LW1 A;  1JJG A;  4L5Q A;  2E5L Q;  2FXQ A;  4JI8 Q;  4HID A;  1V43 A;  3PIP A;  3U4V A;  2GVB A;  4DV5 Q;  3CXC A;  1NY4 A;  3GDE A;  2CWP A;  1EUJ A;  1KQS A;  2HIV A;  5IY0 A;  1WOC A;  3CW2 C;  1IL2 A;  4BA1 I;  4BY1 G;  5JJK A;  1NE3 A;  5LMN L;  3S14 H;  1JT8 A;  4R4I A;  1E7Z A;  1Q86 C;  4DV7 Q;  1SN8 A;  3S24 A;  3KF6 A;  1OXX K;  3GTQ H;  2UXD L;  2CKZ B;  1OTC A;  4QL5 A;  1PH5 A;  2HHH L;  1QUQ B;  4DUZ L;  4DUY Q;  1X54 A;  1YHA A;  2JE6 I;  4A3L H;  2R7F A;  1N34 Q;  1XNQ Q;  5M3F H;  1R9T H;  3U4Z A;  4DV2 L;  4KHZ A;  3W1B A;  4GNX A;  3UDI A;  1HNW Q;  1B7Y B;  2IHE A;  1E1T A;  4JV5 Q;  1EQQ A;  1QVG A;  4XIG S;  1Q12 A;  2NZO A;  3GTL H;  1MJE A;  2QEX A;  3U50 C;  4L5R C;  4JOI A;  4A3J H;  1X3F A;  3OW2 A;  4LFB L;  2UUB Q;  4Y52 H;  4L5S A;  1QVC A;  3RZO H;  3ICE A;  2F3I A;  2E2J H;  1QZH A;  4GKK Q;  4A3C H;  2R93 G;  3CCU A;  4J15 A;  1EWI A;  1L0W A;  5M3F G;  4R4Q A;  4BBS G;  4A3J G;  4GKJ Q;  2PI2 E;  4DV1 L;  2LSS A;  3EBE A;  2K5N A;  1TWF H;  2ZJP A;  4LF7 L;  4OON A;  2QGQ A;  4X62 L;  4QIW E;  1L1O C;  4JI6 Q;  4JBJ A;  4X65 L;  3STB D;  5C4J H;  1TWH H;  1HZB A;  3CCE A;  1YHQ A;  1IBK Q;  4PZ7 A;  2YU9 H;  1RIP A;  1N33 L;  2VNU D;  1OXT A;  3M4Q A;  1C0A A;  1K0R A;  2LXJ A;  3ZJY C;  3F2D A;  1XPR A;  1PA6 A;  4JI2 Q;  2JA8 G;  5GAE C;  4TVA B;  2OTL A;  4B3M L;  3HOV H;  3S1M H;  3I55 A;  4JI7 L;  2R7D A;  5GAD C;  4NXM L;  1VQ4 A;  2K5V A;  1UE7 A;  1HR0 W;  3CPW A; 
#chains in the Genus database with same CATH topology
 1STE A;  1PMR A;  2K03 A;  4IUV A;  4YCW A;  1PV4 A;  4LMQ D;  2RHS B;  3DMU A;  3AYH B;  2JA7 H;  4G4K A;  2EXZ A;  2HUG A;  1YVC A;  4P73 A;  4E6I A;  4RGO S;  2F0G A;  5KEE A;  1WTR A;  4GKJ L;  2R7Z H;  1HTL D;  4Y7N B;  2VZA A;  4B3S L;  2ASB A;  2D5D A;  2WAQ B;  1XNR Q;  2UXB Q;  3T53 B;  3C1E A;  3JC6 6;  4KY7 A;  4HJ9 A;  1L0Y B;  4GNX B;  1SYF A;  4CJ2 C;  1XPO A;  3CC2 A;  4DV4 Q;  4DV6 Q;  4KHV A;  4YWK A;  4DR5 Q;  1AFP A;  3NEM A;  3PV0 A;  2VQF L;  1ICF B;  4NXN L;  1V1P A;  4JI1 L;  1K9M C;  1QCB D;  2K04 A;  3LNN A;  4X3S A;  3OSO A;  5C0X G;  1I50 H;  4NKL A;  3D31 A;  1BNZ A;  4A4I A;  2F4I A;  2PYK A;  3BZK A;  4B3R Q;  3R93 A;  5FJ8 G;  4A93 G;  4A3M B;  3SVM A;  1X65 A;  1T5X D;  3MXN B;  4DA2 A;  1K8M A;  2ODG C;  2AWO A;  1CQV A;  2CFM A;  4KI0 A;  4PMB A;  5JVG 3;  4UPA A;  3HZX A;  3PF4 A;  2M9V A;  5BN5 A;  5LMU Q;  3I4M B;  4HSV A;  2Z1C A;  3UE1 A;  2F0W A;  3K5O A;  1E1O A;  4ZKC B;  3HKZ B;  3PO3 B;  5DAU A;  1EQV A;  4JBM A;  4DV3 Q;  1V9P A;  2D62 A;  3KBG A;  3VA5 A;  3T1H L;  1PH8 A;  4NPS A;  4XYQ A;  4N9T A;  3FMC A;  4WRD A;  2PZU A;  4IUT A;  1Y1V G;  5FLX E;  1CSP A;  1ZKO A;  5M3M G;  3Q24 A;  3PO3 G;  3EIV A;  1EU3 A;  1GUG A;  4JOI C;  4DR3 Q;  1X55 A;  2Q2I A;  1BUV T;  1QB5 D;  4DV4 L;  4XDX A;  4H0L C;  5E4X A;  1GXD C;  1LAC A;  1IKM A;  1OXV A;  1W3S A;  1FYC A;  2EYO A;  1QNK A;  4DF7 A;  3I56 A;  1YNX A;  4N8F A;  1GOZ A;  3S16 B;  2V1C C;  4UP7 A;  3H09 A;  5EAY A;  4WJ3 M;  1TII D;  2A6H D;  5EBC A;  1V66 A;  4KK7 A;  3R8B A;  2R92 H;  2OQ0 A;  2O2L D;  2B2T A;  3VR6 A;  3PF5 A;  4JI0 L;  4A3I G;  2KCM A;  5D3I B;  4R4T A;  3FDT A;  1ENA A;  4X65 Q;  2A69 C;  3C46 A;  4DU9 A;  1Z9F A;  1Y1W G;  1TY0 A;  2XSC A;  4S3S A;  4OWT B;  2YU9 B;  4DR2 Q;  1SYG A;  4RA8 A;  3G7L A;  5LMU L;  4Z9C B;  1DON A;  5JEA J;  3RN5 A;  3HOX H;  1CTM A;  5G3L F;  2KBN A;  2ZXO A;  1P8L A;  3K0Y A;  4KHP L;  1CI3 M;  1VQD A;  3NBH B;  1FGU A;  4XXE A;  3I4N H;  5FLM H;  4AYB B;  2PI2 A;  5ISR A;  3HOZ H;  4A3G G;  3KOJ A;  1SE4 A;  2HDM A;  1QE6 A;  4CKC A;  3AQQ A;  1XTD A;  4H7B A;  4X64 L;  1EOV A;  3G48 A;  3N6R A;  2C35 B;  2HHH Q;  3OWF A;  4ME3 A;  4C3J H;  4A3G H;  2H5X A;  5K36 G;  2DY8 A;  4KD3 A;  1EY0 A;  1N36 L;  3I4N G;  3SK5 A;  1IHZ A;  4PG3 A;  2MO0 A;  4OHJ A;  2B2Y A;  4ZRZ A;  4EQO A;  5IP9 G;  4V19 0;  2A1A A;  3E9H A;  4L5T A;  4L6T B;  4C3I H;  2JA7 B;  1H9S A;  3MWY W;  2ZM6 L;  1HFN A;  2NBF A;  4HJ7 A;  3URY A;  4A93 B;  2IW3 A;  3P20 A;  2EZV A;  1I3Q B;  1RJT A;  3HKS A;  4HIM A;  3Q8D A;  3R2I A;  4DFA A;  3FKI H;  3CCS A;  3QWN A;  2XRS D;  3OMG A;  5L37 A;  4A76 A;  3KF8 A;  1ROD A;  1CKN A;  3NHH A;  1T5E A;  5NUC A;  1SNM A;  3HOZ B;  5IYB G;  1B9N A;  4C3H H;  2ODC I;  2MNA A;  4UP9 A;  2K33 A;  4B9X A;  4XT3 B;  4KV6 A;  2SNM A;  4FDB A;  3JAM c;  1VQJ A;  1SJE D;  2O5J C;  1KD1 C;  1SMX A;  2K5W A;  