3FVCA

Crystal structure of a trimeric variant of the epstein-barr virus glycoprotein b
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
638
structure length
559
Chain Sequence
QQTSFPFRVCELSSHGDLFRFSSDIQCPSFENHTEGLLMVFKDNIIPYSFKVRSYTKIVTNILIYNGHRADSVTNRHEEKFSVDSYETDQMDTIYQCYNAVKMTKDGLTRVYVDRDGVNITVNLKPTGGLANGVRRYASQTELYDAPGRVEATYRTRTTVNCLITDMMAKSNSPFDFFVTTTGQTVEMSPFYDGKNKETFHERADSFHVRTNYKIVDYDNRGTNPQGERRAFLDKGTYTLSWKLENRTAYCPLQHWQTFDSTIATETGKSIHFVTDEGTSSFVTNTTVGIELPDAFKCIEEQVNKTMHEKYEAVQDRYTKGQEAITYFITSGGLLLAWLPLTPRSLKSLGTLNNPATVQIQFAYDSLRRQINRMLGDLARAWCLEQKRQNMVLRELTKINPTTVMSSIYGKAVAAKRLGDVISVSQCVPVNQATVTLRKSMRMCYSRPLVSFSFTKTYEGQLGTDNEIFATSQYYFQSGNEIHVYNDYHHFKTIELDGIATLQTFISLNTSLIENIDFASLELYSRDEQRASNVFDLEGIFREYNFQAQNIAGLRKDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoprotein GP110
publication title Structure of a trimeric variant of the Epstein-Barr virus glycoprotein B
pubmed doi rcsb
source organism Human herpesvirus 4
molecule tags Viral protein
total genus 112
structure length 559
sequence length 638
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00606 Glycoprotein_B Herpesvirus Glycoprotein B ectodomain
A PF17416 Glycoprot_B_PH1 Herpesvirus Glycoprotein B
A PF17417 Glycoprot_B_PH2 Herpesvirus Glycoprotein B PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.100 Mainly Beta Roll PH-domain like PH-domain like 3fvcA03
3.30.1450.20 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 3fvcA01
4OT1A 3FVCA 2GUMA 4L1RA 4HSIA 4OSNA 3NWDA 3NWAA 3NWFA 3NW8A
chains in the Genus database with same CATH superfamily
5KCVA 2Z59A 2KCJA 4CHJA 3GMUB 2D9ZA 1B55A 2ZPYA 2LKOA 2PXGA 3CIKA 3NWAA 4DX8A 2YRYA 5HE2A 2RRFA 4L1RA 5D3VA 1Q67A 1ZVRA 2EMTA 5DH9B 3TFMA 5C79A 4GZUA 2GCLA 1WVHA 1Y19B 5CLQB 2KUPA 4A6FA 2XQNM 4QJ4B 4GMVA 3WYFB 3PZDA 1FHOA 2DX1A 3VIAA 3N7CA 3D8EA 1WGUA 2J0MA 4QXAB 2DFKA 1LW3A 3MPXA 5KQ4A 4QJ3B 3C4OB 4Z2MB 2COAA 