5KTGA

Crystal structure of mouse bak bh3-in-groove homodimer (gfp)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
309
structure length
308
Chain Sequence
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSNLSKDPNEKRDHMVLLEFVTAAGITGSNSILGQVGRQLALIGDDICRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSGISWGRVVALLGFGYRLALYVYQRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein, Bcl-2 homologous antagonist/kille
publication title Assembly of Bak homodimers into higher order homooligomers in the mitochondrial apoptotic pore.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Apoptosis
total genus 82
structure length 308
sequence length 309
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.437.10 Mainly Alpha Orthogonal Bundle Apoptosis Regulator Bcl-x Blc2-like 5ktgA02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 5ktgA01
1YSWA 1JBYA 2JADA 3I19A 4XOVA 4DXNA 3PJ7A 1XMZA 3DQJA 1C4FA 3E5TA 3OGOA 1AF3A 2PXWA 4W6OA 5HBDA 4IK5A 3ILCA 4Q7TA 1G5MA 4QVXA 4JEOA 4W6GA 2GX2A 2ICRA 1QYFA 4W6AA 4L12A 3SSPA 3U0LA 2IB6A 4KGFA 1MOUA 2BIDA 1WSXA 2G16B 1ZGQA 2HJOA 1GL4A 1Q4EA 2G6YA 4PPJA 4BD7A 1QXTA 4LJDC 5IF4A 2VADA 2DD9A 1ZY3A 1KYRA 4Q7UA 4W72A 3LF4B 4ZBFA 2A54B 5BTTA 5EXUA 4ZIGA 3IHEA 2A52B 3U8PA 2AWMA 4PFEA 5IEZA 2WISA 4KW9A 1OHUA 2A50B 2Q57A 3DQFA 4HQ8A 3ZULA 3SVNA 5FHVA 2A46A 1MYWA 4OJ0A 3EVRA 5LK4A 3A8SA 2HQZA 2G3OA 4ZBIA 5EJUA 4ZIEA 3SVSA 5FVGA 3IR8A 1Q4DA 3DPZA 2C9JA 4W6BA 4Z4MA 2QT2A 2WH6A 3VHTB 3SVBA 5AQBB 2YE0A 4S0PA 1XSSA 3SG6A 2IE2A 3EVPA 2HGYA 2O24A 1RM9A 2DDDA 3O78A 3U8AA 2HFCA 4L1IA 3KCTA 5HZUA 2ME8A 2DUFA 3DQKA 4W6PA 4ZIOA 2YE1A 1W7SA 3KCSA 3MK8A 4WMRA 3CFHA 5BQLA 2OTBA 2H8QA 4AR7A 2HGDA 4S0OA 5HW9A 3SVOA 4QNQA 4YJ4A 2ZMUA 3S05A 3DQMA 4J88A 4H3LA 2BZWA 1EMEA 4OGSA 4W7EA 4H3NA 1TY4A 4IK3A 2Z6YA 1JBZA 4Q9XA 3TMTA 3MQPA 4IK9A 5HZSA 4KF4A 2K7WA 4W7AA 3IP2A 1F0BA 3DQIA 4W6UA 3U8CA 4W6HA 3CFAA 3DQNA 2A56B 2HPWA 1Q59A 3NF0A 2Z6ZA 3I1HA 1RRXA 3ST3A 1CV7A 1ZUXA 4RTCA 3SG3A 3LA1A 2V4EA 4Z4KA 4B30A 4PPLA 4ZINA 4KF5C 2QLGB 1Z1PA 3LS3A 4TZGA 4W7XA 2RH7A 2Y0GA 3VICA 3V3DA 4YK9A 4OY4A 4KA9A 2M5BA 2O21A 2HQKA 4W6JA 4LQUA 4P1QA 1MK3A 3PJBA 4ANJA 2G6EA 4W74A 2ZO7A 1XA9A 3SVUA 4Q9WA 3DQUA 3BL2A 2RODA 4ZF3A 2DUIA 5DU0A 5BT0A 3WIXA 1QYQA 4W7FA 2NLAA 3DQCA 3EK4A 3M22A 2DUGA 5DRGA 4W6IA 2JM6B 1YJ2A 3U0MA 3WIYA 3GB3A 2LR1A 2V6QA 3SSVA 1YSIA 2OKWA 2O2BA 3LVDA 3PIBA 3DQ3A 4LJBA 2A48A 4P76A 3NT3A 2JCNA 3WCKA 1OXFA 2VVIA 1GFLA 3PK1A 2NL9A 3DQ7A 5H88A 2EMNA 5DTLA 4ZB1A 1EMCA 3EVVA 4J8AA 3EK7A 2O22A 3SVCA 3LF3A 4KW4A 4R6DA 4BD2A 2QLHA 2O2NA 3DQEA 3P8UA 4W6LA 3GEXA 2P4MA 1LXLA 4G35A 5KTGA 2YV6A 3QBRA 4RYWA 5EXCI 3EKHA 3CGLA 3DQ4A 5LTPA 4DKNA 5BTTB 3WLCA 2VOFA 2XPXA 1F09A 3DQHA 3BX9A 1GJHA 1EMKA 4HE4A 2ROCA 1OXDA 4MI8A 2WSOA 1K3KA 2WHSA 2IMSA 3CFFA 4OQWA 2VVJA 4W7CA 4ZIHA 3EK8A 2QRFA 2ABOA 3D7VA 3GJ2A 4J89A 1R2HA 1YHGA 1UISA 2GW3A 4XVPA 1R2DA 3KJ0A 1QYOA 2ZMWA 5EB6A 2OTEA 3GJ1A 4ZIFA 1F16A 2IOVA 4H47A 1JC0A 2VZXA 3DPWA 3SSHA 3SG2A 5FDOA 3EKJA 3SVDA 1H4UA 4GOBA 4DKMA 3UG0A 1EMFA 2FZUA 2WHTA 3LVAA 4W6DA 5LTQA 2EMDA 2O2FA 4KPIA 5DQBA 3SG7A 3MGFA 1Q4AA 3IO9A 2VAEA 3O77A 2BTJA 1RMOA 4IK4A 3ED8A 3NEZA 4HW4A 3DVUA 3ZTFA 5EB7A 3BXBA 4ZF4A 4DXQA 4H48A 2VOGA 2OJKA 3SV5A 4ZFSA 4L13A 1EMGA 3IHCA 1EMAA 3SG4A 3SSTA 4DXOA 4B4SA 3CD1A 3EVUA 2GX0A 2H6VA 2DUHA 1MOVA 2FWQA 4PPKA 5HZOA 4W73A 1R2EA 4HQCA 5DTZA 2QLGA 3W1CA 2WSNA 2H9WA 2OGRA 2HCGA 2PXSA 3AKOA 4H3MA 5FVFA 4KF5A 5HZTA 5FC4A 4HW3A 2Z1OA 3AI4A 3ZUJA 3SSYA 2MEJA 1W7TA 3H1OA 3DQAA 2G6XA 2VM6A 4W7DA 4AS8A 1YFPA 5HGEA 4BD8A 4GF6B 3DQ1A 4K5BC 3ADFA 2KUAA 1B9CA 3DQLA 2QLEA 3VK1A 1BXLA 5DPGA 1EMBA 4KAGA 1YJFA 3E5WA 5DPIA 5FMIA 4LQTA 3PJ5A 2FL1A 2ARLA 2H5PA 5DQMA 1BFPA 4JC2A 5EBJA 4W69A 4W6SA 3KZ0A 2O2MA 4HVFA 4DXPA 2YDZA 4NWSA 2IB5A 1XQMA 4JF9A 2ZO6A 1PQ0A 2O29A 3NT9A 4KEXA 3OSQA 2WURA 4EMQA 1DDBA 4Q7RA 1PQ1A 3IIGA 3SG5A 2AWLA 4W6KA 4ZBLA 3OSRA 2DDCA 2KBWA 3E5VA 2Q6PA 2H5RA 3CVAX 3SRYA 3DQOA 4DXIA 3CBEA 3SSLA 4JFGA 1G5JA 3P28A 4IZNA 4W6MA 2H5QA 2HRSA 3ST0A 4LJDA 3KJ1A 1XAEA 1KP5A 4EN1A 4HW2A 1JC1A 4W6RA 2QZ0A 2W3LA 4W6NA 3WLDA 3DQ2A 2G3DB 3CB9A 5DRFA 2GW4B 3ZUFA 3M24A 4GESB 3VHTA 3DQ5A 4IK1A 4R6BA 3W1DA 3DQDA 4JRBA 