The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
26
|
sequence length |
144
|
structure length |
144
|
Chain Sequence |
TSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAWD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural Basis of Competitive Recognition of p53 and MDM2 by HAUSP/USP7: Implications for the Regulation of the p53-MDM2 Pathway.
pubmed doi rcsb |
molecule tags |
Hydrolase
|
source organism |
Homo sapiens
|
molecule keywords |
Ubiquitin carboxyl-terminal hydrolase 7
|
total genus |
26
|
structure length |
144
|
sequence length |
144
|
ec nomenclature |
ec
3.4.19.12: Ubiquitinyl hydrolase 1. |
pdb deposition date | 2005-11-15 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00917 | MATH | MATH domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A | Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A |
#chains in the Genus database with same CATH superfamily 2F1X A; 2A25 A; 2F1W A; 4Z8M A; 2FOO A; 2F1Z A; 1QSC A; 4YSI A; 3MQS C; 4O1V A; 1CA9 A; 3IVQ A; 2FOP A; 3MQR A; 4GHU A; 3HSV A; 2XXN A; 3IVV A; 5H9M A; 3IVB A; 1CZY A; 1K2F A; 1CZZ A; 1LB4 A; 1RF3 A; 4I7D A; 4X3G A; 4CA1 A; 1FLL A; 4GWM A; 2F1Y A; 2GKW A; 4C9Z A; 4M4E A; 1D01 A; 3HQM A; 4KG9 A; 3HU6 A; 3HQL A; 1CA4 A; 2FOJ A; 1ZMS A; 4JJQ A; 4I7C A; 2AN6 A; 1D0J A; 1D00 A; 4GJH A; 4GWN A; 4I7B A; 1D0A A; 1FLK A; 1YZE A; 5E1T A; 3ZJB A; 3HQI A; 1LB6 A; 4K8U A; 1L0A A; 1YY6 A; 1KZZ A; 1F3V B; 2CR2 A; 1LB5 A; 3HQH A; #chains in the Genus database with same CATH topology 2F1X A; 2A25 A; 2F1W A; 4Z8M A; 2FOO A; 2F1Z A; 1QSC A; 4YSI A; 3MQS C; 4O1V A; 1CA9 A; 3IVQ A; 2FOP A; 3MQR A; 4GHU A; 3HSV A; 2XXN A; 3IVV A; 5H9M A; 3IVB A; 1CZY A; 1K2F A; 1CZZ A; 1LB4 A; 1RF3 A; 4I7D A; 4X3G A; 4CA1 A; 1FLL A; 4GWM A; 2F1Y A; 2GKW A; 4C9Z A; 4M4E A; 1D01 A; 3HQM A; 4KG9 A; 3HU6 A; 3HQL A; 1CA4 A; 2FOJ A; 1ZMS A; 4JJQ A; 4I7C A; 2AN6 A; 1D0J A; 1D00 A; 4GJH A; 4GWN A; 4I7B A; 1D0A A; 1FLK A; 1YZE A; 5E1T A; 3ZJB A; 3HQI A; 1LB6 A; 4K8U A; 1L0A A; 1YY6 A; 1KZZ A; 1F3V B; 2CR2 A; 1LB5 A; 3HQH A; #chains in the Genus database with same CATH homology 2F1X A; 2A25 A; 2F1W A; 4Z8M A; 2FOO A; 2F1Z A; 1QSC A; 4YSI A; 3MQS C; 4O1V A; 1CA9 A; 3IVQ A; 2FOP A; 3MQR A; 4GHU A; 3HSV A; 2XXN A; 3IVV A; 5H9M A; 3IVB A; 1CZY A; 1K2F A; 1CZZ A; 1LB4 A; 1RF3 A; 4I7D A; 4X3G A; 4CA1 A; 1FLL A; 4GWM A; 2F1Y A; 2GKW A; 4C9Z A; 4M4E A; 1D01 A; 3HQM A; 4KG9 A; 3HU6 A; 3HQL A; 1CA4 A; 2FOJ A; 1ZMS A; 4JJQ A; 4I7C A; 2AN6 A; 1D0J A; 1D00 A; 4GJH A; 4GWN A; 4I7B A; 1D0A A; 1FLK A; 1YZE A; 5E1T A; 3ZJB A; 3HQI A; 1LB6 A; 4K8U A; 1L0A A; 1YY6 A; 1KZZ A; 1F3V B; 2CR2 A; 1LB5 A; 3HQH A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...