1IBK L;  1HNX L;  5E7N A;  1X3P A;  1H9J A;  1EU4 A;  1NBW A;  2PNH A;  5HGQ A;  2HIX A;  2PW7 A;  4IOC A;  2Z8L A;  3U9O A;  1LTL A;  3I8Z A;  1SNO A;  2D2C C;  2H4O A;  2I5L X;  1JWU D;  1F2Z A;  3H3V H;  2VUM B;  2N49 A;  2HD3 A;  3CRK C;  2VB2 X;  5G3L D;  3CCV A;  3DWQ A;  4LF8 Q;  1HQR D;  4O42 A;  5JVH 3;  4JI4 L;  1HZ9 A;  2K05 A;  3GTM B;  2B2V A;  2B63 B;  4CHT B;  1EY5 A;  2KVE A;  2IL8 A;  4MNO A;  4FO2 A;  4OEL B;  2A6E C;  2B8F A;  1JE5 A;  4OX9 L;  1QG7 A;  3HOY G;  2YTX A;  2NN6 H;  1JJ2 A;  1ONL A;  2F0T A;  1ZYR C;  2Q2T A;  3H94 A;  1UAP A;  1UEB A;  5M5X H;  3J80 c;  1JOQ A;  1JJC B;  4AH6 A;  3KF6 B;  2RQX A;  3P7J A;  1QUQ A;  1IBL Q;  4YWL A;  3LLR A;  2MJ8 A;  3EJI A;  1D1I A;  4LF4 L;  3PUX A;  2Q2H A;  1J5E L;  4KTA A;  2F0F A;  2F0I A;  5KYL A;  5EKK A;  1IZ6 A;  1SNQ A;  3C2P A;  2WP8 J;  1HXY D;  2NTS A;  4NXM Q;  3KBX A;  1LM0 A;  4BA2 I;  4BS9 A;  1F9S A;  3OYY A;  5ELN A;  2UU9 Q;  1EEF D;  3A8K E;  3BG3 A;  4MHE A;  4F88 A;  2XWB B;  4B9W A;  2MGS A;  4YY3 Q;  1HH2 P;  4PNY A;  4DXG A;  1RTN A;  1M4V A;  3MXP A;  4DGZ A;  2F0N A;  2VS1 A;  3AU7 A;  4J8Q A;  3FPU B;  5EPJ A;  4JI6 L;  5I2Y A;  4GLA C;  1XWE A;  4IPD A;  1I4X A;  3A7A B;  4DR3 L;  4DKA C;  1U4M A;  4KMU C;  5E3F A;  1BOS A;  5BR8 Q;  4ZKB B;  2XNA C;  2HQL A;  3K7A H;  1IYV A;  5CIU A;  2RDF A;  5EBD A;  3SGI A;  5HGT A;  1SAP A;  5J3B A;  3HEJ A;  1BBW A;  3OTO Q;  2AUJ D;  4L8J A;  4QMG A;  4C3H B;  1BR9 A;  2ZXP A;  1WCM B;  3CCR A;  1LYL A;  5IYB H;  3FP9 A;  5AJ3 Q;  1SSO A;  4MTK A;  1KDA A;  1FJG L;  1FVI A;  2HDL A;  1TY2 A;  5CV9 A;  1VQ7 A;  4B3T L;  2K14 A;  1NJI C;  1TT2 A;  4ZUI A;  4JG2 A;  2CW0 C;  3RR5 A;  3MZ5 A;  3UDX A;  4PV1 C;  3RMH A;  1E24 A;  4LWC A;  2CH4 A;  2JA5 B;  4IJH A;  1EY7 A;  1EQR A;  2YTY A;  3S2D H;  2Z6K C;  4HN7 A;  2F0S A;  1YJ9 A;  4IQZ A;  1KHI A;  4JBK A;  5JPN C;  1GUN A;  2EY6 A;  3GTM H;  2NVQ H;  1HA6 A;  4MTN A;  1UWV A;  3TBI B;  3RLF A;  1X56 A;  4RGM A;  3GO5 A;  2EYJ A;  1UE6 A;  2VXW A;  4JI3 L;  4IN3 A;  3ERQ A;  3TEH B;  2KHS A;  1CHQ D;  4L5Q A;  1STH A;  3PIP A;  2GVB A;  3CXC A;  1NY4 A;  3GDE A;  2K7V A;  2G9D A;  2CWP A;  3BDC A;  1EY9 A;  3FRP B;  2HIV A;  1IL2 A;  1F9P A;  4BY1 G;  1S5B D;  3S14 H;  1JJR A;  3M4O B;  4R4I A;  4ZQ3 A;  2EY2 A;  1SN8 A;  4ZK9 B;  2BCO A;  3GTQ H;  5K36 H;  1RD9 D;  4R8I A;  3J80 E;  4DUZ L;  3MFY A;  4DUY Q;  2R7F A;  5IGC A;  3IFD A;  2R93 B;  5M3F H;  2J7Z A;  1TWH B;  1SBB B;  4KHZ A;  3W1B A;  1DD2 A;  1B7Y B;  2IHE A;  4IUR A;  1H9R A;  5C3W A;  2NZO A;  1MJE A;  4G7H C;  1X3F A;  2ZXR A;  4Y52 H;  3E3X A;  4L5S A;  3TP8 A;  1JOR A;  3S2H B;  1VMP A;  5FKA C;  2Q8I B;  5M3F G;  1LLR D;  1CQF A;  4R4Q A;  4A3J G;  1ENF A;  2LSS A;  2K5N A;  1TWF H;  2ZJP A;  4LF7 L;  2QGQ A;  2QDB A;  4X62 L;  3RZO B;  1F2L A;  4JBJ A;  3CCE A;  1YHQ A;  1HZB A;  5M9O A;  1BXT A;  1LTA D;  1OXT A;  2Z4I A;  3FEW X;  2LXJ A;  4CDE C;  3F2D A;  5GAE C;  4TVA B;  3BDO A;  3U9S A;  3HOV H;  3H6M A;  5J22 A;  1VQ4 A;  5A2Q L;  4C1N K;  1JOK A;  1XMO L;  3L9A X;  2B2U A;  2UXD Q;  1EIH A;  1U4L A;  4AQY Q;  3PSI A;  2RHQ B;  1IBM L;  5M5Y B;  2EPB A;  1YNN D;  2R3Z A;  1X3E A;  1O7Y A;  3TQY A;  1O80 A;  3HOY B;  3L7Z C;  4A75 A;  1SFO H;  2OTJ A;  3F2B A;  3J81 j;  4IJL A;  5JEA G;  2PQA B;  2PZW A;  2KUM A;  1ZS9 A;  1PH4 A;  4JI0 Q;  2R7Z B;  3CC4 A;  1K83 B;  3QOL A;  3TDQ A;  2BDN A;  2EIF A;  4P75 A;  3T16 A;  1QNU A;  1F77 A;  2I46 A;  3H91 A;  4FXD A;  1VQG A;  3CMA A;  4TKO B;  1K3R A;  2IY5 B;  3TRZ A;  4QY7 A;  1MD2 D;  5FO8 B;  2HCI A;  1QZG A;  5JPM C;  2NN6 I;  3HOW B;  3AFP A;  3NWS A;  2B29 A;  2HJQ A;  1ILQ A;  1B44 D;  1ZXT A;  3M4P A;  4NDX A;  3ULJ A;  2AMC B;  1I50 B;  3RNU A;  1FD7 D;  5LL6 X;  5BN3 A;  5IYD G;  2NVT H;  4HMI A;  1BCP F;  4IOA A;  4PMC A;  3K5L A;  4O1N A;  5JJI A;  1VQ6 A;  2OEO A;  4LF9 L;  4DK6 C;  2K4K A;  2Z9H A;  1XXG A;  1V1P B;  4B3R L;  4IO9 A;  1K8A C;  4C2M H;  1VF7 A;  2EQS A;  1KNE A;  3D6C A;  1XMO Q;  3NP8 A;  3NXW A;  4YHH Q;  4L63 B;  1KTK A;  4EQ5 A;  4DR4 Q;  1NSN S;  3V96 A;  2Z6K A;  2Q8R E;  3VA7 A;  4RCO A;  2JYO A;  4LUZ A;  3BVG A;  1U4P A;  4AYB G;  5EJW A;  3IL8 A;  3AB9 A;  5EKI A;  1PYB A;  3OW7 A;  2C9O A;  4JI1 Q;  1TS3 A;  2JA5 G;  1XPU A;  4BY7 H;  5GQO A;  3NK9 A;  1GUO A;  1S5D D;  1EFW A;  2WB1 G;  3D3R A;  1WCM H;  3J7A F;  2UUB L;  1N32 Q;  1EIY B;  1W2B A;  1X32 A;  4ME5 A;  