4XL5A 4ZF5A 4OHSA 3RWAA 3CD9A 3IIHA 1YZWA 3SVEA 2VOIA 2B3QA 2OKYA 2EMOA 2A47A 4XGYA 1HCJA 1Q4CA 3UFZA 3SS0A 1O0LA 2PQKA 4W7RA 2G5ZB 1YHHA 2IMTA 1ZGOA 4I2YA 1R2IA 5FDRA 2B3PA 4IK8A 4ORNA 1YSGA 4UTSA 5EHUA 4W76A 4W6TA 5DTYA 3SVRA 2WIQA 4ZIIA 1KYPA 5DY6A 4KW8A 4OQ5A 1ZGPA 4U2VA 5FVIA 4BD6A 4TZAA 1W7UA 2XA0A 2G2SB 2C9IA 3G9AA 3LSAA 3DQ9A 4OYDA 3ST2A 3BXAA 1Q4BA 2DD7A 5JSBA 1G7KA 4W77A 3RWTA 2WHUA 5KU9A 2AHAA 3DQ8A 3NEDA 2Z6XA 1OXEA 4XOWA 3IHDA 5F9GA 4DXMA 2A5YA 2V4EC 3DQ6A 3TMRA 3AI5A 3KJ2A 1S6ZA 2QLIA 4W75A 3GL4A 5LTRA 1R2GA 2POXA 3DPXA 2YFPA 1RMPA 4LW5A 1EMLA 2AWJA 4N3DA 2V4EB 5C6HA 4BPIA 1H6RA 1QY3A 4B30B 4OQ6A 2A53B 2VVHA 1RMMA 2QU1A 1Q73A 5C3FA 1Z1QA 1MAZA 4BDUA 5EXBA 2H5OA 3H1RA 3LVCA 3U0NA 1YSNA 4W6FA 3BXCA 1HUYA 2DUEA 4W6CA 3K1KA 4HQ9A 4LJCA 2AWKA 5T3IA 4B5YA 5H89A 4EDOA 4ZEQA 1EMMA 3ST4A 1GGXA 4U2UA 4RYSA 5H87A 5J2OA 1YHIA 1KYSA 4BPJA 4EULA 3U0KA 5DPHA 5DPJA 2MHSA 2VOHA 4KGEA 2AH8A 2B48A 3SSKA 4EDSA 4JGEA 5DTXA
chains in the Genus database with same CATH superfamily
1YSWA 1JBYA 2JADA 3I19A 4XOVA 4DXNA 3PJ7A 1XMZA 3DQJA 1C4FA 3E5TA 3OGOA 1AF3A 2PXWA 4W6OA 5HBDA 4IK5A 3ILCA 4Q7TA 1G5MA 4QVXA 4JEOA 4W6GA 2GX2A 2ICRA 1QYFA 4W6AA 4L12A 3SSPA 3U0LA 2IB6A 4KGFA 1MOUA 2BIDA 1WSXA 2G16B 1ZGQA 2HJOA 1GL4A 1Q4EA 2G6YA 4PPJA 4BD7A 1QXTA 4LJDC 2JBYA 5IF4A 2VADA 2DD9A 1ZY3A 1KYRA 4Q7UA 4W72A 3LF4B 4ZBFA 2A54B 5BTTA 5EXUA 4ZIGA 3IHEA 2A52B 3U8PA 2AWMA 4PFEA 5IEZA 2WISA 4KW9A 1OHUA 2A50B 2Q57A 3DQFA 4HQ8A 3ZULA 3SVNA 5FHVA 2A46A 1MYWA 4OJ0A 3EVRA 5LK4A 3A8SA 2HQZA 2G3OA 4ZBIA 5EJUA 4ZIEA 3SVSA 5FVGA 3IR8A 1Q4DA 3DPZA 2C9JA 4W6BA 4Z4MA 2QT2A 2WH6A 3VHTB 2VVWA 5AQBB 3SVBA 2YE0A 4S0PA 1XSSA 4UF2A 3SG6A 2IE2A 3EVPA 2HGYA 2O24A 1RM9A 2DDDA 3O78A 3U8AA 2HFCA 4L1IA 3KCTA 5HZUA 2ME8A 2DUFA 3DQKA 4W6PA 4ZIOA 2YE1A 1W7SA 3KCSA 3MK8A 4WMRA 3CFHA 5BQLA 2OTBA 2H8QA 4AR7A 2HGDA 4S0OA 5HW9A 3SVOA 4QNQA 4YJ4A 2ZMUA 4BBDA 3S05A 3DQMA 4J88A 4H3LA 2BZWA 1EMEA 4OGSA 4W7EA 4H3NA 1TY4A 4IK3A 2Z6YA 1JBZA 4Q9XA 3TMTA 3MQPA 4IK9A 5HZSA 4KF4A 2K7WA 2VVXA 4W7AA 3IP2A 1F0BA 3DQIA 4BBCA 4W6UA 3U8CA 4W6HA 3CFAA 3DQNA 2A56B 2HPWA 1Q59A 3NF0A 2Z6ZA 3I1HA 1RRXA 3ST3A 1CV7A 1ZUXA 4RTCA 3SG3A 3LA1A 2V4EA 4Z4KA 4B30A 4PPLA 4ZINA 2UXEA 4KF5C 2QLGB 1Z1PA 3LS3A 4TZGA 4W7XA 2RH7A 2Y0GA 3VICA 3V3DA 4YK9A 4OY4A 4KA9A 2M5BA 2O21A 2HQKA 4W6JA 4LQUA 4P1QA 1MK3A 3PJBA 4ANJA 2G6EA 4W74A 2ZO7A 1XA9A 3SVUA 4Q9WA 3DQUA 3BL2A 2RODA 4ZF3A 2DUIA 5DU0A 5BT0A 3WIXA 1QYQA 4W7FA 2NLAA 3DQCA 3EK4A 3M22A 2DUGA 5DRGA 4W6IA 2JM6B 1YJ2A 3U0MA 2I39A 3WIYA 3GB3A 2LR1A 2V6QA 3SSVA 2O42A 1YSIA 2OKWA 2O2BA 3LVDA 3PIBA 3JRVA 3DQ3A 4LJBA 2A48A 4P76A 3NT3A 2JCNA 3WCKA 1OXFA 2VVIA 1GFLA 3PK1A 2NL9A 3DQ7A 5H88A 2EMNA 5DTLA 4ZB1A 1EMCA 3EVVA 4J8AA 3EK7A 2O22A 3SVCA 3LF3A 4KW4A 4R6DA 4BD2A 2QLHA 2O2NA 3DQEA 3P8UA 4W6LA 3GEXA 2P4MA 1LXLA 4G35A 5KTGA 2YV6A 3QBRA 4RYWA 5EXCI 3EKHA 3CGLA 3DQ4A 5LTPA 4DKNA 5BTTB 3WLCA 2VOFA 2XPXA 1F09A 3DQHA 3BX9A 1GJHA 1EMKA 4HE4A 2ROCA 1OXDA 4MI8A 2WSOA 1K3KA 2WHSA 2IMSA 3CFFA 4OQWA 2VVJA 4W7CA 4ZIHA 3EK8A 2QRFA 2ABOA 3D7VA 3GJ2A 4J89A 1R2HA 1YHGA 1UISA 2GW3A 4XVPA 1R2DA 3KJ0A 1QYOA 2ZMWA 5EB6A 2OTEA 3GJ1A 4ZIFA 1F16A 2IOVA 4H47A 1JC0A 2VZXA 3DPWA 3SSHA 3SG2A 5FDOA 3EKJA 3SVDA 1H4UA 4GOBA 4DKMA 3UG0A 1EMFA 2FZUA 2WHTA 3LVAA 4W6DA 5LTQA 2EMDA 2O2FA 4KPIA 5DQBA 2K36A 3SG7A 3MGFA 1Q4AA 3IO9A 2VAEA 3O77A 2BTJA 1RMOA 4IK4A 3ED8A 3NEZA 4HW4A 3DVUA 3ZTFA 5EB7A 3BXBA 4ZF4A 4DXQA 4H48A 2VOGA 2OJKA 3SV5A 4ZFSA 4L13A 1EMGA 3IHCA 1EMAA 3SG4A 3SSTA 4DXOA 4B4SA 3CD1A 3EVUA 2GX0A 2H6VA 2DUHA 1MOVA 2FWQA 4PPKA 5HZOA 4W73A 1R2EA 4HQCA 5DTZA 2QLGA 3W1CA 2WSNA 2H9WA 2OGRA 2HCGA 2PXSA 3AKOA 4H3MA 5FVFA 4KF5A 5HZTA 5FC4A 4HW3A 2Z1OA 3AI4A 3ZUJA 3SSYA 2MEJA 1W7TA 3H1OA 3DQAA 2G6XA 2VM6A 4W7DA 4AS8A 1YFPA 5HGEA 4BD8A 4GF6B 3DQ1A 4K5BC 3ADFA 2KUAA 1B9CA 3DQLA 2QLEA 3VK1A 1BXLA 5DPGA 1EMBA 4KAGA 1YJFA 3E5WA 5DPIA 5FMIA 4LQTA 3PJ5A 2FL1A 2ARLA 2H5PA 5DQMA 1BFPA 4JC2A 5EBJA 4W69A 4W6SA 3KZ0A 2O2MA 4HVFA 4DXPA 2YDZA 4NWSA 2IB5A 1XQMA 4JF9A 2ZO6A 1PQ0A 2O29A 3NT9A 4KEXA 3OSQA 2WURA 4EMQA 1DDBA 4LQKA 4Q7RA 1PQ1A 3IIGA 3SG5A 2AWLA 4W6KA 4ZBLA 3OSRA 2DDCA 2KBWA 3E5VA 2Q6PA 2H5RA 3CVAX 3SRYA 3DQOA 4D2MA 4DXIA 3CBEA 3SSLA 4JFGA 