2A8VA

Rho transcription termination factor/rna complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
118
structure length
118
Chain Sequence
MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*CP*CP*C)-3'
publication title The structural basis for terminator recognition by the Rho transcription termination factor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein/rna
total genus 33
structure length 118
sequence length 118
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07498 Rho_N Rho termination factor, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.10 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 2a8vA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2a8vA02
4OO1G 1K0RA 4YY3L 4MNOA 4YCVA 2E2JH 1EUJA 4L5QA 2JA7G 2UXDL 1UE1A 4JG2A 2D0OA 2MO1A 1YBYA 2WB1G 4HJ5A 3BJUA 5FLXc 3CCUA 4DV0Q 1EFWA 3CW2C 3I55A 1N36L 4MTNA 4A93G 5GAEC 1HZCA 1N34Q 2AMCB 4KHZA 2ASBA 3BZCA 3CQZH 1KAWA 1PH7A 2F4VL 2AWNA 4HIDA 1VQIA 1VQNA 4A3FG 2ZTCA 1YEZA 4X65L 4DAMA 2QGQA 3GTMH 2B29A 3KJOA 1QUQA 1V43A 3A5ZB 5JEAJ 1PYBA 3NBHB 3UDXA 5C4JH 4GNXA 3GTGH 4A3DG 1E22A 1IBKL 3S2DH 1VQBA 4GN5A 1EQRA 3TQYA 1X3GA 4GN4B 1B8AA 3KDFB 1KQSA 3RLNA 4A3JG 5FJ8H 2NZOA 4YHHQ 2QNFA 1LYLA 1TWHH 1AH9A 2B3GA 4DKAC 4LW1A 1UE5A 2JA9A 1IBLQ 3U50C 2R92G 1B7YB 2CCZA 1HZAA 2I5LX 5IYCG 3CCQA 3ICEA 3PO2H 2DGYA 1K8GA 3PGZA 2ATWA 4BBSG 3OTOQ 3NELA 2EQSA 1YJ9A 1XJVA 4GNXC 2K50A 1E7ZA 1TWFH 4C2MH 1WOCA 3F2CA 3J80c 4DV4Q 5IY0A 1A62A 5IP7H 4YHHL 1J5EQ 4JYAQ 3GTJH 1VQPA 4JBKA 1VCIA 1J6QA 1SE8A 3STBD 5C0XI 3HOXG 2OQ0A 3GD7A 3J7ZC 2KCMA 1OXVA 4IFDJ 4ALPA 5M3FH 5H1SE 3H3VI 4IOAA 2KCTA 1HZBA 4MZ9A 5LMNW 3J80i 5JJKA 3OTOL 2QEXA 4LWCA 3KDFA 4JI8Q 2K75A 2MQHA 2D62A 1VQ4A 4AIMA 4EQ5A 2GN5A 3S1RH 3K7AH 3CAMA 3FHWA 1WCMG 1C9OA 3F8TA 1J5EL 3M4PA 1VQFA 3PCOB 1NTGA 2HQLA 4JBMA 2YU9H 4LF4Q 4A3LG 4JYAL 1FL0A 3E9IA 5IP9H 2HT1A 3CCLA 2I5MX 4OONA 1SFOH 4A4IA 3PUZA 1H95A 4B3SQ 1X56A 2A1AA 1A8VA 1YI2A 3NEMA 2L15A 4IPHA 2OWOA 1LM0A 3TRZA 1Q46A 4DUZL 3GTLH 1P8LA 4JI8L 1AE3A 1V9PA 1E24A 3I2ZA 4JCVE 1YHQA 4A76A 3M3YH 4XIGS 2NN6I 3CMAA 4JV5Q 2BH8A 1X6OA 2I0QA 4UP9A 5BR8Q 5GAGC 3J81j 1KRTA 4LF4L 2R7ZH 5JEAG 3AEVA 3S17H 4GKJQ 1QZGA 1K73C 2LXJA 2ES2A 1XNQL 4IPDA 3KYHC 1PH4A 4C3JH 4OO1I 4B3SL 5K36G 1Q86C 4DR1Q 2UUBQ 4IJHA 4OWWB 1VQ6A 2UUCL 3AFPA 4QQBX 1EWIA 1MKHA 1EQQA 4BA2I 1CSPA 1Y14B 2ZJRA 4BY7G 2XTIA 2RF4A 1VQ8A 2R93G 3PO2G 1N33L 4B3RQ 1SROA 2Q2UA 3U4VA 2D0PA 3TEHB 2AHOB 2VS1A 4HIKA 4NPSA 5GADC 3HOVG 3M7NA 4K0KQ 3BZKA 1QZHA 1KD1C 3EBEA 4R4IA 2VY3A 3PO3G 4GKJL 4YWLA 3M9BA 3E0EA 2K5HA 3I4MG 4WJ3M 3W1BA 3NENA 3LGJA 5IP7G 1SRUA 4A3BH 3HOYG 4DNIA 2IHFA 4DUYL 2ZJQA 2RHSB 3RZOH 4Y7NH 3K81C 4DR1L 1C7YA 4DV2Q 5HGQA 2UUBL 2IX1A 2VUMH 2HIVA 4P73A 2F4VQ 4LUZA 2VW9A 4PMWA 3S15H 3OYYA 3DM3A 4GS3A 4X65Q 4B3RL 1VQAA 1XMQQ 1PH9A 2B63H 2BH2A 4X66Q 4P72A 2MFIA 1XNRL 4K0KL 1KHIA 4JI3L 3CP0A 4IFDG 4R4QA 1XPRA 1IBKQ 1HR0Q 1CSQA 1NE3A 2N78A 4HJAA 4L5TA 3PIPA 1M1KC 3W1GA 1HNXL 2HIXA 1EIYB 4BY7H 1X9NA 3CCJA 3HOUH 1PVOA 4DV2L 3GTKH 2ID0A 4FDBA 1Y1WG 1C0AA 1UEBA 2N3SA 2Q2TA 2ALYB 1X54A 3A74A 2RCNA 2VZAA 4POFA 4R4TA 3G4SA 1XMQL 1AE2A 4NXML 2PI2E 4X66L 1VQLA 1SN8A 5M5XH 3KLWA 2CWPA 2BA0A 4O2DA 3T1YQ 1I94Q 4KLKA 1YHBA 3CPWA 1T9HA 1HR0L 2WFWA 4JI2Q 3PV0A 1I50H 4A3KH 4LUVA 1Q1BA 2K5NA 2RHQB 3GO5A 3HOZG 1LTLA 1X55A 1E1TA 2YTXA 3I4NG 2WP8J 3RR5A 1Q7YC 3L7ZC 2CKZB 1SLJA 2IX0A 2Z6KA 2GVAA 3AYHB 1VQ9A 3GTQH 4GLAC 4DR4Q 1YNXA 1YVCA 4X62L 2LXKA 5JJIA 3S2HH 3PSIA 3CCEA 2AWOA 4KHPQ 3RN2A 3G71A 4RMFA 3T1YL 1I94L 4UPAA 1I6HH 3I56A 1FVIA 3ULPA 4PZ7A 4JI2L 3CCVA 4A3IH 3GTOH 1CKMA 3H3VH 2DUDA 3SGIA 3K7UC 1Q81C 1EOVA 1OXSC 2JK8A 1A0IA 5C3EH 3CCSA 1I3QH 4BY1H 1Y1VH 3F1ZA 3F2BA 2E2HH 4A3GG 2KHIA 4DR4L 4IPCA 3CC4A 4BXXH 4R1JA 4JI5Q 1HNWQ 2Z6KC 3AQQA 2UXCQ 3B6YA 1JJGA 4DV6L 1TXYA 4KHPL 1N32L 4A3CH 4XTCS 4YCWA 1JMCA 1E1OA 5IE8A 1Q1EA 4GN3B 3UE0A 3K8AA 2YTVA 5M3MH 4DUZQ 3CC2A 1KL9A 2ZJPA 3CD6A 1B70B 5IYBH 2IY5B 5IT9c 3RLOA 1FJGQ 1JT8A 3I7FA 2JA6H 3CC7A 3CF5A 3FP9A 2VQFQ 2ZM6Q 1XNQQ 1YZ6A 4JOIA 5C44H 1IXRA 3RZDH 1G51A 4JI5L 1VQCA 3CXCA 4DK6C 4LNQA 2NZHA 1RL2A 1X3EA 4DV3Q 2K4KA 3TREA 5FLMH 1YITA 1K9MC 1QVFA 2UXCL 3IRBA 2JA8H 2CFMA 5IYDH 2UUCQ 3PUVA 2YTYA 1HNWL 4WJ4A 4DV5Q 1HH2P 2KHJA 3UE1A 2QNCA 1N33Q 3F2DA 1RIPA 1WJJA 1NY4A 2NVQH 1W3SA 4BA1I 3J7A5 1G6PA 1FJGL 2PI2A 2EXDA 3M4OH 2QA4A 3GDEA 5M5YH 1WFQA 2WAQE 3KOJA 4LF8Q 5GQOA 2VQFL 2ZM6L 1QVCA 3OW2A 2CWAA 5FJ8G 4TVAB 1XPOA 4DR6L 4DV3L 3S14H 4DUYQ 1CKOA 1YJNA 4IFDI 4JOIC 4A3FH 1PFSA 4BBRH 1SMXA 1PHJA 4B3MQ 4LF6Q 4PG3A 2XGTA 4DV5L 1GKHA 3FKIH 1HNZL 4HIMA 4A3LH 2K14A 4X64Q 3D31A 2JA5H 4JI0Q 2FXQA 3RNUA 1N8RC 1KIXA 1IBMQ 4LF7Q 3KFUA 1PH5A 1XNRQ 4A3DH 4HJ7A 4R4OA 4JI3Q 1VS0A 4DR3L 5LMNL 4A3MH 1MJCA 1XTDA 4A3IG 2OTLA 4LFCQ 4LF8L 3S16H 1M90C 2JE6I 5IWAQ 2Y0SE 1VQDA 1NBWA 4A3JH 1HNXQ 4OXPA 2NVTH 4O0AA 2PMZE 2YV5A 3CCRA 1CUKA 1VQHA 1WYDA 4H02A 2A8VA 2KBNA 1L2FA 1E7LA 4B3ML 4LF6L 2VL6A 5IYCH 3PIOA 3I4OA 4DR2L 5M3FG 3HOWH 3JC66 3TS2A 2NVYH 2JQOA 3S24A 4DPGA 4X64L 4JI0L 4NXMQ 1IBML 4LF7L 4P75A 2VQEQ 1UE7A 4LFCL 4YWMA 3CCMA 4C3HH 4HJ9A 2JA6G 3STBC 5IWAL 1BBWA 1K83H 2Z0SA 3G6EA 4HJ8A 1WI5A 5IP9G 5C44G 1MIUA 2V1CC 2NN6G 2E5LQ 1UE6A 1PH8A 2JJQA 1BKBA 3W5OA 5GAHC 4JI7L 3EIVA 1V1QA 1OTCA 3ER0A 4X62Q 2EIFA 2PQAB 1NMGA 1S72A 4DK3C 2UU9Q 2VQEL 3PUXA 1PYSB 4QL5A 2ZTEA 2IHEA 4DV7L 4LF9Q 2VNUD 4JI6Q 4NXNQ 3ULJA 1OXTA 1GM5A 2H5XA 3D0FA 1WCMH 4QJFA 4L5RC 4B3TL 4AYBG 4NB3A 4JI4Q 1R9TH 4AH6A 2R7ZG 2WB1E 1TWCH 4X6AH 1NMFA 1X65A 4AYBE 2E5LL 2NVXH 2YYZA 3EN2A 1YIJA 1PV4A 1GD7A 2F52A 5C0XJ 4DV1L 1L1OB 4UP8A 4BBRG 3UDFA 4EX5A 1S3OA 4DV6Q 2F3IA 3U58A 1QVGA 3M85A 1HZ9A 4PZ8A 2UU9L 4LFBQ 4JBJA 3FKIG 4JC0A 1N32Q 4GOPB 5J3BA 1IL2A 2OCEA 4LF9L 3E9HA 4QY7A 3T1HQ 1HJPA 2GVBA 2R7DA 1ASZA 4P74A 4NXNL 2JA5G 4JI6L 1XMOQ 5M5WH 2UXBQ 4OX9Q 1BBUA 3PF4A 4A3MG 1EN7A 1O7IA 4DV0L 1Q12A 4JI4L 2OTJA 1TWAH 4OWTB 5E7NA 1N34L 1GO3E 2PQAA 4A3BG 4UP7A 3KF6B 1P16A 4PZ6A 4DR7Q 3DLLA 5LMUQ 4GLXA 2N8NA 2VUMG 4LFAQ 3J81c 2R93H 3L2PA 3PF5A 4L5SA 5GROA 1VQMA 3CPFA 3HOWG 1JJCB 1K3RA 4LFBL 1YJWA 4Y52H 3AFQA 2N49A 3HKZG 3H15A 3T1HL 3K0XA 4IJLA 1I5FA 1FGUA 4YWKA 1MJEA 2B63G 1XMOL 3HOVH 2UXBL 1CKNB 4OX9L 3S1QH 3HKZE 3HFZB 4OWXB 2R6GA 3PO3H 3BU2A 1PA6A 4UY8C 3K80C 4APVA 3L0OA 3J81i 2C35B 2IT1A 1JJ2A 2R92H 3I4MH 1IYJB 3H0GH 2OQKA 1L1OA 4RG1A 3JAMc 3VDYA 1VQJA 3HOYH 1Z47A 5ELNA 4R4CA 3MEFA 2I5HA 4A3EH 4P71A 1U5KA 4GOPA 4DR7L 5LMUL 3PUYA 4ME3A 3HOUG 1IBLL 4IO9A 4LFAL 2ZTDA 4JI1Q 5JJLA 2BA1A 4JBWA 5C4XH 1S40A 2PNHA 3U4ZA 3A5UA 5AJ3Q 3JAMi 1HNZQ 2K5VA 3UDIA 2MNAA 2Q2HA 4YCUA 1YHAA 2JA7H 1DGSA 4DR5Q 2WAQG 2JEAI 4KI0A 1KC8C 2R7FA 3KF6A 4DR3Q 1PH3A 5LMNQ 4A3KG 1BVSA 3S1MH 1A63A 3Q8DA 4DV4L 1NJIC 3KJPA 1G291 4C3IH 4A93H 1OXXK 1D7QA 4IOCA 1L1OC 1LUZA 5EAYA 1U0LA 4LF5Q 4GKKQ 1Y1WH 1UWVA 4JI1L 1N9WA 1CKNA 4GOPC 4A75A 5AJ3L 4DR2Q 1Q8KA 1EIFA 3RN5A 2HHHQ 2LSSA 3ERSX 1K8AC 2MO0A 2E2IH 4DR5L 1E3PA 1PH6A 4GLVB 4QGUA 1EYGA 5C0XG 3PUWA 4DR6Q 4J15A 2Y0SG 3HKSA 5HY6A 4QIWE 1Z9FA 3HOZH 5ELOA 5C3EG 3I4NH 1D8LA 4BY1G 1JB7A 1Y1VG 4LF5L 4GKKL 2AKWB 2Q2IA 1VQEA 3CMEA 2UUAQ 3A0JA 3GTPH 3KF8B 1VQ7A 4BXXG 3S1NH 2KENA 4JI7Q 1PH2A 3G48A 3WWVA 1HR0W 2HHHL 4AQYQ 3MXNB 3UDGA 1ASYA 1VQ5A 4BBSH 3ZJYC 3RLFA 3M4QA 4YY3Q 2CQOA 5M3MG 1SR3A 4DV7Q 4JV5L 2UXDQ 1XPUA 1L0WA 5BR8L 4IPGA 3ULLA 5IYBG 5DLQE 1QUQB 4LUOA 1KRSA 4TQUS 3H0GG 1W2BA 4GNXB 1Q82C 2E8GA 4B3TQ 4A3GH 1IZ6A 1N36Q 4A3EG 2UUAL 3TS0A 2JEBI 1OXUA 3HOXH 1VQOA 4A3CG 1VQKA 2HJQA 4HIOA 5FLMG 4POGA 1KXLA 1GVPA 4DV1Q 1TWGH 1X3FA 2A19A 4AQYL 1VQGA 4DAYB 5IYDG 1PH1A 2K52A 2JA8G 5C4XG 1JE5A 1E7DA
chains in the Genus database with same CATH superfamily
4OO1G 1EOTA 4V0BA 1UE1A 2MJ8A 2N88A 4HSPA 5C3EB 4WORA 2K32A 5FLXc 2QILA 2E2HB 1JR0D 3CW2C 3FDTA 1N34Q 2ZXPA 4KHZA 4CJ0B 3BZCA 1PTOD 3J7AV 1SEBD 4IURA 4LJZC 1IW7D 1EY5A 3NP8A 4X65L 3J81L 2O5JC 2KFVA 3NBHB 4EQNA 2OF1A 2I46A 4GNXA 4A3DG 1AW7A 1IBKL 3KUPA 4GN5A 1EQRA 4XT1B 3TQYA 1X3GA 3NTKA 2D2CC 1HFNA 1T5XD 2RNOA 1K3BC 5FJ8H 4YHHQ 5K36H 4KY7A 4DKAC 4LW1A 2JA8B 2EY5A 2DY7A 3BYYB 2CCZA 3CCQA 3PO2H 2XSCA 1I4RA 2NVQB 2ATWA 4BBSG 4KD3A 4A93B 1WOCA 1CM9A 3TMEA 3J80c 1AFPA 3SK6A 5IP7H 5EBDA 4JBKA 1UEAB 3X3MA 1K28A 3NBHA 3H94A 3HOXG 3J7ZC 4HMJA 1TS3A 1D6EC 4ALPA 3H3VI 2O4XA 5JJKA 2XWBB 2QEXA 1NR2A 1R4QB 4JI8Q 1EZ6A 3FLGA 1G2SA 3S1RH 3FHWA 4HEDA 3EQLC 3ITPA 3VYSA 3EFXD 2K05A 3E9IA 2I5MX 2WQGA 2EYPA 2Z9HA 3QR8A 4IPHA 3Q22A 3D4DA 1LV9A 3D6CA 1ZS9A 1AE3A 1V9PA 4KK7A 5HURA 1YHQA 4FP5D 1D5XC 4JV5Q 4UP9A 1K83B 5GAGC 3VA5A 1PTOC 1CTMA 1RJTA 1IW7C 1QILA 4IPDA 5CV9A 4OO1I 1F2ZA 2JYOA 1FNVA 5JJZA 4DR1Q 2UUBQ 1KLUD 4OWWB 3GQBA 2Z6BA 1PRTB 3AFPA 1MKHA 4BA2I 2R93G 1EEFD 1N33L 1SROA 4OIJA 3U4VA 1D2BA 2VS1A 2PPBC 5GADC 5CGKA 3BZKA 1KD1C 2KA7A 3EBEA 2N55A 4R4IA 1PRTF 1TWCB 2QEJC 3M9BA 3E0EA 1RD9D 3W1BA 3TBIB 4XYQA 3S1MH 1C7YA 2IX1A 1CA6A 2HIVA 3P75A 3D6WA 4LUZA 2E74C 5ISRA 4X65Q 4GS3A 2B63H 1II3A 1O7ZA 2FINB 1DCZA 3OHXC 1PLFA 1XPRA 1IBKQ 4FF1A 2N78A 2QDBA 2F0GA 2OEOA 3VR2A 4DNTB 2F0TA 1M1KC 1TWHB 2HIXA 1EIYB 1B4OA 3ZYYX 1STEA 4BY7H 1SYFA 3HOUH 3OSOA 4DV2L 2NUCA 4FDBA 1Y1WG 1C0AA 2Z8LA 1B9MA 5D3IB 3IL8A 1VDZA 2IPKD 2DY8A 3G4SA 2VB3X 4X66L 1VQLA 1SN8A 3D4WA 4O2DA 1I94Q 3PO3B 4K5VA 1STNA 3P1HA 3H0GB 2K5NA 4HR7B 2BE5C 3MWYW 2MHVA 1SYEA 3HOYB 3I4NG 4IUQA 1BDOA 2CKZB 1SLJA 2Z6KA 2GVAA 3K5OA 4QUFA 4X62L 1SYBA 4N8X1 2A6ED 2NZ1D 2AWOA 4KHPQ 2GA4B 3RN2A 3G71A 2JA7B 2Q8RE 5COYA 3MFGA 3I56A 2CQAA 4R8NA 4JVZA 1CKMA 1A6XA 3QJYA 3K7UC 1Q81C 1EOVA 