3CF5 A;  4DPG A;  1DXM A;  2B2W C;  4A3C G;  1MGS A;  2RCF A;  1WTX A;  1E2W A;  2CQO A;  1ET6 A;  4A3K B;  1TWG B;  1CKO A;  1HZC A;  2ICE C;  1EZ8 A;  2WB1 E;  3AEV A;  2IT1 A;  1A2T A;  4IUP A;  3VR4 A;  2M00 A;  3T1H Q;  1GM5 A;  2EOT A;  2K75 A;  1UE1 A;  2KVD A;  4Y7N H;  3CAM A;  4DV7 L;  1TVX A;  1E7L A;  4BY1 B;  3SXH A;  5EPL A;  3TP7 A;  2JJQ A;  4A3I B;  2D0P A;  2I5H A;  1G6P A;  2PQA A;  3DWP A;  2NVX H;  3OHX C;  2JXM B;  2DNC A;  4HR7 B;  1PFN A;  4PQX A;  1FNV A;  1V8Q A;  1R4Q B;  5EPK A;  1KXL A;  3L2P A;  1R4P B;  1EEI D;  2EYH A;  5FJ8 H;  2F0E A;  1H9F A;  5ELC A;  4LF7 Q;  4GN5 A;  1EQT A;  1EYA A;  3EN2 A;  2L5T A;  2RDG A;  3HFZ B;  1HNW L;  1WFQ A;  5M5Y H;  2KEE A;  5ELO A;  4LF5 L;  4H44 C;  3A5U A;  2E2H H;  1BDO A;  3ZYY X;  4DUY L;  2F0O A;  3H0G G;  1HTP A;  4DR6 Q;  1CZW A;  3NQI A;  5HY6 A;  2PZT A;  4HTH A;  2L12 A;  1CM9 A;  2G5D A;  2UXB L;  1XTC D;  2B3G A;  1EY8 A;  1XNQ L;  3KJO A;  1B2T A;  4X6A H;  3OPO A;  2UU9 L;  1J6Q A;  4KD4 A;  1EFI D;  1IBL L;  2JQO A;  3FKI B;  3ND9 A;  1Q1E A;  3R2T A;  3BJU A;  1IW7 D;  1GL9 B;  2F0L A;  4DAY B;  3VYR A;  3F2C A;  2B39 A;  2EYL A;  2Y0S E;  2JA7 G;  4LF6 Q;  3G71 A;  1KIX A;  4BXX G;  3S1N B;  4CDF C;  3I90 A;  2PW5 A;  3FKI G;  3ND8 A;  1YIJ A;  3HOW G;  4ZUJ A;  3SE0 A;  4KKT A;  2VQE L;  1YIT A;  4OO1 H;  4LFC Q;  1K0S A;  3IKJ A;  2L1B A;  5E1F A;  2SDF A;  1B70 B;  3S16 H;  2F3V A;  2Y0S G;  2P5Z X;  1LTI D;  2UUA Q;  4C1N I;  2L9H A;  1CZG A;  5F2D A;  1EOT A;  1GHJ A;  1KL9 A;  1PFB A;  1U5K A;  3QOJ A;  1LUZ A;  1LAB A;  4A3B G;  2F0U A;  2K28 A;  3K5M A;  3EA6 A;  2FMC A;  1HNX Q;  1SMY D;  3DM3 A;  4X66 L;  1VF5 C;  1SE3 A;  3TS0 A;  2FIN B;  4HJ8 A;  4HMJ A;  4GLX A;  1VQE A;  2Q2U A;  4QB4 A;  1WTP A;  2XN9 C;  3MEH A;  5D14 A;  1TS2 A;  4OL7 A;  1NNX A;  3I70 A;  3K5N A;  2L0C A;  5IGB A;  1FL0 A;  1QJO A;  1Q3L A;  3EQL C;  5C5L A;  3MVV A;  1D8L A;  4A3F G;  1A15 A;  1BVS A;  2JA6 H;  1NTG A;  3BYT B;  2DGY A;  4AYB E;  2LC3 A;  1NR4 A;  1EY4 A;  3PUW A;  5CV7 A;  2PPB C;  2K5H A;  2MPM A;  2DJF C;  5KYI A;  4JI2 L;  1VQF A;  3S15 H;  4DK0 A;  4IFD J;  4DNI A;  1YHB A;  3OIP A;  2SEB D;  4A3K G;  3VR5 A;  3SDZ A;  1M1K C;  3TME A;  1KRS A;  1BKB A;  1PHJ A;  3GV6 A;  2B63 G;  1KRT A;  3U58 A;  1O7Z A;  1UUP A;  4NB3 A;  4ABN A;  4U68 A;  4JYA Q;  4DR7 L;  3D4R A;  3LGJ A;  1A3U A;  3MC0 B;  1IYJ B;  1G6Z A;  3HKZ E;  3KK7 A;  4YIJ A;  1HJP A;  1DCZ A;  5IWA L;  2PMZ B;  5IYD H;  4X3T A;  4O2D A;  1ICW A;  3K0X A;  2JVW A;  1DZ1 A;  3PCO B;  3WOF A;  3A55 A;  3SR1 A;  3D8G A;  3OOC A;  5M5X B;  1HCZ A;  1BO0 A;  3RN2 A;  1D5Z C;  1WTQ A;  4LNQ A;  3G6E A;  1VQI A;  1S5C D;  4BY7 B;  3M4O H;  3S14 B;  1LT4 D;  2JEB I;  4R1J A;  2J0T D;  2IJ0 A;  1AP0 A;  5J39 A;  2UXC Q;  1E22 A;  1E7D A;  1SRU A;  3PUY A;  4NXN Q;  3E6Z X;  2KFV A;  2PNR C;  3H15 A;  1EYG A;  2A19 A;  3PO2 G;  1PZK D;  3T4A C;  4HAE A;  5CR3 A;  4JW0 A;  2ZJR A;  5DEH A;  3S1Q H;  1SDF A;  3J81 i;  1MJC A;  5TSS A;  1B4O A;  1CKM A;  2LS0 1;  4DAM A;  1EIF A;  4MZ9 A;  4TSS A;  4IFD H;  3CPF A;  1CSQ A;  1LT5 D;  3SK6 A;  4FF3 A;  1JJG A;  2E5L Q;  2FXQ A;  4JI8 Q;  1V43 A;  2A68 C;  1A6X A;  4DXF A;  3J7Y W;  1JT8 A;  1NE3 A;  1E7Z A;  4DK1 A;  4P2C B;  3KF6 A;  3TP6 A;  2J4X A;  2EY5 A;  1OTC A;  2O5I C;  2A5H A;  2Z6B A;  1TQO A;  1HPC A;  1YHA A;  2B2T C;  4A3L H;  3QB3 A;  3R3O A;  5CV4 A;  1J9O A;  1XNQ Q;  3U4Z A;  3I72 A;  4DV2 L;  1HNW Q;  4KJO A;  3P75 A;  5DNF A;  1EQQ A;  1QVG A;  2QDL A;  5C3E B;  2QEX A;  3U50 C;  4B08 A;  3ERO A;  5ELF A;  2CVR A;  4X3K A;  1QZH A;  2A74 C;  3S1Q B;  4FF1 A;  2NB0 A;  3ONA B;  1EWI A;  1L0W A;  1CA5 A;  4BBS G;  1RKN A;  2PI2 E;  5JAV A;  3EBE A;  3RUZ A;  1CK1 A;  1CA6 A;  4OON A;  5ELD A;  4DAV A;  4X65 L;  5C4J H;  1WTH A;  3DM1 A;  4PZ7 A;  4R8N A;  4KN7 C;  2YU9 H;  1N33 L;  1A2U A;  3VR3 A;  4HED A;  3NE5 B;  3CU7 A;  3CQZ B;  1K0R A;  3ZJY C;  2G80 A;  2OTL A;  1R9T B;  3A7L A;  3W3A A;  4A3F B;  4NXM L;  1HR0 W;  4LF9 Q;  3PQI A;  2KHI A;  2VW9 A;  1MKH A;  5IGG A;  1PFS A;  2ZTE A;  1S5E D;  1W6K A;  4FXK C;  1II3 A;  1Y69 U;  2UUC L;  4B3S Q;  2ES2 A;  2R6G A;  1OXU A;  4IUU A;  1SND A;  1VQN A;  4IFD I;  4C3J B;  2KVU A;  4X64 Q;  1WD0 A;  3JAM i;  4V0B A;  3GTG B;  1Y1V H;  2PMZ E;  1Q82 C;  3H0G H;  3W5O A;  2ID0 A;  3VYS A;  5COY A;  1KDB A;  1I5F A;  3J81 c;  4DV6 L;  1YNJ D;  3D0F A;  3HOZ G;  