1G5JA 3P28A 4IZNA 4W6MA 2H5QA 2HRSA 3ST0A 4LJDA 3KJ1A 1XAEA 1KP5A 4EN1A 4HW2A 1JC1A 4W6RA 2QZ0A 2W3LA 4W6NA 3WLDA 3DQ2A 2G3DB 3CB9A 5DRFA 2GW4B 3ZUFA 3M24A 4GESB 3VHTA 3DQ5A 4IK1A 4R6BA 3W1DA 3DQDA 4JRBA 4XL5A 4ZF5A 4OHSA 3RWAA 3CD9A 3IIHA 1YZWA 3SVEA 2VOIA 2B3QA 2OKYA 2EMOA 2A47A 4XGYA 1HCJA 1Q4CA 3UFZA 3SS0A 1O0LA 2PQKA 4W7RA 2G5ZB 1YHHA 2IMTA 1ZGOA 4I2YA 1R2IA 5FDRA 2B3PA 4IK8A 4ORNA 1YSGA 4UTSA 5EHUA 4W76A 4W6TA 2VVYA 5DTYA 3SVRA 2WIQA 4ZIIA 1KYPA 5DY6A 4KW8A 4OQ5A 1ZGPA 4U2VA 5FVIA 4BD6A 4TZAA 1W7UA 2XA0A 2G2SB 2C9IA 3G9AA 3LSAA 3DQ9A 4OYDA 3ST2A 3BXAA 1Q4BA 2DD7A 5JSBA 1G7KA 4W77A 3RWTA 2WHUA 5KU9A 2AHAA 3DQ8A 3NEDA 4M0SA 2Z6XA 1OXEA 4XOWA 3IHDA 5F9GA 4DXMA 2A5YA 2V4EC 3DQ6A 3TMRA 3AI5A 3KJ2A 1S6ZA 2QLIA 4W75A 3GL4A 5LTRA 1R2GA 2POXA 3DPXA 2YFPA 1RMPA 4LW5A 1EMLA 2AWJA 4N3DA 2V4EB 5C6HA 4BPIA 1H6RA 1QY3A 4B30B 4UF1A 4OQ6A 2A53B 2VVHA 1RMMA 2QU1A 1Q73A 5C3FA 1Z1QA 1MAZA 4BDUA 5EXBA 2H5OA 3H1RA 3LVCA 2JBXA 3U0NA 1YSNA 4W6FA 3BXCA 1HUYA 2DUEA 4W6CA 3K1KA 4HQ9A 4LJCA 4D2LA 2AWKA 5T3IA 4B5YA 5H89A 4EDOA 4ZEQA 1EMMA 2VTYA 3ST4A 1GGXA 4U2UA 4RYSA 5H87A 5J2OA 1YHIA 1KYSA 4BPJA 4EULA 3U0KA 5DPHA 5DPJA 2MHSA 2VOHA 4KGEA 2AH8A 2B48A 4BBBA 4UF3A 3SSKA 4EDSA 4JGEA 5DTXA
chains in the Genus database with same CATH topology
1YSWA 1JBYA 2JADA 3I19A 4XOVA 4DXNA 3PJ7A 1XMZA 3DQJA 1C4FA 3E5TA 3OGOA 1AF3A 2PXWA 4W6OA 5HBDA 4IK5A 3ILCA 4Q7TA 1G5MA 4QVXA 4JEOA 4W6GA 2GX2A 2ICRA 1QYFA 4W6AA 4L12A 3SSPA 3U0LA 2IB6A 4KGFA 1MOUA 2BIDA 1WSXA 2G16B 1ZGQA 2HJOA 1GL4A 1Q4EA 2G6YA 4PPJA 4BD7A 1QXTA 4LJDC 5IF4A 2VADA 2DD9A 1ZY3A 1KYRA 4Q7UA 4W72A 3LF4B 4ZBFA 2A54B 5BTTA 5EXUA 4ZIGA 3IHEA 2A52B 3U8PA 2AWMA 4PFEA 5IEZA 2WISA 4KW9A 1OHUA 2A50B 2Q57A 3DQFA 4HQ8A 3ZULA 3SVNA 5FHVA 2A46A 1MYWA 4OJ0A 3EVRA 5LK4A 3A8SA 2HQZA 2G3OA 4ZBIA 5EJUA 4ZIEA 3SVSA 5FVGA 3IR8A 1Q4DA 3DPZA 2C9JA 4W6BA 4Z4MA 2QT2A 2WH6A 3VHTB 3SVBA 5AQBB 2YE0A 4S0PA 1XSSA 3SG6A 2IE2A 3EVPA 2HGYA 2O24A 1RM9A 2DDDA 3O78A 3U8AA 2HFCA 4L1IA 3KCTA 5HZUA 2ME8A 2DUFA 3DQKA 4W6PA 4ZIOA 2YE1A 1W7SA 3KCSA 3MK8A 4WMRA 3CFHA 5BQLA 2OTBA 2H8QA 4AR7A 2HGDA 4S0OA 5HW9A 3SVOA 4QNQA 4YJ4A 2ZMUA 3S05A 3DQMA 4J88A 4H3LA 2BZWA 1EMEA 4OGSA 4W7EA 4H3NA 1TY4A 4IK3A 2Z6YA 1JBZA 4Q9XA 3TMTA 3MQPA 4IK9A 5HZSA 4KF4A 2K7WA 4W7AA 3IP2A 1F0BA 3DQIA 4W6UA 3U8CA 4W6HA 3CFAA 3DQNA 2A56B 2HPWA 1Q59A 3NF0A 2Z6ZA 3I1HA 1RRXA 3ST3A 1CV7A 1ZUXA 4RTCA 3SG3A 3LA1A 2V4EA 4Z4KA 4B30A 4PPLA 4ZINA 4KF5C 2QLGB 1Z1PA 3LS3A 4TZGA 4W7XA 2RH7A 2Y0GA 3VICA 3V3DA 4YK9A 4OY4A 4KA9A 2M5BA 2O21A 2HQKA 4W6JA 4LQUA 4P1QA 1MK3A 3PJBA 4ANJA 2G6EA 4W74A 2ZO7A 1XA9A 3SVUA 4Q9WA 3DQUA 3BL2A 2RODA 4ZF3A 2DUIA 5DU0A 5BT0A 3WIXA 1QYQA 4W7FA 2NLAA 3DQCA 3EK4A 3M22A 2DUGA 5DRGA 4W6IA 2JM6B 1YJ2A 3U0MA 3WIYA 3GB3A 2LR1A 2V6QA 3SSVA 1YSIA 2OKWA 2O2BA 3LVDA 3PIBA 3DQ3A 4LJBA 2A48A 4P76A 3NT3A 2JCNA 3WCKA 1OXFA 2VVIA 1GFLA 3PK1A 2NL9A 3DQ7A 5H88A 2EMNA 5DTLA 4ZB1A 1EMCA 3EVVA 4J8AA 3EK7A 2O22A 3SVCA 3LF3A 4KW4A 4R6DA 4BD2A 2QLHA 2O2NA 3DQEA 3P8UA 4W6LA 3GEXA 2P4MA 1LXLA 4G35A 5KTGA 2YV6A 3QBRA 4RYWA 5EXCI 3EKHA 3CGLA 3DQ4A 5LTPA 4DKNA 5BTTB 3WLCA 2VOFA 2XPXA 1F09A 3DQHA 3BX9A 1GJHA 1EMKA 4HE4A 2ROCA 1OXDA 4MI8A 2WSOA 1K3KA 2WHSA 2IMSA 3CFFA 4OQWA 2VVJA 4W7CA 4ZIHA 3EK8A 2QRFA 2ABOA 3D7VA 3GJ2A 4J89A 1R2HA 1YHGA 1UISA 2GW3A 4XVPA 1R2DA 3KJ0A 1QYOA 2ZMWA 5EB6A 2OTEA 3GJ1A 4ZIFA 1F16A 2IOVA 4H47A 1JC0A 2VZXA 3DPWA 3SSHA 3SG2A 5FDOA 3EKJA 3SVDA 1H4UA 4GOBA 4DKMA 3UG0A 1EMFA 2FZUA 2WHTA 3LVAA 4W6DA 5LTQA 2EMDA 2O2FA 4KPIA 5DQBA 3SG7A 3MGFA 1Q4AA 3IO9A 2VAEA 3O77A 2BTJA 1RMOA 4IK4A 3ED8A 3NEZA 4HW4A 3DVUA 3ZTFA 5EB7A 3BXBA 4ZF4A 4DXQA 4H48A 2VOGA 2OJKA 3SV5A 4ZFSA 4L13A 1EMGA 3IHCA 1EMAA 3SG4A 3SSTA 4DXOA 4B4SA 3CD1A 3EVUA 2GX0A 2H6VA 2DUHA 1MOVA 2FWQA 4PPKA 5HZOA 4W73A 1R2EA 4HQCA 5DTZA 2QLGA 3W1CA 2WSNA 2H9WA 2OGRA 2HCGA 2PXSA 3AKOA 4H3MA 5FVFA 4KF5A 5HZTA 5FC4A 4HW3A 2Z1OA 3AI4A 3ZUJA 3SSYA 2MEJA 1W7TA 3H1OA 3DQAA 2G6XA 2VM6A 4W7DA 4AS8A 1YFPA 5HGEA 4BD8A 4GF6B 3DQ1A 4K5BC 3ADFA 2KUAA 1B9CA 3DQLA 2QLEA 3VK1A 1BXLA 5DPGA 1EMBA 4KAGA 1YJFA 3E5WA 5DPIA 5FMIA 4LQTA 3PJ5A 2FL1A 2ARLA 2H5PA 5DQMA 1BFPA 4JC2A 5EBJA 4W69A 4W6SA 3KZ0A 2O2MA 4HVFA 4DXPA 2YDZA 4NWSA 2IB5A 1XQMA 4JF9A 2ZO6A 