3FVCA

Crystal structure of a trimeric variant of the epstein-barr virus glycoprotein b
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
638
structure length
559
Chain Sequence
QQTSFPFRVCELSSHGDLFRFSSDIQCPSFENHTEGLLMVFKDNIIPYSFKVRSYTKIVTNILIYNGHRADSVTNRHEEKFSVDSYETDQMDTIYQCYNAVKMTKDGLTRVYVDRDGVNITVNLKPTGGLANGVRRYASQTELYDAPGRVEATYRTRTTVNCLITDMMAKSNSPFDFFVTTTGQTVEMSPFYDGKNKETFHERADSFHVRTNYKIVDYDNRGTNPQGERRAFLDKGTYTLSWKLENRTAYCPLQHWQTFDSTIATETGKSIHFVTDEGTSSFVTNTTVGIELPDAFKCIEEQVNKTMHEKYEAVQDRYTKGQEAITYFITSGGLLLAWLPLTPRSLKSLGTLNNPATVQIQFAYDSLRRQINRMLGDLARAWCLEQKRQNMVLRELTKINPTTVMSSIYGKAVAAKRLGDVISVSQCVPVNQATVTLRKSMRMCYSRPLVSFSFTKTYEGQLGTDNEIFATSQYYFQSGNEIHVYNDYHHFKTIELDGIATLQTFISLNTSLIENIDFASLELYSRDEQRASNVFDLEGIFREYNFQAQNIAGLRKDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a trimeric variant of the Epstein-Barr virus glycoprotein B
pubmed doi rcsb
source organism Human herpesvirus 4
molecule tags Viral protein
molecule keywords Glycoprotein GP110
total genus 112
structure length 559
sequence length 638
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00606 Glycoprotein_B Herpesvirus Glycoprotein B ectodomain
A PF17416 Glycoprot_B_PH1 Herpesvirus Glycoprotein B
A PF17417 Glycoprot_B_PH2 Herpesvirus Glycoprotein B PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.100 Mainly Beta Roll PH-domain like PH-domain like 3fvcA03
3.30.1450.20 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 3fvcA01
4OT1A 2GUMA 4HSIA 3NWFA 3NWAA 3NWDA 3FVCA 3NW8A 4OSNA 4L1RA
chains in the Genus database with same CATH superfamily
2FJUB 1H4RA 3ODWA 2E2XA 2YSZA 4GMVA 3WA0A 2YT0A 2MKRA 4B6HA 3A8QA 2DX5A 3FM8C 3OHMB 5CLLB 4GOUA 3QBVB 4K17A 4YONA 2Z0PA 2Z0QA 2EJ8A 2DKQA 3G9WA 2D9VA 3QIJA 2DX1A 3WYFB 1ZM0A 3E2LC 4GN1A 2COCA 3HIEA 1J0WA 1MKEA 4L1RA 2D9WA 1ZC4B 4NY0A 2H7DA 2RNRB 5C16A 2ELBA 2K2UA 2RSGA 3ULCA 3PVUA 4D6WA 2I1JA 1SGHA 4CYEA 3KRXA 3DXEA 