3HP3 A;  3J81 L;  1JC7 A;  2CQA A;  4M1U B;  2F0M A;  2HCC A;  5C0X J;  4Q0F A;  2ZM6 Q;  1M8A A;  3MEF A;  4EQN A;  3GTK H;  2EYM A;  3UDF A;  2QW7 A;  4GN3 B;  1GVP A;  2EVB A;  1VQ8 A;  3PGZ A;  5C4H A;  5IE8 A;  2EYP A;  3C1F A;  5T1G A;  4A3B H;  2VQF Q;  2OCE A;  4RGT A;  3HOX B;  1SYD A;  2EJF C;  1D6E C;  2NVX B;  3HKZ G;  2WB1 B;  3HRZ C;  2WQG A;  4BBR B;  1G2S A;  3TSS A;  2ALY B;  2G9H D;  1SE2 A;  1WYD A;  3KDF B;  5C0X I;  3HOV B;  5FLX L;  4K0K L;  1MBY A;  2JP1 A;  5I9P A;  4B3T Q;  3MFG A;  4G57 A;  3S17 B;  1PTO B;  1IW7 C;  1Q46 A;  2I07 B;  3UE0 A;  2N3S A;  1MSG A;  1EWH A;  2LMC B;  5C44 H;  1VQM A;  4PMW A;  5IT9 c;  1A3V A;  2DNE A;  3OIQ A;  1K28 A;  1E2V A;  3ER0 A;  3CD6 A;  4UZW A;  4J6H A;  3OWE B;  4BIT A;  1B1Z A;  4N9P A;  4OWW B;  3RLO A;  4N8X 1;  3QJY A;  1ESF A;  4JI7 Q;  4JYA L;  2NYZ D;  1S40 A;  4DK3 C;  1SE8 A;  1G51 A;  4YCU A;  1HR0 Q;  3I4M H;  1K8G A;  1UE5 A;  1STA A;  1STN A;  3CC7 A;  4OEM B;  1IXR A;  4QJF A;  5DM7 3;  1E2Z A;  3PO3 H;  1NUC A;  3KUP A;  3F8T A;  1BCP C;  1WVL A;  4GKK L;  1RF2 D;  4ID6 A;  1SNP A;  3I2Z A;  3KLR A;  4RKB A;  3UDG A;  4A3F H;  2JA6 G;  2SNS A;  3NBI A;  1ASY A;  1PFM A;  2K01 A;  4BBR H;  2KJX A;  3S1N H;  4OIK A;  4DR1 L;  1LTG D;  2WII B;  3GTQ B;  2E8G A;  4JI8 L;  4A3G B;  3HOU B;  2ZTC A;  3A0J A;  4GOP A;  1LTB D;  3CCQ A;  1GKH A;  1STY A;  3A8J E;  1V1Q A;  2F0K A;  1FR3 A;  3TZU A;  4GOP B;  1PVO A;  1XMQ Q;  1KAB A;  1WTO A;  2CH4 W;  5IOC A;  4HIK A;  3IRB A;  4CDC C;  4RHS A;  3IFT A;  1U0L A;  2IHF A;  1E0B A;  2HQE A;  4HCE A;  2B2V C;  1VS0 A;  5COR A;  5KIX A;  2VUM H;  3HOX G;  1JE4 A;  1HNZ L;  2XVS A;  1G2T A;  5M5W B;  3GV3 A;  1F2Y A;  1S72 A;  3T1Y Q;  3K80 C;  3M85 A;  3ITP A;  4X66 Q;  4IUQ A;  5C3X A;  5LL6 S;  4AIM A;  1KLG D;  1I6H B;  1RCV D;  3M3Y H;  4OO1 G;  2D0O A;  1A8V A;  3I91 A;  4GZY C;  4UDU C;  3K6O A;  2ENB A;  4OO1 I;  2LD7 A;  3VDY A;  1XYI A;  2VY3 A;  3F1Z A;  4POF A;  1WD1 A;  4KKS A;  4XQQ A;  1ML0 D;  4K5V A;  1PXU A;  1XNR L;  1AZP A;  3NEN A;  3K57 A;  4IAL A;  5GAH C;  1VCI A;  4APV A;  1VQL A;  2NVY H;  2JA9 A;  4RKL A;  3TN2 A;  1FJG Q;  5KNB A;  4R4O A;  4XQN A;  3PUV A;  5IWA Q;  1Q8K A;  1YJW A;  1F9Q A;  5IGF A;  3A74 A;  2VL6 A;  4DV5 L;  1WI5 A;  4JBW A;  4UAI A;  5KGU A;  3Q23 A;  1PRT B;  3EVQ A;  2A8V A;  1T9H A;  3QIA A;  1Z7T A;  5IYC G;  4LUV A;  1AEX A;  3A5Z B;  3GTJ H;  2F4V L;  2LFN A;  1F2M A;  1H95 A;  1SRO A;  2RNN A;  4DR7 Q;  1WCM G;  2XGT A;  4JPB W;  3PIO 3;  2FHT A;  2TMP A;  3S1R H;  3V05 A;  1MI2 A;  1AW7 A;  5EGT A;  3AFQ A;  3PIP 3;  3NTK A;  2BDO A;  1GHK A;  1I4R A;  1WTW A;  4QQB X;  1PTO C;  1KHC A;  5GAG C;  3KFU A;  2WFW A;  2B2W A;  5KRU A;  4LFB Q;  2JA6 B;  4LF5 Q;  1QOH A;  5M3M H;  2QF7 A;  4DV1 Q;  3HOV G;  1RHP A;  4LFC L;  5IOD A;  3B6Y A;  2IX0 A;  1TS5 A;  5A35 A;  1X3Q A;  5C6A A;  3GP7 A;  1OXS C;  1TU2 B;  1Y1W B;  2I5M X;  2QIL A;  2XIW A;  3HOW H;  1TWC B;  1A3T A;  3T51 B;  3J7A 5;  2NVT B;  3QR8 A;  3L0O A;  1GD7 A;  2BH2 A;  2AWN A;  2OWO A;  1BBU A;  1SXT A;  5I9O A;  4GOP C;  3NUC A;  4IPC A;  3NSW A;  4HJA A;  1K8O A;  3SHL A;  3RZD B;  2B2Y C;  3A56 A;  5I2X A;  3L3O C;  1YNJ C;  4HJ5 A;  1EZ6 A;  2R7Z G;  4KHP Q;  1AH9 A;  3BU2 A;  3M3Y B;  3G6J B;  2KCN A;  1HFG A;  1KAW A;  1S4Z A;  3KDF A;  4DN4 M;  3CME A;  3F2U A;  2EY1 A;  4GLV B;  1U9R A;  2F52 A;  1LTR D;  4FYD A;  5IGE A;  4ZAI A;  4DR2 L;  1TWF B;  2EE1 A;  5BR8 L;  2Z0S A;  5K5P A;  1XJV A;  3CCJ A;  1ASZ A;  3KF8 B;  3WWV A;  1CUK A;  4JI5 L;  4ZYS A;  1HA5 A;  1N36 Q;  4K8I A;  5CV5 A;  1D5M C;  4LUO A;  2VB3 X;  2JEA I;  2X69 A;  2ATW A;  2KOL A;  1NMG A;  2F03 A;  1FGB D;  5FOB B;  2K52 A;  2IWH A;  4X3U A;  4C3I B;  4MN3 A;  1PZJ D;  4A3M G;  1IYU A;  1GJX A;  5IIF A;  1DGS A;  2JA5 H;  4DR1 Q;  3BVM A;  2A69 D;  5IGD A;  1C9O A;  5M3F B;  1MIU A;  4DV3 L;  2WV6 D;  1AE3 A;  1PRT C;  3GQB A;  1VQ5 A;  3MXG A;  5C5M A;  4DR6 L;  1Y8N B;  3VYT A;  4C3I G;  4FNF A;  1VQO A;  1TKW B;  4GN4 B;  1Q1B A;  2KQ3 A;  2A73 B;  2DJG C;  1X6O A;  1N9W A;  1Y14 B;  2WAQ E;  5CV6 A;  1VDZ A;  1A0I A;  5C4X G;  5DLQ E;  4A3D G;  3A54 A;  1H9M A;  3RLN A;  1A63 A;  1H9K A;  1FNU A;  4IFD G;  2L11 A;  3MTS A;  5FLX c;  1W6J A;  3KLS A;  3BZC A;  3DEO A;  1Y1W H;  2GVA A;  1J8I A;  2K5D A;  5AFW A;  1PYW D;  3N52 A;  4BBS H;  3TRE A;  1I94 L;  5IT9 L;  4PZ6 A;  3KJP A;  2EJM A;  4GNX C;  