1A0IA 4X3TA 3CHBD 4A3GG 3F2BA 2V4DA 4BXXH 2LC3A 2UXCQ 3EA6A 1N32L 1JMCA 1E1OA 2B2WA 1H9MA 5M3MH 5A35A 2ZJPA 1B70B 3J81E 2MP1A 5IYBH 3D3RA 4IQZA 1V1OA 1WTQA 4CBVA 4ZAIA 3VR6A 4RHSA 2NN6H 4JI5L 1VQCA 1VMPA 3CXCA 3S15H 2F0DA 4FF3A 2TSSA 1HA6A 4WJ4A 1N33Q 3J7YW 1LTBD 1I4QA 1IYVA 3KBXA 4LF8Q 2QDLA 2ZM6L 2AUKA 4X3SA 5C4HA 1QVCA 3OW2A 4Y7NB 5KYLA 5FJ8G 4TVAB 1GUSA 4DR6L 2RVLA 4JOIC 3K5LA 1PFSA 4BBRH 1SMXA 2WIIB 1PHJA 5KRUA 1EIHA 4K14A 1HNZL 3PMFA 1YNND 4A3LH 4X64Q 2JA5H 1RTOA 1N8RC 4LF7Q 3BVZA 5EPKA 4R4OA 2JSOA 5LMNL 1XTDA 3TDQA 4LFCQ 1H1JS 2A6EC 5DM73 5I2XA 5EQ0A 3D4RA 3R3OA 1L2FA 1S5DD 2Z1CA 3GTMB 3PIOA 2RSNA 3JC66 1K8MA 2NVYH 4S3SA 4DPGA 4JI0L 3GTGB 4K5XA 3HEJA 2ZT9C 2VQEQ 4ID6A 1ZYRD 4KY6A 5LL6S 4YWMA 3CCMA 4FXGC 1BBWA 1G91A 2Z0SA 2AQ2B 4L6TB 1UE6A 5GAHC 1UNSA 4JI7L 4K6DA 2K28A 4IUPA 4X62Q 1NMGA 3K5NA 1A3UA 2EJFC 4QL5A 5EKKA 1U4MA 4NXNQ 3ULJA 4C2MB 3EJIA 2PMZB 3D0FA 1WCMH 2F4IA 3QB3A 2WKDA 1LT6D 1WVLA 4B3TL 1JOQA 2WB1E 2OT2A 4R9WA 3GTJB 3NXWA 2IX3A 4NDXA 4RA8A 2X69A 1GD7A 4RCNA 5C0XJ 1B50A 1L1OB 1S3OA 2EDGA 1N32Q 1HZ9A 4PZ8A 4LFBQ 3FKIG 1HPCA 1GJXA 4GOPB 5J3BA 2EY1A 4LF9L 1BBUA 3VR4A 2JA6B 4A3MG 5IT9L 2YU9B 5EPJA 1Z6HA 4DN4M 1GKUB 3DWAA 1P16A 1YNNC 3DLLA 3RUZA 1EYDA 4LFAQ 2Q8TA 3PF5A 4L5SA 2F3WA 4ZCKA 1UAPA 1JJCB 1TVXA 1YJWA 3HKZG 2NTTA 2B63G 1I5FA 4QF4A 1TS2A 3N52A 1XMOL 3HOVH 1BNZA 1CKNB 3M4OB 1I4PA 2CH4A 2HUGA 3BU2A 3TP5A 2R7ZB 3K80C 4APVA 3J81i 2IT1A 3I4MH 1FD7D 1L1OA 3JAMc 3VDYA 1BR9A 3QWNA 2I5HA 4GOPA 1ONLA 3HOUG 3PUYA 4CGYB 1PTOH 4IO9A 1D1KA 1ZYRC 1S40A 2PNHA 1HNZQ 4CDFC 2HCCA 1F2MA 2Q2HA 2IW3A 3G6JB 4KI0A 4RHRA 1PH3A 2RDHA 1JOKA 5LMNQ 1JEIA 1SE3A 1S4ZA 4DV4L 2L9HA 3KJPA 1NJIC 4C3IH 2EPBA 4WFN3 5EAYA 1LUZA 4ZUJA 4JI1L 3HOWB 1CKNA 5KIXA 4A75A 1PRTD 2F0LA 2LSSA 3ERSX 1K8AC 2HHHQ 1EYCA 4PV1C 5E4XA 4DR5L 1PH6A 5HGTA 1XX8A 3PUWA 4G57A 5C0XG 4J15A 1MGSA 2FMMA 4QIWE 1WTWA 1FYCA 1G8ZD 3HOZH 3E3XA 4GKKL 3E0JA 4BXXG 1VQ7A 1Q90A 4ZQ3A 3S1NH 4JI7Q 4WRDA 3I4LA 3WWVA 3UDGA 1ASYA 4BBSH 1BUVT 3QOLA 5M3MG 4A3KB 1L0WA 5IYBG 1IYUA 1QUQB 1R9TB 4DFAA 3BVGA 4LUOA 5E4WC 3NTIA 3H0GG 1W2BA 4HMIA 1Q82C 5IIFA 4B3TQ 1IZ6A 3GV3A 1N36Q 1QCBD 4KY5A 2B8FA 4CJ2C 2UUAL 1VQOA 4TRDA 3HOXH 1GUTA 2HJQA 5C3XA 4POGA 1QNKA 5KEEA 2A19A 4AQYL 1VQGA 1I6HB 1E7DA 1EWHA 5K5PA 1EY9A 1K0RA 1EUJA 2QF7A 2Y0SB 4L5QA 2JA7G 3GTOB 2UXDL 2D0OA 2MO1A 3VR5A 1LT5D 2WB1G 3NPPA 4HJ5A 1GJJA 4BY1B 1F2LA 1Y1VB 1JE4A 2HDLA 3I55A 2F0NA 5GAEC 3NWSA 3R2TA 5CV4A 2ASBA 3CQZH 1BBXC 4PQXA 1NCVA 2AWNA 4HIDA 2D9UA 4DAMA 2B29A 1QUQA 1V43A 5J1ZA 1E2VA 2FMCA 1PYBA 4CKBA 1HFGA 1ZEQX 4HCSA 2EYJA 4I7ZC 1EY8A 1HTPA 2VB2X 4A3EB 3KDFB 3RZDB 3RLNA 1CZGA 3D8GA 2R61A 1UE5A 5C4XB 3U50C 5G3LF 2I5LX 3ICEA 1ENFA 3QOJA 4TSSA 4FYDA 3PGZA 3OTOQ 1JJRA 2EQSA 1LABA 4IN3A 3MA2B 4AYBB 5EBCA 4DXGA 4OL7A 3SHLA 1TWFH 4KKTA 2K33A 1H9FA 5DNFA 1NR4A 4DV4Q 1J5EQ 1A62A 4YHHL 5IGFA 1LT3D 3H09A 5IODA 4A3FB 1SE8A 5C0XI 1AP0A 3AMUA 2KCMA 1OXVA 3C1EA 1B9NA 2G80A 1EQVA 5M3FH 1LACA 4U68A 5EGTA 4X3KA 2E2DC 5FKAC 4OHJA 1HHVA 5FOBB 5JVH3 3KDFA 2RDFA 2K75A 2MQHA 5I6WA 4AIMA 2EYMA 4EQ5A 3TP7A 1LTGD 1STAA 2F0MA 3K7AH 1WCMG 4A3JB 3F8TA 4CKEA 2A68C 1NTGA 2HQEA 2B2UC 4JBMA 2HT1A 3CCLA 5JPMC 3PUZA 2R92B 4B3SQ 1A8VA 2L15A 5FO8B 1LM0A 3TRZA 1Q46A 2LKVA 3GTLH 1P8LA 4JI8L 1E24A 3I2ZA 1PMRA 3M3YH 4C3HB 2NN6I 2B2WC 4KKUA 2JVWA 1X6OA 3AEVA 4GKJQ 1QZGA 1K73C 1DYQA 1EIGA 3KYHC 4C3JH 5EPLA 1H9RA 4IJHA 1SBBB 2RA4A 3V2TA 1EWIA 5ELDA 3FVQA 3UI2A 2RF4A 3K6OA 1FGBD 2Q2UA 4B3RQ 5DAUA 2B39A 4HIKA 2AHOB 3HOVG 2KCCA 1QZHA 2H1EA 1RDPD 3MEHA 2B2YA 3I4MG 5FLXL 2LMCB 3LGJA 3R8BA 4DNIA 2ZJQA 2XIWA 1BCPC 4DR1L 2UUBL 4DU9A 1CHQD 1TT2A 3N6RA 1JOOA 2VW9A 4PMWA 2AQ1B 3DM3A 1VQAA 4QB4A 5KGUA 2EXZA 1XNRL 5M5WB 1KHIA 4B9XA 1CZWA 1HR0Q 2K03A 2EZVA 1SNMA 1SXTA 4N9PA 4FO2A 1HNXL 2B2TA 4C3IG 5C4ZA 2EYFA 1WTHA 2IL8A 1KABA 1Y69U 4TKOB 1WD0A 4DK0A 3PO2B 3A74A 4POFA 2EVBA 1T5EA 4C56C 4ZYSA 2PI2E 2XNAC 2M9VA 3KLWA 2BA0A 5M5XH 3S1QB 2QW7A 1QG7A 2AUJD 2ZXRA 2WFWA 4RKBA 4JI2Q 3PV0A 1O7LA 1HTLD 3GO5A 3HOZG 1LTLA 2EYHA 3RR5A 4K8JA 1SMYD 3J80L 3GTQH 2IX0A 2IWHA 1VQ9A 4DR4Q 5JJIA 5ELFA 2QKIC 3TZUA 3S2HH 3PSIA 4DA2A 1I94L 3L3OC 1FVIA 1QNUA 4KJOA 3MC0B 1OXSC 5C3EH 3CCSA 2E2HH 2I07B 4H13C 3R93A 3SK5A 1F9RA 4KHPL 4XDXA 4YCWA 2O5IC 2E2IB 4GN3B 4GZYC 3UE0A 2L1BA 1WTOA 3CC2A 1KL9A 2LD7A 1S5FD 1FJGQ 1JT8A 3I7FA 3CC7A 4IUNA 2VQFQ 2PCFB 3ONAB 3GTPB 1G51A 1LTAD 1JJGA 2NZHA 1X3EA 4A3CH 4DV3Q 2UXCL 3TREA 2PO4A 2JA8H 2EY6A 2PNRC 4DV5Q 1ZXTA 3F2DA 1WJJA 2NVQH 1KAAA 1L0YB 3DUZA 1PZJD 3FPUB 2EXDA 2QA4A 3DXJC 4FF2A 1EL0A 5M5YH 1G2TA 2WAQE 3KOJA 3DEOA 5J39A 1GOZA 2X6LA 1DD2A 2CWAA 1HRJA 1EY7A 1PZID 2HD3A 3A8IE 3KBGA 1KHCA 4LF6Q 4PG3A 1GKHA 2E2JB 3FKIH 3DWQA 5FO9B 3O13A 3RNUA 3KFUA 1XYIA 3QIAA 1XNRQ 1SMYC 2D5DA 4A3MH 3MTSA 2FJ2A 2OTLA 4A3IG 2PYKA 4LF8L 3S16H 1M90C 4J8QA 1Y8PB 5A2QL 4BY7B 1VQDA 1HNXQ 4G7ZC 2KCNA 3PIP3 2YV5A 1WYDA 4H02A 2A8VA 2KBNA 2VL6A 4DR2L 2CW0D 5M3FG 5C4JB 4X64L 3OWFA 2ODCI 4LF7L 4ODGA 5DEHA 3S2DB 5D65A 4LFCL 2IJ0A 1G6ZA 1K83H 2A73B 4DNRB 3I90A 5C44G 1PH8A 2JJQA 3ER0A 4HSVA 1JORA 2UU9Q 2VQEL 2BDOA 2ZTEA 2K5QA 2VNUD 4JI6Q 4UAIA 1GM5A 1UUPA 2H5XA 4JI4Q 5G3LD 4AYBG 3A7LA 4AH6A 3FRPB 1TWCH 3K0YA 4X6AH 3K58A 1NMFA 4C3JG 3NSWA 2YYZA 3EN2A 2NVXH 4JK1C 3QKJA 5FLXE 1XWEA 3UDFA 2F3IA 1BF4A 3A8JE 1IHZA 2KEDA 3AU7A 3C1FA 1MSHA 2EOTA 2OCEA 1TU2B 3T1HQ 1ASZA 1HJPA 3IAYA 2R7DA 5C0XH 4P74A 4NXNL 1EY6A 3U9OA 2UXBQ 2DNEA 4OX9Q 1EN7A 1O7IA 4DV0L 1Q12A 5JEAH 3NE5B 4OWTB 2C9OA 1SFOB 4BITA 4DR7Q 1JC7A 2EJMA 5LMUQ 4GLXA 2WACA 3MHBA 1B44D 4LFBL 3CPFA 1GUNA 3RD4A 1MJEA 3H15A 3K0XA 4FF4A 4YWKA 1STHA 2DNCA 2RBMA 3HKZE 3MXUA 4OWXB 3PO3H 3S17B 1HQRD 3L0OA 4XQQA 3NHHA 2AQ3B 3H0GH 4OEMB 3HOYH 1Z47A 4P71A 1U5KA 4ME3A 3SDZA 4BBRB 1IBLL 4LFAL 2ZTDA 5J22A 2L0CA 5JJLA 3CU7A 1QOHA 3FEWX 3A5UA 2JA5B 4E6IA 1EYAA 2K5VA 3UDIA 4KMUC 4YCUA 1YHAA 1YNJD 2JA7H 1DGSA 4OGQC 2WAQG 4RGOS 2R7FA 1BVSA 4O42A 4Q0FA 4A3BB 1ILPA 1D7QA 2PZUA 4KHVA 2VUMB 1U0LA 3ND8A 1UWVA 2A6HD 2P5ZX 4RH6A 4DR2Q 1Q8KA 3RN5A 3GP7A 1SNDA 1WTRA 4DGZA 2F0SA 3WOEA 4ULLA 4M1UB 1Z9FA 5ELOA 5C3EG 2FFKB 1D8LA 3LNNA 3GTKB 1EEID 1MHWC 1H9JA 1WD1A 1CA5A 1D1IA 3KF8B 2K5WA 3Q6SA 3G48A 2HHHL 1VQ5A 3SE0A 2NB0A 4YY3Q 1D5ZC 2CQOA 5CV7A 1I50B 5CBEE 5BR8L 4J6HA 3WDNA 3MFYA 1PDQA 1XTCD 5C5MA 1DM0B 2JEBI 1OXUA 4A3CG 1VQKA 2F0UA 1KXLA 1X3FA 2JA8G 5TSSA 4QIWB 1ILQA 4YCVA 3DM1A 4FXKC 4MTKA 4JG2A 1YBYA 3X3NA 3BJUA 1PZKD 3KF8A 1D5MC 1I3QB 4KV6A 4DV0Q 2NWGA 3GV6A 1N36L 2B2YC 4MTNA 4A93G 2AMCB 1KAWA 3OIPA 1YNJC 2ZTCA 2MPHA 1YEZA 5A2QE 5EJWA 3GTMH 3A5ZB 1PFBA 5JEAJ 1ET6A 3GTGH 3HP3A 1E22A 1VQBA 1B8AA 2A6HC 1KNEA 1A2UA 3SXHA 4F7XA 1KQSA 3JAML 3E5SA 4CDEC 1AH9A 2E75C 2B3GA 2B2TC 1S5ED 1PXUA 1IBLQ 2WKCA 1CK1A 4K5WA 4LAAA 2DGYA 1K8GA 1A15A 1XJVA 4GNXC 2CH4W 2K50A 1E7ZA 3BDLA 4C2MH 3A54A 4I7AA 3V96A 1M4VA 3M7GA 3S14B 3GTJH 1VQPA 5BN3A 4JYAQ 1VCIA 2RKSA 3STBD 5FO7B 4IFDJ 2B8GA 5IGBA 5H1SE 4IOAA 2KCTA 1HZBA 4MZ9A 5I9PA 5LMNW 4A3DB 3J80i 3OTOL 3LX0A 2F0HA 1SE4A 2GN5A 3CAMA 3NK9A 4RGTA 4LF4Q 1J5EL 3M4PA 2NVTB 2YU9H 1GUOA 1LLRD 4OONA 5CMDA 2HDMA 2A1AA 1ZBHA 1YI2A 2MUYA 4BBSB 2OWOA 4G4KA 3MXGA 1SYDA 4O1NA 2E76C 2SOBA 4A76A 3CMAA 2BH8A 2I0QA 5BR8Q 3J81j 1KRTA 2R7ZH 5JEAG 3RMHA 1VMCA 3KLSA 2LXJA 1O80A 4KJNA 1PH4A 3HOXB 4CHTB 4B3SL 1IL2A 1JWUD 5IOCA 4ZRZA 2UUCL 1EQQA 1U4LA 2ZJRA 1VQ8A 2D0PA 1O78A 3C46A 4NPSA 4K0KQ 4IUTA 3PO3G 2VY3A 5LHY1 4GKJL 2F0OA 1LTRD 4WJ3M 2K5HA 4G7HC 1EU4A 3DWPA 3HOYG 3RZOH 3K81C 3MZ5A 2XRSD 3MVVA 1F77A 1EWCA 3OYYA 4B3RL 1KDBA 1XMQQ 1PH9A 2BH2A 1RODA 4P72A 1Y02A 4JI3L 3CP0A 4IFDG 1DONA 1PFMA 1TWAB 1CSQA 1LTTD 1NE3A 1YNSA 1B2TA 1A3TA 5L37A 3CCJA 2ID0A 1KDCA 4V190 1E2WA 2R93B 3DMUA 2ALYB 3OIQA 1X54A 2VZAA 3M4YA 4HN7A 2KW9A 4CDCC 1AE2A 4NXML 1GHJA 2CWPA 4MHEA 3T1YQ 2A5HA 1T9HA 1HR0L 1X3PA 1CQVA 4A3KH 2L55A 2RHQB 1MD2D 1STGA 2YTXA 1E1TA 1X55A 2B2VA 2L11A 2WP8J 3L7ZC 1JWMD 1PRTC 3AYHB 4MIUA 4GLAC 1YNXA 4G7OC 1YVCA 3PQIA 1HXYD 3CCEA 2F0QA 1GL9B 4UPAA 1I6HH 3EROA 5T1GA 3SK8A 4PZ7A 4JI2L 3K7AB 3CCVA 4A3IH 3GTOH 4ZLTF 2JK8A 4B08A 4BY1H 1Y1VH 3F1ZA 1Y1WB 5I9OA 4B9WA 2KHIA 4DR4L 3OWEB 4ZK9B 4R1JA 4ZUIA 1HNWQ 5BN5A 1CQFA 2Z6KC 2F0IA 3AQQA 1FNUA 3BG3A 1TXYA 5ELCA 5IE8A 3GTLB 4K8IA 4IZ8A 3K8AA 1I4XA 2IY5B 4RKLA 1I4GA 1PYWD 4UHVA 3I4NB 3CF5A 2BCOA 2WINB 1YZ6A 4JOIA 5C44H 1IXRA 3RZDH 4LNQA 4QUCA 1RL2A 5IT9E 1K9MC 5FLMH 1SNPA 3IRBA 4UZWA 2CFMA 2UUCQ 2YTYA 1Q3LA 5F2DA 1HH2P 2KHJA 2QNCA 3K59A 1RIPA 1U9RA 2KEEA 1RF2D 2EY2A 5LL6X 5KNDA 4BA1I 1G6PA 1FJGL 2PI2A 4EQOA 3P7JA 1SJHD 1WFQA 2L12A 4A3GB 5GQOA 2VQFL 2JP1A 3S9WA 1ICFB 1GUGA 3VYRA 4DV3L 4IFDI 1YJNA 1TWGB 4A3FH 4WJWA 3KLSX 3CRKC 4B3MQ 2XGTA 4DV5L 4H44C 2LS01 3D31A 2FXQA 4XT3B 1KIXA 1IBMQ 3MAQA 1PH5A 4QCLA 2JN4A 3IKJA 4DR3L 4JI3Q 3R2IA 1RHPA 1MJCA 2F0PA 1F9QA 1DOMA 2F0WA 2K01A 1ICWA 2JE6I 4K2LA 5IWAQ 2Y0SE 4N9TA 4A3JH 1VF5C 4OXPA 1SNQA 4DXFA 3T56B 2R92H 1SYGA 4LF6L 5IYCH 3I4OA 1ZKOA 2A69D 3TS2A 2JQOA 3S24A 4NXMQ 3BYTB 1DOKA 3QO2A 4J1MA 5CV5A 1NUCA 1UE7A 3NUCA 2KHSA 2W51A 1B3AA 4C3HH 4DF7A 4HJ9A 4RAUC 2JA6G 1KLGD 3GTQB 1SSOA 3V05A 3E6ZX 1V1PA 1WI5A 4MN3A 5JVG3 1TR5A 2E5LQ 1FR3A 1HUMA 1V1QA 1F9SA 4CJ1B 2XN9C 1W6KA 2EIFA 2PQAB 1S72A 4DK3C 4DV7L 1J9OA 4X3UA 2KQ3A 4QJFA 1K8OA 2L4NA 4NB3A 4KD4A 2R7ZG 4KTAA 4IALA 1LTSD 4AYBE 1PV4A 1M8AA 2K04A 4ILWA 1C8CA 4Z9CB 4UP8A 4EX5A 3U58A 2UU9L 4JBJA 3A56A 3E9HA 4QY7A 3TP8A 4JI6L 3HG9A 5M5WH 3S1RB 4JI4L 1KTKA 2SDFA 1V8QA 1QWYA 2PQAA 1TS4A 2EE1A 1WTXA 2Q8IB 4UP7A 3KF6B 4JW0A 2EYOA 3J81c 3KLRA 3HOWG 1K3RA 3T1HL 3T13A 3KK7A 1QB5D 1FGUA 1W6JA 3I3CA 2UXBL 1H9EA 4OX9L 3S1QH 3HFZB 2F1MA 3I70A 5M5YB 1PA6A 4UY8C 4XQJA 2C35B 1IYJB 2OQKA 4RG1A 2A69C 4DK1A 1B1ZA 4P2CB 4R4CA 5ELNA 4DR7L 5CC4A 5LMUL 2XVSA 1ESRA 1DOLA 1GUWA 3P20A 3FKIB 4JBWA 3U4ZA 3OOCA 5AJ3Q 3JAMi 3H3VC 3LWUA 2MNAA 5E3FA 3HGBA 4A3MB 3DHQA 3S16B 3L9AX 3KF6A 4DR3Q 4A3KG 1QE6A 1S5BD 3Q8DA 4A93H 3BDCA 3S1MB 4IOCA 1L1OC 1TS5A 3FMCA 1SDFA 4H7BA 4LF5Q 2BE5D 3U9SA 4R8IA 4GOPC 2KUMA 2X6GA 3HKZB 2B63B 1F2YA 1H9KA 3PIO3 2E2IH 4GLVB 3TP6A 4QGUA 1EYGA 3Q23A 2Y0SG 3DEPA 5HY6A 4U673 3BVMA 1RTNA 4I65A 4XYOA 5C5LA 3HOUB 4BY1G 1JB7A 1Y1VG 2K5DA 2Q2IA 3GTPH 3A0JA 2CVRA 2K7VA 2RNNA 2KENA 1PH2A 3IFDA 4UDUC 3MXNB 3ZJYC 3W3AA 3M4QA 3RLFA 4DV7Q 2KECA 4N8FA 3ULLA 4HAEA 1S5CD 4TQUS 2E8GA 5KYIA 2NVXB 3SEBA 4A3EG 3TS0A 5I4DA 5CV6A 5FLMG 1GVPA 4DAYB 5C4XG 1HCZA 1PH1A 2K52A 2L5TA 4YY3L 2E2JH 4MNOA 2F03A 1SE2A 2MGSA 4CKCA 3CCUA 2DN8A 5EKLA 1EFWA 4EVOA 1HZCA 3MXNA 1AN8A 2HCIA 1PH7A 2TMPA 2F4VL 1OO9B 1VQNA 1VQIA 4A3FG 5CIUA 2ZXOA 2QGQA 3KJOA 3BDOA 3SK4A 2WV6D 5M3MB 3UDXA 2J0TD 5C4JH 4M8AA 2EYLA 4DAVA 2XWJB 1SYCA 3S2DH 4GN4B 1V66A 4F88A 4DAYA 4A3JG 2NZOA 1Z7TA 3S15B 2QNFA 1LYLA 1TWHH 1JICA 2JA9A 3G7LA 2R92G 1B7YB 2MPMA 1HZAA 5IYCG 4XQNA 2KOLA 2RCFA 5FK9C 2WB1B 1GXDC 3NELA 2KVUA 1LTID 1YJ9A 1JQYD 3EVQA 4KKSA 1AZQA 2B2UA 4C3HG 4Q5VA 3F2CA 2RDGA 5IY0A 1IKLA 2CW0C 1PFNA 2F0JA 2ODGC 2B2VC 1J6QA 4RWSC 4HCEA 5I2YA 1H9SB 2OQ0A 3GD7A 4FNFA 1WTVA 1BCPB 3BS1A 3J80E 3NWTA 3I73A 4IUUA 1C48A 2SEBD 4LWCA 4IFDH 2PW7A 2F0KA 3QG1A 1R4PB 1TIID 1X3QA 2D62A 2NYZD 1VQ4A 3A55A 3H6MA 3H91A 1C9OA 1BCPF 1VQFA 3PCOB 4C1NK 2HQLA 4JYAL 1FL0A 5IP9H 1SFOH 5ELEA 4A4IA 1H95A 1X56A 3I8ZA 3NEMA 2DJGC 2NVYB 5D3DA 2PQEA 2PZTA 5ELBA 4DUZL 3OW7A 2QCPX 2G9HD 4JCVE 3URYA 4XIGS 3J7AF 1H9SA 4LF4L 3S17H 2ES2A 1XNQL 3T53B 5K36G 3VYTA 1Q86C 3VR3A 2Z4HA 1VQ6A 1TKWB 1LO5D 4QQBX 1CSPA 1Y14B 1IKMA 2XTIA 1BOSA 3PO2G 1A2TA 4NKLA 3TEHB 4OELB 5E1FA 1XXGA 3M7NA 1WCMB 2SNMA 4YWLA 3NENA 5IP7G 1SRUA 4A3BH 2IHFA 4DUYL 2RHSB 4Y7NH 4DV2Q 5HGQA 2VUMH 4P73A 2F4VQ 3HRZC 1ESFA 4KN4C 4X66Q 2MFIA 4K0KL 1ENCA 4R4QA 3BZDB 1LT4D 4CDDC 4HJAA 4L5TA 3K57A 3PIPA 2ENBA 3W1GA 5BN4A 1JCKB 1X9NA 1PVOA 3GTKH 4RCOA 1DJRD 1K0SA 1UEBA 2N3SA 2Q2TA 2RCNA 4R4TA 4BS9A 1XMQL 2R3ZA 3HOVB 1MBYA 4KLKA 1YHBA 3CPWA 5I6YA 2KVEA 2NBFA 2M2LA 3I4MB 1I50H 1BXTA 4LUVA 1Q1BA 5M9OA 1AZPA 1BQQT 1Q7YC 1Q8IA 1AEXA 1PTOB 3ERQA 2M00A 3F2UA 5JOBA 2KVDA 2LXKA 2BDNA 1NAPA 1VF7A 4RMFA 5CBAE 3T1YL 2EJGC 2SNSA 1PTOF 3ULPA 1SJED 2G5DA 3TN2A 3H3VH 2DUDA 3SGIA 4C3IB 2FHTA 1I3QH 1ML0D 1Y8OB 2F0VA 5IGDA 5IGGA 5DM63 5IGEA 1QJOA 4IPCA 3CC4A 2OXPA 4ZKCB 4JI5Q 3C2PA 1SNCA 3B6YA 1SAPA 4DV6L 1RCVD 3LLRA 4XTCS 1Q1EA 1HQMC 4BWGB 2YTVA 5JAVA 4DUZQ 3WOFA 3CD6A 5IT9c 3RLOA 3HOZB 3NQTA 1I6VC 2LFNA 2JA6H 1KNAA 5JPNC 3FP9A 3OMGA 1MI2A 4PNYA 2ZM6Q 1XNQQ 4BY7G 1HNWL 4DK6C 4DR6Q 3S1NB 2K4KA 4OIKA 5AFWA 4RGNA 1YITA 1QVFA 1JB3A 5IYDH 3PUVA 3SVMA 4OO1H 3UE1A 1NY4A 2JXMB 1W3SA 3NQIA 3J7A5 3M4OH 3GDEA 1DZ1A 1IL8A 4HTHA 3RZOB 1FNWA 1XPOA 3S14H 4DUYQ 1CKOA 1DXMA 1CT1D 1EFID 4LK1C 4HIMA 1CHPD 2K14A 4L63B 4JI0Q 3CRLC 4A3DH 1B53A 4HJ7A 1VS0A 4ABNA 1RKNA 2F0EA 4FVMA 4F87A 1NBWA 4XXEA 2NVTH 3CQZB 3A8KE 3ND9A 4O0AA 2C5CA 2PMZE 1O7YA 1L0XB 3CCRA 1CUKA 1VQHA 3NTHA 1E7LA 4B3ML 3HOWH 2CHBD 5IGCA 1IBML 4K2KA 4P75A 1JEQA 1CI3M 5NUCA 3STBC 5IWAL 2H4OA 4RFBA 3C3LA 3G6EA 2O2LD 4HJ8A 5IP9G 4NP5A 4DAPA 4C1NI 1MIUA 2V1CC 2NN6G 1BKBA 3TSSA 5KNCA 3W5OA 2J4XA 3EIVA 4K6LA 1TQOA 2A68D 4EQPA 1OTCA 2DK4A 4ME5A 1Y8NB 4F8MA 1WTPA 2VXWA 1EZ8A 3PUXA 1PYSB 2IHEA 4LF9Q 4A3IB 5T1IA 2XRQD 1TWFB 2A74C 1OXTA 3W2DA 4NMZA 4L5RC 3Q24A 3AB9A 1R9TH 3NBIA 4JPBW 1X65A 2E5LL 4RGMA 1YIJA 5C3WA 5M3FB 2F52A 2KVMA 4DV1L 2Z4IA 4BBRG 1X32A 4DV6Q 4L8JA 1QVGA 3M85A 2F0FA 2RQXA 4JC0A 2DJFC 1EY4A 4A3LG 4QMGA 3HS0C 2JA5G 2GVBA 3OMCA 1HUNA 1XMOQ 3LWEA 3VYUA 4YIJA 3PF4A 5CORA 1MSGA 2OTJA 1TWAH 3T51B 1HA5A 1TY0A 5C44B 5E7NA 1N34L 1GO3E 2ICIA 4A3BG 2BOSA 3IFTA 3HZXA 4PZ6A 3T16A 2NTSA 2N8NA 2ICEC 2KJXA 2VUMG 2K6AA 5EKIA 2R93H 3L2PA 5GROA 1VQMA 4Y52H 3AFQA 1BCPD 2N49A 4FXDA 4IJLA 3M3YB 2RSOA 1GHKA 2R6GA 1JJ2A 5D14A 1STBA 4ZKBB 3I91A 3OPOA 1VQJA 3SR1A 4C3JB 1E0BA 3MEFA 1BO0A 4A3EH 1B3QA 2F3VA 4NW2A 4JI1Q 2BA1A 5C4XH 3JAME 2LY7A 4DR5Q 2JEAI 1KC8C 3FPPA 2K1BA 1CFMA 1A63A 4PMBA 1G291 1EU3A 1SNOA 2PZWA 4H0LC 1OXXK 1ET9A 5CR3A 1A3VA 4GKKQ 1Y1WH 1N9WA 4KN7C 5AJ3L 1EIFA 1V1PB 3T4AC 1U4PA 1EQTA 2MO0A 1E3PA 5KNBA 2PW5A 1TY2A 3HKSA 4EGVA 3I4NH 1E2ZA 1KDAA 5CYUA 3TZDA 4LF5L 2AKWB 1I4HA 3I72A 5C6AA 1NSNS 1F9PA 3VA7A 1VQEA 3CMEA 2UUAQ 3A7AB 1HR0W 4AQYQ 5M5XB 3CKIB 1U4RA 2WAQB 1SR3A 4JV5L 5CV8A 4IUVA 1XPUA 2UXDQ 1ENAA 4IPGA 1NNXA 4LMQD 1J8IA 5DLQE 1JWSD 1KRSA 4GNXB 3K5MA 4A3GH 1C4QA 3Q0AA 1EY0A 4PMCA 3S2HB 1STYA 4HIOA 2G9DA 4DV1Q 1TWGH 5IYDG 2J7ZA 3MXPA 1JE5A
chains in the Genus database with same CATH topology
4OO1G 1K0RA 4YY3L 4MNOA 4YCVA 2E2JH 1EUJA 4L5QA 2JA7G 2UXDL 1UE1A 4JG2A 2D0OA 2MO1A 1YBYA 2WB1G 4HJ5A 3BJUA 5FLXc 3CCUA 1GJJA 4DV0Q 1EFWA 3CW2C 3I55A 1N36L 4MTNA 4A93G 5GAEC 1HZCA 1N34Q 2AMCB 4KHZA 2ASBA 3BZCA 3CQZH 1KAWA 1PH7A 2F4VL 2AWNA 4HIDA 1VQIA 1VQNA 4A3FG 2ZTCA 2MPHA 1YEZA 4X65L 4DAMA 2QGQA 3GTMH 2KFVA 2B29A 3KJOA 1QUQA 1V43A 3A5ZB 5JEAJ 1PYBA 3NBHB 3UDXA 5C4JH 4GNXA 3GTGH 4A3DG 1E22A 1IBKL 3S2DH 1VQBA 4GN5A 1EQRA 3TQYA 1X3GA 4GN4B 1B8AA 3KDFB 1KQSA 3RLNA 4A3JG 5FJ8H 2NZOA 4YHHQ 2QNFA 1LYLA 1TWHH 1AH9A 2B3GA 4DKAC 4LW1A 1UE5A 2JA9A 1IBLQ 3U50C 2R92G 1B7YB 2CCZA 1HZAA 2I5LX 5IYCG 3CCQA 3ICEA 3PO2H 2DGYA 1K8GA 3PGZA 2ATWA 4BBSG 3OTOQ 3NELA 2EQSA 1YJ9A 1XJVA 4GNXC 2K50A 1E7ZA 1TWFH 4C2MH 1H9FA 1WOCA 3F2CA 3J80c 4DV4Q 5IY0A 1A62A 5IP7H 4YHHL 1J5EQ 4JYAQ 3GTJH 1VQPA 4JBKA 2ODGC 1VCIA 1J6QA 1SE8A 3STBD 5C0XI 3HOXG 2OQ0A 3GD7A 3J7ZC 2KCMA 1OXVA 4IFDJ 4ALPA 2G80A 5M3FH 5H1SE 3H3VI 4IOAA 2KCTA 1HZBA 4MZ9A 5LMNW 3J80i 5JJKA 3OTOL 2QEXA 4LWCA 3KDFA 4JI8Q 2K75A 2MQHA 2D62A 1VQ4A 4AIMA 4EQ5A 2GN5A 3S1RH 3K7AH 3CAMA 3FHWA 1WCMG 1C9OA 3F8TA 1J5EL 3M4PA 1VQFA 3PCOB 1NTGA 2HQLA 4JBMA 2YU9H 4LF4Q 4A3LG 4JYAL 1FL0A 3E9IA 5IP9H 2HT1A 3CCLA 2I5MX 4OONA 1SFOH 4A4IA 3PUZA 1H95A 4B3SQ 1X56A 2A1AA 1A8VA 1YI2A 3NEMA 2L15A 4IPHA 2OWOA 1LM0A 3TRZA 1Q46A 4DUZL 3GTLH 1ZS9A 1P8LA 4JI8L 1AE3A 1V9PA 1E24A 3I2ZA 4JCVE 1YHQA 4A76A 3M3YH 4XIGS 2NN6I 3CMAA 4JV5Q 2BH8A 1X6OA 2I0QA 4UP9A 5BR8Q 5GAGC 3J81j 1KRTA 4LF4L 2R7ZH 5JEAG 3AEVA 3S17H 4GKJQ 1QZGA 1K73C 2LXJA 2ES2A 1XNQL 4IPDA 3KYHC 1PH4A 4C3JH 4OO1I 4B3SL 5K36G 1Q86C 4DR1Q 2UUBQ 4IJHA 4OWWB 1VQ6A 2UUCL 3AFPA 4QQBX 1EWIA 1MKHA 1EQQA 4BA2I 1CSPA 1Y14B 2ZJRA 4BY7G 2RF4A 2XTIA 1VQ8A 2R93G 3PO2G 1N33L 4B3RQ 1SROA 2Q2UA 3U4VA 2D0PA 3TEHB 2AHOB 2VS1A 4HIKA 4NPSA 5GADC 3HOVG 3M7NA 4K0KQ 3BZKA 1QZHA 1KD1C 3EBEA 4R4IA 2VY3A 3PO3G 4GKJL 4YWLA 3M9BA 3E0EA 2K5HA 3I4MG 4WJ3M 3W1BA 3NENA 3LGJA 5IP7G 1SRUA 4A3BH 3HOYG 4DNIA 2IHFA 4DUYL 2ZJQA 2RHSB 3RZOH 4Y7NH 3K81C 4DR1L 1C7YA 4DV2Q 5HGQA 2UUBL 2IX1A 2VUMH 2HIVA 4P73A 2F4VQ 4LUZA 2VW9A 4PMWA 3S15H 3OYYA 3DM3A 4GS3A 4X65Q 4B3RL 1VQAA 1XMQQ 1PH9A 2B63H 2BH2A 4X66Q 4P72A 1Y02A 2MFIA 1XNRL 1KHIA 4JI3L 3CP0A 4IFDG 4K0KL 4R4QA 1XPRA 1IBKQ 1HR0Q 1CSQA 1NE3A 2N78A 4HJAA 1YNSA 4L5TA 3PIPA 1M1KC 3W1GA 1HNXL 2HIXA 1EIYB 4BY7H 1X9NA 3CCJA 3HOUH 1PVOA 4DV2L 3GTKH 2ID0A 4FDBA 1Y1WG 1C0AA 1UEBA 2N3SA 2Q2TA 2ALYB 1X54A 3A74A 2RCNA 2VZAA 4POFA 4R4TA 3G4SA 1XMQL 1AE2A 4NXML 2PI2E 4X66L 1VQLA 1SN8A 5M5XH 3KLWA 2CWPA 2BA0A 4O2DA 3T1YQ 1I94Q 4KLKA 1YHBA 3CPWA 1T9HA 1HR0L 2WFWA 4JI2Q 3PV0A 1I50H 4A3KH 4LUVA 1Q1BA 2K5NA 2RHQB 3GO5A 3HOZG 1LTLA 1X55A 1E1TA 2YTXA 3I4NG 2WP8J 3RR5A 1Q7YC 3L7ZC 2CKZB 1SLJA 2IX0A 2Z6KA 2GVAA 3AYHB 1VQ9A 3GTQH 4GLAC 4DR4Q 1YNXA 1YVCA 4X62L 2LXKA 5JJIA 3S2HH 3PSIA 3CCEA 2AWOA 4KHPQ 3RN2A 3G71A 4RMFA 1GL9B 3T1YL 1I94L 4UPAA 1I6HH 3I56A 1FVIA 3ULPA 4PZ7A 4JI2L 3CCVA 4A3IH 3GTOH 1CKMA 3H3VH 2DUDA 3SGIA 3K7UC 1Q81C 1EOVA 1OXSC 2JK8A 1A0IA 5C3EH 3CCSA 1I3QH 4BY1H 1Y1VH 3F1ZA 3F2BA 2E2HH 4A3GG 2KHIA 4DR4L 4IPCA 3CC4A 4BXXH 4R1JA 4JI5Q 1HNWQ 2Z6KC 3AQQA 2LC3A 2UXCQ 3B6YA 1JJGA 4DV6L 1TXYA 4KHPL 1N32L 4A3CH 4XTCS 4YCWA 1JMCA 1E1OA 5IE8A 1Q1EA 4GN3B 3UE0A 3K8AA 2YTVA 5M3MH 4DUZQ 3CC2A 1KL9A 2LD7A 2ZJPA 3CD6A 1B70B 5IYBH 2IY5B 5IT9c 3RLOA 1FJGQ 1JT8A 3I7FA 2JA6H 3CC7A 3CF5A 3FP9A 2VQFQ 2ZM6Q 1XNQQ 1YZ6A 4JOIA 5C44H 1IXRA 3RZDH 1G51A 4JI5L 1VQCA 3CXCA 4DK6C 4LNQA 2NZHA 1RL2A 1X3EA 4DV3Q 2K4KA 3TREA 5FLMH 1YITA 1K9MC 1QVFA 2UXCL 3IRBA 2JA8H 2CFMA 5IYDH 2UUCQ 3PUVA 2YTYA 1HNWL 4WJ4A 4DV5Q 1HH2P 2KHJA 3UE1A 2QNCA 1N33Q 3F2DA 1RIPA 1WJJA 1NY4A 2NVQH 1W3SA 4BA1I 3J7A5 1G6PA 1FJGL 2PI2A 2EXDA 3M4OH 2QA4A 3GDEA 5M5YH 1WFQA 2WAQE 3KOJA 4LF8Q 5GQOA 2VQFL 2ZM6L 1QVCA 3OW2A 2CWAA 5FJ8G 4TVAB 1XPOA 4DR6L 4DV3L 3S14H 4DUYQ 1CKOA 1YJNA 4IFDI 4JOIC 4A3FH 1PFSA 4BBRH 1SMXA 1PHJA 4B3MQ 4LF6Q 4PG3A 2XGTA 4DV5L 1GKHA 3FKIH 1HNZL 4HIMA 4A3LH 2K14A 4X64Q 3D31A 2JA5H 4JI0Q 2FXQA 3RNUA 1N8RC 1KIXA 1IBMQ 4LF7Q 3KFUA 1PH5A 1XNRQ 4A3DH 4HJ7A 4R4OA 4JI3Q 1VS0A 4DR3L 5LMNL 4A3MH 1MJCA 1XTDA 4A3IG 2OTLA 4LFCQ 4LF8L 3S16H 1M90C 2JE6I 5IWAQ 2Y0SE 1VQDA 1NBWA 4A3JH 1HNXQ 4OXPA 2NVTH 4O0AA 2PMZE 2YV5A 3CCRA 1CUKA 1VQHA 1WYDA 4H02A 2A8VA 2KBNA 1L2FA 1E7LA 4B3ML 4LF6L 2VL6A 5IYCH 3PIOA 3I4OA 4DR2L 5M3FG 3HOWH 3JC66 3TS2A 2NVYH 2JQOA 3S24A 4DPGA 4X64L 4JI0L 4NXMQ 2ODCI 1IBML 4LF7L 4P75A 2VQEQ 1UE7A 4LFCL 2W51A 4YWMA 3CCMA 4C3HH 4HJ9A 2JA6G 3STBC 5IWAL 1BBWA 1K83H 2Z0SA 3G6EA 4HJ8A 1WI5A 5IP9G 5C44G 1MIUA 2V1CC 2NN6G 2E5LQ 1UE6A 1PH8A 2JJQA 1BKBA 3W5OA 5GAHC 4JI7L 3EIVA 1V1QA 1OTCA 3ER0A 2DK4A 4X62Q 2EIFA 2PQAB 