3FVCA

Crystal structure of a trimeric variant of the epstein-barr virus glycoprotein b
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
638
structure length
559
Chain Sequence
QQTSFPFRVCELSSHGDLFRFSSDIQCPSFENHTEGLLMVFKDNIIPYSFKVRSYTKIVTNILIYNGHRADSVTNRHEEKFSVDSYETDQMDTIYQCYNAVKMTKDGLTRVYVDRDGVNITVNLKPTGGLANGVRRYASQTELYDAPGRVEATYRTRTTVNCLITDMMAKSNSPFDFFVTTTGQTVEMSPFYDGKNKETFHERADSFHVRTNYKIVDYDNRGTNPQGERRAFLDKGTYTLSWKLENRTAYCPLQHWQTFDSTIATETGKSIHFVTDEGTSSFVTNTTVGIELPDAFKCIEEQVNKTMHEKYEAVQDRYTKGQEAITYFITSGGLLLAWLPLTPRSLKSLGTLNNPATVQIQFAYDSLRRQINRMLGDLARAWCLEQKRQNMVLRELTKINPTTVMSSIYGKAVAAKRLGDVISVSQCVPVNQATVTLRKSMRMCYSRPLVSFSFTKTYEGQLGTDNEIFATSQYYFQSGNEIHVYNDYHHFKTIELDGIATLQTFISLNTSLIENIDFASLELYSRDEQRASNVFDLEGIFREYNFQAQNIAGLRKDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoprotein GP110
publication title Structure of a trimeric variant of the Epstein-Barr virus glycoprotein B
pubmed doi rcsb
source organism Human herpesvirus 4
molecule tags Viral protein
total genus 112
structure length 559
sequence length 638
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00606 Glycoprotein_B Herpesvirus Glycoprotein B ectodomain
A PF17416 Glycoprot_B_PH1 Herpesvirus Glycoprotein B
A PF17417 Glycoprot_B_PH2 Herpesvirus Glycoprotein B PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.100 Mainly Beta Roll PH-domain like PH-domain like 3fvcA03
3.30.1450.20 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 3fvcA01
4HSIA 3FVCA 3NWAA 4OT1A 4L1RA 2GUMA 3NW8A 3NWDA 4OSNA 3NWFA
chains in the Genus database with same CATH superfamily
3E2KC 3CIKA 2LULA 1U27A 3HIEA 2BCJA 4GN1A 3KRWA 1B55A 3F0WA 5D0QE 5EKQE 2G2WB 2MFQA 3G9WA 4XWXA 4K2PA 2ZKMX 2YF0A 2PXGA 4HAXB 3AU4A 1T77A 3F5RA 3FVCA 3DCXA 2K2JA 2ROVA 2DHJA 2W2WA 1DDWA 5DH9B 4CSQA 1N3HA 2COAA 2XQNM 4HHVA 3D8EA 5FI1A 5JP4A 2RNRB 3BJIA 1P6SA 3SYXA 3C7VB 4EKUA 2GS0A 2IYBA 1FHOA 2I5CA 3FEHA 2OTXA 2J0KA 3GYPA 4GMXB 4CHJA 3HQCA 3PVUA 4OT1A 1XKEA 3TCAA 3GYOA 2H7EA 5EFXA 2KXXA 2YT1A 1M7EA 1FHWA 1WGUA 2KUQA 3AU5A 2KM7A 2AEHA 2I1KA 3PEGA 3P7ZA 2VRWB 1K5GB 2KUPA 1QC6A 3PG7A 5C5BA 2K2UA 5D0OE 2YVCA 1H4RA 1OMWA 5J3YA 1ZVRA 1KZGA 3U8ZA 1FB8A 1XD4A 2QKMA 1MAIA 4OSNA 3RCPA 1RJ2A 2DX5A 4GXBA 2N23A 1V89A 2RRFA 1X05A 2YRYA 1KI1B 1ZSQA 4NSWA 2LOXA 4KVGB 2D4QA 4QJ5B 