2TSS A;  3K8A A;  2R92 G;  5T1I A;  1L1O A;  4IZ8 A;  1LT6 D;  4QF4 A;  2VQE Q;  1JEI A;  1PZI D;  1JQY D;  1AE2 A;  4H13 C;  3M7G A;  4LF8 L;  4LW1 A;  1WTV A;  1SJH D;  4J1M A;  4HID A;  3E0J A;  1SFO B;  4DV5 Q;  4I65 A;  3S1R B;  5I4D A;  1YNN C;  2NWG A;  5BN4 A;  1WOC A;  4NW2 A;  3BYY B;  4BA1 I;  5CMD A;  5LMN L;  1JCK B;  2F3W A;  1HQM C;  4OIJ A;  3S24 A;  1STB A;  1OXX K;  4QL5 A;  3QG1 A;  1QUQ B;  4K5W A;  4UHV A;  4EVO A;  1N34 Q;  1UNS A;  1R9T H;  1SNC A;  4GNX A;  3UDI A;  2EYF A;  2PCF B;  4JV5 Q;  1IKL A;  4I7Z C;  4FP5 D;  1DM0 B;  3GTL H;  1GUW A;  1JIC A;  4A3E B;  4A3J H;  3I4L A;  3OW2 A;  4Q5V A;  3WDN A;  5JJZ A;  1EL0 A;  1Y02 A;  2E2J H;  4DNT B;  4A3C H;  2R93 G;  2A68 D;  3NTH A;  1CFM A;  4FF2 A;  4DV1 L;  1FNW A;  3FLG A;  1DYQ A;  5D3D A;  1V1O A;  1BCP B;  3SEB A;  3STB D;  1TWH H;  3J7A V;  1ET9 A;  4G7Z C;  4JVZ A;  1JEQ A;  1JOO A;  1XPR A;  1PA6 A;  2JA8 G;  5CC4 A;  3S1M B;  4B3M L;  3IAY A;  3S1M H;  3I55 A;  4JI7 L;  4A3D B;  2H1E A;  2FFK B;  1UE7 A;  3M4Y A;  3EFX D;  5KNC A;  2ZTD A;  1G29 1;  1L2F A;  1LV9 A;  1AZQ A;  1BF4 A;  2RNO A;  4BY1 H;  2DK4 A;  1OO9 B;  4BBR G;  5AJ3 L;  3E9I A;  3J80 i;  1PRT D;  4A3L G;  5IP7 G;  5CV8 A;  4AQY L;  1SYE A;  1I6V C;  1ZYR D;  4F7X A;  5JJL A;  3QO2 A;  3PO2 H;  2LKV A;  2MP1 A;  1NCV A;  1EWC A;  1GKU B;  4IPH A;  1E3P A;  1B53 A;  2F0J A;  1PDQ A;  2KVM A;  4NP5 A;  4DV0 Q;  1DOK A;  4UY8 C;  4BBS B;  3I73 A;  1Q81 C;  4ALP A;  4XT1 B;  2DN8 A;  2WAC A;  3S17 H;  2XTI A;  1PH3 A;  2F0P A;  3GTG H;  4K2L A;  4RH6 A;  1KAA A;  1PH7 A;  5C44 B;  2PO4 A;  1EYC A;  4FF4 A;  1QWY A;  1PLF A;  5EQ0 A;  4B3M Q;  4A3K H;  2R92 B;  1D2B A;  3Q6S A;  4WJW A;  3E0E A;  3S2D B;  3NTI A;  4CKB A;  2F0D A;  1M90 C;  2UXC L;  3D6W A;  2BE5 C;  5DM6 3;  4POG A;  4C3J G;  4QUC A;  1VQH A;  5E4W C;  4KLK A;  1LO5 D;  1PH2 A;  5JOB A;  1C7Y A;  3FHW A;  1BQQ T;  1JB3 A;  4TRD A;  5EKL A;  5M5W H;  4DR4 L;  1TS4 A;  4RG1 A;  1D7Q A;  1HZA A;  4NMZ A;  3CQZ H;  2RBM A;  1SR3 A;  4BXX H;  5IP9 H;  1GUS A;  3J80 L;  2MO1 A;  4A3E G;  2NN6 G;  1CKN B;  1BCP D;  2ZT9 C;  2WIN B;  4K6D A;  1BBX C;  2L55 A;  3Q0A A;  4OGQ C;  4A3E H;  3ULP A;  2CCZ A;  2JSO A;  3M7N A;  1A62 A;  1LTS D;  5CBA E;  3KYH C;  1KNA A;  4JI4 Q;  1PRT F;  5GRO A;  4DUZ Q;  3HOU H;  3BVZ A;  4CJ0 B;  2NTT A;  1PH9 A;  1F9R A;  1N8R C;  3O13 A;  4EX5 A;  4DAP A;  2DY7 A;  4K6L A;  4YWM A;  1JMC A;  2KEN A;  4ULL A;  4IUN A;  4X62 Q;  2RDH A;  3CKI B;  1IL8 A;  3DUZ A;  2F0H A;  3E5S A;  5IYC H;  3MXU A;  1RL2 A;  5I6W A;  1H9S B;  1C4Q A;  1X9N A;  1QIL A;  2F0Q A;  4WFN 3;  4YY3 L;  4K0K Q;  2MQH A;  4DV0 L;  2E74 C;  2AUK A;  1Y8P B;  1MHW C;  1O78 A;  1PH6 A;  4DR5 L;  2IX3 A;  1DJR D;  2K5Q A;  2V4D A;  2YYZ A;  3LWE A;  2RA4 A;  5HUR A;  2YV5 A;  1TWA H;  1HR0 L;  4QGU A;  3K81 C;  2RVL A;  3VYU A;  1IBM Q;  2A6E D;  3S9W A;  5FK9 C;  1STG A;  4JCV E;  1JWS D;  3OTO L;  3W1G A;  1G8Z D;  3FVQ A;  1CT1 D;  5FO9 B;  3I4N B;  4RGN A;  4QUF A;  2X6G A;  1B8A A;  4F8M A;  3HS0 C;  1HHV A;  1YNS A;  5M3M B;  3QKJ A;  4FVM A;  5D65 A;  3CHB D;  4RHR A;  4DV2 Q;  2K1B A;  1B50 A;  1X3G A;  4KN4 C;  2NZH A;  1I4P A;  2JA8 H;  1TWC H;  4HSP A;  1U4R A;  1VQB A;  4K14 A;  2RSN A;  4O0A A;  3A8I E;  4XQJ A;  4P71 A;  1K73 C;  1EY6 A;  5C0X H;  2WKD A;  2N8N A;  3H3V I;  2UUC Q;  3TS2 A;  4K8J A;  2IPK D;  1XX8 A;  5C3E H;  1TXY A;  1JB7 A;  5IP7 H;  3UI2 A;  4I7A A;  3KLS X;  1YEZ A;  4JI3 Q;  3PMF A;  4JI5 Q;  3D4W A;  1DOL A;  2HT1 A;  1GO3 E;  4JV5 L;  4BY7 G;  4OXP A;  3GTO H;  1HUM A;  2AQ3 B;  3T56 B;  4EQP A;  4WJ4 A;  1VQ9 A;  3BDL A;  4A3I H;  4DNR B;  3VR2 A;  1L0X B;  3P1H A;  1Q7Y C;  3CCM A;  2M2L A;  1SLJ A;  2VUM G;  2L15 A;  4QIW B;  4LFA Q;  2D9U A;  5KND A;  4RWS C;  3JAM E;  1PH1 A;  4H02 A;  4OWX B;  1NMF A;  1VQP A;  3LX0 A;  1P16 A;  3CP0 A;  3NPP A;  2AQ2 B;  2XWJ B;  4MIU A;  2K50 A;  2AQ1 B;  4ILW A;  2C5C A;  5CBE E;  2KED A;  4IPG A;  3GTL B;  2EJG C;  3I3C A;  4CKE A;  3AMU A;  3C3L A;  3JAM L;  4KJN A;  4LAA A;  1PTO F;  1B9M A;  2DUD A;  3K7U C;  4JK1 C;  4C56 C;  2Y0S B;  4XYO A;  3Q22 A;  2QKI C;  2E2I H;  3RD4 A;  3T13 A;  2EDG A;  3NWT A;  4U67 3;  2BA1 A;  4A93 H;  1HUN A;  4K2K A;  2R93 H;  3CCL A;  3NQT A;  1SMY C;  2LXK A;  2X6L A;  3RZD H;  1YJN A;  4R9W A;  3D4D A;  2RSO A;  2AHO B;  1I3Q H;  2JN4 A;  4LFA L;  4A3B B;  2UUA L;  4CDD C;  1I4H A;  1TWA B;  