3FVCA

Crystal structure of a trimeric variant of the epstein-barr virus glycoprotein b
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
638
structure length
559
Chain Sequence
QQTSFPFRVCELSSHGDLFRFSSDIQCPSFENHTEGLLMVFKDNIIPYSFKVRSYTKIVTNILIYNGHRADSVTNRHEEKFSVDSYETDQMDTIYQCYNAVKMTKDGLTRVYVDRDGVNITVNLKPTGGLANGVRRYASQTELYDAPGRVEATYRTRTTVNCLITDMMAKSNSPFDFFVTTTGQTVEMSPFYDGKNKETFHERADSFHVRTNYKIVDYDNRGTNPQGERRAFLDKGTYTLSWKLENRTAYCPLQHWQTFDSTIATETGKSIHFVTDEGTSSFVTNTTVGIELPDAFKCIEEQVNKTMHEKYEAVQDRYTKGQEAITYFITSGGLLLAWLPLTPRSLKSLGTLNNPATVQIQFAYDSLRRQINRMLGDLARAWCLEQKRQNMVLRELTKINPTTVMSSIYGKAVAAKRLGDVISVSQCVPVNQATVTLRKSMRMCYSRPLVSFSFTKTYEGQLGTDNEIFATSQYYFQSGNEIHVYNDYHHFKTIELDGIATLQTFISLNTSLIENIDFASLELYSRDEQRASNVFDLEGIFREYNFQAQNIAGLRKDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Glycoprotein GP110
publication title Structure of a trimeric variant of the Epstein-Barr virus glycoprotein B
pubmed doi rcsb
source organism Human herpesvirus 4
total genus 112
structure length 559
sequence length 638
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00606 Glycoprotein_B Herpesvirus Glycoprotein B ectodomain
A PF17416 Glycoprot_B_PH1 Herpesvirus Glycoprotein B
A PF17417 Glycoprot_B_PH2 Herpesvirus Glycoprotein B PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.100 Mainly Beta Roll PH-domain like PH-domain like 3fvcA03
3.30.1450.20 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 3fvcA01
3NWFA 3FVCA 3NWAA 4L1RA 4OSNA 3NW8A 2GUMA 4HSIA 4OT1A 3NWDA
chains in the Genus database with same CATH superfamily
4ZRKA 2Z14A 1NU2A 2KCJA 4DX90 3HW2B 2K00A 3A58A 1P6SA 1UPRA 5KQ4A 4GXBA 1AQCA 1IRSA 2D11A 3A98B 1XX0A 3PVUA 2UVMA 4EMOA 3E2KC 4CSQA 5HE1A 5D3WA 5I2SA 3FSSA 1J0WA 2Z13A 2HE7A 5M4YB 3C7VB 1DYNA 2GUMA 2Y8FA 1KZ7A 4K81A 2YVCA 2LULA 4HB2B 2EMTA 4KAXB 4CHMA 2MFQA 1UEFA 5DHFB 4HATB 2DKPA 2XQNM 3C4OB 5KQ1A 2EC1A 3NSUA 2YH9A 4EKUA 1U5DA 