3OANA 2DHIA 1V5UA 2M14A 1QC6A 2UVMA 4BBKA 1MPHA 3FSSA 3SUZA 5HE1A 1J19A 4DX90 4NY0A 2KM7A 3U7DA 1KI1B 1LB1A 3KZ1A 4TYZA 1DBHA 3SO6A 2Y8FA 1K5DB 3LJUX 1FOEA 3C7VB 1U5EA 5C5BB 5HE0A 4YONA 4DBBA 4HB4B 1DYNA 4IFSA 4PQ0A 1K5GB 2DYQA 3SNHA 3D4EA 2YF0A 4IAPA 4D6WA 3C7UB 1ZC4B 2DHJA 2JP2A 4F7GA 4WJ7A 5KQ1A 4PNKA 3PVLA 2RGNB 2GUMA 1J0WA 1UPQA 2R09A 2YT0A 1MAIA 3G9WA 2Y8GA 4A5KA 2VSZA 1DDWA 1XODA 5C6RA 3HQCA 3PEGA 2ELBA 3SYXA 5DIFB 2CRFA 1IRSA 1P3RA 3FM8C 4HHVA 4KHOA 1TQZA 2VRWB 5JHHA 3QBVB 1P6SA 2OTXA 5D3XA 3O96A 4GOUA 1XR0B 2EC1A 3MDBC 1ISNA 3U8ZA 2D9YA 2D9WA 2D2QA 4DXAB 2I5CA 2H7EA 1U29A 2DYNA 3PVWA 1BAKA 5AYWE 2YS1A 3PSCA 2NZ8B 1DDMA 3FEHA 2K00A 1E5WA 2DN6A 4HAUB 2BCJA 4GMXB 3WA0A 2DKQA 2L1CA 1H10A 1X1FA 2MWNB 4CHMA 1AWEA 2LG1A 2FJUB 1I7AA 3F0WA 2K49A 2L2IA 3QIJA 3GYOA 2KR0A 1Y5OA 5IRSA 1U2BA 4YL8A 4B6HA 1NU2A 1UPRA 4HSIA 2CY5A 1GG3A 2OQBA 3ML4A 1U5DA 2QKMA 4A6HA 2HE7A 3ULBA 2N0YA 5JP4A 3A8QA 1FGYA 1ZSQA 2RLOA 1UNPA 3QWMA 1Z87A 1XKEA 3ULCA 1XX0A 4HAVB 4KAXB 5DHAB 1X05A 3CXBB 1EAZA 3OHMB 3HK0A 3AU4A 1OY2A 2Z4DA 3KRWA 1NI2A 2KXXA 2I1JA 2J59M 4KHAA 1I2HA 3P6AA 1UNRA 2J0KA 5I2SA 2P0DA 3RCPA 1OMWA 1TXDA 3UZTA 3KRXA 2D10A 3TO1A 2B5RC 2M38A 4QJ5B 4F7UP 3DXEA 3V5WA 2COFA 4GPTB 4OT1A 4K2OA 2K2JA 2LOZA 1W1HA 3NWFA 1OQNA 2KIEA 3NW8A 4HAWB 1UNQA 3ODOA 1M7EA 1WGQA 4HATB 1PFJA 3D8DA 1WI1A 4Z2NA 2Z0PA 5DHFB 2GS0A 2ELAA 3TVVA 4CSQA 2R2YA 2W2WA 1FAOA 5J3YA 4IOYX 2KGXB 4K2PA 4HB2B 2E2XA 2J0JA 2V76A 3VOQA 5D0QE 3SV1A 4KVGB 1EF1A 2DX5A 4MY6A 3F5RA 4K17A 5M4YB 4HAYB 3ODXA 1ZC3B 3AJ4A 2COCA 1X11A 3AU5A 1DROA 3B77A 2IFSA 1T77A 4HDOA 3HW2B 2X18A 3NSUA 1WG7A 5GOWB 5JHGA 1MI1A 4ZRKA 1MK9B 4HAXB 2GJYA 3DCXA 4GXBA 5HE3A 2ROZB 2UZSA 1ZYIA 4A6KA 2D9XA 1X1GA 1QQGA 2P0HA 2D9VA 5I2MA 5J3QA 1U27A 2KIGA 1GC7A 1W1GA 1FHWA 1SGHA 2CY4A 4HB3B 2FJLA 1M7RA 2IYBA 2GCJA 2YVCA 3TW1A 4WVFB 3T06A 2RVBB 2G35A 2K2UA 2LULA 2I5FA 5EFXA 1DDVA 1V61A 2DKPA 4OSNA 1RJ2A 3C4PB 3ODWA 4K81A 4EJNA 