2I0Q A;  2AKW B;  2F4V Q;  1I94 Q;  1Z47 A;  1KC8 C;  4A3D H;  3PIO A;  3ULL A;  5C44 G;  2A6H C;  3V2T A;  1Y8O B;  2KCT A;  3NBH A;  1WJJ A;  2FJ2 A;  4YHH L;  2MUY A;  2PQE A;  3I4O A;  2E75 C;  4G7O C;  4PZ8 A;  1VQK A;  1GJJ A;  4UP8 A;  1EN7 A;  4LF4 Q;  2KEC A;  2N78 A;  2MHV A;  4RMF A;  1PTO H;  1H9E A;  5JEA H;  3DLL A;  4HIO A;  5J1Z A;  1C8C A;  5ELE A;  3PO2 B;  5LMN Q;  3GD7 A;  3KLW A;  1J5E Q;  1B3A A;  1MSH A;  2OT2 A;  1TWG H;  1JR0 D;  2RCN A;  1JWM D;  3DEP A;  3M9B A;  4C3H G;  2E5L L;  2YTV A;  2OQK A;  2NUC A;  2KW9 A;  4TQU S;  3MHB A;  1D5X C;  3ERS X;  2LY7 A;  1QVF A;  4GS3 A;  1YZ6 A;  1VQA A;  4BWG B;  2IX1 A;  3GTP H;  1KDC A;  5CYU A;  3GTJ B;  5FO7 B;  4RAU C;  4DAY A;  2KA7 A;  3HOY H;  1K83 H;  2JK8 A;  4HCS A;  2R61 A;  2F0V A;  1YBY A;  2B8G A;  3H3V C;  3STB C;  2GN5 A;  4JC0 A;  1CHP D;  1YI2 A;  2B63 H;  5CGK A;  2QA4 A;  2BE5 D;  5C4J B;  2QNC A;  3NEL A;  1VMC A;  2SOB A;  3K7A B;  2CHB D;  2MFI A;  2EXD A;  1N33 Q;  2BA0 A;  2CW0 D;  1SEB D;  3BS1 A;  5IT9 E;  1G91 A;  2QEJ C;  4ZLT F;  2NVY B;  1C48 A;  1I4G A;  1RTO A;  5C3E G;  3I4M G;  1S3O A;  1O7I A;  5C4X B;  4XTC S;  2O4X A;  4P72 A;  5C4X H;  2ZJQ A;  4EGV A;  4R4C A;  2BH8 A;  4WOR A;  2Q8T A;  1Q90 A;  3TZD A;  2E2H B;  1I4Q A;  3HOU G;  3S15 B;  2L4N A;  2N88 A;  3T1Y L;  2NZ1 D;  3HGB A;  1LTT D;  5C4Z A;  1Y1V B;  1XMQ L;  2RF4 A;  3BZD B;  3SK4 A;  1N34 L;  5LMN W;  1H1J S;  4QCL A;  1PYS B;  3WOE A;  3GTO B;  5H1S E;  3DWA A;  4OX9 Q;  1NR2 A;  3PUZ A;  4A3M H;  3G4S A;  1RDP D;  1UEA B;  5FLM G;  3DHQ A;  3S2H H;  4ODG A;  4C2M B;  3GTK B;  4P74 A;  2WAQ G;  2CWA A;  1AN8 A;  2NVQ B;  2QNF A;  4CGY B;  1ILP A;  1KLU D;  2QCP X;  1HNZ Q;  5A2Q E;  2K6A A;  4K5X A;  2N55 A;  2XRQ D;  3X3N A;  3I7F A;  2KHJ A;  3CRL C;  1SYB A;  1Z6H A;  1VQC A;  2E76 C;  2F1M A;  1I6H H;  1NAP A;  4CJ1 B;  3MAQ A;  3TP5 A;  3FPP A;  4YCV A;  4LF6 L;  1N32 L;  4KKU A;  4M8A A;  4A3J B;  2BOS A;  1L1O B;  3J7Z C;  1ESR A;  1O7L A;  2E2J B;  4ZCK A;  2FMM A;  4RFB A;  3LWU A;  1K3B C;  3MXN A;  3U4V A;  2E2I B;  1EUJ A;  1KQS A;  5IY0 A;  3CW2 C;  4FXG C;  3X3M A;  3K59 A;  5JJK A;  1SYC A;  2WKC A;  1Q86 C;  2JA8 B;  1GUT A;  4DV7 Q;  2UXD L;  1B3Q A;  2CKZ B;  1PH5 A;  1EIG A;  2HHH L;  3K58 A;  2ICI A;  1ZBH A;  1X54 A;  2JE6 I;  2KCC A;  3DXJ C;  5LHY 1;  4LK1 C;  2K32 A;  2MPH A;  1E1T A;  2E2D C;  1HRJ A;  1TR5 A;  1Q12 A;  4XIG S;  5I6Y A;  3HG9 A;  4L5R C;  4JOI A;  4KY5 A;  1LT3 D;  4LFB L;  2UUB Q;  1QVC A;  3W2D A;  3RZO H;  2GA4 B;  3ICE A;  2F3I A;  4F87 A;  4GKK Q;  4KY6 A;  3CCU A;  2RKS A;  4J15 A;  2OF1 A;  4CBV A;  1DOM A;  4GKJ Q;  1ZEQ X;  1Q8I A;  3J81 E;  4QIW E;  1L1O C;  4JI6 Q;  2B2U C;  1IBK Q;  1PTO D;  1RIP A;  5ELB A;  4RCN A;  1S5F D;  1ENC A;  2VNU D;  3SK8 A;  3M4Q A;  3H0G B;  1C0A A;  4LJZ C;  4JI2 Q;  3MA2 B;  1EYD A;  2OXP A;  3GTP B;  2R7D A;  2Z4H A;  5GAD C;  2W51 A;  2K5V A;  3OMC A;  3CPW A;  1D1K A; 
#chains in the Genus database with same CATH homology
 2ZTD A;  1XMO L;  1G29 1;  1L2F A;  2KHI A;  2VW9 A;  1MKH A;  2UXD Q;  4AQY Q;  4YCW A;  1PV4 A;  4BY1 H;  2DK4 A;  1PFS A;  2RHS B;  2ZTE A;  3PSI A;  2RHQ B;  3AYH B;  4BBR G;  5AJ3 L;  1IBM L;  2JA7 H;  3E9I A;  3J80 i;  4A3L G;  1YVC A;  5IP7 G;  4P73 A;  4AQY L;  1X3E A;  3TQY A;  2ES2 A;  2R6G A;  2UUC L;  4B3S Q;  1OXU A;  3L7Z C;  4A75 A;  1SFO H;  1VQN A;  2OTJ A;  4IFD I;  5JJL A;  4X64 Q;  3PO2 H;  4GKJ L;  3JAM i;  3F2B A;  1Y1V H;  2PMZ E;  4IJL A;  3H0G H;  3J81 j;  5JEA G;  1Q82 C;  2VZA A;  4B3S L;  2ASB A;  3W5O A;  1GKU B;  2ID0 A;  1E3P A;  4IPH A;  1XNR Q;  2UXB Q;  4DV0 Q;  2PQA B;  1I5F A;  4LF9 Q;  4UY8 C;  3J81 c;  4DV6 L;  1ZS9 A;  3JC6 6;  3D0F A;  1Q81 C;  3HOZ G;  4HJ9 A;  4ALP A;  1PH4 A;  4JI0 Q;  3S17 H;  2XTI A;  4GNX B;  1PH3 A;  3GTG H;  1XPO A;  3CC4 A;  3CC2 A;  4DV4 Q;  1PH7 A;  4DV6 Q;  5C0X J;  2EIF A;  4YWK A;  4DR5 Q;  4P75 A;  2ZM6 Q;  4B3M Q;  3MEF A;  3NEM A;  3GTK H;  3PV0 A;  2VQF L;  4A3K H;  3UDF A;  1VQG A;  4GN3 B;  1GVP A;  4NXN L;  1K3R A;  3CMA A;  3E0E A;  4JI1 L;  4QY7 A;  3TRZ A;  1K9M C;  1VQ8 A;  2IY5 B;  3PGZ A;  5IE8 A;  1QZG A;  1M90 C;  4A3B H;  2VQF Q;  2UXC L;  2NN6 I;  2OCE A;  5C0X G;  1I50 H;  3AFP A;  4POG A;  3D31 A;  1VQH A;  4A4I A;  4KLK A;  2B29 A;  3BZK A;  2HJQ A;  4B3R Q;  1PH2 A;  3HKZ G;  5FJ8 G;  1C7Y A;  3FHW A;  4A93 G;  3M4P A;  3ULJ A;  2AMC B;  5M5W H;  4DR4 