2ADZA 2KGXB 3FVCA 1ISNA 2KXXA 1DDVA 1V5MA 1W1DA 3A8PA 5LG4B 1MAIA 4D0NB 4EJNA 1PLSA 1GC7A 2DYNA 2DYQA 2K49A 1U27A 3F5RA 2B5RC 4CHJA 2YF0A 1ZVRA 3SYXA 1SHCA 3TO1A 1NTVA 2D9ZA 2Z0PA 2LOZA 5HE3A 3N7CA 2FJUB 1TQZA 4HAZB 2OTXA 1M7RA 1Z87A 3ODWA 2DFKA 3ULCA 4DIXA 2YRYA 3U12A 1WJMA 2CODA 1U5FA 1EVHA 2J59M 3FM8C 3KZ1A 2GCLA 5LONB 1MPHA 2RLOA 1X86A 4KVGB 3NW8A 2KR0A 3P7ZA 1WVHA 5CLLB 1OY2A 4HAWB 2RRFA 5DH9B 2P0HA 4K17A 1FOEA 2EJ8A 2W2XC 1GG3A 3SO6A 2CY4A 1JTGB 4Z2NA 3A8QA 1V5PA 2ZKMX 5GOWB 2Z4DA 4WJ7A 2P0FA 2EMSA 2D4QA 1W1GA 5IRSA 2OQBA 1NI2A 3T06A 3KRXA 4DX8A 1X11A 1QC6A 3PZDA 5C6RA 4WVFB 2G35A 2KIGA 1RJ2A 4HDQA 3FEHA 1V88A 4MK0A 2G2UB 1OMWA 2MKRA 2LG1A 4YL8A 4L1RA 4OSNA 2Y7BA 4GMVA 3WYFB 3D8FA 1PFJA 2LOXA 5KCVA 4KHOA 3ULBA 2QKLA 1XODA 3PEGA 1BAKA 2DLWA 3NWDA 4HAUB 1K5DB 4TKNA 5D3YA 1DDMA 2W2XD 2YT1A 5C5BB 3HQCA 2COAA 4B6HA 5J3YA 2Z59A 2K2UA 4GMXB 1X1GA 1ZC3B 2DX1A 3PP2A 3CXBB 2DX5A 3AU5A 2UZSA 3PVWA 1ZC4B 5EFXA 1DBHA 2ELBA 2RUKB 1MK9B 4HAYB 1V61A 4HDOA 4HB0B 2N0YA 1XD4A 1V5UA 2AEHA 2Q13A 3OHMB 1EGXA 2LYDA 3MPXA 1Y5OA 2RSGA 2RVBB 3IVFA 3GYOA 1XKEA 2YS1A 4HAVB 1AWEA 3PVLA 5HE2A 1XXMC 2K8EA 4D6WA 5DIFB 4ZRIA 4A5KA 2RGNB 2VSZA 4DM5A 3B77A 4GPTB 4A6FB 2CRFA 3DCXA 3PSCA 1DROA 5JLJB 2JP2A 3PG7A 1S0WC 4KHAA 2NZ8B 2I1JA 5D3VA 4ZRJA 2DTCA 2H7DA 3AJ4A 1MK7B 3U7DA 1I7AA 1TJ6A 2N23A 2KIEA 3SNHA 2CAYA 4F7HA 1H4RA 1B55A 3F0WA 3KRWA 2D9XA 3ODOA 2D9VA 2IYBA 2DHKA 1UNQA 1NTYA 1FHXA 2DHJA 2KUQA 2ROVA 3G9WA 3QBVB 1MIXA 2V76A 3V5WA 4KHBA 3NWAA 4GZUA 4F7GA 5FI0A 4H8SA 2Y8GA 4PQ0A 3BJIA 3OANA 1BTNA 5L81A 5FI1A 4NSWA 2MWNB 4PNKA 3O96A 4NY0A 4HB3B 1WI1A 3QIJA 1ZSQA 2I5FA 1X05A 3AU4A 5D3XA 3D8DA 1FHOA 1BTKA 3P6AA 2FJLA 5D27A 1KZGA 3UZTA 2J0MA 4GOUA 2W2WA 1WGQA 1XCGA 2G2WB 1UPQA 1U2BA 3C4PB 1U5GA 1J19A 2PZ1A 2MDXA 2BCJA 3SUZA 5JHGA 5C79A 2COCA 3ODXA 1P5TA 2K2JA 3N4IB 4OT1A 1RRPB 1M7EA 3TVVA 3WA0A 3C7UB 1U29A 3VIAA 2KUPA 2VRWB 5DHAB 4DXAB 4QJ4B 1WGUA 3DXCA 1WJ1A 3GYPA 