The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
20
|
sequence length |
65
|
structure length |
65
|
Chain Sequence |
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKELYRRRF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
NMR structure of the N-terminal domain of SUMO ligase PIAS1 and its interaction with tumor suppressor p53 and A/T-rich DNA oligomers
pubmed doi rcsb |
molecule tags |
Ligase
|
source organism |
Homo sapiens
|
molecule keywords |
Protein inhibitor of activated STAT protein 1
|
total genus |
20
|
structure length |
65
|
sequence length |
65
|
ec nomenclature | |
pdb deposition date | 2003-11-27 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 | SAP domain |
#chains in the Genus database with same CATH superfamily 1H1J S; 2WQG A; 4UZW A; 2RNN A; 2JVW A; 2KW9 A; 1V66 A; 2KVD A; 1JEQ A; 1JJR A; 2KVU A; 1ZBH A; 4BIT A; 2RNO A; 2KVE A; #chains in the Genus database with same CATH topology 2G80 A; 1H9F A; 1ZS9 A; 2RNN A; 3LLR A; 2ODG C; 1E7L A; 1GJJ A; 3FLG A; 1JJR A; 1JEQ A; 3L0O A; 1GL9 B; 1A63 A; 2RNO A; 5CIU A; 1H1J S; 4UZW A; 1A62 A; 2A8V A; 1Y02 A; 2QNF A; 2DK4 A; 2KW9 A; 2KVD A; 2LD7 A; 2LC3 A; 1KHC A; 1A8V A; 4BIT A; 2MPH A; 2KVE A; 1H9E A; 1YNS A; 2JVW A; 1JEI A; 3QKJ A; 2KVU A; 1EN7 A; 2W51 A; 2WQG A; 2QNC A; 2KFV A; 2HJQ A; 1E7D A; 2ODC I; 1V66 A; 1GKU B; 1ZBH A; #chains in the Genus database with same CATH homology 1H1J S; 2WQG A; 4UZW A; 2RNN A; 2JVW A; 2KW9 A; 1V66 A; 2KVD A; 1JEQ A; 1JJR A; 2KVU A; 1ZBH A; 4BIT A; 2RNO A; 2KVE A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...