4Y94A 2R0DA 4XWXA 2KUQA 2Z0OA 3HIEA 2RSGA 1XXMC 1V5PA 4HAZB 2EMSA 2P0FA 4TKNA 2VKIA 1BWNA 5D3WA 2CAYA 1XD4A 1N3HA 2G2UB 4F7HA 4KHBB 1BTNA 1AQCA 4EMOA 3FVCA 1EGXA 1JTGB 2DTCA 5FI1A 1WJ1A 2DA0A 5C5BA 1MK7B 2CODA 2PZ1A 3A8PA 4EKUA 5LONB 3IVFA 2Z13A 2P8VA 3ZVRA 2YH9A 3U12A 4ZRJA 2W2XD 1MIXA 2YS5A 3BINA 4HB0B 2EJ8A 4A6FB 1V88A 2K8EA 4GN1A 3KY9A 2NMBA 3GYPA 3N4IB 1FB8A 5LOPB 3PP2A 1FHXA 2W2XC 3HSAA 1ZM0A 3KSYA 1H4RA 1KZ7A 2AEHA 1NTVA 1EVHA 4P7IA 2QKLA 2H7DA 1FGZA 3TCAA 1MIZB 3P7ZA 1U5FA 2YT2A 3A98B 4ZRIA 3X23A 2D11A 1U5GA 2DHKA 1MKEA 1V89A 2Z0QA 3NWDA 2ROVA 2YS3A 2MDXA 2MKRA 5L81A 4DIXA 4L6EA 2DLWA 5LG4B 3ZDTA 1NTYA 1BTKA 4MT7A 2UZRA 2Q13A 2RNRB 3D8FA 4DM5A 1SHCA 1UEFA 5D3YA 4MK0A 3E2KC 1PMSA 2G2WB 1X86A 5D27A 1KZGA 2Y7BA 3BJIA 2N23A 4D0NB 5JLJB 1S0WC 3PG7A 4HDQA 3E2LC 2HTHB 1RRPB 2AL6A 4WSFA 3A58A 2MFQA 1W1DA 5DI9B 2YT1A 4GNKB 3DXDA 4H8SA 2RUKB 1TJ6A 1V5MA 2LYDA 1XCGA 1PLSA 4CYEA 5CLLB 2ADZA 3DXCA 4NSWA 4C0AA 2YSZA 2Z14A 3PVUA 1GC6A 2NBVA 5FI0A 5C16A 2D4QA 2I1KA 2LOXA 1WJMA 1P5TA 2ZKMX 3M1IB 5D0OE 5J3TA 5EKQE 4KHBA
chains in the Genus database with same CATH topology
2Z13A 2YH9A 2Z59A 3U12A 5AYWE 3TVVA 4CSQA 2R2YA 3GMUB 4IOYX 2PXGA 3NWAA 2K8EA 2RRFA 5D0QE 4L1RA 3GYPA 3N4IB 5M4YB 2GCLA 4QJ4B 2FJUB 2K49A 2YT2A 4QXAB 3GYOA 2KR0A 4QJ3B 3C4OB 5IRSA 4Z2MB 1ZYIA 4HSIA 5I2MA 3NWDA 3FSSA 4DIXA 2KIGA 2KM7A 5LG4B 2GCJA 3TW1A 3C7VB 4DM5A 4IFSA 3OHMB 4OSNA 4PQ0A 3C4PB 3D4EA 2Z4DA 4D6WA 3C7UB 3E2KC 2KXXA 2G2WB 2KUQA 4KHAA 3HIEA 2GUMA 1S0WC 5I2SA 3E2LC 3A58A 1XXMC 4GNKB 3TO1A 2B5RC 4QJ5B 2G2UB 4KHBB 4KHOA 2Z14A 3FVCA 4OT1A 2NBVA 1JTGB 3NWFA 3NW8A 2KIEA 4GOUA 2ZKMX 5D0OE 5EKQE 4Z2NA 4KHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OT1 A;  3FVC A;  2GUM A;  4L1R A;  4HSI A;  4OSN A;  3NWD A;  3NWA A;  3NWF A;  3NW8 A; 
#chains in the Genus database with same CATH topology