3QWMA 1H10A 2GS0A 3D4EA 3TW1A 4F7UP 1FGZA 2I5CA 5C16A 3CIKA 3MDBC 4MY6A 3HK0A 4GN1A 2L1CA 3BINA 4QJ3B 3KSYA 4P7IA 4HB4B 4WSFA 1EAZA 2DA0A 1FHWA 5DI9B 5LOPB 5J3TA 1MIZB 4IOYX 3M1IB 2DKQA 5CLQB 4C0AA 4YONA 3KY9A 2VKIA 1K5GB 5J3QA 5D0QE 2GJYA 4KHBB 4IFSA 3NWFA 5EKQE 4MT7A 2GCJA 2Z0QA 3RCPA 3ML4A 2PXGA 2COFA 4K2PA 1E5WA 3ZVRA 1OQNA 2ELAA 2R2YA 4XWXA 3VOQA 5AYWE 5HE0A 1ZM0A 1T77A 1X1FA 4Y94A 4HAXB 2IFSA 3X23A 4Z2MB 1ZYIA 4BBKA 5C5BA 2M38A 2DHIA 2HTHB 5JHHA 2P0DA 3HSAA 1Y19B 4HHVA 2CY5A 2P8VA 2ROZB 1P3RA 1LW3A 2R0DA 2KM7A 1FAOA 1LB1A 1QQGA 1WG7A 3U8ZA 2Z0OA 3LJUX 4CYEA 1GC6A 5D0OE 1U5EA 1FGYA 3TFMA 3ZDTA 4QXAB 2YS5A 2NBVA 4DBBA 2RNRB 1I2HA 1KI1B 2NMBA 4GNKB 2J0JA 3DXDA 4QJ5B 1UNRA 2QKMA 2ZPYA 2D10A 1MI1A 2X18A 2J0KA 4L6EA 4TYZA 1TXDA 2YT2A 1Q67A 3D8EA 2LKOA 2L2IA 1XR0B 2D9WA 4HSIA 1BWNA 4IAPA 2E2XA 2M14A 4K2OA 2YS3A 2R09A 5I2MA 1PMSA 4A6FA 4A6HA 2DN6A 3TCAA 2D9YA 3GMUB 3DXEA 1EF1A 2D2QA 3HIEA 2YT0A 3E2LC 1V89A 2UZRA 2YSZA 1UNPA 1FB8A 1SGHA 4A6KA 5JP4A 3SV1A 2I1KA 1N3HA 2H7EA 2AL6A 1W1HA 1DDWA 1MKEA
chains in the Genus database with same CATH topology
4QJ3B 2Z14A 2KIEA 4IOYX 3A58A 1JTGB 4Z2NA 2ZKMX 5D0QE 4KHBB 2Z4DA 4IFSA 3NWFA 5EKQE 2GCJA 5IRSA 2PXGA 3E2KC 4CSQA 5I2SA 2KUQA 2R2YA 5AYWE 3FSSA 2Z13A 5M4YB 3C7VB 4KHBA 3NWAA 2KIGA 2GUMA 2G2UB 4PQ0A 4L1RA 4OSNA 4Z2MB 1ZYIA 4KHOA 3C4OB 2YH9A 3NWDA 3FVCA 2KXXA 2KM7A 4GOUA 5LG4B 2Z59A 2G2WB 5D0OE 3C4PB 4QXAB 2NBVA 2K49A 2B5RC 4GNKB 3TO1A 4QJ5B 3N4IB 2FJUB 4OT1A 3OHMB 2YT2A 3TVVA 4HSIA 3GYOA 3C7UB 5I2MA 4DIXA 3U12A 4QJ4B 1XXMC 3GMUB 2K8EA 3HIEA 3GYPA 4D6WA 2GCLA 4DM5A 3D4EA 3E2LC 3TW1A 3NW8A 2KR0A 2RRFA 1S0WC 4KHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NWF A;  3FVC A;  3NWA A;  4L1R A;  4OSN A;  3NW8 A;  2GUM A;  4HSI A;  4OT1 A;  3NWD A; 
#chains in the Genus database with same CATH topology
