The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
73
|
structure length |
73
|
Chain Sequence |
MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of the N-terminal domain of FK506-binding protein 3
rcsb |
| molecule tags |
Isomerase
|
| source organism |
Homo sapiens
|
| molecule keywords |
FK506-binding protein 3
|
| total genus |
19
|
| structure length |
73
|
| sequence length |
73
|
| ec nomenclature |
ec
5.2.1.8: Peptidylprolyl isomerase. |
| pdb deposition date | 2009-02-27 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 | Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 |
#chains in the Genus database with same CATH superfamily 2MPH A; 2KFV A; 2LC3 A; #chains in the Genus database with same CATH topology 4UZW A; 2G80 A; 2KFV A; 2JVW A; 2KW9 A; 2LC3 A; 1GKU B; 1A63 A; 1GL9 B; 2W51 A; 2RNO A; 1E7L A; 3FLG A; 2QNC A; 2KVD A; 3QKJ A; 1ZS9 A; 2ODG C; 1Y02 A; 1GJJ A; 5CIU A; 1JEQ A; 2DK4 A; 1E7D A; 1ZBH A; 2A8V A; 2MPH A; 1JEI A; 2LD7 A; 1V66 A; 1YNS A; 1A62 A; 1H9E A; 2WQG A; 3LLR A; 2KVU A; 2QNF A; 3L0O A; 1JJR A; 2ODC I; 2HJQ A; 2KVE A; 2RNN A; 4BIT A; 1H1J S; 1KHC A; 1H9F A; 1A8V A; 1EN7 A; #chains in the Genus database with same CATH homology 2G80 A; 2KFV A; 2LC3 A; 1GKU B; 1A63 A; 1GL9 B; 2W51 A; 1E7L A; 2QNC A; 1ZS9 A; 2ODG C; 1Y02 A; 1GJJ A; 2DK4 A; 1E7D A; 2A8V A; 2MPH A; 1JEI A; 2LD7 A; 1YNS A; 1A62 A; 1H9E A; 2QNF A; 3L0O A; 2ODC I; 2HJQ A; 1H9F A; 1A8V A; 1EN7 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
