2YH9A

Crystal structure of the dimeric bame from e. coli
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
66
structure length
66
Chain Sequence
VSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SMALL PROTEIN A
publication title Structural Basis of Outer Membrane Protein Biogenesis in Bacteria.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 9
structure length 66
sequence length 66
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04355 SmpA_OmlA SmpA / OmlA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 2yh9A00
3N4IB 2KM7A 3D4EA 2G2WB 2G2UB 5EKQE 2KXXA 3E2KC 5D0OE 1XXMC 3E2LC 5AYWE 3C7UB 2PXGA 5D0QE 3C7VB 4DM5A 3C4PB 3C4OB 2B5RC 3GMUB 1S0WC 2YH9A 1JTGB
chains in the Genus database with same CATH superfamily
3NWFA 3N4IB 2KM7A 3D4EA 2G2WB 3NWAA 2G2UB 5EKQE 2KXXA 3E2KC 3NW8A 5D0OE 2GUMA 3FVCA 1XXMC 4HSIA 3E2LC 5AYWE 4L1RA 3C7UB 2PXGA 5D0QE 3C7VB 4DM5A 3C4PB 3NWDA 3C4OB 2B5RC 3GMUB 1S0WC 2YH9A 1JTGB
chains in the Genus database with same CATH topology
3NWFA 3N4IB 2KM7A 3D4EA 2G2WB 3NWAA 2G2UB 5EKQE 2KXXA 3E2KC 3NW8A 5D0OE 2GUMA 3FVCA 1XXMC 4HSIA 3E2LC 5AYWE 4L1RA 3C7UB 2PXGA 5D0QE 3C7VB 4DM5A 3C4PB 3NWDA 3C4OB 2B5RC 3GMUB 1S0WC 2YH9A 1JTGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4I B;  2KM7 A;  3D4E A;  2G2W B;  2G2U B;  5EKQ E;  2KXX A;  3E2K C;  5D0O E;  1XXM C;  3E2L C;  5AYW E;  3C7U B;  2PXG A;  5D0Q E;  3C7V B;  4DM5 A;  3C4P B;  3C4O B;  2B5R C;  3GMU B;  1S0W C;  2YH9 A;  1JTG B; 
#chains in the Genus database with same CATH topology
 3NWF A;  3N4I B;  2KM7 A;  3D4E A;  2G2W B;  3NWA A;  2G2U B;  5EKQ E;  2KXX A;  3E2K C;  3NW8 A;  5D0O E;  2GUM A;  3FVC A;  1XXM C;  4HSI A;  3E2L C;  5AYW E;  4L1R A;  3C7U B;  2PXG A;  5D0Q E;  3C7V B;  4DM5 A;  3C4P B;  3NWD A;  3C4O B;  2B5R C;  3GMU B;  1S0W C;  2YH9 A;  1JTG B; 
#chains in the Genus database with same CATH homology
 3NWF A;  3N4I B;  2KM7 A;  3D4E A;  2G2W B;  3NWA A;  2G2U B;  5EKQ E;  2KXX A;  3E2K C;  3NW8 A;  5D0O E;  2GUM A;  3FVC A;  1XXM C;  4HSI A;  3E2L C;  5AYW E;  4L1R A;  3C7U B;  2PXG A;  5D0Q E;  3C7V B;  4DM5 A;  3C4P B;  3NWD A;  3C4O B;  2B5R C;  3GMU B;  1S0W C;  2YH9 A;  1JTG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...