2KM7A

Solution structure of bame, a component of the outer membrane protein assembly machinery in escherichia coli
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
102
structure length
102
Chain Sequence
b'SSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALSGNLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small protein A
publication title Structure and function of BamE within the outer membrane and the beta-barrel assembly machine.
pubmed doi rcsb
molecule tags Membrane protein
total genus 15
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04355 SmpA_OmlA SmpA / OmlA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 2km7A01
3D4EA 5AYWE 1XXMC 1S0WC 2KXXA 3GMUB 2G2WB 3E2KC 3N4IB 3C4OB 2B5RC 5D0QE 3C7VB 3E2LC 2PXGA 1JTGB 5EKQE 5D0OE 3C7UB 2KM7A 3C4PB 4DM5A 2YH9A 2G2UB
chains in the Genus database with same CATH superfamily
3FVCA 3D4EA 5AYWE 3NW8A 1XXMC 1S0WC 2KXXA 3GMUB 3NWAA 2G2WB 3NWDA 3E2KC 3N4IB 3C4OB 2B5RC 5D0QE 3C7VB 4HSIA 3E2LC 2PXGA 1JTGB 5EKQE 5D0OE 3C7UB 2KM7A 3C4PB 4DM5A 2YH9A 2GUMA 2G2UB 3NWFA 4L1RA
chains in the Genus database with same CATH topology
3FVCA 3D4EA 5AYWE 3NW8A 1XXMC 1S0WC 2KXXA 3GMUB 3NWAA 2G2WB 3NWDA 3E2KC 3N4IB 3C4OB 2B5RC 5D0QE 3C7VB 4HSIA 3E2LC 2PXGA 1JTGB 5EKQE 5D0OE 3C7UB 2KM7A 3C4PB 4DM5A 2YH9A 2GUMA 2G2UB 3NWFA 4L1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4E A;  5AYW E;  1XXM C;  1S0W C;  2KXX A;  3GMU B;  2G2W B;  3E2K C;  3N4I B;  3C4O B;  2B5R C;  5D0Q E;  3C7V B;  3E2L C;  2PXG A;  1JTG B;  5EKQ E;  5D0O E;  3C7U B;  2KM7 A;  3C4P B;  4DM5 A;  2YH9 A;  2G2U B; 
#chains in the Genus database with same CATH topology
 3FVC A;  3D4E A;  5AYW E;  3NW8 A;  1XXM C;  1S0W C;  2KXX A;  3GMU B;  3NWA A;  2G2W B;  3NWD A;  3E2K C;  3N4I B;  3C4O B;  2B5R C;  5D0Q E;  3C7V B;  4HSI A;  3E2L C;  2PXG A;  1JTG B;  5EKQ E;  5D0O E;  3C7U B;  2KM7 A;  3C4P B;  4DM5 A;  2YH9 A;  2GUM A;  2G2U B;  3NWF A;  4L1R A; 
#chains in the Genus database with same CATH homology
 3FVC A;  3D4E A;  5AYW E;  3NW8 A;  1XXM C;  1S0W C;  2KXX A;  3GMU B;  3NWA A;  2G2W B;  3NWD A;  3E2K C;  3N4I B;  3C4O B;  2B5R C;  5D0Q E;  3C7V B;  4HSI A;  3E2L C;  2PXG A;  1JTG B;  5EKQ E;  5D0O E;  3C7U B;  2KM7 A;  3C4P B;  4DM5 A;  2YH9 A;  2GUM A;  2G2U B;  3NWF A;  4L1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...