1PQ0A 2O29A 3NT9A 4KEXA 3OSQA 2WURA 4EMQA 1DDBA 4Q7RA 1PQ1A 3IIGA 3SG5A 2AWLA 4W6KA 4ZBLA 3OSRA 2DDCA 2KBWA 3E5VA 2Q6PA 2H5RA 3CVAX 3SRYA 3DQOA 4DXIA 3CBEA 3SSLA 4JFGA 1G5JA 3P28A 4IZNA 4W6MA 2H5QA 2HRSA 3ST0A 4LJDA 3KJ1A 1XAEA 1KP5A 4EN1A 4HW2A 1JC1A 4W6RA 2QZ0A 2W3LA 4W6NA 3WLDA 3DQ2A 2G3DB 3CB9A 5DRFA 2GW4B 3ZUFA 3M24A 4GESB 3VHTA 3DQ5A 4IK1A 4R6BA 3W1DA 3DQDA 4JRBA 4XL5A 4ZF5A 4OHSA 3RWAA 3CD9A 3IIHA 1YZWA 3SVEA 2VOIA 2B3QA 2OKYA 2EMOA 2A47A 4XGYA 1HCJA 1Q4CA 3UFZA 3SS0A 1O0LA 2PQKA 4W7RA 2G5ZB 1YHHA 2IMTA 1ZGOA 4I2YA 1R2IA 5FDRA 2B3PA 4IK8A 4ORNA 1YSGA 4UTSA 5EHUA 4W76A 4W6TA 5DTYA 3SVRA 2WIQA 4ZIIA 1KYPA 5DY6A 4KW8A 4OQ5A 1ZGPA 4U2VA 5FVIA 4BD6A 4TZAA 1W7UA 2XA0A 2G2SB 2C9IA 3G9AA 3LSAA 3DQ9A 4OYDA 3ST2A 3BXAA 1Q4BA 2DD7A 5JSBA 1G7KA 4W77A 3RWTA 2WHUA 5KU9A 2AHAA 3DQ8A 3NEDA 2Z6XA 1OXEA 4XOWA 3IHDA 5F9GA 4DXMA 2A5YA 2V4EC 3DQ6A 3TMRA 3AI5A 3KJ2A 1S6ZA 2QLIA 4W75A 3GL4A 5LTRA 1R2GA 2POXA 3DPXA 2YFPA 1RMPA 4LW5A 1EMLA 2AWJA 4N3DA 2V4EB 5C6HA 4BPIA 1H6RA 1QY3A 4B30B 4OQ6A 2A53B 2VVHA 1RMMA 2QU1A 1Q73A 5C3FA 1Z1QA 1MAZA 4BDUA 5EXBA 2H5OA 3H1RA 3LVCA 3U0NA 1YSNA 4W6FA 3BXCA 1HUYA 2DUEA 4W6CA 3K1KA 4HQ9A 4LJCA 2AWKA 5T3IA 4B5YA 5H89A 4EDOA 4ZEQA 1EMMA 3ST4A 1GGXA 4U2UA 4RYSA 5H87A 5J2OA 1YHIA 1KYSA 4BPJA 4EULA 3U0KA 5DPHA 5DPJA 2MHSA 2VOHA 4KGEA 2AH8A 2B48A 3SSKA 4EDSA 4JGEA 5DTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YSW A;  1JBY A;  2JAD A;  3I19 A;  4XOV A;  4DXN A;  3PJ7 A;  1XMZ A;  3DQJ A;  1C4F A;  3E5T A;  3OGO A;  1AF3 A;  2PXW A;  4W6O A;  5HBD A;  4IK5 A;  3ILC A;  4Q7T A;  1G5M A;  4QVX A;  4JEO A;  4W6G A;  2GX2 A;  2ICR A;  1QYF A;  4W6A A;  4L12 A;  3SSP A;  3U0L A;  2IB6 A;  4KGF A;  1MOU A;  2BID A;  1WSX A;  2G16 B;  1ZGQ A;  2HJO A;  1GL4 A;  1Q4E A;  2G6Y A;  4PPJ A;  4BD7 A;  1QXT A;  4LJD C;  5IF4 A;  2VAD A;  2DD9 A;  1ZY3 A;  1KYR A;  4Q7U A;  4W72 A;  3LF4 B;  4ZBF A;  2A54 B;  5BTT A;  5EXU A;  4ZIG A;  3IHE A;  2A52 B;  3U8P A;  2AWM A;  4PFE A;  5IEZ A;  2WIS A;  4KW9 A;  1OHU A;  2A50 B;  2Q57 A;  3DQF A;  4HQ8 A;  3ZUL A;  3SVN A;  5FHV A;  2A46 A;  1MYW A;  4OJ0 A;  3EVR A;  5LK4 A;  3A8S A;  2HQZ A;  2G3O A;  4ZBI A;  5EJU A;  4ZIE A;  3SVS A;  5FVG A;  3IR8 A;  1Q4D A;  3DPZ A;  2C9J A;  4W6B A;  4Z4M A;  2QT2 A;  2WH6 A;  3VHT B;  3SVB A;  5AQB B;  2YE0 A;  4S0P A;  1XSS A;  3SG6 A;  2IE2 A;  3EVP A;  2HGY A;  2O24 A;  1RM9 A;  2DDD A;  3O78 A;  3U8A A;  2HFC A;  4L1I A;  3KCT A;  5HZU A;  2ME8 A;  2DUF A;  3DQK A;  4W6P A;  4ZIO A;  2YE1 A;  1W7S A;  3KCS A;  3MK8 A;  4WMR A;  3CFH A;  5BQL A;  2OTB A;  2H8Q A;  4AR7 A;  2HGD A;  4S0O A;  5HW9 A;  3SVO A;  4QNQ A;  4YJ4 A;  2ZMU A;  3S05 A;  3DQM A;  4J88 A;  4H3L A;  2BZW A;  1EME A;  4OGS A;  4W7E A;  4H3N A;  1TY4 A;  4IK3 A;  2Z6Y A;  1JBZ A;  4Q9X A;  3TMT A;  3MQP A;  4IK9 A;  5HZS A;  4KF4 A;  2K7W A;  4W7A A;  3IP2 A;  1F0B A;  3DQI A;  4W6U A;  3U8C A;  4W6H A;  3CFA A;  3DQN A;  2A56 B;  2HPW A;  1Q59 A;  3NF0 A;  2Z6Z A;  3I1H A;  1RRX A;  3ST3 A;  1CV7 A;  1ZUX A;  4RTC A;  3SG3 A;  3LA1 A;  2V4E A;  4Z4K A;  4B30 A;  4PPL A;  4ZIN A;  4KF5 C;  2QLG B;  1Z1P A;  3LS3 A;  4TZG A;  4W7X A;  2RH7 A;  2Y0G A;  3VIC A;  3V3D A;  4YK9 A;  4OY4 A;  4KA9 A;  2M5B A;  2O21 A;  2HQK A;  4W6J A;  4LQU A;  4P1Q A;  1MK3 A;  3PJB A;  4ANJ A;  2G6E A;  4W74 A;  2ZO7 A;  1XA9 A;  3SVU A;  4Q9W A;  3DQU A;  3BL2 A;  2ROD A;  4ZF3 A;  2DUI A;  5DU0 A;  5BT0 A;  3WIX A;  1QYQ A;  4W7F A;  2NLA A;  3DQC A;  3EK4 A;  3M22 A;  2DUG A;  5DRG A;  4W6I A;  2JM6 B;  1YJ2 A;  3U0M A;  3WIY A;  3GB3 A;  2LR1 A;  2V6Q A;  3SSV A;  1YSI A;  2OKW A;  2O2B A;  3LVD A;  3PIB A;  3DQ3 A;  4LJB A;  2A48 A;  4P76 A;  3NT3 A;  2JCN A;  3WCK A;  1OXF A;  2VVI A;  1GFL A;  3PK1 A;  2NL9 A;  3DQ7 A;  5H88 A;  2EMN A;  5DTL A;  4ZB1 A;  1EMC A;  3EVV A;  4J8A A;  3EK7 A;  2O22 A;  3SVC A;  3LF3 A;  4KW4 A;  4R6D A;  4BD2 A;  2QLH A;  2O2N A;  3DQE A;  3P8U A;  4W6L A;  3GEX A;  2P4M A;  1LXL A;  4G35 A;  5KTG A;  2YV6 A;  3QBR A;  4RYW A;  5EXC I;  3EKH A;  3CGL A;  3DQ4 A;  5LTP A;  4DKN A;  5BTT B;  3WLC A;  2VOF A;  2XPX A;  1F09 A;  3DQH A;  3BX9 A;  1GJH A;  1EMK A;  