The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
23
|
sequence length |
143
|
structure length |
137
|
Chain Sequence |
TSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAW
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of the p53 binding domain of HAUSP/USP7 bound to Epstein-Barr nuclear antigen 1 implications for EBV-mediated immortalization.
pubmed doi rcsb |
| molecule keywords |
Ubiquitin carboxyl-terminal hydrolase 7
|
| molecule tags |
Hydrolase
|
| source organism |
Homo sapiens
|
| total genus |
23
|
| structure length |
137
|
| sequence length |
143
|
| ec nomenclature |
ec
3.4.19.12: Ubiquitinyl hydrolase 1. |
| pdb deposition date | 2005-02-23 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00917 | MATH | MATH domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A | Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A |
#chains in the Genus database with same CATH superfamily 1FLK A; 3HQI A; 4KG9 A; 5E1T A; 1CZZ A; 4GJH A; 4X3G A; 4M4E A; 1D00 A; 2CR2 A; 2GKW A; 3HQM A; 1YZE A; 2F1Y A; 3HU6 A; 2FOO A; 3MQR A; 4JJQ A; 2FOP A; 4Z8M A; 1FLL A; 1K2F A; 3IVV A; 4I7B A; 1CZY A; 4YSI A; 4K8U A; 1YY6 A; 2F1Z A; 3MQS C; 1D0A A; 1QSC A; 2A25 A; 1LB6 A; 1RF3 A; 2F1X A; 1D0J A; 1D01 A; 2F1W A; 2XXN A; 3HSV A; 2AN6 A; 3ZJB A; 1CA9 A; 4C9Z A; 1F3V B; 1LB5 A; 1ZMS A; 3IVQ A; 4GHU A; 4O1V A; 3HQH A; 1KZZ A; 2FOJ A; 5H9M A; 1L0A A; 1LB4 A; 4I7C A; 4GWN A; 4GWM A; 4CA1 A; 3HQL A; 3IVB A; 4I7D A; 1CA4 A; #chains in the Genus database with same CATH topology 1FLK A; 3HQI A; 4KG9 A; 5E1T A; 1CZZ A; 4GJH A; 4X3G A; 4M4E A; 1D00 A; 2CR2 A; 2GKW A; 3HQM A; 1YZE A; 2F1Y A; 3HU6 A; 2FOO A; 3MQR A; 4JJQ A; 2FOP A; 4Z8M A; 1FLL A; 1K2F A; 3IVV A; 4I7B A; 1CZY A; 4YSI A; 4K8U A; 1YY6 A; 2F1Z A; 3MQS C; 1D0A A; 1QSC A; 2A25 A; 1LB6 A; 1RF3 A; 2F1X A; 1D0J A; 1D01 A; 2F1W A; 2XXN A; 3HSV A; 2AN6 A; 3ZJB A; 1CA9 A; 4C9Z A; 1F3V B; 1LB5 A; 1ZMS A; 3IVQ A; 4GHU A; 4O1V A; 3HQH A; 1KZZ A; 2FOJ A; 5H9M A; 1L0A A; 1LB4 A; 4I7C A; 4GWN A; 4GWM A; 4CA1 A; 3HQL A; 3IVB A; 4I7D A; 1CA4 A; #chains in the Genus database with same CATH homology 1FLK A; 3HQI A; 4KG9 A; 5E1T A; 1CZZ A; 4GJH A; 4X3G A; 4M4E A; 1D00 A; 2CR2 A; 2GKW A; 3HQM A; 1YZE A; 2F1Y A; 3HU6 A; 2FOO A; 3MQR A; 4JJQ A; 2FOP A; 4Z8M A; 1FLL A; 1K2F A; 3IVV A; 4I7B A; 1CZY A; 4YSI A; 4K8U A; 1YY6 A; 2F1Z A; 3MQS C; 1D0A A; 1QSC A; 2A25 A; 1LB6 A; 1RF3 A; 2F1X A; 1D0J A; 1D01 A; 2F1W A; 2XXN A; 3HSV A; 2AN6 A; 3ZJB A; 1CA9 A; 4C9Z A; 1F3V B; 1LB5 A; 1ZMS A; 3IVQ A; 4GHU A; 4O1V A; 3HQH A; 1KZZ A; 2FOJ A; 5H9M A; 1L0A A; 1LB4 A; 4I7C A; 4GWN A; 4GWM A; 4CA1 A; 3HQL A; 3IVB A; 4I7D A; 1CA4 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...