2KM7A

Solution structure of bame, a component of the outer membrane protein assembly machinery in escherichia coli
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
102
structure length
102
Chain Sequence
SSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALSGNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small protein A
publication title Structure and function of BamE within the outer membrane and the beta-barrel assembly machine.
pubmed doi rcsb
molecule tags Membrane protein
total genus 15
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04355 SmpA_OmlA SmpA / OmlA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 2km7A01
5D0OE 1S0WC 1JTGB 3C7UB 3C4PB 2G2UB 2YH9A 2G2WB 5AYWE 5EKQE 2PXGA 4DM5A 5D0QE 2B5RC 3C4OB 3N4IB 3GMUB 3C7VB 3D4EA 2KXXA 3E2KC 1XXMC 2KM7A 3E2LC
chains in the Genus database with same CATH superfamily
5D0OE 1S0WC 1JTGB 3C7UB 3C4PB 4L1RA 4HSIA 3NWDA 2G2UB 2YH9A 2G2WB 5AYWE 5EKQE 2PXGA 4DM5A 5D0QE 2B5RC 3FVCA 3C4OB 3N4IB 3GMUB 3C7VB 3D4EA 2KXXA 3NWAA 3E2KC 1XXMC 2KM7A 2GUMA 3E2LC 3NWFA 3NW8A
chains in the Genus database with same CATH topology
5D0OE 1S0WC 1JTGB 3C7UB 3C4PB 4L1RA 4HSIA 3NWDA 2G2UB 2YH9A 2G2WB 5AYWE 5EKQE 2PXGA 4DM5A 5D0QE 2B5RC 3FVCA 3C4OB 3N4IB 3GMUB 3C7VB 3D4EA 2KXXA 3NWAA 3E2KC 1XXMC 2KM7A 2GUMA 3E2LC 3NWFA 3NW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D0O E;  1S0W C;  1JTG B;  3C7U B;  3C4P B;  2G2U B;  2YH9 A;  2G2W B;  5AYW E;  5EKQ E;  2PXG A;  4DM5 A;  5D0Q E;  2B5R C;  3C4O B;  3N4I B;  3GMU B;  3C7V B;  3D4E A;  2KXX A;  3E2K C;  1XXM C;  2KM7 A;  3E2L C; 
#chains in the Genus database with same CATH topology
 5D0O E;  1S0W C;  1JTG B;  3C7U B;  3C4P B;  4L1R A;  4HSI A;  3NWD A;  2G2U B;  2YH9 A;  2G2W B;  5AYW E;  5EKQ E;  2PXG A;  4DM5 A;  5D0Q E;  2B5R C;  3FVC A;  3C4O B;  3N4I B;  3GMU B;  3C7V B;  3D4E A;  2KXX A;  3NWA A;  3E2K C;  1XXM C;  2KM7 A;  2GUM A;  3E2L C;  3NWF A;  3NW8 A; 
#chains in the Genus database with same CATH homology
 5D0O E;  1S0W C;  1JTG B;  3C7U B;  3C4P B;  4L1R A;  4HSI A;  3NWD A;  2G2U B;  2YH9 A;  2G2W B;  5AYW E;  5EKQ E;  2PXG A;  4DM5 A;  5D0Q E;  2B5R C;  3FVC A;  3C4O B;  3N4I B;  3GMU B;  3C7V B;  3D4E A;  2KXX A;  3NWA A;  3E2K C;  1XXM C;  2KM7 A;  2GUM A;  3E2L C;  3NWF A;  3NW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...