4HE4 A;  2ROC A;  1OXD A;  4MI8 A;  2WSO A;  1K3K A;  2WHS A;  2IMS A;  3CFF A;  4OQW A;  2VVJ A;  4W7C A;  4ZIH A;  3EK8 A;  2QRF A;  2ABO A;  3D7V A;  3GJ2 A;  4J89 A;  1R2H A;  1YHG A;  1UIS A;  2GW3 A;  4XVP A;  1R2D A;  3KJ0 A;  1QYO A;  2ZMW A;  5EB6 A;  2OTE A;  3GJ1 A;  4ZIF A;  1F16 A;  2IOV A;  4H47 A;  1JC0 A;  2VZX A;  3DPW A;  3SSH A;  3SG2 A;  5FDO A;  3EKJ A;  3SVD A;  1H4U A;  4GOB A;  4DKM A;  3UG0 A;  1EMF A;  2FZU A;  2WHT A;  3LVA A;  4W6D A;  5LTQ A;  2EMD A;  2O2F A;  4KPI A;  5DQB A;  3SG7 A;  3MGF A;  1Q4A A;  3IO9 A;  2VAE A;  3O77 A;  2BTJ A;  1RMO A;  4IK4 A;  3ED8 A;  3NEZ A;  4HW4 A;  3DVU A;  3ZTF A;  5EB7 A;  3BXB A;  4ZF4 A;  4DXQ A;  4H48 A;  2VOG A;  2OJK A;  3SV5 A;  4ZFS A;  4L13 A;  1EMG A;  3IHC A;  1EMA A;  3SG4 A;  3SST A;  4DXO A;  4B4S A;  3CD1 A;  3EVU A;  2GX0 A;  2H6V A;  2DUH A;  1MOV A;  2FWQ A;  4PPK A;  5HZO A;  4W73 A;  1R2E A;  4HQC A;  5DTZ A;  2QLG A;  3W1C A;  2WSN A;  2H9W A;  2OGR A;  2HCG A;  2PXS A;  3AKO A;  4H3M A;  5FVF A;  4KF5 A;  5HZT A;  5FC4 A;  4HW3 A;  2Z1O A;  3AI4 A;  3ZUJ A;  3SSY A;  2MEJ A;  1W7T A;  3H1O A;  3DQA A;  2G6X A;  2VM6 A;  4W7D A;  4AS8 A;  1YFP A;  5HGE A;  4BD8 A;  4GF6 B;  3DQ1 A;  4K5B C;  3ADF A;  2KUA A;  1B9C A;  3DQL A;  2QLE A;  3VK1 A;  1BXL A;  5DPG A;  1EMB A;  4KAG A;  1YJF A;  3E5W A;  5DPI A;  5FMI A;  4LQT A;  3PJ5 A;  2FL1 A;  2ARL A;  2H5P A;  5DQM A;  1BFP A;  4JC2 A;  5EBJ A;  4W69 A;  4W6S A;  3KZ0 A;  2O2M A;  4HVF A;  4DXP A;  2YDZ A;  4NWS A;  2IB5 A;  1XQM A;  4JF9 A;  2ZO6 A;  1PQ0 A;  2O29 A;  3NT9 A;  4KEX A;  3OSQ A;  2WUR A;  4EMQ A;  1DDB A;  4Q7R A;  1PQ1 A;  3IIG A;  3SG5 A;  2AWL A;  4W6K A;  4ZBL A;  3OSR A;  2DDC A;  2KBW A;  3E5V A;  2Q6P A;  2H5R A;  3CVA X;  3SRY A;  3DQO A;  4DXI A;  3CBE A;  3SSL A;  4JFG A;  1G5J A;  3P28 A;  4IZN A;  4W6M A;  2H5Q A;  2HRS A;  3ST0 A;  4LJD A;  3KJ1 A;  1XAE A;  1KP5 A;  4EN1 A;  4HW2 A;  1JC1 A;  4W6R A;  2QZ0 A;  2W3L A;  4W6N A;  3WLD A;  3DQ2 A;  2G3D B;  3CB9 A;  5DRF A;  2GW4 B;  3ZUF A;  3M24 A;  4GES B;  3VHT A;  3DQ5 A;  4IK1 A;  4R6B A;  3W1D A;  3DQD A;  4JRB A;  4XL5 A;  4ZF5 A;  4OHS A;  3RWA A;  3CD9 A;  3IIH A;  1YZW A;  3SVE A;  2VOI A;  2B3Q A;  2OKY A;  2EMO A;  2A47 A;  4XGY A;  1HCJ A;  1Q4C A;  3UFZ A;  3SS0 A;  1O0L A;  2PQK A;  4W7R A;  2G5Z B;  1YHH A;  2IMT A;  1ZGO A;  4I2Y A;  1R2I A;  5FDR A;  2B3P A;  4IK8 A;  4ORN A;  1YSG A;  4UTS A;  5EHU A;  4W76 A;  4W6T A;  5DTY A;  3SVR A;  2WIQ A;  4ZII A;  1KYP A;  5DY6 A;  4KW8 A;  4OQ5 A;  1ZGP A;  4U2V A;  5FVI A;  4BD6 A;  4TZA A;  1W7U A;  2XA0 A;  2G2S B;  2C9I A;  3G9A A;  3LSA A;  3DQ9 A;  4OYD A;  3ST2 A;  3BXA A;  1Q4B A;  2DD7 A;  5JSB A;  1G7K A;  4W77 A;  3RWT A;  2WHU A;  5KU9 A;  2AHA A;  3DQ8 A;  3NED A;  2Z6X A;  1OXE A;  4XOW A;  3IHD A;  5F9G A;  4DXM A;  2A5Y A;  2V4E C;  3DQ6 A;  3TMR A;  3AI5 A;  3KJ2 A;  1S6Z A;  2QLI A;  4W75 A;  3GL4 A;  5LTR A;  1R2G A;  2POX A;  3DPX A;  2YFP A;  1RMP A;  4LW5 A;  1EML A;  2AWJ A;  4N3D A;  2V4E B;  5C6H A;  4BPI A;  1H6R A;  1QY3 A;  4B30 B;  4OQ6 A;  2A53 B;  2VVH A;  1RMM A;  2QU1 A;  1Q73 A;  5C3F A;  1Z1Q A;  1MAZ A;  4BDU A;  5EXB A;  2H5O A;  3H1R A;  3LVC A;  3U0N A;  1YSN A;  4W6F A;  3BXC A;  1HUY A;  2DUE A;  4W6C A;  3K1K A;  4HQ9 A;  4LJC A;  2AWK A;  5T3I A;  4B5Y A;  5H89 A;  4EDO A;  4ZEQ A;  1EMM A;  3ST4 A;  1GGX A;  4U2U A;  4RYS A;  5H87 A;  5J2O A;  1YHI A;  1KYS A;  4BPJ A;  4EUL A;  3U0K A;  5DPH A;  5DPJ A;  2MHS A;  2VOH A;  4KGE A;  2AH8 A;  2B48 A;  3SSK A;  4EDS A;  4JGE A;  5DTX A; 
#chains in the Genus database with same CATH topology
 1YSW A;  1JBY A;  2JAD A;  3I19 A;  4XOV A;  4DXN A;  3PJ7 A;  1XMZ A;  3DQJ A;  1C4F A;  3E5T A;  3OGO A;  1AF3 A;  2PXW A;  4W6O A;  5HBD A;  4IK5 A;  3ILC A;  4Q7T A;  1G5M A;  4QVX A;  4JEO A;  4W6G A;  2GX2 A;  2ICR A;  1QYF A;  4W6A A;  4L12 A;  3SSP A;  3U0L A;  2IB6 A;  4KGF A;  1MOU A;  2BID A;  1WSX A;  2G16 B;  1ZGQ A;  2HJO A;  1GL4 A;  1Q4E A;  2G6Y A;  4PPJ A;  4BD7 A;  1QXT A;  4LJD C;  2JBY A;  5IF4 A;  2VAD A;  2DD9 A;  1ZY3 A;  1KYR A;  4Q7U A;  4W72 A;  3LF4 B;  4ZBF A;  2A54 B;  5BTT A;  5EXU A;  4ZIG A;  3IHE A;  2A52 B;  3U8P A;  2AWM A;  4PFE A;  5IEZ A;  2WIS A;  4KW9 A;  1OHU A;  2A50 B;  2Q57 A;  3DQF A;  4HQ8 A;  3ZUL A;  3SVN A;  5FHV A;  2A46 A;  1MYW A;  4OJ0 A;  3EVR A;  5LK4 A;  3A8S A;  2HQZ A;  2G3O A;  4ZBI A;  5EJU A;  4ZIE A;  3SVS A;  5FVG A;  3IR8 A;  1Q4D A;  3DPZ A;  2C9J A;  4W6B A;  4Z4M A;  2QT2 A;  2WH6 A;  3VHT B;  2VVW A;  5AQB B;  3SVB A;  2YE0 A;  4S0P A;  1XSS A;  4UF2 A;  3SG6 A;  2IE2 A;  3EVP A;  2HGY A;  2O24 A;  1RM9 A;  2DDD A;  3O78 A;  3U8A A;  2HFC A;  4L1I A;  3KCT A;  5HZU A;  2ME8 A;  2DUF A;  3DQK A;  4W6P A;  4ZIO A;  2YE1 A;  1W7S A;  3KCS A;  3MK8 A;  4WMR A;  3CFH A;  5BQL A;  2OTB A;  2H8Q A;  4AR7 A;  2HGD A;  4S0O A;  5HW9 A;  3SVO A;  4QNQ A;  4YJ4 A;  2ZMU A;  4BBD A;  3S05 A;  3DQM A;  4J88 A;  4H3L A;  2BZW A;  1EME A;  4OGS A;  4W7E A;  4H3N A;  1TY4 A;  4IK3 A;  2Z6Y A;  1JBZ A;  4Q9X A;  3TMT A;  3MQP A;  4IK9 A;  5HZS A;  4KF4 A;  2K7W A;  2VVX A;  4W7A A;  3IP2 A;  1F0B A;  3DQI A;  4BBC A;  4W6U A;  3U8C A;  4W6H A;  3CFA A;  3DQN A;  2A56 B;  2HPW A;  1Q59 A;  3NF0 A;  2Z6Z A;  3I1H A;  1RRX A;  3ST3 A;  1CV7 A;  1ZUX A;  4RTC A;  3SG3 A;  3LA1 A;  2V4E A;  4Z4K A;  4B30 A;  4PPL A;  4ZIN A;  2UXE A;  4KF5 C;  2QLG B;  1Z1P A;  3LS3 A;  4TZG A;  4W7X A;  2RH7 A;  2Y0G A;  3VIC A;  3V3D A;  4YK9 A;  4OY4 A;  4KA9 A;  2M5B A;  2O21 A;  2HQK A;  4W6J A;  4LQU A;  4P1Q A;  1MK3 A;  3PJB A;  4ANJ A;  2G6E A;  4W74 A;  2ZO7 A;  1XA9 A;  3SVU A;  4Q9W A;  3DQU A;  3BL2 A;  2ROD A;  4ZF3 A;  2DUI A;  5DU0 A;  5BT0 A;  3WIX A;  1QYQ A;  4W7F A;  2NLA A;  3DQC A;  3EK4 A;  3M22 A;  2DUG A;  5DRG A;  4W6I A;  2JM6 B;  1YJ2 A;  3U0M A;  2I39 A;  3WIY A;  3GB3 A;  2LR1 A;  2V6Q A;  3SSV A;  2O42 A;  1YSI A;  2OKW A;  2O2B A;  3LVD A;  3PIB A;  3JRV A;  3DQ3 A;  4LJB A;  2A48 A;  4P76 A;  3NT3 A;  2JCN A;  3WCK A;  1OXF A;  2VVI A;  1GFL A;  3PK1 A;  2NL9 A;  3DQ7 A;  5H88 A;  2EMN A;  5DTL A;  4ZB1 A;  1EMC A;  3EVV A;  4J8A A;  3EK7 A;  2O22 A;  3SVC A;  3LF3 A;  4KW4 A;  4R6D A;  4BD2 A;  2QLH A;  2O2N A;  3DQE A;  3P8U A;  4W6L A;  3GEX A;  2P4M A;  1LXL A;  4G35 A;  5KTG A;  2YV6 A;  3QBR A;  4RYW A;  5EXC I;  3EKH A;  3CGL A;  3DQ4 A;  5LTP A;  4DKN A;  5BTT B;  3WLC A;  2VOF A;  2XPX A;  1F09 A;  3DQH A;  3BX9 A;  1GJH A;  1EMK A;  4HE4 A;  2ROC A;  1OXD A;  4MI8 A;  2WSO A;  1K3K A;  2WHS A;  2IMS A;  3CFF A;  4OQW A;  2VVJ A;  4W7C A;  4ZIH A;  3EK8 A;  2QRF A;  2ABO A;  3D7V A;  3GJ2 A;  4J89 A;  1R2H A;  1YHG A;  1UIS A;  2GW3 A;  4XVP A;  1R2D A;  3KJ0 A;  1QYO A;  2ZMW A;  5EB6 A;  2OTE A;  3GJ1 A;  4ZIF A;  1F16 A;  2IOV A;  4H47 A;  1JC0 A;  2VZX A;  3DPW A;  3SSH A;  3SG2 A;  5FDO A;  3EKJ A;  3SVD A;  1H4U A;  4GOB A;  4DKM A;  3UG0 A;  1EMF A;  2FZU A;  2WHT A;  3LVA A;  4W6D A;  5LTQ A;  2EMD A;  2O2F A;  4KPI A;  5DQB A;  2K36 A;  3SG7 A;  3MGF A;  1Q4A A;  3IO9 A;  2VAE A;  3O77 A;  2BTJ A;  1RMO A;  4IK4 A;  3ED8 A;  3NEZ A;  4HW4 A;  3DVU A;  3ZTF A;  5EB7 A;  3BXB A;  4ZF4 A;  4DXQ A;  4H48 A;  2VOG A;  2OJK A;  3SV5 A;  4ZFS A;  4L13 A;  1EMG A;  3IHC A;  1EMA A;  3SG4 A;  3SST A;  4DXO A;  4B4S A;  3CD1 A;  3EVU A;  2GX0 A;  2H6V A;  2DUH A;  1MOV A;  2FWQ A;  4PPK A;  5HZO A;  4W73 A;  1R2E A;  4HQC A;  5DTZ A;  2QLG A;  3W1C A;  2WSN A;  2H9W A;  2OGR A;  2HCG A;  2PXS A;  3AKO A;  4H3M A;  5FVF A;  4KF5 A;  5HZT A;  5FC4 A;  4HW3 A;  2Z1O A;  3AI4 A;  3ZUJ A;  3SSY A;  2MEJ A;  1W7T A;  3H1O A;  3DQA A;  2G6X A;  2VM6 A;  4W7D A;  4AS8 A;  1YFP A;  5HGE A;  4BD8 A;  4GF6 B;  3DQ1 A;  4K5B C;  3ADF A;  2KUA A;  1B9C A;  3DQL A;  2QLE A;  3VK1 A;  1BXL A;  5DPG A;  1EMB A;  4KAG A;  1YJF A;  3E5W A;  5DPI A;  5FMI A;  4LQT A;  3PJ5 A;  2FL1 A;  2ARL A;  2H5P A;  5DQM A;  1BFP A;  4JC2 A;  5EBJ A;  4W69 A;  4W6S A;  3KZ0 A;  2O2M A;  4HVF A;  4DXP A;  2YDZ A;  4NWS A;  2IB5 A;  1XQM A;  4JF9 A;  2ZO6 A;  1PQ0 A;  2O29 A;  3NT9 A;  4KEX A;  3OSQ A;  2WUR A;  4EMQ A;  1DDB A;  4LQK A;  4Q7R A;  1PQ1 A;  3IIG A;  3SG5 A;  2AWL A;  4W6K A;  4ZBL A;  3OSR A;  2DDC A;  2KBW A;  3E5V A;  2Q6P A;  2H5R A;  3CVA X;  3SRY A;  3DQO A;  4D2M A;  4DXI A;  