5D0OE 2OTXA 2GJYA 3M1IB 4DX90 5CLQB 1SHCA 2J0JA 2P0FA 1MK9B 2DN6A 1GC6A 3FEHA 1EAZA 5FI0A 4A6HA 4KHBB 2DHIA 3F0WA 3PG7A 2GUMA 2R2YA 2D9YA 2NZ8B 5D3YA 4ZRJA 4EMOA 4P7IA 1M7RA 3P6AA 2W2XC 1V5UA 3DXCA 3VIAA 4A6KA 3N7CA 5FI1A 2LYDA 2MDXA 2G2UB 3QWMA 1WGQA 2I5FA 2GCLA 3NWFA 4A5KA 4OSNA 4TKNA 3U7DA 1V61A 2ZKMX 1LW3A 2RGNB 1X1GA 2RVBB 4K81A 1E5WA 3NW8A 2B5RC 3CIKA 3X23A 2UZSA 2YS3A 1UPRA 5J3YA 1Y19B 2CAYA 5C6RA 4ZRIA 4HATB 2MWNB 2L2IA 2W2WA 1X05A 3SNHA 1U5FA 2CY5A 2AL6A 1TXDA 2K49A 2N23A 2ROZB 2KM7A 1GC7A 3KZ1A 1EVHA 3C4OB 1V89A 2ZPYA 1B55A 4C0AA 3A8PA 4Z2MB 1OMWA 3TVVA 4K2PA 1KZ7A 2KR0A 4QJ4B 1NTVA 1ZVRA 1EGXA 1XODA 3PVWA 3LJUX 4EKUA 3IVFA 5C79A 4HAVB 2P0DA 1K5DB 3B77A 3O96A 1MK7B 2DHKA 3UZTA 4HB0B 3TW1A 1MI1A 3A58A 1H10A 1MPHA 3TO1A 1UNPA 3PVLA 1V88A 5EFXA 4F7GA 1FB8A 4HDOA 1WJ1A 3CXBB 4PNKA 2LOZA 1FHWA 4KHOA 4D0NB 4IOYX 1Z87A 2YH9A 5J3TA 1ZYIA 3SUZA 3SYXA 1PFJA 1S0WC 4L6EA 1DBHA 2COAA 5JHGA 2X18A 3OANA 3E2KC 4CHJA 5D27A 2AEHA 2KUQA 1XXMC 5JHHA 4QJ3B 3N4IB 4HDQA 2J0KA 4DIXA 4DM5A 1BTNA 4KVGB 1UPQA 1DDWA 4HB2B 5DI9B 5HE3A 1NU2A 1Y5OA 3KSYA 2Z59A 1BTKA 4KHAA 1XCGA 2DFKA 1ISNA 5C5BB 4CHMA 5KQ4A 5JP4A 3D8EA 2W2XD 2N0YA 2V76A 1RJ2A 2QKMA 3TCAA 2Y8GA 2YT1A 3NSUA 4GNKB 2MFQA 3P7ZA 2J0MA 2BCJA 4NSWA 2DYNA 3HQCA 4MK0A 4F7UP 1RRPB 2D10A 1XX0A 2G35A 2K8EA 3DXDA 3GMUB 4GPTB 2YF0A 1FOEA 1LB1A 2D11A 2LG1A 3FVCA 4HAWB 3AU5A 1OY2A 1Q67A 3NWAA 1I7AA 3AU4A 3D4EA 1WI1A 1NI2A 4GXBA 2R0DA 4WVFB 1DYNA 2RLOA 1KZGA 3DCXA 3V5WA 3C4PB 2KIGA 4HHVA 2CODA 2PZ1A 1P6SA 2KGXB 2KIEA 4GMXB 1WG7A 2QKLA 2Z14A 1W1DA 2M38A 3PEGA 2Z4DA 3KRWA 2UZRA 2EMTA 4DBBA 3ML4A 3ZDTA 1QC6A 4WJ7A 2D9ZA 2NMBA 4A6FB 2L1CA 5D0QE 4MT7A 1XD4A 3TFMA 2R09A 1OQNA 5I2SA 2GS0A 2RRFA 1FGZA 1BAKA 2D9XA 2G2WB 2K2JA 2Z0OA 5AYWE 1WVHA 4DX8A 2NBVA 4KAXB 4IFSA 2DA0A 2M14A 1FHXA 3D8DA 1AQCA 1P3RA 3T06A 5IRSA 1DDMA 2D4QA 2HE7A 2Z13A 1DDVA 2YS5A 3HK0A 2P8VA 1XKEA 3SO6A 1PLSA 2K00A 1U27A 1WGUA 2JP2A 2GCJA 3RCPA 