 4ZRK A;  2Z14 A;  1NU2 A;  2KCJ A;  4DX9 0;  3HW2 B;  2K00 A;  3A58 A;  1P6S A;  1UPR A;  5KQ4 A;  4GXB A;  1AQC A;  1IRS A;  2D11 A;  3A98 B;  1XX0 A;  3PVU A;  2UVM A;  4EMO A;  3E2K C;  4CSQ A;  5HE1 A;  5D3W A;  5I2S A;  3FSS A;  1J0W A;  2Z13 A;  2HE7 A;  5M4Y B;  3C7V B;  1DYN A;  2GUM A;  2Y8F A;  1KZ7 A;  4K81 A;  2YVC A;  2LUL A;  4HB2 B;  2EMT A;  4KAX B;  4CHM A;  2MFQ A;  1UEF A;  5DHF B;  4HAT B;  2DKP A;  2XQN M;  3C4O B;  5KQ1 A;  2EC1 A;  3NSU A;  2YH9 A;  4EKU A;  1U5D A;  2ADZ A;  2KGX B;  3FVC A;  1ISN A;  2KXX A;  1DDV A;  1V5M A;  1W1D A;  3A8P A;  5LG4 B;  1MAI A;  4D0N B;  4EJN A;  1PLS A;  1GC7 A;  2DYN A;  2DYQ A;  2K49 A;  1U27 A;  3F5R A;  2B5R C;  4CHJ A;  2YF0 A;  1ZVR A;  3SYX A;  1SHC A;  3TO1 A;  1NTV A;  2D9Z A;  2Z0P A;  2LOZ A;  5HE3 A;  3N7C A;  2FJU B;  1TQZ A;  4HAZ B;  2OTX A;  1M7R A;  1Z87 A;  3ODW A;  2DFK A;  3ULC A;  4DIX A;  2YRY A;  3U12 A;  1WJM A;  2COD A;  1U5F A;  1EVH A;  2J59 M;  3FM8 C;  3KZ1 A;  2GCL A;  5LON B;  1MPH A;  2RLO A;  1X86 A;  4KVG B;  3NW8 A;  2KR0 A;  3P7Z A;  1WVH A;  5CLL B;  1OY2 A;  4HAW B;  2RRF A;  5DH9 B;  2P0H A;  4K17 A;  1FOE A;  2EJ8 A;  2W2X C;  1GG3 A;  3SO6 A;  2CY4 A;  1JTG B;  4Z2N A;  3A8Q A;  1V5P A;  2ZKM X;  5GOW B;  2Z4D A;  4WJ7 A;  2P0F A;  2EMS A;  2D4Q A;  1W1G A;  5IRS A;  2OQB A;  1NI2 A;  3T06 A;  3KRX A;  4DX8 A;  1X11 A;  1QC6 A;  3PZD A;  5C6R A;  4WVF B;  2G35 A;  2KIG A;  1RJ2 A;  4HDQ A;  3FEH A;  1V88 A;  4MK0 A;  2G2U B;  1OMW A;  2MKR A;  2LG1 A;  4YL8 A;  4L1R A;  4OSN A;  2Y7B A;  4GMV A;  3WYF B;  3D8F A;  1PFJ A;  2LOX A;  5KCV A;  4KHO A;  3ULB A;  2QKL A;  1XOD A;  3PEG A;  1BAK A;  2DLW A;  3NWD A;  4HAU B;  1K5D B;  4TKN A;  5D3Y A;  1DDM A;  2W2X D;  2YT1 A;  5C5B B;  3HQC A;  2COA A;  4B6H A;  5J3Y A;  2Z59 A;  2K2U A;  4GMX B;  1X1G A;  1ZC3 B;  2DX1 A;  3PP2 A;  3CXB B;  2DX5 A;  3AU5 A;  2UZS A;  3PVW A;  1ZC4 B;  5EFX A;  1DBH A;  2ELB A;  2RUK B;  1MK9 B;  4HAY B;  1V61 A;  4HDO A;  4HB0 B;  2N0Y A;  1XD4 