1NMGA 1S72A 4DK3C 2UU9Q 2VQEL 3PUXA 1PYSB 4QL5A 2ZTEA 2IHEA 4DV7L 4LF9Q 2VNUD 4JI6Q 4NXNQ 3ULJA 1OXTA 1GM5A 2H5XA 3D0FA 1WCMH 4QJFA 4L5RC 4B3TL 4AYBG 4NB3A 4JI4Q 1R9TH 4AH6A 2R7ZG 2WB1E 1TWCH 4X6AH 1NMFA 1X65A 4AYBE 2E5LL 2NVXH 2YYZA 3EN2A 1YIJA 1PV4A 1GD7A 2F52A 5C0XJ 4DV1L 1L1OB 4UP8A 4BBRG 3UDFA 4EX5A 1S3OA 4DV6Q 2F3IA 3U58A 1QVGA 3M85A 1HZ9A 4PZ8A 2UU9L 4LFBQ 4JBJA 3FKIG 4JC0A 1N32Q 4GOPB 5J3BA 1IL2A 2OCEA 4LF9L 3E9HA 4QY7A 3T1HQ 1HJPA 2GVBA 2R7DA 1ASZA 4P74A 4NXNL 2JA5G 4JI6L 1XMOQ 5M5WH 2UXBQ 4OX9Q 1BBUA 3PF4A 4A3MG 1EN7A 1O7IA 4DV0L 1Q12A 4JI4L 2OTJA 1TWAH 4OWTB 5E7NA 1GKUB 1N34L 1GO3E 2PQAA 4A3BG 4UP7A 3KF6B 1P16A 4PZ6A 4DR7Q 3DLLA 5LMUQ 4GLXA 2N8NA 2VUMG 4LFAQ 3J81c 2R93H 3L2PA 3PF5A 4L5SA 5GROA 1VQMA 3CPFA 3HOWG 1JJCB 1K3RA 4LFBL 1YJWA 4Y52H 3AFQA 2N49A 3HKZG 3H15A 3T1HL 3K0XA 4IJLA 1I5FA 1FGUA 4YWKA 1MJEA 2B63G 1XMOL 3HOVH 2UXBL 1H9EA 1CKNB 4OX9L 3S1QH 3HKZE 3HFZB 4OWXB 2R6GA 3PO3H 3BU2A 1PA6A 4UY8C 3K80C 4APVA 3L0OA 3J81i 2C35B 2IT1A 1JJ2A 2R92H 3I4MH 1IYJB 3H0GH 2OQKA 1L1OA 4RG1A 3JAMc 3VDYA 1VQJA 3HOYH 1Z47A 5ELNA 4R4CA 3MEFA 2I5HA 4A3EH 4P71A 1U5KA 4GOPA 4DR7L 5LMUL 3PUYA 4ME3A 3HOUG 1IBLL 4IO9A 4LFAL 2ZTDA 4JI1Q 5JJLA 2BA1A 4JBWA 5C4XH 1S40A 2PNHA 3U4ZA 3A5UA 5AJ3Q 3JAMi 1HNZQ 2K5VA 3UDIA 2MNAA 2Q2HA 4YCUA 1YHAA 2JA7H 1DGSA 4DR5Q 2WAQG 2JEAI 4KI0A 1KC8C 2R7FA 3KF6A 4DR3Q 1PH3A 5LMNQ 4A3KG 1BVSA 3S1MH 1A63A 1JEIA 3Q8DA 4DV4L 1NJIC 3KJPA 1G291 4C3IH 4A93H 1OXXK 1D7QA 4IOCA 1L1OC 1LUZA 5EAYA 1U0LA 4LF5Q 4GKKQ 1Y1WH 1UWVA 4JI1L 1N9WA 1CKNA 4GOPC 4A75A 5AJ3L 4DR2Q 1Q8KA 1EIFA 3RN5A 2HHHQ 2LSSA 3ERSX 1K8AC 2MO0A 2E2IH 4DR5L 1E3PA 1PH6A 4GLVB 4QGUA 1EYGA 5C0XG 3PUWA 4DR6Q 4J15A 2Y0SG 3HKSA 5HY6A 4QIWE 1Z9FA 3HOZH 5ELOA 5C3EG 3I4NH 1D8LA 4BY1G 1JB7A 1Y1VG 4LF5L 4GKKL 2AKWB 2Q2IA 1VQEA 3CMEA 2UUAQ 3A0JA 3GTPH 3KF8B 1VQ7A 4BXXG 3S1NH 2KENA 4JI7Q 1PH2A 3G48A 3WWVA 1HR0W 2HHHL 4AQYQ 3MXNB 3UDGA 1ASYA 1VQ5A 4BBSH 3ZJYC 3RLFA 3M4QA 4YY3Q 2CQOA 5M3MG 1SR3A 4DV7Q 4JV5L 2UXDQ 1XPUA 1L0WA 5BR8L 4IPGA 3ULLA 5IYBG 5DLQE 1QUQB 4LUOA 1KRSA 4TQUS 3H0GG 1W2BA 4GNXB 1Q82C 2E8GA 4B3TQ 4A3GH 1IZ6A 1N36Q 4A3EG 2UUAL 3TS0A 2JEBI 1OXUA 3HOXH 1VQOA 4A3CG 1VQKA 2HJQA 4HIOA 5FLMG 4POGA 1KXLA 1GVPA 4DV1Q 1TWGH 1X3FA 2A19A 4AQYL 1VQGA 4DAYB 5IYDG 1PH1A 2K52A 2JA8G 5C4XG 1JE5A 1E7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO1 G;  1K0R A;  4YY3 L;  4MNO A;  4YCV A;  2E2J H;  1EUJ A;  4L5Q A;  2JA7 G;  2UXD L;  1UE1 A;  4JG2 A;  2D0O A;  2MO1 A;  1YBY A;  2WB1 G;  4HJ5 A;  3BJU A;  5FLX c;  3CCU A;  4DV0 Q;  1EFW A;  3CW2 C;  3I55 A;  1N36 L;  4MTN A;  4A93 G;  5GAE C;  1HZC A;  1N34 Q;  2AMC B;  4KHZ A;  2ASB A;  3BZC A;  3CQZ H;  1KAW A;  1PH7 A;  2F4V L;  2AWN A;  4HID A;  1VQI A;  1VQN A;  4A3F G;  2ZTC A;  1YEZ A;  4X65 L;  4DAM A;  2QGQ A;  3GTM H;  2B29 A;  3KJO A;  1QUQ A;  1V43 A;  3A5Z B;  5JEA J;  1PYB A;  3NBH B;  3UDX A;  5C4J H;  4GNX A;  3GTG H;  4A3D G;  1E22 A;  1IBK L;  3S2D H;  1VQB A;  4GN5 A;  1EQR A;  3TQY A;  1X3G A;  4GN4 B;  1B8A A;  3KDF B;  1KQS A;  3RLN A;  4A3J G;  5FJ8 H;  2NZO A;  4YHH Q;  2QNF A;  1LYL A;  1TWH H;  1AH9 A;  2B3G A;  4DKA C;  4LW1 A;  1UE5 A;  2JA9 A;  1IBL Q;  3U50 C;  2R92 G;  1B7Y B;  2CCZ A;  1HZA A;  2I5L X;  5IYC G;  3CCQ A;  3ICE A;  3PO2 H;  2DGY A;  1K8G A;  3PGZ A;  2ATW A;  4BBS G;  3OTO Q;  3NEL A;  2EQS A;  1YJ9 A;  1XJV A;  4GNX C;  2K50 A;  1E7Z A;  1TWF H;  4C2M H;  1WOC A;  3F2C A;  3J80 c;  4DV4 Q;  5IY0 A;  1A62 A;  5IP7 H;  4YHH L;  1J5E Q;  4JYA Q;  3GTJ H;  1VQP A;  4JBK A;  1VCI A;  1J6Q A;  1SE8 A;  3STB D;  5C0X I;  3HOX G;  2OQ0 A;  3GD7 A;  3J7Z C;  2KCM A;  1OXV A;  4IFD J;  4ALP A;  5M3F H;  5H1S E;  3H3V I;  4IOA A;  2KCT A;  1HZB A;  4MZ9 A;  5LMN W;  3J80 i;  5JJK A;  3OTO L;  2QEX A;  4LWC A;  3KDF A;  4JI8 Q;  2K75 A;  2MQH A;  2D62 A;  1VQ4 A;  4AIM A;  4EQ5 A;  2GN5 A;  3S1R H;  3K7A H;  3CAM A;  3FHW A;  1WCM G;  1C9O A;  3F8T A;  1J5E L;  3M4P A;  1VQF A;  3PCO B;  1NTG A;  2HQL A;  4JBM A;  2YU9 H;  4LF4 Q;  4A3L G;  4JYA L;  1FL0 A;  3E9I A;  5IP9 H;  2HT1 A;  3CCL A;  2I5M X;  4OON A;  1SFO H;  4A4I A;  3PUZ A;  1H95 A;  4B3S Q;  1X56 A;  2A1A A;  1A8V A;  1YI2 A;  3NEM A;  2L15 A;  4IPH A;  2OWO A;  1LM0 A;  3TRZ A;  1Q46 A;  4DUZ L;  3GTL H;  1P8L A;  4JI8 L;  1AE3 A;  1V9P A;  1E24 A;  3I2Z A;  4JCV E;  1YHQ A;  4A76 A;  3M3Y H;  4XIG S;  2NN6 I;  3CMA A;  4JV5 Q;  2BH8 A;  1X6O A;  2I0Q A;  4UP9 A;  5BR8 Q;  5GAG C;  3J81 j;  1KRT A;  4LF4 L;  2R7Z H;  5JEA G;  3AEV A;  3S17 H;  4GKJ Q;  1QZG A;  1K73 C;  2LXJ A;  2ES2 A;  1XNQ L;  4IPD A;  3KYH C;  1PH4 A;  4C3J H;  4OO1 I;  4B3S L;  5K36 G;  1Q86 C;  4DR1 Q;  2UUB Q;  4IJH A;  4OWW B;  1VQ6 A;  2UUC L;  3AFP A;  4QQB X;  1EWI A;  1MKH A;  1EQQ A;  4BA2 I;  1CSP A;  1Y14 B;  2ZJR A;  4BY7 G;  2XTI A;  2RF4 A;  1VQ8 A;  2R93 G;  3PO2 G;  1N33 L;  4B3R Q;  1SRO A;  2Q2U A;  3U4V A;  2D0P A;  3TEH B;  2AHO B;  2VS1 A;  4HIK A;  4NPS A;  5GAD C;  3HOV G;  3M7N A;  4K0K Q;  3BZK A;  1QZH A;  1KD1 C;  3EBE A;  4R4I A;  2VY3 A;  3PO3 G;  4GKJ L;  4YWL A;  3M9B A;  3E0E A;  2K5H A;  3I4M G;  4WJ3 M;  3W1B A;  3NEN A;  3LGJ A;  5IP7 G;  1SRU A;  4A3B H;  3HOY G;  4DNI A;  2IHF A;  4DUY L;  2ZJQ A;  2RHS B;  3RZO H;  4Y7N H;  3K81 C;  4DR1 L;  1C7Y A;  4DV2 Q;  5HGQ A;  2UUB L;  2IX1 A;  2VUM H;  2HIV A;  4P73 A;  2F4V Q;  4LUZ A;  2VW9 A;  4PMW A;  3S15 H;  3OYY A;  3DM3 A;  4GS3 A;  4X65 Q;  4B3R L;  1VQA A;  1XMQ Q;  1PH9 A;  2B63 H;  2BH2 A;  4X66 Q;  4P72 A;  2MFI A;  1XNR L;  4K0K L;  1KHI A;  4JI3 L;  3CP0 A;  4IFD G;  4R4Q A;  1XPR A;  1IBK Q;  1HR0 Q;  1CSQ A;  1NE3 A;  2N78 A;  4HJA A;  4L5T A;  3PIP A;  1M1K C;  3W1G A;  1HNX L;  2HIX A;  1EIY B;  4BY7 H;  1X9N A;  3CCJ A;  3HOU H;  1PVO A;  4DV2 L;  3GTK H;  2ID0 A;  4FDB A;  1Y1W G;  1C0A A;  1UEB A;  2N3S A;  2Q2T A;  2ALY B;  1X54 A;  3A74 A;  2RCN A;  2VZA A;  4POF A;  4R4T A;  3G4S A;  1XMQ L;  1AE2 A;  4NXM L;  2PI2 E;  4X66 L;  1VQL A;  1SN8 A;  5M5X H;  3KLW A;  2CWP A;  2BA0 A;  4O2D A;  3T1Y Q;  1I94 Q;  4KLK A;  1YHB A;  3CPW A;  1T9H A;  1HR0 L;  2WFW A;  4JI2 Q;  3PV0 A;  1I50 H;  4A3K H;  4LUV A;  1Q1B A;  2K5N A;  2RHQ B;  3GO5 A;  3HOZ G;  1LTL A;  1X55 A;  1E1T A;  2YTX A;  3I4N G;  2WP8 J;  3RR5 A;  1Q7Y C;  3L7Z C;  2CKZ B;  1SLJ A;  2IX0 A;  2Z6K A;  2GVA A;  3AYH B;  1VQ9 A;  3GTQ H;  4GLA C;  4DR4 Q;  1YNX A;  1YVC A;  4X62 L;  2LXK A;  5JJI A;  3S2H H;  3PSI A;  3CCE A;  2AWO A;  4KHP Q;  3RN2 A;  3G71 A;  4RMF A;  3T1Y L;  1I94 L;  4UPA A;  1I6H H;  3I56 A;  1FVI A;  3ULP A;  4PZ7 A;  4JI2 L;  3CCV A;  4A3I H;  3GTO H;  1CKM A;  3H3V H;  2DUD A;  3SGI A;  3K7U C;  1Q81 C;  1EOV A;  1OXS C;  2JK8 A;  1A0I A;  5C3E H;  3CCS A;  1I3Q H;  4BY1 H;  1Y1V H;  3F1Z A;  3F2B A;  2E2H H;  4A3G G;  2KHI A;  4DR4 L;  4IPC A;  3CC4 A;  4BXX H;  4R1J A;  4JI5 Q;  1HNW Q;  2Z6K C;  3AQQ A;  2UXC Q;  3B6Y A;  1JJG A;  4DV6 L;  1TXY A;  4KHP L;  1N32 L;  4A3C H;  4XTC S;  4YCW A;  1JMC A;  1E1O A;  5IE8 A;  1Q1E A;  4GN3 B;  3UE0 A;  3K8A A;  2YTV A;  5M3M H;  4DUZ Q;  3CC2 A;  1KL9 A;  2ZJP A;  3CD6 A;  1B70 B;  5IYB H;  2IY5 B;  5IT9 c;  3RLO A;  1FJG Q;  1JT8 A;  3I7F A;  2JA6 H;  3CC7 A;  3CF5 A;  3FP9 A;  2VQF Q;  2ZM6 Q;  1XNQ Q;  1YZ6 A;  4JOI A;  5C44 H;  1IXR A;  3RZD H;  1G51 A;  4JI5 L;  1VQC A;  3CXC A;  4DK6 C;  4LNQ A;  2NZH A;  1RL2 A;  1X3E A;  4DV3 Q;  2K4K A;  3TRE A;  5FLM H;  1YIT A;  1K9M C;  1QVF A;  2UXC L;  3IRB A;  2JA8 H;  2CFM A;  5IYD H;  2UUC Q;  3PUV A;  2YTY A;  1HNW L;  4WJ4 A;  4DV5 Q;  1HH2 P;  2KHJ A;  3UE1 A;  2QNC A;  1N33 Q;  3F2D A;  1RIP A;  1WJJ A;  1NY4 A;  2NVQ H;  1W3S A;  4BA1 I;  3J7A 5;  1G6P A;  1FJG L;  2PI2 A;  2EXD A;  3M4O H;  2QA4 A;  3GDE A;  5M5Y H;  1WFQ A;  2WAQ E;  3KOJ A;  4LF8 Q;  5GQO A;  2VQF L;  2ZM6 L;  1QVC A;  3OW2 A;  2CWA A;  5FJ8 G;  4TVA B;  1XPO A;  4DR6 L;  4DV3 L;  3S14 H;  4DUY Q;  1CKO A;  1YJN A;  4IFD I;  4JOI C;  4A3F H;  1PFS A;  4BBR H;  1SMX A;  1PHJ A;  4B3M Q;  4LF6 Q;  4PG3 A;  2XGT A;  4DV5 L;  1GKH A;  3FKI H;  1HNZ L;  4HIM A;  4A3L H;  2K14 A;  4X64 Q;  3D31 A;  2JA5 H;  4JI0 Q;  2FXQ A;  3RNU A;  1N8R C;  1KIX A;  1IBM Q;  4LF7 Q;  3KFU A;  1PH5 A;  1XNR Q;  4A3D H;  4HJ7 A;  4R4O A;  4JI3 Q;  1VS0 A;  4DR3 L;  5LMN L;  4A3M H;  1MJC A;  1XTD A;  4A3I G;  2OTL A;  4LFC Q;  4LF8 L;  3S16 H;  1M90 C;  2JE6 I;  5IWA Q;  2Y0S E;  1VQD A;  1NBW A;  4A3J H;  1HNX Q;  4OXP A;  2NVT H;  4O0A A;  2PMZ E;  2YV5 A;  3CCR A;  1CUK A;  1VQH A;  1WYD A;  4H02 A;  2A8V A;  2KBN A;  1L2F A;  1E7L A;  4B3M L;  4LF6 L;  2VL6 A;  5IYC H;  3PIO A;  3I4O A;  4DR2 L;  5M3F G;  3HOW H;  3JC6 6;  3TS2 A;  2NVY H;  2JQO A;  3S24 A;  4DPG A;  4X64 L;  4JI0 L;  4NXM Q;  1IBM L;  4LF7 L;  4P75 A;  2VQE Q;  1UE7 A;  4LFC L;  4YWM A;  3CCM A;  4C3H H;  4HJ9 A;  2JA6 G;  3STB C;  5IWA L;  1BBW A;  1K83 H;  2Z0S A;  3G6E A;  4HJ8 A;  1WI5 A;  5IP9 G;  5C44 G;  1MIU A;  2V1C C;  2NN6 G;  2E5L Q;  1UE6 A;  1PH8 A;  2JJQ A;  1BKB A;  3W5O A;  5GAH C;  4JI7 L;  3EIV A;  1V1Q A;  1OTC A;  3ER0 A;  4X62 Q;  2EIF A;  2PQA B;  1NMG A;  1S72 A;  4DK3 C;  2UU9 Q;  2VQE L;  3PUX A;  1PYS B;  4QL5 A;  2ZTE A;  2IHE A;  4DV7 L;  4LF9 Q;  2VNU D;  4JI6 Q;  4NXN Q;  3ULJ A;  1OXT A;  1GM5 A;  2H5X A;  3D0F A;  1WCM H;  4QJF A;  4L5R C;  4B3T L;  4AYB G;  4NB3 A;  4JI4 Q;  1R9T H;  4AH6 A;  2R7Z