3CBE A;  3SSL A;  4JFG A;  1G5J A;  3P28 A;  4IZN A;  4W6M A;  2H5Q A;  2HRS A;  3ST0 A;  4LJD A;  3KJ1 A;  1XAE A;  1KP5 A;  4EN1 A;  4HW2 A;  1JC1 A;  4W6R A;  2QZ0 A;  2W3L A;  4W6N A;  3WLD A;  3DQ2 A;  2G3D B;  3CB9 A;  5DRF A;  2GW4 B;  3ZUF A;  3M24 A;  4GES B;  3VHT A;  3DQ5 A;  4IK1 A;  4R6B A;  3W1D A;  3DQD A;  4JRB A;  4XL5 A;  4ZF5 A;  4OHS A;  3RWA A;  3CD9 A;  3IIH A;  1YZW A;  3SVE A;  2VOI A;  2B3Q A;  2OKY A;  2EMO A;  2A47 A;  4XGY A;  1HCJ A;  1Q4C A;  3UFZ A;  3SS0 A;  1O0L A;  2PQK A;  4W7R A;  2G5Z B;  1YHH A;  2IMT A;  1ZGO A;  4I2Y A;  1R2I A;  5FDR A;  2B3P A;  4IK8 A;  4ORN A;  1YSG A;  4UTS A;  5EHU A;  4W76 A;  4W6T A;  2VVY A;  5DTY A;  3SVR A;  2WIQ A;  4ZII A;  1KYP A;  5DY6 A;  4KW8 A;  4OQ5 A;  1ZGP A;  4U2V A;  5FVI A;  4BD6 A;  4TZA A;  1W7U A;  2XA0 A;  2G2S B;  2C9I A;  3G9A A;  3LSA A;  3DQ9 A;  4OYD A;  3ST2 A;  3BXA A;  1Q4B A;  2DD7 A;  5JSB A;  1G7K A;  4W77 A;  3RWT A;  2WHU A;  5KU9 A;  2AHA A;  3DQ8 A;  3NED A;  4M0S A;  2Z6X A;  1OXE A;  4XOW A;  3IHD A;  5F9G A;  4DXM A;  2A5Y A;  2V4E C;  3DQ6 A;  3TMR A;  3AI5 A;  3KJ2 A;  1S6Z A;  2QLI A;  4W75 A;  3GL4 A;  5LTR A;  1R2G A;  2POX A;  3DPX A;  2YFP A;  1RMP A;  4LW5 A;  1EML A;  2AWJ A;  4N3D A;  2V4E B;  5C6H A;  4BPI A;  1H6R A;  1QY3 A;  4B30 B;  4UF1 A;  4OQ6 A;  2A53 B;  2VVH A;  1RMM A;  2QU1 A;  1Q73 A;  5C3F A;  1Z1Q A;  1MAZ A;  4BDU A;  5EXB A;  2H5O A;  3H1R A;  3LVC A;  2JBX A;  3U0N A;  1YSN A;  4W6F A;  3BXC A;  1HUY A;  2DUE A;  4W6C A;  3K1K A;  4HQ9 A;  4LJC A;  4D2L A;  2AWK A;  5T3I A;  4B5Y A;  5H89 A;  4EDO A;  4ZEQ A;  1EMM A;  2VTY A;  3ST4 A;  1GGX A;  4U2U A;  4RYS A;  5H87 A;  5J2O A;  1YHI A;  1KYS A;  4BPJ A;  4EUL A;  3U0K A;  5DPH A;  5DPJ A;  2MHS A;  2VOH A;  4KGE A;  2AH8 A;  2B48 A;  4BBB A;  4UF3 A;  3SSK A;  4EDS A;  4JGE A;  5DTX A; 
#chains in the Genus database with same CATH homology
 1YSW A;  1JBY A;  2JAD A;  3I19 A;  4XOV A;  4DXN A;  3PJ7 A;  1XMZ A;  3DQJ A;  1C4F A;  3E5T A;  3OGO A;  1AF3 A;  2PXW A;  4W6O A;  5HBD A;  4IK5 A;  3ILC A;  4Q7T A;  1G5M A;  4QVX A;  4JEO A;  4W6G A;  2GX2 A;  2ICR A;  1QYF A;  4W6A A;  4L12 A;  3SSP A;  3U0L A;  2IB6 A;  4KGF A;  1MOU A;  2BID A;  1WSX A;  2G16 B;  1ZGQ A;  2HJO A;  1GL4 A;  1Q4E A;  2G6Y A;  4PPJ A;  4BD7 A;  1QXT A;  4LJD C;  5IF4 A;  2VAD A;  2DD9 A;  1ZY3 A;  1KYR A;  4Q7U A;  4W72 A;  3LF4 B;  4ZBF A;  2A54 B;  5BTT A;  5EXU A;  4ZIG A;  3IHE A;  2A52 B;  3U8P A;  2AWM A;  4PFE A;  5IEZ A;  2WIS A;  4KW9 A;  1OHU A;  2A50 B;  2Q57 A;  3DQF A;  4HQ8 A;  3ZUL A;  3SVN A;  5FHV A;  2A46 A;  1MYW A;  4OJ0 A;  3EVR A;  5LK4 A;  3A8S A;  2HQZ A;  2G3O A;  4ZBI A;  5EJU A;  4ZIE A;  3SVS A;  5FVG A;  3IR8 A;  1Q4D A;  3DPZ A;  2C9J A;  4W6B A;  4Z4M A;  2QT2 A;  2WH6 A;  3VHT B;  3SVB A;  5AQB B;  2YE0 A;  4S0P A;  1XSS A;  3SG6 A;  2IE2 A;  3EVP A;  2HGY A;  2O24 A;  1RM9 A;  2DDD A;  3O78 A;  3U8A A;  2HFC A;  4L1I A;  3KCT A;  5HZU A;  2ME8 A;  2DUF A;  3DQK A;  4W6P A;  4ZIO A;  2YE1 A;  1W7S A;  3KCS A;  3MK8 A;  4WMR A;  3CFH A;  5BQL A;  2OTB A;  2H8Q A;  4AR7 A;  2HGD A;  4S0O A;  5HW9 A;  3SVO A;  4QNQ A;  4YJ4 A;  2ZMU A;  3S05 A;  3DQM A;  4J88 A;  4H3L A;  2BZW A;  1EME A;  4OGS A;  4W7E A;  4H3N A;  1TY4 A;  4IK3 A;  2Z6Y A;  1JBZ A;  4Q9X A;  3TMT A;  3MQP A;  4IK9 A;  5HZS A;  4KF4 A;  2K7W A;  4W7A A;  3IP2 A;  1F0B A;  3DQI A;  4W6U A;  3U8C A;  4W6H A;  3CFA A;  3DQN A;  2A56 B;  2HPW A;  1Q59 A;  3NF0 A;  2Z6Z A;  3I1H A;  1RRX A;  3ST3 A;  1CV7 A;  1ZUX A;  4RTC A;  3SG3 A;  3LA1 A;  2V4E A;  4Z4K A;  4B30 A;  4PPL A;  4ZIN A;  4KF5 C;  2QLG B;  1Z1P A;  3LS3 A;  4TZG A;  4W7X A;  2RH7 A;  2Y0G A;  3VIC A;  3V3D A;  4YK9 A;  4OY4 A;  4KA9 A;  2M5B A;  2O21 A;  2HQK A;  4W6J A;  4LQU A;  4P1Q A;  1MK3 A;  3PJB A;  4ANJ A;  2G6E A;  4W74 A;  2ZO7 A;  1XA9 A;  3SVU A;  4Q9W A;  3DQU A;  3BL2 A;  2ROD A;  4ZF3 A;  2DUI A;  5DU0 A;  5BT0 A;  3WIX A;  1QYQ A;  4W7F A;  2NLA A;  3DQC A;  3EK4 A;  3M22 A;  2DUG A;  5DRG A;  4W6I A;  2JM6 B;  1YJ2 A;  3U0M A;  3WIY A;  3GB3 A;  2LR1 A;  2V6Q A;  3SSV A;  1YSI A;  2OKW A;  2O2B A;  3LVD A;  