 5KCV A;  2Z59 A;  2KCJ A;  4CHJ A;  3GMU B;  2D9Z A;  1B55 A;  2ZPY A;  2LKO A;  2PXG A;  3CIK A;  3NWA A;  4DX8 A;  2YRY A;  5HE2 A;  2RRF A;  4L1R A;  5D3V A;  1Q67 A;  1ZVR A;  2EMT A;  5DH9 B;  3TFM A;  5C79 A;  4GZU A;  2GCL A;  1WVH A;  1Y19 B;  5CLQ B;  2KUP A;  4A6F A;  2XQN M;  4QJ4 B;  4GMV A;  3WYF B;  3PZD A;  1FHO A;  2DX1 A;  3VIA A;  3N7C A;  3D8E A;  1WGU A;  2J0M A;  4QXA B;  2DFK A;  1LW3 A;  3MPX A;  5KQ4 A;  4QJ3 B;  3C4O B;  4Z2M B;  2COA A;  3OAN A;  2DHI A;  1V5U A;  2M14 A;  1QC6 A;  2UVM A;  4BBK A;  1MPH A;  3FSS A;  3SUZ A;  5HE1 A;  1J19 A;  4DX9 0;  4NY0 A;  2KM7 A;  3U7D A;  1KI1 B;  1LB1 A;  3KZ1 A;  4TYZ A;  1DBH A;  3SO6 A;  2Y8F A;  1K5D B;  3LJU X;  1FOE A;  3C7V B;  1U5E A;  5C5B B;  5HE0 A;  4YON A;  4DBB A;  4HB4 B;  1DYN A;  4IFS A;  4PQ0 A;  1K5G B;  2DYQ A;  3SNH A;  3D4E A;  2YF0 A;  4IAP A;  4D6W A;  3C7U B;  1ZC4 B;  2DHJ A;  2JP2 A;  4F7G A;  4WJ7 A;  5KQ1 A;  4PNK A;  3PVL A;  2RGN B;  2GUM A;  1J0W A;  1UPQ A;  2R09 A;  2YT0 A;  1MAI A;  3G9W A;  2Y8G A;  4A5K A;  2VSZ A;  1DDW A;  1XOD A;  5C6R A;  3HQC A;  3PEG A;  2ELB A;  3SYX A;  5DIF B;  2CRF A;  1IRS A;  1P3R A;  3FM8 C;  4HHV A;  4KHO A;  1TQZ A;  2VRW B;  5JHH A;  3QBV B;  1P6S A;  2OTX A;  5D3X A;  3O96 A;  4GOU A;  1XR0 B;  2EC1 A;  3MDB C;  1ISN A;  3U8Z A;  2D9Y A;  2D9W A;  2D2Q A;  4DXA B;  2I5C A;  2H7E A;  1U29 A;  2DYN A;  3PVW A;  1BAK A;  5AYW E;  2YS1 A;  3PSC A;  2NZ8 B;  1DDM A;  3FEH A;  2K00 A;  1E5W A;  2DN6 A;  4HAU B;  2BCJ A;  4GMX B;  3WA0 A;  2DKQ A;  2L1C A;  1H10 A;  1X1F A;  2MWN B;  4CHM A;  1AWE A;  2LG1 A;  2FJU B;  1I7A A;  3F0W A;  2K49 A;  2L2I A;  3QIJ A;  3GYO A;  2KR0 A;  1Y5O A;  5IRS A;  1U2B A;  4YL8 A;  4B6H A;  1NU2 A;  1UPR A;  4HSI A;  2CY5 A;  1GG3 A;  2OQB A;  3ML4 A;  1U5D A;  2QKM A;  4A6H A;  2HE7 A;  3ULB A;  2N0Y A;  5JP4 A;  3A8Q A;  1FGY A;  1ZSQ A;  2RLO A;  1UNP A;  3QWM A;  1Z87 A;  1XKE A;  3ULC A;  1XX0 A;  4HAV B;  4KAX B;  5DHA B;  1X05 A;  3CXB B;  1EAZ A;  3OHM B;  3HK0 A;  3AU4 A;  1OY2 A;  2Z4D A;  3KRW A;  1NI2 A;  2KXX A;  2I1J A;  2J59 M;  4KHA A;  1I2H A;  3P6A A;  1UNR A;  2J0K A;  5I2S A;  2P0D A;  3RCP A;  1OMW A;  1TXD A;  3UZT A;  3KRX A;  2D10 A;  3TO1 A;  2B5R C;  2M38 A;  4QJ5 B;  4F7U P;  3DXE A;  3V5W A;  2COF A;  4GPT B;  4OT1 A;  4K2O A;  2K2J A;  2LOZ A;  1W1H A;  3NWF A;  1OQN A;  2KIE A;  3NW8 A;  4HAW B;  1UNQ A;  3ODO A;  1M7E A;  1WGQ A;  4HAT B;  1PFJ A;  3D8D A;  1WI1 A;  4Z2N A;  2Z0P A;  5DHF B;  2GS0 A;  2ELA A;  3TVV A;  4CSQ A;  2R2Y A;  2W2W A;  1FAO A;  5J3Y A;  4IOY X;  2KGX B;  4K2P A;  4HB2 B;  2E2X A;  2J0J A;  2V76 A;  3VOQ A;  5D0Q E;  3SV1 A;  4KVG B;  1EF1 A;  2DX5 A;  4MY6 A;  3F5R A;  4K17 A;  5M4Y B;  4HAY B;  3ODX A;  1ZC3 B;  3AJ4 A;  2COC A;  1X11 A;  3AU5 A;  1DRO A;  3B77 A;  2IFS A;  1T77 A;  4HDO A;  3HW2 B;  2X18 A;  3NSU A;  1WG7 A;  5GOW B;  5JHG A;  1MI1 A;  4ZRK A;  1MK9 B;  4HAX B;  2GJY A;  3DCX A;  4GXB A;  5HE3 A;  2ROZ B;  2UZS A;  1ZYI A;  4A6K A;  2D9X A;  1X1G A;  1QQG A;  2P0H A;  2D9V A;  5I2M A;  5J3Q A;  1U27 A;  2KIG A;  1GC7 A;  1W1G A;  1FHW A;  1SGH A;  2CY4 A;  4HB3 B;  2FJL A;  1M7R A;  2IYB A;  2GCJ A;  2YVC A;  3TW1 A;  4WVF B;  3T06 A;  2RVB B;  2G35 A;  2K2U A;  2LUL A;  2I5F A;  5EFX A;  1DDV A;  1V61 A;  2DKP A;  4OSN A;  1RJ2 A;  3C4P B;  3ODW A;  4K81 A;  4EJN A;  4Y94 A;  2R0D A;  4XWX A;  2KUQ A;  2Z0O A;  3HIE A;  2RSG A;  1XXM C;  1V5P A;  4HAZ B;  2EMS A;  2P0F A;  4TKN A;  2VKI A;  1BWN A;  5D3W A;  2CAY A;  1XD4 A;  1N3H A;  2G2U B;  4F7H A;  4KHB B;  1BTN A;  1AQC A;  4EMO A;  3FVC A;  1EGX A;  1JTG B;  2DTC A;  5FI1 A;  1WJ1 A;  2DA0 A;  5C5B A;  1MK7 B;  2COD A;  2PZ1 A;  3A8P A;  4EKU A;  5LON B;  3IVF A;  2Z13 A;  2P8V A;  3ZVR A;  2YH9 A;  3U12 A;  4ZRJ A;  2W2X D;  1MIX A;  2YS5 A;  3BIN A;  4HB0 B;  2EJ8 A;  4A6F B;  1V88 A;  2K8E A;  4GN1 A;  3KY9 A;  2NMB A;  3GYP A;  3N4I B;  1FB8 A;  