G;  2WB1 E;  1TWC H;  4X6A H;  1NMF A;  1X65 A;  4AYB E;  2E5L L;  2NVX H;  2YYZ A;  3EN2 A;  1YIJ A;  1PV4 A;  1GD7 A;  2F52 A;  5C0X J;  4DV1 L;  1L1O B;  4UP8 A;  4BBR G;  3UDF A;  4EX5 A;  1S3O A;  4DV6 Q;  2F3I A;  3U58 A;  1QVG A;  3M85 A;  1HZ9 A;  4PZ8 A;  2UU9 L;  4LFB Q;  4JBJ A;  3FKI G;  4JC0 A;  1N32 Q;  4GOP B;  5J3B A;  1IL2 A;  2OCE A;  4LF9 L;  3E9H A;  4QY7 A;  3T1H Q;  1HJP A;  2GVB A;  2R7D A;  1ASZ A;  4P74 A;  4NXN L;  2JA5 G;  4JI6 L;  1XMO Q;  5M5W H;  2UXB Q;  4OX9 Q;  1BBU A;  3PF4 A;  4A3M G;  1EN7 A;  1O7I A;  4DV0 L;  1Q12 A;  4JI4 L;  2OTJ A;  1TWA H;  4OWT B;  5E7N A;  1N34 L;  1GO3 E;  2PQA A;  4A3B G;  4UP7 A;  3KF6 B;  1P16 A;  4PZ6 A;  4DR7 Q;  3DLL A;  5LMU Q;  4GLX A;  2N8N A;  2VUM G;  4LFA Q;  3J81 c;  2R93 H;  3L2P A;  3PF5 A;  4L5S A;  5GRO A;  1VQM A;  3CPF A;  3HOW G;  1JJC B;  1K3R A;  4LFB L;  1YJW A;  4Y52 H;  3AFQ A;  2N49 A;  3HKZ G;  3H15 A;  3T1H L;  3K0X A;  4IJL A;  1I5F A;  1FGU A;  4YWK A;  1MJE A;  2B63 G;  1XMO L;  3HOV H;  2UXB L;  1CKN B;  4OX9 L;  3S1Q H;  3HKZ E;  3HFZ B;  4OWX B;  2R6G A;  3PO3 H;  3BU2 A;  1PA6 A;  4UY8 C;  3K80 C;  4APV A;  3L0O A;  3J81 i;  2C35 B;  2IT1 A;  1JJ2 A;  2R92 H;  3I4M H;  1IYJ B;  3H0G H;  2OQK A;  1L1O A;  4RG1 A;  3JAM c;  3VDY A;  1VQJ A;  3HOY H;  1Z47 A;  5ELN A;  4R4C A;  3MEF A;  2I5H A;  4A3E H;  4P71 A;  1U5K A;  4GOP A;  4DR7 L;  5LMU L;  3PUY A;  4ME3 A;  3HOU G;  1IBL L;  4IO9 A;  4LFA L;  2ZTD A;  4JI1 Q;  5JJL A;  2BA1 A;  4JBW A;  5C4X H;  1S40 A;  2PNH A;  3U4Z A;  3A5U A;  5AJ3 Q;  3JAM i;  1HNZ Q;  2K5V A;  3UDI A;  2MNA A;  2Q2H A;  4YCU A;  1YHA A;  2JA7 H;  1DGS A;  4DR5 Q;  2WAQ G;  2JEA I;  4KI0 A;  1KC8 C;  2R7F A;  3KF6 A;  4DR3 Q;  1PH3 A;  5LMN Q;  4A3K G;  1BVS A;  3S1M H;  1A63 A;  3Q8D A;  4DV4 L;  1NJI C;  3KJP A;  1G29 1;  4C3I H;  4A93 H;  1OXX K;  1D7Q A;  4IOC A;  1L1O C;  1LUZ A;  5EAY A;  1U0L A;  4LF5 Q;  4GKK Q;  1Y1W H;  1UWV A;  4JI1 L;  1N9W A;  1CKN A;  4GOP C;  4A75 A;  5AJ3 L;  4DR2 Q;  1Q8K A;  1EIF A;  3RN5 A;  2HHH Q;  2LSS A;  3ERS X;  1K8A C;  2MO0 A;  2E2I H;  4DR5 L;  1E3P A;  1PH6 A;  4GLV B;  4QGU A;  1EYG A;  5C0X G;  3PUW A;  4DR6 Q;  4J15 A;  2Y0S G;  3HKS A;  5HY6 A;  4QIW E;  1Z9F A;  3HOZ H;  5ELO A;  5C3E G;  3I4N H;  1D8L A;  4BY1 G;  1JB7 A;  1Y1V G;  4LF5 L;  4GKK L;  2AKW B;  2Q2I A;  1VQE A;  3CME A;  2UUA Q;  3A0J A;  3GTP H;  3KF8 B;  1VQ7 A;  4BXX G;  3S1N H;  2KEN A;  4JI7 Q;  1PH2 A;  3G48 A;  3WWV A;  1HR0 W;  2HHH L;  4AQY Q;  3MXN B;  3UDG A;  1ASY A;  1VQ5 A;  4BBS H;  3ZJY C;  3RLF A;  3M4Q A;  4YY3 Q;  2CQO A;  5M3M G;  1SR3 A;  4DV7 Q;  4JV5 L;  2UXD Q;  1XPU A;  1L0W A;  5BR8 L;  4IPG A;  3ULL A;  5IYB G;  5DLQ E;  1QUQ B;  4LUO A;  1KRS A;  4TQU S;  3H0G G;  1W2B A;  4GNX B;  1Q82 C;  2E8G A;  4B3T Q;  4A3G H;  1IZ6 A;  1N36 Q;  4A3E G;  2UUA L;  3TS0 A;  2JEB I;  1OXU A;  3HOX H;  1VQO A;  4A3C G;  1VQK A;  2HJQ A;  4HIO A;  5FLM G;  4POG A;  1KXL A;  1GVP A;  4DV1 Q;  1TWG H;  1X3F A;  2A19 A;  4AQY L;  1VQG A;  4DAY B;  5IYD G;  1PH1 A;  2K52 A;  2JA8 G;  5C4X G;  1JE5 A;  1E7D A; 
#chains in the Genus database with same CATH topology
 4OO1 G;  1EOT A;  4V0B A;  1UE1 A;  2MJ8 A;  2N88 A;  4HSP A;  5C3E B;  4WOR A;  2K32 A;  5FLX c;  2QIL A;  2E2H B;  1JR0 D;  3CW2 C;  3FDT A;  1N34 Q;  2ZXP A;  4KHZ A;  4CJ0 B;  3BZC A;  1PTO D;  3J7A V;  1SEB D;  4IUR A;  4LJZ C;  1IW7 D;  1EY5 A;  3NP8 A;  4X65 L;  3J81 L;  2O5J C;  2KFV A;  3NBH B;  4EQN A;  2OF1 A;  2I46 A;  4GNX A;  4A3D G;  1AW7 A;  1IBK L;  3KUP A;  4GN5 A;  1EQR A;  4XT1 B;  3TQY A;  1X3G A;  3NTK A;  2D2C C;  1HFN A;  1T5X D;  2RNO A;  1K3B C;  5FJ8 H;  4YHH Q;  5K36 H;  4KY7 A;  4DKA C;  4LW1 A;  2JA8 B;  2EY5 A;  2DY7 A;  3BYY B;  2CCZ A;  3CCQ A;  3PO2 H;  2XSC A;  1I4R A;  2NVQ B;  2ATW A;  4BBS G;  4KD3 A;  4A93 B;  1WOC A;  1CM9 A;  3TME A;  3J80 c;  1AFP A;  3SK6 A;  5IP7 H;  5EBD A;  4JBK A;  1UEA B;  3X3M A;  1K28 A;  3NBH A;  3H94 A;  3HOX G;  3J7Z C;  4HMJ A;  1TS3 A;  1D6E C;  4ALP A;  3H3V I;  2O4X A;  5JJK A;  2XWB B;  2QEX A;  1NR2 A;  1R4Q B;  4JI8 Q;  1EZ6 A;  3FLG A;  1G2S A;  3S1R H;  3FHW A;  4HED A;  3EQL C;  3ITP A;  3VYS A;  3EFX D;  2K05 A;  3E9I A;  2I5M X;  2WQG A;  2EYP A;  2Z9H A;  3QR8 A;  4IPH A;  3Q22 A;  3D4D A;  1LV9 A;  3D6C A;  1ZS9 A;  1AE3 A;  1V9P A;  4KK7 A;  5HUR A;  1YHQ A;  4FP5 D;  1D5X C;  4JV5 Q;  4UP9 A;  1K83 B;  5GAG C;  3VA5 A;  1PTO C;  1CTM A;  1RJT A;  1IW7 C;  1QIL A;  4IPD A;  5CV9 A;  4OO1 I;  1F2Z A;  2JYO A;  1FNV A;  5JJZ A;  4DR1 Q;  2UUB Q;  1KLU D;  4OWW B;  3GQB A;  2Z6B A;  1PRT B;  3AFP A;  1MKH A;  4BA2 I;  2R93 G;  1EEF D;  1N33 L;  1SRO A;  4OIJ A;  3U4V A;  1D2B A;  2VS1 A;  2PPB C;  5GAD C;  5CGK A;  3BZK A;  1KD1 C;  2KA7 A;  3EBE A;  2N55 A;  4R4I A;  1PRT F;  1TWC B;  2QEJ C;  3M9B A;  3E0E A;  1RD9 D;  3W1B A;  3TBI B;  4XYQ A;  3S1M H;  1C7Y A;  2IX1 A;  1CA6 A;  2HIV A;  3P75 A;  3D6W A;  4LUZ A;  2E74 C;  5ISR A;  4X65 Q;  4GS3 A;  2B63 H;  1II3 A;  1O7Z A;  2FIN B;  1DCZ A;  3OHX C;  1PLF A;  1XPR A;  1IBK Q;  4FF1 A;  2N78 A;  2QDB A;  2F0G A;  2OEO A;  3VR2 A;  4DNT B;  2F0T A;  1M1K C;  1TWH B;  2HIX A;  1EIY B;  1B4O A;  3ZYY X;  1STE A;  4BY7 H;  1SYF A;  3HOU H;  3OSO A;  4DV2 L;  2NUC A;  4FDB A;  1Y1W G;  1C0A A;  2Z8L A;  1B9M A;  5D3I B;  3IL8 A;  1VDZ A;  2IPK D;  2DY8 A;  3G4S A;  2VB3 X;  4X66 L;  1VQL A;  1SN8 A;  3D4W A;  4O2D A;  1I94 Q;  3PO3 B;  4K5V A;  1STN A;  3P1H A;  3H0G B;  2K5N A;  4HR7 B;  2BE5 C;  3MWY W;  2MHV A;  1SYE A;  3HOY B;  3I4N G;  4IUQ A;  1BDO A;  2CKZ B;  1SLJ A;  2Z6K A;  2GVA A;  3K5O A;  4QUF A;  4X62 L;  1SYB A;  4N8X 1;  2A6E D;  2NZ1 D;  2AWO A;  4KHP Q;  2GA4 B;  3RN2 A;  3G71 A;  2JA7 B;  2Q8R E;  5COY A;  3MFG A;  3I56 A;  2CQA A;  4R8N A;  4JVZ A;  1CKM A;  1A6X A;  3QJY A;  3K7U C;  1Q81 C;  1EOV A;  1A0I A;  4X3T A;  3CHB D;  4A3G G;  3F2B A;  2V4D A;  4BXX H;  2LC3 A;  2UXC Q;  3EA6 A;  1N32 L;  1JMC A;  1E1O A;  2B2W A;  1H9M A;  5M3M H;  5A35 A;  2ZJP A;  1B70 B;  3J81 E;  2MP1 A;  5IYB H;  3D3R A;  4IQZ A;  1V1O A;  1WTQ A;  4CBV A;  4ZAI A;  3VR6 A;  4RHS A;  2NN6 H;  4JI5 L;  1VQC A;  1VMP A;  3CXC A;  3S15 H;  2F0D A;  4FF3 A;  2TSS A;  1HA6 A;  4WJ4 A;  1N33 Q;  3J7Y W;  1LTB D;  1I4Q A;  1IYV A;  3KBX A;  4LF8 Q;  2QDL A;  2ZM6 L;  2AUK A;  4X3S A;  5C4H A;  1QVC A;  3OW2 A;  4Y7N B;  5KYL A;  5FJ8 G;  4TVA B;  1GUS A;  4DR6 L;  2RVL A;  4JOI C;  3K5L A;  1PFS A;  4BBR H;  1SMX A;  2WII B;  1PHJ A;  5KRU A;  1EIH A;  4K14 A;  1HNZ L;  3PMF A;  1YNN D;  4A3L H;  4X64 Q;  2JA5 H;  1RTO A;  1N8R C;  4LF7 Q;  3BVZ A;  5EPK A;  4R4O A;  2JSO A;  5LMN L;  1XTD A;  3TDQ A;  4LFC Q;  1H1J S;  2A6E C;  5DM7 3;  5I2X A;  5EQ0 A;  3D4R A;  3R3O A;  1L2F A;  1S5D D;  2Z1C A;  3GTM B;  3PIO A;  2RSN A;  3JC6 6;  1K8M A;  2NVY H;  4S3S A;  4DPG A;  4JI0 L;  3GTG B;  4K5X A;  3HEJ A;  2ZT9 C;  2VQE Q;  4ID6 A;  1ZYR D;  4KY6 A;  5LL6 S;  4YWM A;  3CCM A;  4FXG C;  1BBW A;  1G91 A;  2Z0S A;  2AQ2 B;  4L6T B;  1UE6 A;  5GAH C;  1UNS A;  4JI7 L;  4K6D A;  2K28 A;  4IUP A;  4X62 Q;  1NMG A;  3K5N A;  1A3U A;  2EJF C;  4QL5 A;  5EKK A;  1U4M A;  4NXN Q;  3ULJ A;  4C2M B;  3EJI A;  2PMZ B;  3D0F A;  1WCM H;  2F4I A;  3QB3 A;  2WKD A;  1LT6 D;  1WVL A;  4B3T L;  1JOQ A;  2WB1 E;  2OT2 A;  4R9W A;  3GTJ B;  3NXW A;  2IX3 A;  4NDX A;  4RA8 A;  2X69 A;  1GD7 A;  4RCN A;  5C0X J;  1B50 A;  1L1O B;  1S3O A;  2EDG A;  1N32 Q;  1HZ9 A;  4PZ8 A;  4LFB Q;  3FKI G;  1HPC A;  1GJX A;  4GOP B;  5J3B A;  2EY1 A;  4LF9 L;  1BBU A;  3VR4 A;  2JA6 B;  4A3M G;  5IT9 L;  2YU9 B;  5EPJ A;  1Z6H A;  4DN4 M;  1GKU B;  3DWA A;  1P16 A;  1YNN C;  3DLL A;  3RUZ A;  1EYD A;  4LFA Q;  2Q8T A;  3PF5 A;  4L5S A;  2F3W A;  4ZCK A;  1UAP A;  1JJC B;  1TVX A;  1YJW A;  3HKZ G;  2NTT A;  2B63 G;  1I5F A;  4QF4 A;  1TS2 A;  3N52 A;  1XMO L;  3HOV H;  1BNZ A;  1CKN B;  3M4O B;  1I4P A;  2CH4 A;  2HUG A;  3BU2 A;  3TP5 A;  2R7Z B;  3K80 C;  4APV A;  3J81 i;  2IT1 A;  3I4M H;  1FD7 D;  1L1O A;  3JAM c;  3VDY A;  1BR9 A;  3QWN A;  2I5H A;  4GOP A;  1ONL A;  3HOU G;  3PUY A;  4CGY B;  1PTO H;  4IO9 A;  1D1K A;  1ZYR C;  1S40 A;  2PNH A;  1HNZ Q;  4CDF C;  2HCC A;  1F2M A;  2Q2H A;  2IW3 A;  3G6J B;  4KI0 A;  4RHR A;  1PH3 A;  2RDH A;  1JOK A;  5LMN Q;  1JEI A;  1SE3 A;  1S4Z A;  4DV4 L;  2L9H A;  3KJP A;  1NJI C;  4C3I H;  2EPB A;  4WFN 3;  5EAY A;  1LUZ A;  4ZUJ A;  4JI1 L;  3HOW B;  1CKN A;  5KIX A;  4A75 A;  1PRT D;  2F0L A;  2LSS A;  3ERS X;  1K8A C;  2HHH Q;  1EYC A;  4PV1 C;  5E4X A;  4DR5 L;  1PH6 A;  5HGT A;  1XX8 A;  3PUW A;  4G57 A;  5C0X G;  4J15 A;  1MGS A;  2FMM A;  4QIW E;  1WTW A;  1FYC A;  1G8Z D;  3HOZ H;  3E3X A;  4GKK L;  3E0J A;  4BXX G;  1VQ7 A;  1Q90 A;  4ZQ3 A;  3S1N H;  4JI7 Q;  4WRD A;  3I4L A;  3WWV A;  3UDG A;  1ASY A;  4BBS H;  1BUV T;  3QOL A;  5M3M G;  4A3K B;  1L0W A;  5IYB G;  1IYU A;  1QUQ B;  1R9T B;  4DFA A;  3BVG A;  4LUO A;  5E4W C;  3NTI A;  3H0G G;  1W2B A;  4HMI A;  1Q82 C;  5IIF A;  4B3T Q;  1IZ6 A;  3GV3 A;  1N36 Q;  1QCB D;  4KY5 A;  2B8F A;  4CJ2 C;  2UUA L;  1VQO A;  4TRD A;  3HOX H;  1GUT A;  2HJQ A;  5C3X A;  4POG A;  1QNK A;  5KEE A;  2A19 A;  4AQY L;  1VQG A;  1I6H B;  1E7D A;  1EWH A;  5K5P A;  1EY9 A;  1K0R A;  1EUJ A;  2QF7 A;  2Y0S B;  4L5Q A;  2JA7 G;  3GTO B;  