L;  1X65 A;  3MXN B;  1HZA A;  4RG1 A;  1D7Q A;  1KXL A;  3CQZ H;  2ODG C;  2ALY B;  1SR3 A;  2AWO A;  2CFM A;  4KI0 A;  3RNU A;  4BXX H;  5IP9 H;  2MO1 A;  1WYD A;  3KDF B;  2NN6 G;  5IYD G;  4UPA A;  5C0X I;  4A3E G;  5LMU Q;  1CKN B;  2NVT H;  3PF4 A;  4IOA A;  4K0K L;  3UE1 A;  4B3T Q;  5JJI A;  1E1O A;  1VQ6 A;  1Q46 A;  3UE0 A;  2N3S A;  4LF9 L;  4DK6 C;  4JBM A;  2K4K A;  1V9P A;  2D62 A;  4DV3 Q;  4A3E H;  4B3R L;  3ULP A;  4IO9 A;  3T1H L;  5C44 H;  1VQM A;  4PMW A;  1PH8 A;  5IT9 c;  2CCZ A;  1A62 A;  4NPS A;  4C2M H;  1K8A C;  3M7N A;  3KYH C;  3ER0 A;  4JI4 Q;  2EQS A;  3CD6 A;  1XMO Q;  5GRO A;  4YHH Q;  4DUZ Q;  3HOU H;  4OWW B;  1Y1V G;  3RLO A;  4EQ5 A;  1CSP A;  1PH9 A;  4DR4 Q;  5M3M G;  1N8R C;  2Z6K A;  4JI7 Q;  3EIV A;  4EX5 A;  3PO3 G;  4JYA L;  4LUZ A;  1S40 A;  4YWM A;  4DK3 C;  4JOI C;  2KEN A;  4DR3 Q;  1SE8 A;  1JMC A;  1X55 A;  4AYB G;  2Q2I A;  1G51 A;  4X62 Q;  4YCU A;  1HR0 Q;  3I4M H;  1K8G A;  4DV4 L;  1UE5 A;  1PYB A;  5IYC H;  1RL2 A;  1OXV A;  3CC7 A;  1IXR A;  1W3S A;  4QJF A;  3PO3 H;  4JI1 Q;  3F8T A;  3I56 A;  1X9N A;  1XPU A;  2JA5 G;  4YY3 L;  4BY7 H;  1YNX A;  5GQO A;  2MQH A;  4DV0 L;  4K0K Q;  4GKK L;  1EFW A;  2V1C C;  2WB1 G;  4UP7 A;  4KHP Q;  5EAY A;  1PH6 A;  4DR5 L;  4WJ3 M;  1WCM H;  2UUB L;  3I2Z A;  2R92 H;  1N32 Q;  3UDG A;  2YYZ A;  2OQ0 A;  4A3F H;  1EIY B;  2JA6 G;  1ASY A;  1W2B A;  4BBR H;  3PF5 A;  2YV5 A;  4JI0 L;  4A3I G;  2KCM A;  4DPG A;  3CF5 A;  1TWA H;  4R4T A;  1HR0 L;  4QGU A;  3K81 C;  4X65 Q;  4A3C G;  3S1N H;  2CQO A;  1Z9F A;  1Y1W G;  1IBM Q;  4DR1 L;  4OWT B;  4JCV E;  3OTO L;  4DR2 Q;  2E8G A;  1CKO A;  1HZC A;  4JI8 L;  3W1G A;  2ZTC A;  3A0J A;  5LMU L;  2WB1 E;  4GOP A;  5JEA J;  3CCQ A;  1GKH A;  3HOX H;  3RN5 A;  3AEV A;  2IT1 A;  1B8A A;  2KBN A;  1V1Q A;  3T1H Q;  1P8L A;  4GOP B;  1PVO A;  1XMQ Q;  4KHP L;  1GM5 A;  1YNS A;  1VQD A;  4HIK A;  3IRB A;  2K75 A;  3NBH B;  1UE1 A;  4Y7N H;  1FGU A;  1U0L A;  2IHF A;  3CAM A;  5FLM H;  4DV7 L;  2PI2 A;  1E7L A;  4DV2 Q;  3I4N H;  3HOZ H;  3KOJ A;  4A3G G;  1X3G A;  2JJQ A;  2NZH A;  2D0P A;  2I5H A;  2JA8 H;  2PQA A;  1TWC H;  2NVX H;  1VQB A;  1G6P A;  1VS0 A;  4O0A A;  3AQQ A;  2VUM H;  1XTD A;  4P71 A;  4X64 L;  1EOV A;  3G48 A;  3HOX G;  1K73 C;  1HNZ L;  2C35 B;  2HHH Q;  2N8N A;  4ME3 A;  4C3J H;  3H3V I;  4A3G H;  1S72 A;  2UUC Q;  3TS2 A;  3L2P A;  3T1Y Q;  3K80 C;  2H5X A;  3M85 A;  5K36 G;  4X66 Q;  4AIM A;  1TXY A;  5C3E H;  5IP7 H;  1JB7 A;  5FJ8 H;  3M3Y H;  4OO1 G;  2D0O A;  1A8V A;  1N36 L;  1H9F A;  3I4N G;  4PG3 A;  1YEZ A;  4JI3 Q;  2MO0 A;  4GN5 A;  4LF7 Q;  4OO1 I;  2LD7 A;  3EN2 A;  4JI5 Q;  3VDY A;  2HT1 A;  1GO3 E;  5IP9 G;  4JV5 L;  2VY3 A;  4BY7 G;  3F1Z A;  4POF A;  4OXP A;  3GTO H;  3HFZ B;  2A1A A;  1HNW L;  1WFQ A;  3E9H A;  4L5T A;  4C3I H;  4WJ4 A;  5M5Y H;  1XNR L;  2ZM6 L;  5ELO A;  1VQ9 A;  4A3I H;  4LF5 L;  3A5U A;  3NEN A;  4HJ7 A;  1Q7Y C;  5GAH C;  3CCM A;  1VCI A;  4APV A;  1VQL A;  2E2H H;  4DUY L;  1SLJ A;  3H0G G;  2NVY H;  3HKS A;  4HIM A;  4DR6 Q;  3Q8D A;  2JA9 A;  5HY6 A;  2L15 A;  2VUM G;  4LFA Q;  1FJG Q;  3FKI H;  4R4O A;  3CCS A;  1PH1 A;  4H02 A;  3PUV A;  5IWA Q;  2UXB L;  1Q8K A;  2B3G A;  4OWX B;  4A76 A;  1YJW A;  1XNQ L;  1NMF A;  3KJO A;  1VQP A;  4X6A H;  2UU9 L;  1P16 A;  3A74 A;  3CP0 A;  1J6Q A;  1CKN A;  2VL6 A;  4DV5 L;  1IBL L;  1WI5 A;  2K50 A;  4JBW A;  2JQO A;  2A8V A;  1Q1E A;  1T9H A;  4IPG A;  5IYB G;  3BJU A;  4C3H H;  1GL9 B;  5IYC G;  2ODC I;  2MNA A;  4UP9 A;  4DAY B;  4LUV A;  3F2C A;  3A5Z B;  2JA7 G;  2Y0S E;  3GTJ H;  4LF6 Q;  2F4V L;  3G71 A;  4FDB A;  3JAM c;  1KIX A;  4BXX G;  1VQJ A;  2DUD A;  3K7U C;  1H95 A;  1KD1 C;  1SRO A;  1SMX A;  1IBK L;  4DR7 Q;  1WCM G;  2XGT A;  1HNX L;  3S1R H;  5E7N A;  2E2I H;  3FKI G;  4A93 H;  2BA1 A;  1NBW A;  1YIJ A;  3AFQ A;  2R93 H;  3CCL A;  2PNH A;  5HGQ A;  2LXK A;  2HIX A;  1YJN A;  3RZD H;  3HOW G;  2VQE L;  4IOC A;  1YIT A;  2AHO B;  1I3Q H;  4LFC Q;  1LTL A;  4LFA L;  4QQB X;  2UUA L;  2I0Q A;  1B70 B;  2AKW B;  5GAG C;  2I5L X;  3KFU A;  2F4V Q;  1I94 Q;  3S16 H;  2WFW A;  4LFB Q;  2Y0S G;  1Z47 A;  3H3V H;  4LF5 Q;  2N49 A;  5M3M H;  1KC8 C;  2UUA Q;  4A3D H;  4DV1 Q;  3PIO A;  3HOV G;  3CCV A;  4LFC L;  3ULL A;  3B6Y A;  5C44 G;  2IX0 A;  1KL9 A;  4LF8 Q;  2KCT A;  1OXS C;  1U5K A;  1WJJ A;  2I5M X;  4YHH L;  1LUZ A;  4A3B G;  3I4O A;  4JI4 L;  3HOW H;  1HZ9 A;  4PZ8 