4EJNA 2DKPA 2XQNM 2VRWB 1P5TA 1UEFA 1T77A 2IYBA 5DHAB 3AJ4A 1I2HA 1UNQA 2KUPA 1X86A 5I2MA 5J3QA 3SV1A 5M4YB 2DLWA 2IFSA 4PQ0A 1DROA 3U8ZA 2I1KA 1WJMA 1JTGB 1GG3A 1UNRA 2RUKB 1AWEA 1U2BA 4Y94A 5KCVA 3D8FA 1ZSQA 1X1FA 2CY4A 1FAOA 1V5PA 4QXAB 3HSAA 3MPXA 5C5BA 4CSQA 3ULBA 2ADZA 1W1HA 2DHJA 4WSFA 1V5MA 2ELAA 2H7EA 2P0HA 4HAZB 1TQZA 1FGYA 1K5GB 5DH9B 2YRYA 1MAIA 1NTYA 5GOWB 3KY9A 3MDBC 1J19A 1MIXA 1U5EA 2ROVA 5HE1A 2LOXA 4F7HA 2YS1A 2KCJA 2HTHB 4DXAB 3ODXA 5LG4B 4TYZA 5DHFB 4Z2NA 1FHOA 1EF1A 3F5RA 5D3WA 1KI1B 1MIZB 3FSSA 2VKIA 1TJ6A 1U5GA 2OQBA 3VOQA 4H8SA 4KHBA 2J59M 3BJIA 4K2OA 4BBKA 2Y7BA 4MY6A 1W1GA 2FJLA 3PZDA 4A6FA 2COFA 2DTCA 4GZUA 1BWNA 4HAXB 5LOPB 3C7UB 2EMSA 5JLJB 1PMSA 3A98B 3GYPA 3HW2B 4IAPA 2LKOA 3ZVRA 2PXGA 3BINA 2D2QA 1U29A 3PP2A 4HB4B 4ZRKA 5D3VA 5EKQE 2LULA 5HE2A 1XR0B 4QJ5B 2YT2A 3NWDA 3ODOA 4HAYB 1X11A 4HB3B 4OT1A 2DYQA 2VSZA 3U12A 1IRSA 2UVMA 1M7EA 5DIFB 4YL8A 5KQ1A 2YVCA 4XWXA 5D3XA 5LONB 4HSIA 3GYOA 2Q13A 1N3HA 2EC1A 5HE0A 2I5CA 2Y8FA 1U5DA 4HAUB 5L81A 2KXXA 3PSCA 2CRFA 3C7VB 1ZC3B 1QQGA
chains in the Genus database with same CATH topology
2FJUB 4QXAB 4Z2MB 3TVVA 3OHMB 3GMUB 2K8EA 2KR0A 4CSQA 4GOUA 4QJ4B 3FVCA 3NWAA 3D4EA 3E2LC 3C4PB 2KIGA 3HIEA 3TW1A 4L1RA 3A58A 2KIEA 4D6WA 3TO1A 2Z14A 5D0OE 2Z4DA 5LG4B 4Z2NA 4KHOA 4IOYX 2YH9A 5D0QE 1ZYIA 3FSSA 1S0WC 5I2SA 4KHBB 2RRFA 4KHBA 2GUMA 2R2YA 3E2KC 2G2WB 2KUQA 1XXMC 5AYWE 4QJ3B 3N4IB 2NBVA 3C7UB 4DIXA 2G2UB 4IFSA 4DM5A 5IRSA 2GCLA 3NWFA 2Z13A 3GYPA 4OSNA 2ZKMX 2PXGA 2GCJA 3NW8A 5EKQE 2B5RC 2Z59A 4QJ5B 2YT2A 4KHAA 3NWDA 4OT1A 3U12A 5I2MA 5M4YB 4HSIA 3GYOA 2K49A 4PQ0A 2KM7A 2KXXA 4GNKB 1JTGB 3C7VB 3C4OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OT1 A;  2GUM A;  4HSI A;  3NWF A;  3NWA A;  3NWD A;  3FVC A;  3NW8 A;  4OSN A;  4L1R A; 
#chains in the Genus database with same CATH topology