2GCLA 4IOYX 1WJMA 4ZRKA 2YH9A 3C4PB 5C16A 2KIEA 2K8EA 2KCJA 2COFA 3PVLA 2DYQA 2Z13A 3GMUB 1S0WC 2NMBA 4DX90 1V5PA 1J19A 5DHAB 2Z59A 4K2OA 1DROA 2P8VA 3MPXA 2HTHB 1U2BA 3X23A 1J0WA 1UNRA 3DXCA 2YSZA 1Y5OA 4IFSA 1QQGA 4A6KA 5JHHA 2LOZA 3PZDA 4WSFA 5DHFB 2I5FA 1PLSA 1U5GA 5JHGA 2CY4A 2RSGA 2YS1A 1I2HA 2P0FA 5DI9B 5C5BB 2W2XC 2ELBA 1EAZA 3U7DA 3SV1A 4KHBA 2CY5A 2Y7BA 2D11A 1V5MA 4KAXB 2GCJA 2VSZA 2FJUB 2Y8FA 1UNQA 1MKEA 4MK0A 1SGHA 2CODA 1RRPB 2YS5A 2AL6A 3FM8C 3ULCA 5I2SA 4HAYB 2L2IA 3KRXA 5HE3A 4HB2B 3N7CA 1TQZA 1V61A 1FOEA 4EJNA 2KR0A 1FGZA 2D9XA 3IVFA 1XODA 2CRFA 2GUMA 4C0AA 3A8PA 4Y94A 2J0JA 3ODOA 3LJUX 4D0NB 1AWEA 1DYNA 1KZ7A 2DLWA 4ZRIA 2YS3A 2DHKA 2DA0A 5KQ4A 3KSYA 1IRSA 3A58A 2G35A 2ZPYA 1OY2A 1EF1A 1X1FA 2M14A 3T06A 3VOQA 3BINA 4DIXA 4HATB 3WA0A 4HB3B 4KHBB 3QWMA 2DHIA 1MK7B 2N0YA 2LG1A 1X11A 2KGXB 1WI1A 1MK9B 1Z87A 4WJ7A 2ADZA 2Y8GA 3TVVA 4KHOA 1NTVA 2R0DA 1V5UA 2EMSA 1ZM0A 1UEFA 5CLQB 1W1HA 3NWDA 3NSUA 3A8QA 1XXMC 1BAKA 2P0DA 1XCGA 1PFJA 4HAWB 4HAZB 4HAUB 1MIZB 4A6FA 4A6HA 5C79A 5KQ1A 1E5WA 1BTNA 1LW3A 5LOPB 4MT7A 4QJ3B 4YONA 1TJ6A 2Z0PA 2E2XA 3U12A 2H7DA 2RLOA 1UPRA 3O96A 4HSIA 2Z14A 2J59M 2D9WA 2G2UB 4GOUA 2DYNA 2GJYA 1WVHA 2UZSA 3ODWA 1ZC3B 1FGYA 3C4OB 5HE0A 5J3QA 4GNKB 5HE2A 1W1GA 1OQNA 1UPQA 2KIGA 1WJ1A 1P3RA 2L1CA 4K17A 2DTCA 2LKOA 3QBVB 4YL8A 2MDXA 3V5WA 1U5FA 2UVMA 4P7IA 4QJ4B 3ODXA 1U5EA 4DXAB 5DIFB 4F7HA 5AYWE 2RUKB 4DX8A 3D8FA 1MIXA 2D9VA 4CYEA 2Z0OA 4DM5A 1FHXA 4KHAA 3QIJA 5JLJB 2V76A 1LB1A 2J0MA 2NBVA 5FI0A 1UNPA 1XR0B 2K49A 4EMOA 5KCVA 4HDQA 4A6FB 2DN6A 2Z4DA 3OANA 5L81A 1MPHA 2IFSA 2UZRA 2DFKA 4ZRJA 3PSCA 5IRSA 3TFMA 2Q13A 2P0HA 1FAOA 2CAYA 1AQCA 4L6EA 2EJ8A 4GZUA 5D3XA 4HB4B 4L1RA 2FJLA 3CXBB 5GOWB 3HSAA 3HK0A 4D6WA 2QKLA 4Z2NA 4F7UP 2R09A 1GC7A 2ROZB 2MWNB 4DBBA 1I7AA 5D27A 2YT0A 5M4YB 1EGXA 2EMTA 3B77A 2RVBB 4NY0A 2B5RC 3E2LC 1Q67A 4WVFB 3DXEA 5D3VA 3OHMB 5I2MA 2NZ8B 3ULBA 3ZDTA 4CHMA 5D3YA 3C7UB 1ISNA 1W1DA 3PP2A 2Z0QA 1DBHA 5LONB 1U5DA 4HDOA 2YT2A 3ML4A 2R2YA 5D3WA 1X86A 3PVWA 4TYZA 5J3TA 5CLLB 3M1IB 2M38A 1JTGB 2D9ZA 4GPTB 2D2QA 3ZVRA 3TO1A 3D8DA 2ELAA 2D10A 3KZ1A 4GMVA 3AJ4A 2PZ1A 1X1GA 3SUZA 1P5TA 2OQBA 1NI2A 1ZYIA 2LYDA 4K81A 1U29A 3FSSA 5C6RA 3NW8A 3VIAA 1GC6A 1NTYA 2COCA 2D9YA 1BWNA 3NWAA 4HB0B 3UZTA 1MI1A 2I1JA 2W2XD 1BTKA 3DXDA 4Z2MB 1ZC4B 4F7GA 4IAPA 1Y19B 3D4EA 2HE7A 4BBKA 1DDVA 3HW2B 1K5DB 4HAVB 1H10A 3WYFB 3TW1A 1GG3A 1WGQA 2VKIA 2MKRA 4MY6A 3SNHA 1V88A 4QXAB 3NWFA 2DKPA 1TXDA 5HE1A 5LG4B 4H8SA 1XX0A 3MDBC 3A98B 3N4IB 1DDMA 1PMSA 2DKQA 4A5KA 1SHCA 2K00A 2JP2A 2EC1A 1NU2A 3KY9A 2DX1A 3P6AA 4TKNA 1WG7A 4B6HA 4PQ0A 2X18A 1M7RA 3SO6A 1EVHA 2RGNB 4PNKA