A;  1VQK A;  3J7A 5;  1GJJ A;  4UP8 A;  1HNX Q;  1EN7 A;  4LF4 Q;  2N78 A;  4RMF A;  3L0O A;  1GD7 A;  3DM3 A;  4MNO A;  4X66 L;  2BH2 A;  2AWN A;  1JE5 A;  2OWO A;  1H9E A;  3TS0 A;  4OX9 L;  3DLL A;  4HIO A;  3HOY G;  4HJ8 A;  1BBU A;  2YTX A;  5LMN Q;  4GLX A;  3GD7 A;  1VQE A;  2Q2U A;  1JJ2 A;  3KLW A;  4GOP C;  1J5E Q;  1TWG H;  4IPC A;  4HJA A;  2Q2T A;  2RCN A;  1UEB A;  5M5X H;  3M9B A;  3J80 c;  2E5L L;  2YTV A;  1JJC B;  4AH6 A;  2OQK A;  3KF6 B;  1QUQ A;  1IBL Q;  4YWL A;  1FL0 A;  4TQU S;  4HJ5 A;  3ERS X;  4LF4 L;  3PUX A;  2Q2H A;  1D8L A;  1J5E L;  2R7Z G;  4A3F G;  3BU2 A;  1BVS A;  1QVF A;  1NTG A;  4GS3 A;  2JA6 H;  1AH9 A;  1YZ6 A;  1KAW A;  1VQA A;  3KDF A;  2DGY A;  3CME A;  2IX1 A;  4AYB E;  1IZ6 A;  3GTP H;  2LC3 A;  4GLV B;  2WP8 J;  2F52 A;  3HOY H;  1K83 H;  4NXM Q;  1LM0 A;  2JK8 A;  3PUW A;  4BA2 I;  1YBY A;  4DR2 L;  3OYY A;  5ELN A;  2K5H A;  2UU9 Q;  3STB C;  2GN5 A;  4JC0 A;  5BR8 L;  2Z0S A;  1YI2 A;  1XJV A;  4JI2 L;  2B63 H;  1VQF A;  2QA4 A;  3S15 H;  2QNC A;  3NEL A;  3CCJ A;  1ASZ A;  4IFD J;  4YY3 Q;  1HH2 P;  3KF8 B;  4DNI A;  3WWV A;  1YHB A;  2EXD A;  2MFI A;  4A3K G;  1CUK A;  1N33 Q;  1M1K C;  1KRS A;  4JI5 L;  2BA0 A;  1BKB A;  1PHJ A;  2VS1 A;  4JI6 L;  2B63 G;  1KRT A;  3U58 A;  4GLA C;  1N36 Q;  4IPD A;  4DR3 L;  4DKA C;  5BR8 Q;  4NB3 A;  4JYA Q;  2HQL A;  3K7A H;  4LUO A;  2JEA I;  3SGI A;  5C3E G;  2ATW A;  3I4M G;  4DR7 L;  1NMG A;  1S3O A;  1O7I A;  3LGJ A;  4XTC S;  4P72 A;  5C4X H;  5J3B A;  2K52 A;  2ZJQ A;  1BBW A;  1IYJ B;  4A3M G;  4R4C A;  3OTO Q;  2BH8 A;  2JA5 H;  1DGS A;  4DR1 Q;  3HKZ E;  1HJP A;  1LYL A;  5IYB H;  1C9O A;  5IWA L;  3FP9 A;  5AJ3 Q;  1MIU A;  3CCR A;  3HOU G;  5IYD H;  4DV3 L;  1AE3 A;  4O2D A;  3T1Y L;  1VQ5 A;  1FJG L;  1FVI A;  3K0X A;  3PCO B;  1VQ7 A;  4DR6 L;  4B3T L;  1XMQ L;  2K14 A;  2RF4 A;  1NJI C;  1N34 L;  5LMN W;  1VQO A;  4GN4 B;  1Q1B A;  1X6O A;  1N9W A;  1Y14 B;  1PYS B;  4JG2 A;  2WAQ E;  5H1S E;  3RN2 A;  3RR5 A;  4OX9 Q;  3PUZ A;  4A3M H;  4LNQ A;  1A0I A;  3UDX A;  3G4S A;  5C4X G;  3G6E A;  1VQI A;  5DLQ E;  5FLM G;  4A3D G;  1E24 A;  4LWC A;  3RLN A;  3M4O H;  2JEB I;  3S2H H;  4IJH A;  4R1J A;  1A63 A;  4P74 A;  2WAQ G;  1EQR A;  2CWA A;  4IFD G;  2QNF A;  5FLX c;  2UXC Q;  1E22 A;  1E7D A;  1SRU A;  2YTY A;  3S2D H;  3BZC A;  3PUY A;  2Z6K C;  4NXN Q;  1YJ9 A;  1HNZ Q;  1KHI A;  2KFV A;  1Y1W H;  2GVA A;  3H15 A;  4JBK A;  1EYG A;  2A19 A;  3I7F A;  2KHJ A;  3PO2 G;  1I6H H;  1VQC A;  4BBS H;  3TRE A;  1I94 L;  3GTM H;  2ZJR A;  2R7Z H;  2NVQ H;  4PZ6 A;  4MTN A;  1UWV A;  3KJP A;  3S1Q H;  3RLF A;  1X56 A;  3J81 i;  3GO5 A;  1MJC A;  3K8A A;  4GNX C;  2R92 G;  1L1O A;  1CKM A;  1UE6 A;  4YCV A;  4JI3 L;  2VQE Q;  4LF6 L;  1N32 L;  4DAM A;  1JEI A;  1EIF A;  4MZ9 A;  1L1O B;  3J7Z C;  1AE2 A;  3CPF A;  3TEH B;  1CSQ A;  4LF8 L;  4LW1 A;  1JJG A;  4L5Q A;  2E5L Q;  2FXQ A;  4JI8 Q;  4HID A;  1V43 A;  3PIP A;  3U4V A;  2GVB A;  4DV5 Q;  3CXC A;  1NY4 A;  3GDE A;  2CWP A;  1EUJ A;  1KQS A;  2HIV A;  5IY0 A;  1WOC A;  3CW2 C;  1IL2 A;  4BA1 I;  4BY1 G;  5JJK A;  1NE3 A;  5LMN L;  3S14 H;  1JT8 A;  4R4I A;  1E7Z A;  1Q86 C;  4DV7 Q;  1SN8 A;  3S24 A;  3KF6 A;  1OXX K;  3GTQ H;  2UXD L;  2CKZ B;  1OTC A;  4QL5 A;  1PH5 A;  2HHH L;  1QUQ B;  4DUZ L;  4DUY Q;  1X54 A;  1YHA A;  2JE6 I;  4A3L H;  2R7F A;  1N34 Q;  1XNQ Q;  5M3F H;  1R9T H;  3U4Z A;  2MPH A;  4DV2 L;  4KHZ A;  3W1B A;  4GNX A;  3UDI A;  1HNW Q;  1B7Y B;  2IHE A;  1E1T A;  4JV5 Q;  1EQQ A;  1QVG A;  4XIG S;  1Q12 A;  2NZO A;  3GTL H;  1MJE A;  2QEX A;  3U50 C;  4L5R C;  4JOI A;  4A3J H;  1X3F A;  3OW2 A;  4LFB L;  2UUB Q;  4Y52 H;  4L5S A;  1QVC A;  3RZO H;  1Y02 A;  2F3I A;  2E2J H;  3ICE A;  1QZH A;  4GKK Q;  4A3C H;  2R93 G;  3CCU A;  4J15 A;  1EWI A;  1L0W A;  5M3F G;  4R4Q A;  4BBS G;  4A3J G;  4GKJ Q;  2PI2 E;  4DV1 L;  2LSS A;  3EBE A;  2K5N A;  1TWF H;  2ZJP A;  4LF7 L;  4OON A;  2QGQ A;  4X62 L;  4QIW E;  1L1O C;  4JI6 Q;  4JBJ A;  4X65 L;  3STB D;  5C4J H;  1TWH H;  1HZB A;  3CCE A;  1YHQ A;  1IBK Q;  4PZ7 A;  2YU9 H;  1RIP A;  1N33 L;  2VNU D;  1OXT A;  3M4Q A;  1C0A A;  1K0R A;  2LXJ A;  3ZJY C;  3F2D A;  1XPR A;  1PA6 A;  2G80 A;  4JI2 Q;  5GAE C;  2JA8 G;  4TVA B;  2OTL A;  4B3M L;  3HOV H;  3S1M H;  3I55 A;  4JI7 L;  2R7D A;  5GAD C;  4NXM L;  2W51 A;  1VQ4 A;  2K5V A;  1UE7 A;  1HR0 W;  3CPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...