2UXD L;  2D0O A;  2MO1 A;  3VR5 A;  1LT5 D;  2WB1 G;  3NPP A;  4HJ5 A;  1GJJ A;  4BY1 B;  1F2L A;  1Y1V B;  1JE4 A;  2HDL A;  3I55 A;  2F0N A;  5GAE C;  3NWS A;  3R2T A;  5CV4 A;  2ASB A;  3CQZ H;  1BBX C;  4PQX A;  1NCV A;  2AWN A;  4HID A;  2D9U A;  4DAM A;  2B29 A;  1QUQ A;  1V43 A;  5J1Z A;  1E2V A;  2FMC A;  1PYB A;  4CKB A;  1HFG A;  1ZEQ X;  4HCS A;  2EYJ A;  4I7Z C;  1EY8 A;  1HTP A;  2VB2 X;  4A3E B;  3KDF B;  3RZD B;  3RLN A;  1CZG A;  3D8G A;  2R61 A;  1UE5 A;  5C4X B;  3U50 C;  5G3L F;  2I5L X;  3ICE A;  1ENF A;  3QOJ A;  4TSS A;  4FYD A;  3PGZ A;  3OTO Q;  1JJR A;  2EQS A;  1LAB A;  4IN3 A;  3MA2 B;  4AYB B;  5EBC A;  4DXG A;  4OL7 A;  3SHL A;  1TWF H;  4KKT A;  2K33 A;  1H9F A;  5DNF A;  1NR4 A;  4DV4 Q;  1J5E Q;  1A62 A;  4YHH L;  5IGF A;  1LT3 D;  3H09 A;  5IOD A;  4A3F B;  1SE8 A;  5C0X I;  1AP0 A;  3AMU A;  2KCM A;  1OXV A;  3C1E A;  1B9N A;  2G80 A;  1EQV A;  5M3F H;  1LAC A;  4U68 A;  5EGT A;  4X3K A;  2E2D C;  5FKA C;  4OHJ A;  1HHV A;  5FOB B;  5JVH 3;  3KDF A;  2RDF A;  2K75 A;  2MQH A;  5I6W A;  4AIM A;  2EYM A;  4EQ5 A;  3TP7 A;  1LTG D;  1STA A;  2F0M A;  3K7A H;  1WCM G;  4A3J B;  3F8T A;  4CKE A;  2A68 C;  1NTG A;  2HQE A;  2B2U C;  4JBM A;  2HT1 A;  3CCL A;  5JPM C;  3PUZ A;  2R92 B;  4B3S Q;  1A8V A;  2L15 A;  5FO8 B;  1LM0 A;  3TRZ A;  1Q46 A;  2LKV A;  3GTL H;  1P8L A;  4JI8 L;  1E24 A;  3I2Z A;  1PMR A;  3M3Y H;  4C3H B;  2NN6 I;  2B2W C;  4KKU A;  2JVW A;  1X6O A;  3AEV A;  4GKJ Q;  1QZG A;  1K73 C;  1DYQ A;  1EIG A;  3KYH C;  4C3J H;  5EPL A;  1H9R A;  4IJH A;  1SBB B;  2RA4 A;  3V2T A;  1EWI A;  5ELD A;  3FVQ A;  3UI2 A;  2RF4 A;  3K6O A;  1FGB D;  2Q2U A;  4B3R Q;  5DAU A;  2B39 A;  4HIK A;  2AHO B;  3HOV G;  2KCC A;  1QZH A;  2H1E A;  1RDP D;  3MEH A;  2B2Y A;  3I4M G;  5FLX L;  2LMC B;  3LGJ A;  3R8B A;  4DNI A;  2ZJQ A;  2XIW A;  1BCP C;  4DR1 L;  2UUB L;  4DU9 A;  1CHQ D;  1TT2 A;  3N6R A;  1JOO A;  2VW9 A;  4PMW A;  2AQ1 B;  3DM3 A;  1VQA A;  4QB4 A;  5KGU A;  2EXZ A;  1XNR L;  5M5W B;  1KHI A;  4B9X A;  1CZW A;  1HR0 Q;  2K03 A;  2EZV A;  1SNM A;  1SXT A;  4N9P A;  4FO2 A;  1HNX L;  2B2T A;  4C3I G;  5C4Z A;  2EYF A;  1WTH A;  2IL8 A;  1KAB A;  1Y69 U;  4TKO B;  1WD0 A;  4DK0 A;  3PO2 B;  3A74 A;  4POF A;  2EVB A;  1T5E A;  4C56 C;  4ZYS A;  2PI2 E;  2XNA C;  2M9V A;  3KLW A;  2BA0 A;  5M5X H;  3S1Q B;  2QW7 A;  1QG7 A;  2AUJ D;  2ZXR A;  2WFW A;  4RKB A;  4JI2 Q;  3PV0 A;  1O7L A;  1HTL D;  3GO5 A;  3HOZ G;  1LTL A;  2EYH A;  3RR5 A;  4K8J A;  1SMY D;  3J80 L;  3GTQ H;  2IX0 A;  2IWH A;  1VQ9 A;  4DR4 Q;  5JJI A;  5ELF A;  2QKI C;  3TZU A;  3S2H H;  3PSI A;  4DA2 A;  1I94 L;  3L3O C;  1FVI A;  1QNU A;  4KJO A;  3MC0 B;  1OXS C;  5C3E H;  3CCS A;  2E2H H;  2I07 B;  4H13 C;  3R93 A;  3SK5 A;  1F9R A;  4KHP L;  4XDX A;  4YCW A;  2O5I C;  2E2I B;  4GN3 B;  4GZY C;  3UE0 A;  2L1B A;  1WTO A;  3CC2 A;  1KL9 A;  2LD7 A;  1S5F D;  1FJG Q;  1JT8 A;  3I7F A;  3CC7 A;  4IUN A;  2VQF Q;  2PCF B;  3ONA B;  3GTP B;  1G51 A;  1LTA D;  1JJG A;  2NZH A;  1X3E A;  4A3C H;  4DV3 Q;  2UXC L;  3TRE A;  2PO4 A;  2JA8 H;  2EY6 A;  2PNR C;  4DV5 Q;  1ZXT A;  3F2D A;  1WJJ A;  2NVQ H;  1KAA A;  1L0Y B;  3DUZ A;  1PZJ D;  3FPU B;  2EXD A;  2QA4 A;  3DXJ C;  4FF2 A;  1EL0 A;  5M5Y H;  1G2T A;  2WAQ E;  3KOJ A;  3DEO A;  5J39 A;  1GOZ A;  2X6L A;  1DD2 A;  2CWA A;  1HRJ A;  1EY7 A;  1PZI D;  2HD3 A;  3A8I E;  3KBG A;  1KHC A;  4LF6 Q;  4PG3 A;  1GKH A;  2E2J B;  3FKI H;  3DWQ A;  5FO9 B;  3O13 A;  3RNU A;  3KFU A;  1XYI A;  3QIA A;  1XNR Q;  1SMY C;  2D5D A;  4A3M H;  3MTS A;  2FJ2 A;  2OTL A;  4A3I G;  2PYK A;  4LF8 L;  3S16 H;  1M90 C;  4J8Q A;  1Y8P B;  5A2Q L;  4BY7 B;  1VQD A;  1HNX Q;  4G7Z C;  2KCN A;  3PIP 3;  2YV5 A;  1WYD A;  4H02 A;  2A8V A;  2KBN A;  2VL6 A;  4DR2 L;  2CW0 D;  5M3F G;  5C4J B;  4X64 L;  3OWF A;  2ODC I;  4LF7 L;  4ODG A;  5DEH A;  3S2D B;  5D65 A;  4LFC L;  2IJ0 A;  1G6Z A;  1K83 H;  2A73 B;  4DNR B;  3I90 A;  5C44 G;  1PH8 A;  2JJQ A;  3ER0 A;  4HSV A;  1JOR A;  2UU9 Q;  2VQE L;  2BDO A;  2ZTE A;  2K5Q A;  2VNU D;  4JI6 Q;  4UAI A;  1GM5 A;  1UUP A;  2H5X A;  4JI4 Q;  5G3L D;  4AYB G;  3A7L A;  4AH6 A;  3FRP B;  1TWC H;  3K0Y A;  4X6A H;  3K58 A;  1NMF A;  4C3J G;  3NSW A;  2YYZ A;  3EN2 A;  2NVX H;  4JK1 C;  3QKJ A;  5FLX E;  1XWE A;  3UDF A;  2F3I A;  1BF4 A;  3A8J E;  1IHZ A;  2KED A;  3AU7 A;  3C1F A;  1MSH A;  2EOT A;  2OCE A;  1TU2 B;  3T1H Q;  1ASZ A;  1HJP A;  3IAY A;  2R7D A;  5C0X H;  4P74 A;  4NXN L;  1EY6 A;  3U9O A;  2UXB Q;  2DNE A;  4OX9 Q;  1EN7 A;  1O7I A;  4DV0 L;  1Q12 A;  5JEA H;  3NE5 B;  4OWT B;  2C9O A;  1SFO B;  4BIT A;  4DR7 Q;  1JC7 A;  2EJM A;  5LMU Q;  4GLX A;  2WAC A;  3MHB A;  1B44 D;  4LFB L;  3CPF A;  1GUN A;  3RD4 A;  1MJE A;  3H15 A;  3K0X A;  4FF4 A;  4YWK A;  1STH A;  2DNC A;  2RBM A;  3HKZ E;  3MXU A;  4OWX B;  3PO3 H;  3S17 B;  1HQR D;  3L0O A;  4XQQ A;  3NHH A;  2AQ3 B;  3H0G H;  4OEM B;  3HOY H;  1Z47 A;  4P71 A;  1U5K A;  4ME3 A;  3SDZ A;  4BBR B;  1IBL L;  4LFA L;  2ZTD A;  5J22 A;  2L0C A;  5JJL A;  3CU7 A;  1QOH A;  3FEW X;  3A5U A;  2JA5 B;  4E6I A;  1EYA A;  2K5V A;  3UDI A;  4KMU C;  4YCU A;  1YHA A;  1YNJ D;  2JA7 H;  1DGS A;  4OGQ C;  2WAQ G;  4RGO S;  2R7F A;  1BVS A;  4O42 A;  4Q0F A;  4A3B B;  1ILP A;  1D7Q A;  2PZU A;  4KHV A;  2VUM B;  1U0L A;  3ND8 A;  1UWV A;  2A6H D;  2P5Z X;  4RH6 A;  4DR2 Q;  1Q8K A;  3RN5 A;  3GP7 A;  1SND A;  1WTR A;  4DGZ A;  2F0S A;  3WOE A;  4ULL A;  4M1U B;  1Z9F A;  5ELO A;  5C3E G;  2FFK B;  1D8L A;  3LNN A;  3GTK B;  1EEI D;  1MHW C;  1H9J A;  1WD1 A;  1CA5 A;  1D1I A;  3KF8 B;  2K5W A;  3Q6S A;  3G48 A;  2HHH L;  1VQ5 A;  3SE0 A;  2NB0 A;  4YY3 Q;  1D5Z C;  2CQO A;  5CV7 A;  1I50 B;  5CBE E;  5BR8 L;  4J6H A;  3WDN A;  3MFY A;  1PDQ A;  1XTC D;  5C5M A;  1DM0 B;  2JEB I;  1OXU A;  4A3C G;  1VQK A;  2F0U A;  1KXL A;  1X3F A;  2JA8 G;  5TSS A;  4QIW B;  1ILQ A;  4YCV A;  3DM1 A;  4FXK C;  4MTK A;  4JG2 A;  1YBY A;  3X3N A;  3BJU A;  1PZK D;  3KF8 A;  1D5M C;  1I3Q B;  4KV6 A;  4DV0 Q;  2NWG A;  3GV6 A;  1N36 L;  2B2Y C;  4MTN A;  4A93 G;  2AMC B;  1KAW A;  3OIP A;  1YNJ C;  2ZTC A;  2MPH A;  1YEZ A;  5A2Q E;  5EJW A;  3GTM H;  3A5Z B;  1PFB A;  5JEA J;  1ET6 A;  3GTG H;  3HP3 A;  1E22 A;  1VQB A;  1B8A A;  2A6H C;  1KNE A;  1A2U A;  3SXH A;  4F7X A;  1KQS A;  3JAM L;  3E5S A;  4CDE C;  1AH9 A;  2E75 C;  2B3G A;  2B2T C;  1S5E D;  1PXU A;  1IBL Q;  2WKC A;  1CK1 A;  4K5W A;  4LAA A;  2DGY A;  1K8G A;  1A15 A;  1XJV A;  4GNX C;  2CH4 W;  2K50 A;  1E7Z A;  3BDL A;  4C2M H;  3A54 A;  4I7A A;  3V96 A;  1M4V A;  3M7G A;  3S14 B;  3GTJ H;  1VQP A;  5BN3 A;  4JYA Q;  1VCI A;  2RKS A;  3STB D;  5FO7 B;  4IFD J;  2B8G A;  5IGB A;  5H1S E;  4IOA A;  2KCT A;  1HZB A;  4MZ9 A;  5I9P A;  5LMN W;  4A3D B;  3J80 i;  3OTO L;  3LX0 A;  2F0H A;  1SE4 A;  2GN5 A;  3CAM A;  3NK9 A;  4RGT A;  4LF4 Q;  1J5E L;  3M4P A;  2NVT B;  2YU9 H;  1GUO A;  1LLR D;  4OON A;  5CMD A;  2HDM A;  2A1A A;  1ZBH A;  1YI2 A;  2MUY A;  4BBS B;  2OWO A;  4G4K A;  3MXG A;  1SYD A;  4O1N A;  2E76 C;  2SOB A;  4A76 A;  3CMA A;  2BH8 A;  2I0Q A;  5BR8 Q;  3J81 j;  1KRT A;  2R7Z H;  5JEA G;  3RMH A;  1VMC A;  3KLS A;  2LXJ A;  1O80 A;  4KJN A;  1PH4 A;  3HOX B;  4CHT B;  4B3S L;  1IL2 A;  1JWU D;  5IOC A;  4ZRZ A;  2UUC L;  1EQQ A;  1U4L A;  2ZJR A;  1VQ8 A;  2D0P A;  1O78 A;  3C46 A;  4NPS A;  4K0K Q;  4IUT A;  3PO3 G;  2VY3 A;  5LHY 1;  4GKJ L;  2F0O A;  1LTR D;  4WJ3 M;  2K5H A;  4G7H C;  1EU4 A;  3DWP A;  3HOY G;  3RZO H;  3K81 C;  3MZ5 A;  2XRS D;  3MVV A;  1F77 A;  1EWC A;  3OYY A;  4B3R L;  1KDB A;  1XMQ Q;  1PH9 A;  2BH2 A;  1ROD A;  4P72 A;  1Y02 A;  4JI3 L;  3CP0 A;  4IFD G;  1DON A;  1PFM A;  1TWA B;  1CSQ A;  1LTT D;  1NE3 A;  1YNS A;  1B2T A;  1A3T A;  5L37 A;  3CCJ A;  2ID0 A;  1KDC A;  4V19 0;  1E2W A;  2R93 B;  3DMU A;  2ALY B;  3OIQ A;  1X54 A;  2VZA A;  3M4Y A;  4HN7 A;  2KW9 A;  4CDC C;  1AE2 A;  4NXM L;  1GHJ A;  2CWP A;  4MHE A;  3T1Y Q;  2A5H A;  1T9H A;  1HR0 L;  1X3P A;  1CQV A;  4A3K H;  2L55 A;  2RHQ B;  1MD2 D;  1STG A;  2YTX A;  1E1T A;  1X55 A;  2B2V A;  2L11 A;  2WP8 J;  3L7Z C;  1JWM D;  1PRT C;  3AYH B;  4MIU A;  4GLA C;  1YNX A;  4G7O C;  1YVC A;  3PQI A;  1HXY D;  3CCE A;  2F0Q A;  1GL9 B;  4UPA A;  1I6H H;  3ERO A;  5T1G A;  3SK8 A;  4PZ7 A;  4JI2 L;  3K7A B;  3CCV A;  4A3I H;  3GTO H;  4ZLT F;  2JK8 A;  4B08 A;  4BY1 H;  1Y1V H;  3F1Z A;  1Y1W B;  5I9O A;  4B9W A;  2KHI A;  4DR4 L;  3OWE B;  4ZK9 B;  4R1J A;  4ZUI A;  1HNW Q;  5BN5 A;  1CQF A;  2Z6K C;  2F0I A;  3AQQ A;  1FNU A;  3BG3 A;  1TXY A;  5ELC A;  5IE8 A;  3GTL B;  4K8I A;  4IZ8 A;  3K8A A;  1I4X A;  2IY5 B;  4RKL A;  1I4G A;  1PYW D;  4UHV A;  3I4N B;  3CF5 A;  2BCO A;  2WIN B;  1YZ6 A;  4JOI A;  5C44 H;  1IXR A;  3RZD H;  4LNQ A;  4QUC A;  1RL2 A;  5IT9 E;  1K9M C;  5FLM H;  1SNP A;  3IRB A;  4UZW A;  2CFM A;  2UUC Q;  2YTY A;  1Q3L A;  5F2D A;  1HH2 P;  2KHJ A;  2QNC A;  3K59 A;  1RIP A;  1U9R A;  2KEE A;  1RF2 D;  2EY2 A;  5LL6 X;  5KND A;  4BA1 I;  1G6P A;  1FJG L;  2PI2 A;  4EQO A;  3P7J A;  1SJH D;  1WFQ A;  2L12 A;  4A3G B;  5GQO A;  2VQF L;  2JP1 A;  3S9W A;  1ICF B;  1GUG A;  3VYR A;  4DV3 L;  4IFD I;  1YJN A;  1TWG B;  4A3F H;  4WJW A;  3KLS X;  3CRK C;  4B3M Q;  2XGT A;  4DV5 L;  4H44 C;  2LS0 1;  3D31 A;  2FXQ A;  4XT3 B;  1KIX A;  1IBM Q;  