 2FJU B;  1H4R A;  3ODW A;  2E2X A;  2YSZ A;  4GMV A;  3WA0 A;  2YT0 A;  2MKR A;  4B6H A;  3A8Q A;  2DX5 A;  3FM8 C;  3OHM B;  5CLL B;  4GOU A;  3QBV B;  4K17 A;  4YON A;  2Z0P A;  2Z0Q A;  2EJ8 A;  2DKQ A;  3G9W A;  2D9V A;  3QIJ A;  2DX1 A;  3WYF B;  1ZM0 A;  3E2L C;  4GN1 A;  2COC A;  3HIE A;  1J0W A;  1MKE A;  4L1R A;  2D9W A;  1ZC4 B;  4NY0 A;  2H7D A;  2RNR B;  5C16 A;  2ELB A;  2K2U A;  2RSG A;  3ULC A;  3PVU A;  4D6W A;  2I1J A;  1SGH A;  4CYE A;  3KRX A;  3DXE A;  5D0O E;  2OTX A;  2GJY A;  3M1I B;  4DX9 0;  5CLQ B;  1SHC A;  2J0J A;  2P0F A;  1MK9 B;  2DN6 A;  1GC6 A;  3FEH A;  1EAZ A;  5FI0 A;  4A6H A;  4KHB B;  2DHI A;  3F0W A;  3PG7 A;  2GUM A;  2R2Y A;  2D9Y A;  2NZ8 B;  5D3Y A;  4ZRJ A;  4EMO A;  4P7I A;  1M7R A;  3P6A A;  2W2X C;  1V5U A;  3DXC A;  3VIA A;  4A6K A;  3N7C A;  5FI1 A;  2LYD A;  2MDX A;  2G2U B;  3QWM A;  1WGQ A;  2I5F A;  2GCL A;  3NWF A;  4A5K A;  4OSN A;  4TKN A;  3U7D A;  1V61 A;  2ZKM X;  1LW3 A;  2RGN B;  1X1G A;  2RVB B;  4K81 A;  1E5W A;  3NW8 A;  2B5R C;  3CIK A;  3X23 A;  2UZS A;  2YS3 A;  1UPR A;  5J3Y A;  1Y19 B;  2CAY A;  5C6R A;  4ZRI A;  4HAT B;  2MWN B;  2L2I A;  2W2W A;  1X05 A;  3SNH A;  1U5F A;  2CY5 A;  2AL6 A;  1TXD A;  2K49 A;  2N23 A;  2ROZ B;  2KM7 A;  1GC7 A;  3KZ1 A;  1EVH A;  3C4O B;  1V89 A;  2ZPY A;  1B55 A;  4C0A A;  3A8P A;  4Z2M B;  1OMW A;  3TVV A;  4K2P A;  1KZ7 A;  2KR0 A;  4QJ4 B;  1NTV A;  1ZVR A;  1EGX A;  1XOD A;  3PVW A;  3LJU X;  4EKU A;  3IVF A;  5C79 A;  4HAV B;  2P0D A;  1K5D B;  3B77 A;  3O96 A;  1MK7 B;  2DHK A;  3UZT A;  4HB0 B;  3TW1 A;  1MI1 A;  3A58 A;  1H10 A;  1MPH A;  3TO1 A;  1UNP A;  3PVL A;  1V88 A;  5EFX A;  4F7G A;  1FB8 A;  4HDO A;  1WJ1 A;  3CXB B;  4PNK A;  2LOZ A;  1FHW A;  4KHO A;  4D0N B;  4IOY X;  1Z87 A;  2YH9 A;  5J3T A;  1ZYI A;  3SUZ A;  3SYX A;  1PFJ A;  1S0W C;  4L6E A;  1DBH A;  2COA A;  5JHG A;  2X18 A;  3OAN A;  3E2K C;  4CHJ A;  5D27 A;  2AEH A;  2KUQ A;  1XXM C;  5JHH A;  4QJ3 B;  3N4I B;  4HDQ A;  2J0K A;  4DIX A;  