5LOP B;  3PP2 A;  1FHX A;  2W2X C;  3HSA A;  1ZM0 A;  3KSY A;  1H4R A;  1KZ7 A;  2AEH A;  1NTV A;  1EVH A;  4P7I A;  2QKL A;  2H7D A;  1FGZ A;  3TCA A;  1MIZ B;  3P7Z A;  1U5F A;  2YT2 A;  3A98 B;  4ZRI A;  3X23 A;  2D11 A;  1U5G A;  2DHK A;  1MKE A;  1V89 A;  2Z0Q A;  3NWD A;  2ROV A;  2YS3 A;  2MDX A;  2MKR A;  5L81 A;  4DIX A;  4L6E A;  2DLW A;  5LG4 B;  3ZDT A;  1NTY A;  1BTK A;  4MT7 A;  2UZR A;  2Q13 A;  2RNR B;  3D8F A;  4DM5 A;  1SHC A;  1UEF A;  5D3Y A;  4MK0 A;  3E2K C;  1PMS A;  2G2W B;  1X86 A;  5D27 A;  1KZG A;  2Y7B A;  3BJI A;  2N23 A;  4D0N B;  5JLJ B;  1S0W C;  3PG7 A;  4HDQ A;  3E2L C;  2HTH B;  1RRP B;  2AL6 A;  4WSF A;  3A58 A;  2MFQ A;  1W1D A;  5DI9 B;  2YT1 A;  4GNK B;  3DXD A;  4H8S A;  2RUK B;  1TJ6 A;  1V5M A;  2LYD A;  1XCG A;  1PLS A;  4CYE A;  5CLL B;  2ADZ A;  3DXC A;  4NSW A;  4C0A A;  2YSZ A;  2Z14 A;  3PVU A;  1GC6 A;  2NBV A;  5FI0 A;  5C16 A;  2D4Q A;  2I1K A;  2LOX A;  1WJM A;  1P5T A;  2ZKM X;  3M1I B;  5D0O E;  5J3T A;  5EKQ E;  4KHB A; 
#chains in the Genus database with same CATH homology
 2Z13 A;  2YH9 A;  2Z59 A;  3U12 A;  5AYW E;  3TVV A;  4CSQ A;  2R2Y A;  3GMU B;  4IOY X;  2PXG A;  3NWA A;  2K8E A;  2RRF A;  5D0Q E;  4L1R A;  3GYP A;  3N4I B;  5M4Y B;  2GCL A;  4QJ4 B;  2FJU B;  2K49 A;  2YT2 A;  4QXA B;  3GYO A;  2KR0 A;  4QJ3 B;  3C4O B;  5IRS A;  4Z2M B;  1ZYI A;  4HSI A;  5I2M A;  3NWD A;  3FSS A;  4DIX A;  2KIG A;  2KM7 A;  5LG4 B;  2GCJ A;  3TW1 A;  3C7V B;  4DM5 A;  4IFS A;  3OHM B;  4OSN A;  4PQ0 A;  3C4P B;  3D4E A;  2Z4D A;  4D6W A;  3C7U B;  3E2K C;  2KXX A;  2G2W B;  2KUQ A;  4KHA A;  3HIE A;  2GUM A;  1S0W C;  5I2S A;  3E2L C;  3A58 A;  1XXM C;  4GNK B;  3TO1 A;  2B5R C;  4QJ5 B;  2G2U B;  4KHB B;  4KHO A;  2Z14 A;  3FVC A;  4OT1 A;  2NBV A;  1JTG B;  3NWF A;  3NW8 A;  2KIE A;  4GOU A;  2ZKM X;  5D0O E;  5EKQ E;  4Z2N A;  4KHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...