3MAQ A;  1PH5 A;  4QCL A;  2JN4 A;  3IKJ A;  4DR3 L;  4JI3 Q;  3R2I A;  1RHP A;  1MJC A;  2F0P A;  1F9Q A;  1DOM A;  2F0W A;  2K01 A;  1ICW A;  2JE6 I;  4K2L A;  5IWA Q;  2Y0S E;  4N9T A;  4A3J H;  1VF5 C;  4OXP A;  1SNQ A;  4DXF A;  3T56 B;  2R92 H;  1SYG A;  4LF6 L;  5IYC H;  3I4O A;  1ZKO A;  2A69 D;  3TS2 A;  2JQO A;  3S24 A;  4NXM Q;  3BYT B;  1DOK A;  3QO2 A;  4J1M A;  5CV5 A;  1NUC A;  1UE7 A;  3NUC A;  2KHS A;  2W51 A;  1B3A A;  4C3H H;  4DF7 A;  4HJ9 A;  4RAU C;  2JA6 G;  1KLG D;  3GTQ B;  1SSO A;  3V05 A;  3E6Z X;  1V1P A;  1WI5 A;  4MN3 A;  5JVG 3;  1TR5 A;  2E5L Q;  1FR3 A;  1HUM A;  1V1Q A;  1F9S A;  4CJ1 B;  2XN9 C;  1W6K A;  2EIF A;  2PQA B;  1S72 A;  4DK3 C;  4DV7 L;  1J9O A;  4X3U A;  2KQ3 A;  4QJF A;  1K8O A;  2L4N A;  4NB3 A;  4KD4 A;  2R7Z G;  4KTA A;  4IAL A;  1LTS D;  4AYB E;  1PV4 A;  1M8A A;  2K04 A;  4ILW A;  1C8C A;  4Z9C B;  4UP8 A;  4EX5 A;  3U58 A;  2UU9 L;  4JBJ A;  3A56 A;  3E9H A;  4QY7 A;  3TP8 A;  4JI6 L;  3HG9 A;  5M5W H;  3S1R B;  4JI4 L;  1KTK A;  2SDF A;  1V8Q A;  1QWY A;  2PQA A;  1TS4 A;  2EE1 A;  1WTX A;  2Q8I B;  4UP7 A;  3KF6 B;  4JW0 A;  2EYO A;  3J81 c;  3KLR A;  3HOW G;  1K3R A;  3T1H L;  3T13 A;  3KK7 A;  1QB5 D;  1FGU A;  1W6J A;  3I3C A;  2UXB L;  1H9E A;  4OX9 L;  3S1Q H;  3HFZ B;  2F1M A;  3I70 A;  5M5Y B;  1PA6 A;  4UY8 C;  4XQJ A;  2C35 B;  1IYJ B;  2OQK A;  4RG1 A;  2A69 C;  4DK1 A;  1B1Z A;  4P2C B;  4R4C A;  5ELN A;  4DR7 L;  5CC4 A;  5LMU L;  2XVS A;  1ESR A;  1DOL A;  1GUW A;  3P20 A;  3FKI B;  4JBW A;  3U4Z A;  3OOC A;  5AJ3 Q;  3JAM i;  3H3V C;  3LWU A;  2MNA A;  5E3F A;  3HGB A;  4A3M B;  3DHQ A;  3S16 B;  3L9A X;  3KF6 A;  4DR3 Q;  4A3K G;  1QE6 A;  1S5B D;  3Q8D A;  4A93 H;  3BDC A;  3S1M B;  4IOC A;  1L1O C;  1TS5 A;  3FMC A;  1SDF A;  4H7B A;  4LF5 Q;  2BE5 D;  3U9S A;  4R8I A;  4GOP C;  2KUM A;  2X6G A;  3HKZ B;  2B63 B;  1F2Y A;  1H9K A;  3PIO 3;  2E2I H;  4GLV B;  3TP6 A;  4QGU A;  1EYG A;  3Q23 A;  2Y0S G;  3DEP A;  5HY6 A;  4U67 3;  3BVM A;  1RTN A;  4I65 A;  4XYO A;  5C5L A;  3HOU B;  4BY1 G;  1JB7 A;  1Y1V G;  2K5D A;  2Q2I A;  3GTP H;  3A0J A;  2CVR A;  2K7V A;  2RNN A;  2KEN A;  1PH2 A;  3IFD A;  4UDU C;  3MXN B;  3ZJY C;  3W3A A;  3M4Q A;  3RLF A;  4DV7 Q;  2KEC A;  4N8F A;  3ULL A;  4HAE A;  1S5C D;  4TQU S;  2E8G A;  5KYI A;  2NVX B;  3SEB A;  4A3E G;  3TS0 A;  5I4D A;  5CV6 A;  5FLM G;  1GVP A;  4DAY B;  5C4X G;  1HCZ A;  1PH1 A;  2K52 A;  2L5T A;  4YY3 L;  2E2J H;  4MNO A;  2F03 A;  1SE2 A;  2MGS A;  4CKC A;  3CCU A;  2DN8 A;  5EKL A;  1EFW A;  4EVO A;  1HZC A;  3MXN A;  1AN8 A;  2HCI A;  1PH7 A;  2TMP A;  2F4V L;  1OO9 B;  1VQN A;  1VQI A;  4A3F G;  5CIU A;  2ZXO A;  2QGQ A;  3KJO A;  3BDO A;  3SK4 A;  2WV6 D;  5M3M B;  3UDX A;  2J0T D;  5C4J H;  4M8A A;  2EYL A;  4DAV A;  2XWJ B;  1SYC A;  3S2D H;  4GN4 B;  1V66 A;  4F88 A;  4DAY A;  4A3J G;  2NZO A;  1Z7T A;  3S15 B;  2QNF A;  1LYL A;  1TWH H;  1JIC A;  2JA9 A;  3G7L A;  2R92 G;  1B7Y B;  2MPM A;  1HZA A;  5IYC G;  4XQN A;  2KOL A;  2RCF A;  5FK9 C;  2WB1 B;  1GXD C;  3NEL A;  2KVU A;  1LTI D;  1YJ9 A;  1JQY D;  3EVQ A;  4KKS A;  1AZQ A;  2B2U A;  4C3H G;  4Q5V A;  3F2C A;  2RDG A;  5IY0 A;  1IKL A;  2CW0 C;  1PFN A;  2F0J A;  2ODG C;  2B2V C;  1J6Q A;  4RWS C;  4HCE A;  5I2Y A;  1H9S B;  2OQ0 A;  3GD7 A;  4FNF A;  1WTV A;  1BCP B;  3BS1 A;  3J80 E;  3NWT A;  3I73 A;  4IUU A;  1C48 A;  2SEB D;  4LWC A;  4IFD H;  2PW7 A;  2F0K A;  3QG1 A;  1R4P B;  1TII D;  1X3Q A;  2D62 A;  2NYZ D;  1VQ4 A;  3A55 A;  3H6M A;  3H91 A;  1C9O A;  1BCP F;  1VQF A;  3PCO B;  4C1N K;  2HQL A;  4JYA L;  1FL0 A;  5IP9 H;  1SFO H;  5ELE A;  4A4I A;  1H95 A;  1X56 A;  3I8Z A;  3NEM A;  2DJG C;  2NVY B;  5D3D A;  2PQE A;  2PZT A;  5ELB A;  4DUZ L;  3OW7 A;  2QCP X;  2G9H D;  4JCV E;  3URY A;  4XIG S;  3J7A F;  1H9S A;  4LF4 L;  3S17 H;  2ES2 A;  1XNQ L;  3T53 B;  5K36 G;  3VYT A;  1Q86 C;  3VR3 A;  2Z4H A;  1VQ6 A;  1TKW B;  1LO5 D;  4QQB X;  1CSP A;  1Y14 B;  1IKM A;  2XTI A;  1BOS A;  3PO2 G;  1A2T A;  4NKL A;  3TEH B;  4OEL B;  5E1F A;  1XXG A;  3M7N A;  1WCM B;  2SNM A;  4YWL A;  3NEN A;  5IP7 G;  1SRU A;  4A3B H;  2IHF A;  4DUY L;  2RHS B;  4Y7N H;  4DV2 Q;  5HGQ A;  2VUM H;  4P73 A;  2F4V Q;  3HRZ C;  1ESF A;  4KN4 C;  4X66 Q;  2MFI A;  4K0K L;  1ENC A;  4R4Q A;  3BZD B;  1LT4 D;  4CDD C;  4HJA A;  4L5T A;  3K57 A;  3PIP A;  2ENB A;  3W1G A;  5BN4 A;  1JCK B;  1X9N A;  1PVO A;  3GTK H;  4RCO A;  1DJR D;  1K0S A;  1UEB A;  2N3S A;  2Q2T A;  2RCN A;  4R4T A;  4BS9 A;  1XMQ L;  2R3Z A;  3HOV B;  1MBY A;  4KLK A;  1YHB A;  3CPW A;  5I6Y A;  2KVE A;  2NBF A;  2M2L A;  3I4M B;  1I50 H;  1BXT A;  4LUV A;  1Q1B A;  5M9O A;  1AZP A;  1BQQ T;  1Q7Y C;  1Q8I A;  1AEX A;  1PTO B;  3ERQ A;  2M00 A;  3F2U A;  5JOB A;  2KVD A;  2LXK A;  2BDN A;  1NAP A;  1VF7 A;  4RMF A;  5CBA E;  3T1Y L;  2EJG C;  2SNS A;  1PTO F;  3ULP A;  1SJE D;  2G5D A;  3TN2 A;  3H3V H;  2DUD A;  3SGI A;  4C3I B;  2FHT A;  1I3Q H;  1ML0 D;  1Y8O B;  2F0V A;  5IGD A;  5IGG A;  5DM6 3;  5IGE A;  1QJO A;  4IPC A;  3CC4 A;  2OXP A;  4ZKC B;  4JI5 Q;  3C2P A;  1SNC A;  3B6Y A;  1SAP A;  4DV6 L;  1RCV D;  3LLR A;  4XTC S;  1Q1E A;  1HQM C;  4BWG B;  2YTV A;  5JAV A;  4DUZ Q;  3WOF A;  3CD6 A;  5IT9 c;  3RLO A;  3HOZ B;  3NQT A;  1I6V C;  2LFN A;  2JA6 H;  1KNA A;  5JPN C;  3FP9 A;  3OMG A;  1MI2 A;  4PNY A;  2ZM6 Q;  1XNQ Q;  4BY7 G;  1HNW L;  4DK6 C;  4DR6 Q;  3S1N B;  2K4K A;  4OIK A;  5AFW A;  4RGN A;  1YIT A;  1QVF A;  1JB3 A;  5IYD H;  3PUV A;  3SVM A;  4OO1 H;  3UE1 A;  1NY4 A;  2JXM B;  1W3S A;  3NQI A;  3J7A 5;  3M4O H;  3GDE A;  1DZ1 A;  1IL8 A;  4HTH A;  3RZO B;  1FNW A;  1XPO A;  3S14 H;  4DUY Q;  1CKO A;  1DXM A;  1CT1 D;  1EFI D;  4LK1 C;  4HIM A;  1CHP D;  2K14 A;  4L63 B;  4JI0 Q;  3CRL C;  4A3D H;  1B53 A;  4HJ7 A;  1VS0 A;  4ABN A;  1RKN A;  2F0E A;  4FVM A;  4F87 A;  1NBW A;  4XXE A;  2NVT H;  3CQZ B;  3A8K E;  3ND9 A;  4O0A A;  2C5C A;  2PMZ E;  1O7Y A;  1L0X B;  3CCR A;  1CUK A;  1VQH A;  3NTH A;  1E7L A;  4B3M L;  3HOW H;  2CHB D;  5IGC A;  1IBM L;  4K2K A;  4P75 A;  1JEQ A;  1CI3 M;  5NUC A;  3STB C;  5IWA L;  2H4O A;  4RFB A;  3C3L A;  3G6E A;  2O2L D;  4HJ8 A;  5IP9 G;  4NP5 A;  4DAP A;  4C1N I;  1MIU A;  2V1C C;  2NN6 G;  1BKB A;  3TSS A;  5KNC A;  3W5O A;  2J4X A;  3EIV A;  4K6L A;  1TQO A;  2A68 D;  4EQP A;  1OTC A;  2DK4 A;  4ME5 A;  1Y8N B;  4F8M A;  1WTP A;  2VXW A;  1EZ8 A;  3PUX A;  1PYS B;  2IHE A;  4LF9 Q;  4A3I B;  5T1I A;  2XRQ D;  1TWF B;  2A74 C;  1OXT A;  3W2D A;  4NMZ A;  4L5R C;  3Q24 A;  3AB9 A;  1R9T H;  3NBI A;  4JPB W;  1X65 A;  2E5L L;  4RGM A;  1YIJ A;  5C3W A;  5M3F B;  2F52 A;  2KVM A;  4DV1 L;  2Z4I A;  4BBR G;  1X32 A;  4DV6 Q;  4L8J A;  1QVG A;  3M85 A;  2F0F A;  2RQX A;  4JC0 A;  2DJF C;  1EY4 A;  4A3L G;  4QMG A;  3HS0 C;  2JA5 G;  2GVB A;  3OMC A;  1HUN A;  1XMO Q;  3LWE A;  3VYU A;  4YIJ A;  3PF4 A;  5COR A;  1MSG A;  2OTJ A;  1TWA H;  3T51 B;  1HA5 A;  1TY0 A;  5C44 B;  5E7N A;  1N34 L;  1GO3 E;  2ICI A;  4A3B G;  2BOS A;  3IFT A;  3HZX A;  4PZ6 A;  3T16 A;  2NTS A;  2N8N A;  2ICE C;  2KJX A;  2VUM G;  2K6A A;  5EKI A;  2R93 H;  3L2P A;  5GRO A;  1VQM A;  4Y52 H;  3AFQ A;  1BCP D;  2N49 A;  4FXD A;  4IJL A;  3M3Y B;  2RSO A;  1GHK A;  2R6G A;  1JJ2 A;  5D14 A;  1STB A;  4ZKB B;  3I91 A;  3OPO A;  1VQJ A;  3SR1 A;  4C3J B;  1E0B A;  3MEF A;  1BO0 A;  4A3E H;  1B3Q A;  2F3V A;  4NW2 A;  4JI1 Q;  2BA1 A;  5C4X H;  3JAM E;  2LY7 A;  4DR5 Q;  2JEA I;  1KC8 C;  3FPP A;  2K1B A;  1CFM A;  1A63 A;  4PMB A;  1G29 1;  1EU3 A;  1SNO A;  2PZW A;  4H0L C;  1OXX K;  1ET9 A;  5CR3 A;  1A3V A;  4GKK Q;  1Y1W H;  1N9W A;  4KN7 C;  5AJ3 L;  1EIF A;  1V1P B;  3T4A C;  1U4P A;  1EQT A;  2MO0 A;  1E3P A;  5KNB A;  2PW5 A;  1TY2 A;  3HKS A;  4EGV A;  3I4N H;  1E2Z A;  1KDA A;  5CYU A;  3TZD A;  4LF5 L;  2AKW B;  1I4H A;  3I72 A;  5C6A A;  1NSN S;  1F9P A;  3VA7 A;  1VQE A;  3CME A;  2UUA Q;  3A7A B;  1HR0 W;  4AQY Q;  5M5X B;  3CKI B;  1U4R A;  2WAQ B;  1SR3 A;  4JV5 L;  5CV8 A;  4IUV A;  1XPU A;  2UXD Q;  1ENA A;  4IPG A;  1NNX A;  4LMQ D;  1J8I A;  5DLQ E;  1JWS D;  1KRS A;  4GNX B;  3K5M A;  4A3G H;  1C4Q A;  3Q0A A;  1EY0 A;  4PMC A;  3S2H B;  1STY A;  4HIO A;  2G9D A;  4DV1 Q;  1TWG H;  5IYD G;  2J7Z A;  3MXP A;  1JE5 A; 
#chains in the Genus database with same CATH homology