4DM5 A;  1BTN A;  4KVG B;  1UPQ A;  1DDW A;  4HB2 B;  5DI9 B;  5HE3 A;  1NU2 A;  1Y5O A;  3KSY A;  2Z59 A;  1BTK A;  4KHA A;  1XCG A;  2DFK A;  1ISN A;  5C5B B;  4CHM A;  5KQ4 A;  5JP4 A;  3D8E A;  2W2X D;  2N0Y A;  2V76 A;  1RJ2 A;  2QKM A;  3TCA A;  2Y8G A;  2YT1 A;  3NSU A;  4GNK B;  2MFQ A;  3P7Z A;  2J0M A;  2BCJ A;  4NSW A;  2DYN A;  3HQC A;  4MK0 A;  4F7U P;  1RRP B;  2D10 A;  1XX0 A;  2G35 A;  2K8E A;  3DXD A;  3GMU B;  4GPT B;  2YF0 A;  1FOE A;  1LB1 A;  2D11 A;  2LG1 A;  3FVC A;  4HAW B;  3AU5 A;  1OY2 A;  1Q67 A;  3NWA A;  1I7A A;  3AU4 A;  3D4E A;  1WI1 A;  1NI2 A;  4GXB A;  2R0D A;  4WVF B;  1DYN A;  2RLO A;  1KZG A;  3DCX A;  3V5W A;  3C4P B;  2KIG A;  4HHV A;  2COD A;  2PZ1 A;  1P6S A;  2KGX B;  2KIE A;  4GMX B;  1WG7 A;  2QKL A;  2Z14 A;  1W1D A;  2M38 A;  3PEG A;  2Z4D A;  3KRW A;  2UZR A;  2EMT A;  4DBB A;  3ML4 A;  3ZDT A;  1QC6 A;  4WJ7 A;  2D9Z A;  2NMB A;  4A6F B;  2L1C A;  5D0Q E;  4MT7 A;  1XD4 A;  3TFM A;  2R09 A;  1OQN A;  5I2S A;  2GS0 A;  2RRF A;  1FGZ A;  1BAK A;  2D9X A;  2G2W B;  2K2J A;  2Z0O A;  5AYW E;  1WVH A;  4DX8 A;  2NBV A;  4KAX B;  4IFS A;  2DA0 A;  2M14 A;  1FHX A;  3D8D A;  1AQC A;  1P3R A;  3T06 A;  5IRS A;  1DDM A;  2D4Q A;  2HE7 A;  2Z13 A;  1DDV A;  2YS5 A;  3HK0 A;  2P8V A;  1XKE A;  3SO6 A;  1PLS A;  2K00 A;  1U27 A;  1WGU A;  2JP2 A;  2GCJ A;  3RCP A;  4EJN A;  2DKP A;  2XQN M;  2VRW B;  1P5T A;  1UEF A;  1T77 A;  2IYB A;  5DHA B;  3AJ4 A;  1I2H A;  1UNQ A;  2KUP A;  1X86 A;  5I2M A;  5J3Q A;  3SV1 A;  5M4Y B;  2DLW A;  2IFS A;  4PQ0 A;  1DRO A;  3U8Z A;  2I1K A;  1WJM A;  1JTG B;  1GG3 A;  1UNR A;  2RUK B;  1AWE A;  1U2B A;  4Y94 A;  5KCV A;  3D8F A;  1ZSQ A;  1X1F A;  2CY4 A;  1FAO A;  1V5P A;  4QXA B;  3HSA A;  3MPX A;  5C5B A;  4CSQ A;  3ULB A;  2ADZ A;  1W1H A;  2DHJ A;  4WSF A;  1V5M A;  2ELA A;  2H7E A;  2P0H A;  4HAZ B;  1TQZ A;  1FGY A;  1K5G B;  5DH9 B;  2YRY A;  1MAI A;  1NTY