3PIB A;  3DQ3 A;  4LJB A;  2A48 A;  4P76 A;  3NT3 A;  2JCN A;  3WCK A;  1OXF A;  2VVI A;  1GFL A;  3PK1 A;  2NL9 A;  3DQ7 A;  5H88 A;  2EMN A;  5DTL A;  4ZB1 A;  1EMC A;  3EVV A;  4J8A A;  3EK7 A;  2O22 A;  3SVC A;  3LF3 A;  4KW4 A;  4R6D A;  4BD2 A;  2QLH A;  2O2N A;  3DQE A;  3P8U A;  4W6L A;  3GEX A;  2P4M A;  1LXL A;  4G35 A;  5KTG A;  2YV6 A;  3QBR A;  4RYW A;  5EXC I;  3EKH A;  3CGL A;  3DQ4 A;  5LTP A;  4DKN A;  5BTT B;  3WLC A;  2VOF A;  2XPX A;  1F09 A;  3DQH A;  3BX9 A;  1GJH A;  1EMK A;  4HE4 A;  2ROC A;  1OXD A;  4MI8 A;  2WSO A;  1K3K A;  2WHS A;  2IMS A;  3CFF A;  4OQW A;  2VVJ A;  4W7C A;  4ZIH A;  3EK8 A;  2QRF A;  2ABO A;  3D7V A;  3GJ2 A;  4J89 A;  1R2H A;  1YHG A;  1UIS A;  2GW3 A;  4XVP A;  1R2D A;  3KJ0 A;  1QYO A;  2ZMW A;  5EB6 A;  2OTE A;  3GJ1 A;  4ZIF A;  1F16 A;  2IOV A;  4H47 A;  1JC0 A;  2VZX A;  3DPW A;  3SSH A;  3SG2 A;  5FDO A;  3EKJ A;  3SVD A;  1H4U A;  4GOB A;  4DKM A;  3UG0 A;  1EMF A;  2FZU A;  2WHT A;  3LVA A;  4W6D A;  5LTQ A;  2EMD A;  2O2F A;  4KPI A;  5DQB A;  3SG7 A;  3MGF A;  1Q4A A;  3IO9 A;  2VAE A;  3O77 A;  2BTJ A;  1RMO A;  4IK4 A;  3ED8 A;  3NEZ A;  4HW4 A;  3DVU A;  3ZTF A;  5EB7 A;  3BXB A;  4ZF4 A;  4DXQ A;  4H48 A;  2VOG A;  2OJK A;  3SV5 A;  4ZFS A;  4L13 A;  1EMG A;  3IHC A;  1EMA A;  3SG4 A;  3SST A;  4DXO A;  4B4S A;  3CD1 A;  3EVU A;  2GX0 A;  2H6V A;  2DUH A;  1MOV A;  2FWQ A;  4PPK A;  5HZO A;  4W73 A;  1R2E A;  4HQC A;  5DTZ A;  2QLG A;  3W1C A;  2WSN A;  2H9W A;  2OGR A;  2HCG A;  2PXS A;  3AKO A;  4H3M A;  5FVF A;  4KF5 A;  5HZT A;  5FC4 A;  4HW3 A;  2Z1O A;  3AI4 A;  3ZUJ A;  3SSY A;  2MEJ A;  1W7T A;  3H1O A;  3DQA A;  2G6X A;  2VM6 A;  4W7D A;  4AS8 A;  1YFP A;  5HGE A;  4BD8 A;  4GF6 B;  3DQ1 A;  4K5B C;  3ADF A;  2KUA A;  1B9C A;  3DQL A;  2QLE A;  3VK1 A;  1BXL A;  5DPG A;  1EMB A;  4KAG A;  1YJF A;  3E5W A;  5DPI A;  5FMI A;  4LQT A;  3PJ5 A;  2FL1 A;  2ARL A;  2H5P A;  5DQM A;  1BFP A;  4JC2 A;  5EBJ A;  4W69 A;  4W6S A;  3KZ0 A;  2O2M A;  4HVF A;  4DXP A;  2YDZ A;  4NWS A;  2IB5 A;  1XQM A;  4JF9 A;  2ZO6 A;  1PQ0 A;  2O29 A;  3NT9 A;  4KEX A;  3OSQ A;  2WUR A;  4EMQ A;  1DDB A;  4Q7R A;  1PQ1 A;  3IIG A;  3SG5 A;  2AWL A;  4W6K A;  4ZBL A;  3OSR A;  2DDC A;  2KBW A;  3E5V A;  2Q6P A;  2H5R A;  3CVA X;  3SRY A;  3DQO A;  4DXI A;  3CBE A;  3SSL A;  4JFG A;  1G5J A;  3P28 A;  4IZN A;  4W6M A;  2H5Q A;  2HRS A;  3ST0 A;  4LJD A;  3KJ1 A;  1XAE A;  1KP5 A;  4EN1 A;  4HW2 A;  1JC1 A;  4W6R A;  2QZ0 A;  2W3L A;  4W6N A;  3WLD A;  3DQ2 A;  2G3D B;  3CB9 A;  5DRF A;  2GW4 B;  3ZUF A;  3M24 A;  4GES B;  3VHT A;  3DQ5 A;  4IK1 A;  4R6B A;  3W1D A;  3DQD A;  4JRB A;  4XL5 A;  4ZF5 A;  4OHS A;  3RWA A;  3CD9 A;  3IIH A;  1YZW A;  3SVE A;  2VOI A;  2B3Q A;  2OKY A;  2EMO A;  2A47 A;  4XGY A;  1HCJ A;  1Q4C A;  3UFZ A;  3SS0 A;  1O0L A;  2PQK A;  4W7R A;  2G5Z B;  1YHH A;  2IMT A;  1ZGO A;  4I2Y A;  1R2I A;  5FDR A;  2B3P A;  4IK8 A;  4ORN A;  1YSG A;  4UTS A;  5EHU A;  4W76 A;  4W6T A;  5DTY A;  3SVR A;  2WIQ A;  4ZII A;  1KYP A;  5DY6 A;  4KW8 A;  4OQ5 A;  1ZGP A;  4U2V A;  5FVI A;  4BD6 A;  4TZA A;  1W7U A;  2XA0 A;  2G2S B;  2C9I A;  3G9A A;  3LSA A;  3DQ9 A;  4OYD A;  3ST2 A;  3BXA A;  1Q4B A;  2DD7 A;  5JSB A;  1G7K A;  4W77 A;  3RWT A;  2WHU A;  5KU9 A;  2AHA A;  3DQ8 A;  3NED A;  2Z6X A;  1OXE A;  4XOW A;  3IHD A;  5F9G A;  4DXM A;  2A5Y A;  2V4E C;  3DQ6 A;  3TMR A;  3AI5 A;  3KJ2 A;  1S6Z A;  2QLI A;  4W75 A;  3GL4 A;  5LTR A;  1R2G A;  2POX A;  3DPX A;  2YFP A;  1RMP A;  4LW5 A;  1EML A;  2AWJ A;  4N3D A;  2V4E B;  5C6H A;  4BPI A;  1H6R A;  1QY3 A;  4B30 B;  4OQ6 A;  2A53 B;  2VVH A;  1RMM A;  2QU1 A;  1Q73 A;  5C3F A;  1Z1Q A;  1MAZ A;  4BDU A;  5EXB A;  2H5O A;  3H1R A;  3LVC A;  3U0N A;  1YSN A;  4W6F A;  3BXC A;  1HUY A;  2DUE A;  4W6C A;  3K1K A;  4HQ9 A;  4LJC A;  2AWK A;  5T3I A;  4B5Y A;  5H89 A;  4EDO A;  4ZEQ A;  1EMM A;  3ST4 A;  1GGX A;  4U2U A;  4RYS A;  5H87 A;  5J2O A;  1YHI A;  1KYS A;  4BPJ A;  4EUL A;  3U0K A;  5DPH A;  5DPJ A;  2MHS A;  2VOH A;  4KGE A;  2AH8 A;  2B48 A;  3SSK A;  4EDS A;  4JGE A;  5DTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...