The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
42
|
sequence length |
117
|
structure length |
117
|
Chain Sequence |
SHMRTLLIRYILWRNDNDQTYYNDDFKKLMLLDELVDDGDVCTLIKNMRMTLSDGPLLDRLNQPVNNIEDAKRMIAISAKVARDIGERSEIRWEESFTILFRMIETYFDDLMIDLYG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Vaccinia virus N1L protein resembles a B cell lymphoma-2 (Bcl-2) family protein.
pubmed doi rcsb |
| molecule tags |
Viral protein
|
| source organism |
Vaccinia virus
|
| molecule keywords |
Protein N1
|
| total genus |
42
|
| structure length |
117
|
| sequence length |
117
|
| chains with identical sequence |
B, C, D, E, F
|
| ec nomenclature | |
| pdb deposition date | 2006-08-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF06227 | Poxvirus | dsDNA Poxvirus |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Apoptosis Regulator Bcl-x | Apoptosis Regulator Bcl-x |
#chains in the Genus database with same CATH superfamily 2VVX A; 4BBD A; 3JRV A; 4BBB A; 4BBC A; 2VVY A; 2I39 A; 2VVW A; 4M0S A; 2K36 A; 2UXE A; 4LQK A; #chains in the Genus database with same CATH topology 2MHS A; 1YSW A; 4BDU A; 4BD7 A; 1R2H A; 5FMI A; 1AF3 A; 2JM6 B; 4YJ4 A; 4S0P A; 2IMS A; 4D2M A; 3JRV A; 4ZIF A; 4HW3 A; 1MK3 A; 3I1H A; 4K5B C; 4OQ6 A; 2ME8 A; 4ZIG A; 2O21 A; 3KJ0 A; 1R2D A; 4BBC A; 2BID A; 4QVX A; 4B4S A; 2JBX A; 1ZY3 A; 1LXL A; 2VVW A; 4LQK A; 4MI8 A; 1R2E A; 2MEJ A; 3IHD A; 5FC4 A; 1DDB A; 2VVY A; 3IIH A; 3KJ2 A; 4D2L A; 2M5B A; 2ROD A; 2V6Q A; 5KTG A; 2VM6 A; 2I39 A; 1Q59 A; 4BPJ A; 1K3K A; 4YK9 A; 5FDO A; 3WIX A; 5KU9 A; 2BZW A; 2O2M A; 3DVU A; 4WMR A; 1G5M A; 1R2G A; 3KZ0 A; 2O22 A; 3IO9 A; 2O2N A; 1G5J A; 5C3F A; 1YSN A; 5C6H A; 3MK8 A; 4BBB A; 2K7W A; 4BD6 A; 4UF2 A; 4BD2 A; 2O2F A; 1OHU A; 3WIY A; 2VOI A; 2B48 A; 2VOG A; 1PQ0 A; 4U2U A; 2JBY A; 1O0L A; 1YSG A; 2YV6 A; 3IIG A; 1YSI A; 4M0S A; 4ZII A; 4BBD A; 3QBR A; 2W3L A; 2PQK A; 2KUA A; 3D7V A; 2IMT A; 5JSB A; 3KJ1 A; 2VOF A; 4G35 A; 1MAZ A; 4ZEQ A; 1PQ1 A; 2VOH A; 2O42 A; 3PK1 A; 2KBW A; 4BPI A; 1WSX A; 2VVX A; 3IHE A; 4ZIE A; 2JCN A; 3CVA X; 4QNQ A; 4ZBF A; 3BL2 A; 4UF3 A; 4OYD A; 2VTY A; 4ZBI A; 4HW2 A; 2WH6 A; 2NLA A; 1GJH A; 1F16 A; 2XPX A; 4UF1 A; 4ZIH A; 2K36 A; 2UXE A; 2XA0 A; 3MQP A; 5FDR A; 2A5Y A; 4U2V A; 1R2I A; 1BXL A; 5IEZ A; 5IF4 A; 4S0O A; 2NL9 A; 4HW4 A; 2ROC A; 2LR1 A; 3ILC A; 4OQ5 A; 4BD8 A; 2ABO A; 1TY4 A; 3IHC A; #chains in the Genus database with same CATH homology 2VVX A; 2I39 A; 4UF3 A; 2JBY A; 2VTY A; 4D2M A; 3JRV A; 4UF1 A; 4M0S A; 2K36 A; 2UXE A; 4BBD A; 4BBC A; 2JBX A; 2VVW A; 4BBB A; 4LQK A; 4UF2 A; 2O42 A; 2VVY A; 4D2L A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