A;  5GOW B;  3KY9 A;  3MDB C;  1J19 A;  1MIX A;  1U5E A;  2ROV A;  5HE1 A;  2LOX A;  4F7H A;  2YS1 A;  2KCJ A;  2HTH B;  4DXA B;  3ODX A;  5LG4 B;  4TYZ A;  5DHF B;  4Z2N A;  1FHO A;  1EF1 A;  3F5R A;  5D3W A;  1KI1 B;  1MIZ B;  3FSS A;  2VKI A;  1TJ6 A;  1U5G A;  2OQB A;  3VOQ A;  4H8S A;  4KHB A;  2J59 M;  3BJI A;  4K2O A;  4BBK A;  2Y7B A;  4MY6 A;  1W1G A;  2FJL A;  3PZD A;  4A6F A;  2COF A;  2DTC A;  4GZU A;  1BWN A;  4HAX B;  5LOP B;  3C7U B;  2EMS A;  5JLJ B;  1PMS A;  3A98 B;  3GYP A;  3HW2 B;  4IAP A;  2LKO A;  3ZVR A;  2PXG A;  3BIN A;  2D2Q A;  1U29 A;  3PP2 A;  4HB4 B;  4ZRK A;  5D3V A;  5EKQ E;  2LUL A;  5HE2 A;  1XR0 B;  4QJ5 B;  2YT2 A;  3NWD A;  3ODO A;  4HAY B;  1X11 A;  4HB3 B;  4OT1 A;  2DYQ A;  2VSZ A;  3U12 A;  1IRS A;  2UVM A;  1M7E A;  5DIF B;  4YL8 A;  5KQ1 A;  2YVC A;  4XWX A;  5D3X A;  5LON B;  4HSI A;  3GYO A;  2Q13 A;  1N3H A;  2EC1 A;  5HE0 A;  2I5C A;  2Y8F A;  1U5D A;  4HAU B;  5L81 A;  2KXX A;  3PSC A;  2CRF A;  3C7V B;  1ZC3 B;  1QQG A; 
#chains in the Genus database with same CATH homology
 2FJU B;  4QXA B;  4Z2M B;  3TVV A;  3OHM B;  3GMU B;  2K8E A;  2KR0 A;  4CSQ A;  4GOU A;  4QJ4 B;  3FVC A;  3NWA A;  3D4E A;  3E2L C;  3C4P B;  2KIG A;  3HIE A;  3TW1 A;  4L1R A;  3A58 A;  2KIE A;  4D6W A;  3TO1 A;  2Z14 A;  5D0O E;  2Z4D A;  5LG4 B;  4Z2N A;  4KHO A;  4IOY X;  2YH9 A;  5D0Q E;  1ZYI A;  3FSS A;  1S0W C;  5I2S A;  4KHB B;  2RRF A;  4KHB A;  2GUM A;  2R2Y A;  3E2K C;  2G2W B;  2KUQ A;  1XXM C;  5AYW E;  4QJ3 B;  3N4I B;  2NBV A;  3C7U B;  4DIX A;  2G2U B;  4IFS A;  4DM5 A;  5IRS A;  2GCL A;  3NWF A;  2Z13 A;  3GYP A;  4OSN A;  2ZKM X;  2PXG A;  2GCJ A;  3NW8 A;  5EKQ E;  2B5R C;  2Z59 A;  4QJ5 B;  2YT2 A;  4KHA A;  3NWD A;  4OT1 A;  3U12 A;  5I2M A;  5M4Y B;  4HSI A;  3GYO A;  2K49 A;  4PQ0 A;  2KM7 A;  2KXX A;  4GNK B;  1JTG B;  3C7V B;  3C4O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...