A;  1V5U A;  2AEH A;  2Q13 A;  3OHM B;  1EGX A;  2LYD A;  3MPX A;  1Y5O A;  2RSG A;  2RVB B;  3IVF A;  3GYO A;  1XKE A;  2YS1 A;  4HAV B;  1AWE A;  3PVL A;  5HE2 A;  1XXM C;  2K8E A;  4D6W A;  5DIF B;  4ZRI A;  4A5K A;  2RGN B;  2VSZ A;  4DM5 A;  3B77 A;  4GPT B;  4A6F B;  2CRF A;  3DCX A;  3PSC A;  1DRO A;  5JLJ B;  2JP2 A;  3PG7 A;  1S0W C;  4KHA A;  2NZ8 B;  2I1J A;  5D3V A;  4ZRJ A;  2DTC A;  2H7D A;  3AJ4 A;  1MK7 B;  3U7D A;  1I7A A;  1TJ6 A;  2N23 A;  2KIE A;  3SNH A;  2CAY A;  4F7H A;  1H4R A;  1B55 A;  3F0W A;  3KRW A;  2D9X A;  3ODO A;  2D9V A;  2IYB A;  2DHK A;  1UNQ A;  1NTY A;  1FHX A;  2DHJ A;  2KUQ A;  2ROV A;  3G9W A;  3QBV B;  1MIX A;  2V76 A;  3V5W A;  4KHB A;  3NWA A;  4GZU A;  4F7G A;  5FI0 A;  4H8S A;  2Y8G A;  4PQ0 A;  3BJI A;  3OAN A;  1BTN A;  5L81 A;  5FI1 A;  4NSW A;  2MWN B;  4PNK A;  3O96 A;  4NY0 A;  4HB3 B;  1WI1 A;  3QIJ A;  1ZSQ A;  2I5F A;  1X05 A;  3AU4 A;  5D3X A;  3D8D A;  1FHO A;  1BTK A;  3P6A A;  2FJL A;  5D27 A;  1KZG A;  3UZT A;  2J0M A;  4GOU A;  2W2W A;  1WGQ A;  1XCG A;  2G2W B;  1UPQ A;  1U2B A;  3C4P B;  1U5G A;  1J19 A;  2PZ1 A;  2MDX A;  2BCJ A;  3SUZ A;  5JHG A;  5C79 A;  2COC A;  3ODX A;  1P5T A;  2K2J A;  3N4I B;  4OT1 A;  1RRP B;  1M7E A;  3TVV A;  3WA0 A;  3C7U B;  1U29 A;  3VIA A;  2KUP A;  2VRW B;  5DHA B;  4DXA B;  4QJ4 B;  1WGU A;  3DXC A;  1WJ1 A;  3GYP A;  3QWM A;  1H10 A;  2GS0 A;  3D4E A;  3TW1 A;  4F7U P;  1FGZ A;  2I5C A;  5C16 A;  3CIK A;  3MDB C;  4MY6 A;  3HK0 A;  4GN1 A;  2L1C A;  3BIN A;  4QJ3 B;  3KSY A;  4P7I A;  4HB4 B;  4WSF A;  1EAZ A;  2DA0 A;  1FHW A;  5DI9 B;  5LOP B;  5J3T A;  1MIZ B;  4IOY X;  3M1I B;  2DKQ A;  5CLQ B;  4C0A A;  4YON A;  3KY9 A;  2VKI A;  1K5G B;  5J3Q A;  5D0Q E;  2GJY A;  4KHB B;  4IFS A;  3NWF A;  5EKQ E;  4MT7 A;  2GCJ A;  2Z0Q A;  3RCP A;  3ML4 A;  2PXG A;  2COF A;  4K2P A;  1E5W A;  3ZVR A;  1OQN A;  2ELA A;  2R2Y A;  4XWX A;  3VOQ A;  5AYW E;  5HE0 A;  1ZM0 A;  1T77 A;  1X1F A;  4Y94 A;  4HAX B;  2IFS A;  3X23 A;  4Z2M B;  1ZYI A;  4BBK A;  5C5B A;  2M38 A;  2DHI A;  2HTH B;  5JHH A;  2P0D A;  3HSA A;  1Y19 B;  4HHV A;  2CY5 A;  2P8V A;  2ROZ B;  1P3R A;  1LW3 A;  2R0D A;  2KM7 A;  1FAO A;  1LB1 A;  1QQG A;  1WG7 A;  3U8Z A;  2Z0O A;  3LJU X;  4CYE A;  1GC6 A;  5D0O E;  1U5E A;  1FGY A;  3TFM A;  3ZDT A;  4QXA B;  2YS5 A;  2NBV A;  4DBB A;  2RNR B;  1I2H A;  1KI1 B;  2NMB A;  4GNK B;  2J0J A;  3DXD A;  4QJ5 B;  1UNR A;  2QKM A;  2ZPY A;  2D10 A;  1MI1 A;  2X18 A;  2J0K A;  4L6E A;  4TYZ A;  1TXD A;  2YT2 A;  1Q67 A;  3D8E A;  2LKO A;  2L2I A;  1XR0 B;  2D9W A;  4HSI A;  1BWN A;  4IAP A;  2E2X A;  2M14 A;  4K2O A;  2YS3 A;  2R09 A;  5I2M A;  1PMS A;  4A6F A;  4A6H A;  2DN6 A;  3TCA A;  2D9Y A;  3GMU B;  3DXE A;  1EF1 A;  2D2Q A;  3HIE A;  2YT0 A;  3E2L C;  1V89 A;  2UZR A;  2YSZ A;  1UNP A;  1FB8 A;  1SGH A;  4A6K A;  5JP4 A;  3SV1 A;  2I1K A;  1N3H A;  2H7E A;  2AL6 A;  1W1H A;  1DDW A;  1MKE A; 
#chains in the Genus database with same CATH homology
 4QJ3 B;  2Z14 A;  2KIE A;  4IOY X;  3A58 A;  1JTG B;  4Z2N A;  2ZKM X;  5D0Q E;  4KHB B;  2Z4D A;  4IFS A;  3NWF A;  5EKQ E;  2GCJ A;  5IRS A;  2PXG A;  3E2K C;  4CSQ A;  5I2S A;  2KUQ A;  2R2Y A;  5AYW E;  3FSS A;  2Z13 A;  5M4Y B;  3C7V B;  4KHB A;  3NWA A;  2KIG A;  2GUM A;  2G2U B;  4PQ0 A;  4L1R A;  4OSN A;  4Z2M B;  1ZYI A;  4KHO A;  3C4O B;  2YH9 A;  3NWD A;  3FVC A;  2KXX A;  2KM7 A;  4GOU A;  5LG4 B;  2Z59 A;  2G2W B;  5D0O E;  3C4P B;  4QXA B;  2NBV A;  2K49 A;  2B5R C;  4GNK B;  3TO1 A;  4QJ5 B;  3N4I B;  2FJU B;  4OT1 A;  3OHM B;  2YT2 A;  3TVV A;  4HSI A;  3GYO A;  3C7U B;  5I2M A;  4DIX A;  3U12 A;  4QJ4 B;  1XXM C;  3GMU B;  2K8E A;  3HIE A;  3GYP A;  4D6W A;  2GCL A;  4DM5 A;  3D4E A;  3E2L C;  3TW1 A;  3NW8 A;  2KR0 A;  2RRF A;  1S0W C;  4KHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...