 4OO1 G;  1K0R A;  4YY3 L;  4MNO A;  4YCV A;  2E2J H;  1EUJ A;  4L5Q A;  2JA7 G;  2UXD L;  1UE1 A;  4JG2 A;  2D0O A;  2MO1 A;  1YBY A;  2WB1 G;  4HJ5 A;  3BJU A;  5FLX c;  3CCU A;  1GJJ A;  4DV0 Q;  1EFW A;  3CW2 C;  3I55 A;  1N36 L;  4MTN A;  4A93 G;  5GAE C;  1HZC A;  1N34 Q;  2AMC B;  4KHZ A;  2ASB A;  3BZC A;  3CQZ H;  1KAW A;  1PH7 A;  2F4V L;  2AWN A;  4HID A;  1VQI A;  1VQN A;  4A3F G;  2ZTC A;  2MPH A;  1YEZ A;  4X65 L;  4DAM A;  2QGQ A;  3GTM H;  2KFV A;  2B29 A;  3KJO A;  1QUQ A;  1V43 A;  3A5Z B;  5JEA J;  1PYB A;  3NBH B;  3UDX A;  5C4J H;  4GNX A;  3GTG H;  4A3D G;  1E22 A;  1IBK L;  3S2D H;  1VQB A;  4GN5 A;  1EQR A;  3TQY A;  1X3G A;  4GN4 B;  1B8A A;  3KDF B;  1KQS A;  3RLN A;  4A3J G;  5FJ8 H;  2NZO A;  4YHH Q;  2QNF A;  1LYL A;  1TWH H;  1AH9 A;  2B3G A;  4DKA C;  4LW1 A;  1UE5 A;  2JA9 A;  1IBL Q;  3U50 C;  2R92 G;  1B7Y B;  2CCZ A;  1HZA A;  2I5L X;  5IYC G;  3CCQ A;  3ICE A;  3PO2 H;  2DGY A;  1K8G A;  3PGZ A;  2ATW A;  4BBS G;  3OTO Q;  3NEL A;  2EQS A;  1YJ9 A;  1XJV A;  4GNX C;  2K50 A;  1E7Z A;  1TWF H;  4C2M H;  1H9F A;  1WOC A;  3F2C A;  3J80 c;  4DV4 Q;  5IY0 A;  1A62 A;  5IP7 H;  4YHH L;  1J5E Q;  4JYA Q;  3GTJ H;  1VQP A;  4JBK A;  2ODG C;  1VCI A;  1J6Q A;  1SE8 A;  3STB D;  5C0X I;  3HOX G;  2OQ0 A;  3GD7 A;  3J7Z C;  2KCM A;  1OXV A;  4IFD J;  4ALP A;  2G80 A;  5M3F H;  5H1S E;  3H3V I;  4IOA A;  2KCT A;  1HZB A;  4MZ9 A;  5LMN W;  3J80 i;  5JJK A;  3OTO L;  2QEX A;  4LWC A;  3KDF A;  4JI8 Q;  2K75 A;  2MQH A;  2D62 A;  1VQ4 A;  4AIM A;  4EQ5 A;  2GN5 A;  3S1R H;  3K7A H;  3CAM A;  3FHW A;  1WCM G;  1C9O A;  3F8T A;  1J5E L;  3M4P A;  1VQF A;  3PCO B;  1NTG A;  2HQL A;  4JBM A;  2YU9 H;  4LF4 Q;  4A3L G;  4JYA L;  1FL0 A;  3E9I A;  5IP9 H;  2HT1 A;  3CCL A;  2I5M X;  4OON A;  1SFO H;  4A4I A;  3PUZ A;  1H95 A;  4B3S Q;  1X56 A;  2A1A A;  1A8V A;  1YI2 A;  3NEM A;  2L15 A;  4IPH A;  2OWO A;  1LM0 A;  3TRZ A;  1Q46 A;  4DUZ L;  3GTL H;  1ZS9 A;  1P8L A;  4JI8 L;  1AE3 A;  1V9P A;  1E24 A;  3I2Z A;  4JCV E;  1YHQ A;  4A76 A;  3M3Y H;  4XIG S;  2NN6 I;  3CMA A;  4JV5 Q;  2BH8 A;  1X6O A;  2I0Q A;  4UP9 A;  5BR8 Q;  5GAG C;  3J81 j;  1KRT A;  4LF4 L;  2R7Z H;  5JEA G;  3AEV A;  3S17 H;  4GKJ Q;  1QZG A;  1K73 C;  2LXJ A;  2ES2 A;  1XNQ L;  4IPD A;  3KYH C;  1PH4 A;  4C3J H;  4OO1 I;  4B3S L;  5K36 G;  1Q86 C;  4DR1 Q;  2UUB Q;  4IJH A;  4OWW B;  1VQ6 A;  2UUC L;  3AFP A;  4QQB X;  1EWI A;  1MKH A;  1EQQ A;  4BA2 I;  1CSP A;  1Y14 B;  2ZJR A;  4BY7 G;  2RF4 A;  2XTI A;  1VQ8 A;  2R93 G;  3PO2 G;  1N33 L;  4B3R Q;  1SRO A;  2Q2U A;  3U4V A;  2D0P A;  3TEH B;  2AHO B;  2VS1 A;  4HIK A;  4NPS A;  5GAD C;  3HOV G;  3M7N A;  4K0K Q;  3BZK A;  1QZH A;  1KD1 C;  3EBE A;  4R4I A;  2VY3 A;  3PO3 G;  4GKJ L;  4YWL A;  3M9B A;  3E0E A;  2K5H A;  3I4M G;  4WJ3 M;  3W1B A;  3NEN A;  3LGJ A;  5IP7 G;  1SRU A;  4A3B H;  3HOY G;  4DNI A;  2IHF A;  4DUY L;  2ZJQ A;  2RHS B;  3RZO H;  4Y7N H;  3K81 C;  4DR1 L;  1C7Y A;  4DV2 Q;  5HGQ A;  2UUB L;  2IX1 A;  2VUM H;  2HIV A;  4P73 A;  2F4V Q;  4LUZ A;  2VW9 A;  4PMW A;  3S15 H;  3OYY A;  3DM3 A;  4GS3 A;  4X65 Q;  4B3R L;  1VQA A;  1XMQ Q;  1PH9 A;  2B63 H;  2BH2 A;  4X66 Q;  4P72 A;  1Y02 A;  2MFI A;  1XNR L;  1KHI A;  4JI3 L;  3CP0 A;  4IFD G;  4K0K L;  4R4Q A;  1XPR A;  1IBK Q;  1HR0 Q;  1CSQ A;  1NE3 A;  2N78 A;  4HJA A;  1YNS A;  4L5T A;  3PIP A;  1M1K C;  3W1G A;  1HNX L;  2HIX A;  1EIY B;  4BY7 H;  1X9N A;  3CCJ A;  3HOU H;  1PVO A;  4DV2 L;  3GTK H;  2ID0 A;  4FDB A;  1Y1W G;  1C0A A;  1UEB A;  2N3S A;  2Q2T A;  2ALY B;  1X54 A;  3A74 A;  2RCN A;  2VZA A;  4POF A;  4R4T A;  3G4S A;  1XMQ L;  1AE2 A;  4NXM L;  2PI2 E;  4X66 L;  1VQL A;  1SN8 A;  5M5X H;  3KLW A;  2CWP A;  2BA0 A;  4O2D A;  3T1Y Q;  1I94 Q;  4KLK A;  1YHB A;  3CPW A;  1T9H A;  1HR0 L;  2WFW A;  4JI2 Q;  3PV0 A;  1I50 H;  4A3K H;  4LUV A;  1Q1B A;  2K5N A;  2RHQ B;  3GO5 A;  3HOZ G;  1LTL A;  1X55 A;  1E1T A;  2YTX A;  3I4N G;  2WP8 J;  3RR5 A;  1Q7Y C;  3L7Z C;  2CKZ B;  1SLJ A;  2IX0 A;  2Z6K A;  2GVA A;  3AYH B;  1VQ9 A;  3GTQ H;  4GLA C;  4DR4 Q;  1YNX A;  1YVC A;  4X62 L;  2LXK A;  5JJI A;  3S2H H;  3PSI A;  3CCE A;  2AWO A;  4KHP Q;  3RN2 A;  3G71 A;  4RMF A;  1GL9 B;  3T1Y L;  1I94 L;  4UPA A;  1I6H H;  3I56 A;  1FVI A;  3ULP A;  4PZ7 A;  4JI2 L;  3CCV A;  4A3I H;  3GTO H;  1CKM A;  3H3V H;  2DUD A;  3SGI A;  3K7U C;  1Q81 C;  1EOV A;  1OXS C;  2JK8 A;  1A0I A;  5C3E H;  3CCS A;  1I3Q H;  4BY1 H;  1Y1V H;  3F1Z A;  3F2B A;  2E2H H;  4A3G G;  2KHI A;  4DR4 L;  4IPC A;  3CC4 A;  4BXX H;  4R1J A;  4JI5 Q;  1HNW Q;  2Z6K C;  3AQQ A;  2LC3 A;  2UXC Q;  3B6Y A;  1JJG A;  4DV6 L;  1TXY A;  4KHP L;  1N32 L;  4A3C H;  4XTC S;  4YCW A;  1JMC A;  1E1O A;  5IE8 A;  1Q1E A;  4GN3 B;  3UE0 A;  3K8A A;  2YTV A;  5M3M H;  4DUZ Q;  3CC2 A;  1KL9 A;  2LD7 A;  2ZJP A;  3CD6 A;  1B70 B;  5IYB H;  2IY5 B;  5IT9 c;  3RLO A;  1FJG Q;  1JT8 A;  3I7F A;  2JA6 H;  3CC7 A;  3CF5 A;  3FP9 A;  2VQF Q;  2ZM6 Q;  1XNQ Q;  1YZ6 A;  4JOI A;  5C44 H;  1IXR A;  3RZD H;  1G51 A;  4JI5 L;  1VQC A;  3CXC A;  4DK6 C;  4LNQ A;  2NZH A;  1RL2 A;  1X3E A;  4DV3 Q;  2K4K A;  3TRE A;  5FLM H;  1YIT A;  1K9M C;  1QVF A;  2UXC L;  3IRB A;  2JA8 H;  2CFM A;  5IYD H;  2UUC Q;  3PUV A;  2YTY A;  1HNW L;  4WJ4 A;  4DV5 Q;  1HH2 P;  2KHJ A;  3UE1 A;  2QNC A;  1N33 Q;  3F2D A;  1RIP A;  1WJJ A;  1NY4 A;  2NVQ H;  1W3S A;  4BA1 I;  3J7A 5;  1G6P A;  1FJG L;  2PI2 A;  2EXD A;  3M4O H;  2QA4 A;  3GDE A;  5M5Y H;  1WFQ A;  2WAQ E;  3KOJ A;  4LF8 Q;  5GQO A;  2VQF L;  2ZM6 L;  1QVC A;  3OW2 A;  2CWA A;  5FJ8 G;  4TVA B;  1XPO A;  4DR6 L;  4DV3 L;  3S14 H;  4DUY Q;  1CKO A;  1YJN A;  4IFD I;  4JOI C;  4A3F H;  1PFS A;  4BBR H;  1SMX A;  1PHJ A;  4B3M Q;  4LF6 Q;  4PG3 A;  2XGT A;  4DV5 L;  1GKH A;  3FKI H;  1HNZ L;  4HIM A;  4A3L H;  2K14 A;  4X64 Q;  3D31 A;  2JA5 H;  4JI0 Q;  2FXQ A;  3RNU A;  1N8R C;  1KIX A;  1IBM Q;  4LF7 Q;  3KFU A;  1PH5 A;  1XNR Q;  4A3D H;  4HJ7 A;  4R4O A;  4JI3 Q;  1VS0 A;  4DR3 L;  5LMN L;  4A3M H;  1MJC A;  1XTD A;  4A3I G;  2OTL A;  4LFC Q;  4LF8 L;  3S16 H;  1M90 C;  2JE6 I;  5IWA Q;  2Y0S E;  1VQD A;  1NBW A;  4A3J H;  1HNX Q;  4OXP A;  2NVT H;  4O0A A;  2PMZ E;  2YV5 A;  3CCR A;  1CUK A;  1VQH A;  1WYD A;  4H02 A;  2A8V A;  2KBN A;  1L2F A;  1E7L A;  4B3M L;  4LF6 L;  2VL6 A;  5IYC H;  3PIO A;  3I4O A;  4DR2 L;  5M3F G;  3HOW H;  3JC6 6;  3TS2 A;  2NVY H;  2JQO A;  3S24 A;  4DPG A;  4X64 L;  4JI0 L;  4NXM Q;  2ODC I;  1IBM L;  4LF7 L;  4P75 A;  2VQE Q;  1UE7 A;  4LFC L;  2W51 A;  4YWM A;  3CCM A;  4C3H H;  4HJ9 A;  2JA6 G;  3STB C;  5IWA L;  1BBW A;  1K83 H;  2Z0S A;  3G6E A;  4HJ8 A;  1WI5 A;  5IP9 G;  5C44 G;  1MIU A;  2V1C C;  2NN6 G;  2E5L Q;  1UE6 A;  1PH8 A;  2JJQ A;  1BKB A;  3W5O A;  5GAH C;  4JI7 L;  3EIV A;  1V1Q A;  1OTC A;  3ER0 A;  2DK4 A;  4X62 Q;  2EIF A;  2PQA B;  1NMG A;  1S72 A;  4DK3 C;  2UU9 Q;  2VQE L;  3PUX A;  1PYS B;  4QL5 A;  2ZTE A;  2IHE A;  4DV7 L;  4LF9 Q;  2VNU D;  4JI6 Q;  4NXN Q;  3ULJ A;  1OXT A;  1GM5 A;  2H5X A;  3D0F A;  1WCM H;  4QJF A;  4L5R C;  4B3T L;  4AYB G;  4NB3 A;  4JI4 Q;  1R9T H;  4AH6 A;  2R7Z G;  2WB1 E;  1TWC H;  4X6A H;  1NMF A;  1X65 A;  4AYB E;  2E5L L;  2NVX H;  2YYZ A;  3EN2 A;  1YIJ A;  1PV4 A;  1GD7 A;  2F52 A;  5C0X J;  4DV1 L;  1L1O B;  4UP8 A;  4BBR G;  3UDF A;  4EX5 A;  1S3O A;  4DV6 Q;  2F3I A;  3U58 A;  1QVG A;  3M85 A;  1HZ9 A;  4PZ8 A;  2UU9 L;  4LFB Q;  4JBJ A;  3FKI G;  4JC0 A;  1N32 Q;  4GOP B;  5J3B A;  1IL2 A;  2OCE A;  4LF9 L;  3E9H A;  4QY7 A;  3T1H Q;  1HJP A;  2GVB A;  2R7D A;  1ASZ A;  4P74 A;  4NXN L;  2JA5 G;  4JI6 L;  1XMO Q;  5M5W H;  2UXB Q;  4OX9 Q;  1BBU A;  3PF4 A;  4A3M G;  1EN7 A;  1O7I A;  4DV0 L;  1Q12 A;  4JI4 L;  2OTJ A;  1TWA H;  4OWT B;  5E7N A;  1GKU B;  1N34 L;  1GO3 E;  2PQA A;  4A3B G;  4UP7 A;  3KF6 B;  1P16 A;  4PZ6 A;  4DR7 Q;  3DLL A;  5LMU Q;  4GLX A;  2N8N A;  2VUM G;  4LFA Q;  3J81 c;  2R93 H;  3L2P A;  3PF5 A;  4L5S A;  5GRO A;  1VQM A;  3CPF A;  3HOW G;  1JJC B;  1K3R A;  4LFB L;  1YJW A;  4Y52 H;  3AFQ A;  2N49 A;  3HKZ G;  3H15 A;  3T1H L;  3K0X A;  4IJL A;  1I5F A;  1FGU A;  4YWK A;  1MJE A;  2B63 G;  1XMO L;  3HOV H;  2UXB L;  1H9E A;  1CKN B;  4OX9 L;  3S1Q H;  3HKZ E;  3HFZ B;  4OWX B;  2R6G A;  3PO3 H;  3BU2 A;  1PA6 A;  4UY8 C;  3K80 C;  4APV A;  3L0O A;  3J81 i;  2C35 B;  2IT1 A;  1JJ2 A;  2R92 H;  3I4M H;  1IYJ B;  3H0G H;  2OQK A;  1L1O A;  4RG1 A;  3JAM c;  3VDY A;  1VQJ A;  3HOY H;  1Z47 A;  5ELN A;  4R4C A;  3MEF A;  2I5H A;  4A3E H;  4P71 A;  1U5K A;  4GOP A;  4DR7 L;  5LMU L;  3PUY A;  4ME3 A;  3HOU G;  1IBL L;  4IO9 A;  4LFA L;  2ZTD A;  4JI1 Q;  5JJL A;  2BA1 A;  4JBW A;  5C4X H;  1S40 A;  2PNH A;  3U4Z A;  3A5U A;  5AJ3 Q;  3JAM i;  1HNZ Q;  2K5V A;  3UDI A;  2MNA A;  2Q2H A;  4YCU A;  1YHA A;  2JA7 H;  1DGS A;  4DR5 Q;  2WAQ G;  2JEA I;  4KI0 A;  1KC8 C;  2R7F A;  3KF6 A;  4DR3 Q;  1PH3 A;  5LMN Q;  4A3K G;  1BVS A;  3S1M H;  1A63 A;  1JEI A;  3Q8D A;  4DV4 L;  1NJI C;  3KJP A;  1G29 1;  4C3I H;  4A93 H;  1OXX K;  1D7Q A;  4IOC A;  1L1O C;  1LUZ A;  5EAY A;  1U0L A;  4LF5 Q;  4GKK Q;  1Y1W H;  1UWV A;  4JI1 L;  1N9W A;  1CKN A;  4GOP C;  4A75 A;  5AJ3 L;  4DR2 Q;  1Q8K A;  1EIF A;  3RN5 A;  2HHH Q;  2LSS A;  3ERS X;  1K8A C;  2MO0 A;  2E2I H;  4DR5 L;  1E3P A;  1PH6 A;  4GLV B;  4QGU A;  1EYG A;  5C0X G;  3PUW A;  4DR6 Q;  4J15 A;  2Y0S G;  3HKS A;  5HY6 A;  4QIW E;  1Z9F A;  3HOZ H;  5ELO A;  5C3E G;  3I4N H;  1D8L A;  4BY1 G;  1JB7 A;  1Y1V G;  4LF5 L;  4GKK L;  2AKW B;  2Q2I A;  1VQE A;  3CME A;  2UUA Q;  3A0J A;  3GTP H;  3KF8 B;  1VQ7 A;  4BXX G;  3S1N H;  2KEN A;  4JI7 Q;  1PH2 A;  3G48 A;  3WWV A;  1HR0 W;  2HHH L;  4AQY Q;  3MXN B;  3UDG A;  1ASY A;  1VQ5 A;  4BBS H;  3ZJY C;  3RLF A;  3M4Q A;  4YY3 Q;  2CQO A;  5M3M G;  1SR3 A;  4DV7 Q;  4JV5 L;  2UXD Q;  1XPU A;  1L0W A;  5BR8 L;  4IPG A;  3ULL A;  5IYB G;  5DLQ E;  1QUQ B;  4LUO A;  1KRS A;  4TQU S;  3H0G G;  1W2B A;  4GNX B;  1Q82 C;  2E8G A;  4B3T Q;  4A3G H;  1IZ6 A;  1N36 Q;  4A3E G;  2UUA L;  3TS0 A;  2JEB I;  1OXU A;  3HOX H;  1VQO A;  4A3C G;  1VQK A;  2HJQ A;  4HIO A;  5FLM G;  4POG A;  1KXL A;  1GVP A;  4DV1 Q;  1TWG H;  1X3F A;  2A19 A;  4AQY L;  1VQG A;  4DAY B;  5IYD G;  1PH1 A;  2K52 A;  2JA8 G;  5C4X G;  1JE5 A;  1E7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...