chains in the Genus database with same CATH topology
3E2KC 3HIEA 3TVVA 5M4YB 5D0QE 5EKQE 4KHOA 2G2WB 2Z13A 3GMUB 1S0WC 3NWDA 2ZKMX 2B5RC 2PXGA 2Z59A 3E2LC 1XXMC 3FVCA 3OHMB 5I2MA 4IFSA 3C7UB 4CSQA 4QJ3B 2YT2A 3U12A 2R2YA 4HSIA 2Z14A 4KHBA 3C7VB 2G2UB 1JTGB 4GOUA 2GCJA 2FJUB 3TO1A 3GYPA 3C4OB 4OT1A 4GNKB 3GYOA 1ZYIA 3FSSA 2KIGA 5I2SA 2KXXA 3NW8A 3NWAA 4QJ4B 2KUQA 5AYWE 2KR0A 2KM7A 4Z2MB 3D4EA 2GUMA 4DM5A 4KHAA 3TW1A 5D0OE 2NBVA 4QXAB 3NWFA 2K49A 5LG4B 4OSNA 2Z4DA 3A58A 3N4IB 5IRSA 2RRFA 4DIXA 4L1RA 4QJ5B 2GCLA 4IOYX 4D6WA 4KHBB 4Z2NA 4PQ0A 2YH9A 3C4PB 2KIEA 2K8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HSI A;  3FVC A;  3NWA A;  4OT1 A;  4L1R A;  2GUM A;  3NW8 A;  3NWD A;  4OSN A;  3NWF A; 
#chains in the Genus database with same CATH topology
 3E2K C;  3CIK A;  2LUL A;  1U27 A;  3HIE A;  2BCJ A;  4GN1 A;  3KRW A;  1B55 A;  3F0W A;  5D0Q E;  5EKQ E;  2G2W B;  2MFQ A;  3G9W A;  4XWX A;  4K2P A;  2ZKM X;  2YF0 A;  2PXG A;  4HAX B;  3AU4 A;  1T77 A;  3F5R A;  3FVC A;  3DCX A;  2K2J A;  2ROV A;  2DHJ A;  2W2W A;  1DDW A;  5DH9 B;  4CSQ A;  1N3H A;  2COA A;  2XQN M;  4HHV A;  3D8E A;  5FI1 A;  5JP4 A;  2RNR B;  3BJI A;  1P6S A;  3SYX A;  3C7V B;  4EKU A;  2GS0 A;  2IYB A;  1FHO A;  2I5C A;  3FEH A;  2OTX A;  2J0K A;  3GYP A;  4GMX B;  4CHJ A;  3HQC A;  3PVU A;  4OT1 A;  1XKE A;  3TCA A;  3GYO A;  2H7E A;  5EFX A;  2KXX A;  2YT1 A;  1M7E A;  1FHW A;  1WGU A;  2KUQ A;  3AU5 A;  2KM7 A;  2AEH A;  2I1K A;  3PEG A;  3P7Z A;  2VRW B;  1K5G B;  2KUP A;  1QC6 A;  3PG7 A;  5C5B A;  2K2U A;  5D0O E;  2YVC A;  1H4R A;  1OMW A;  5J3Y A;  1ZVR A;  1KZG A;  3U8Z A;  1FB8 A;  1XD4 A;  2QKM A;  1MAI A;  4OSN A;  3RCP A;  1RJ2 A;  2DX5 A;  4GXB A;  2N23 A;  1V89 A;  2RRF A;  1X05 A;  2YRY A;  1KI1 B;  1ZSQ A;  4NSW A;  2LOX A;  4KVG B;  2D4Q A;  4QJ5 B;  2GCL A;  4IOY X;  1WJM A;  4ZRK A;  2YH9 A;  3C4P B;  5C16 A;  2KIE A;  2K8E A;  2KCJ A;  2COF A;  3PVL A;  2DYQ A;  2Z13 A;  3GMU B;  1S0W C;  2NMB A;  4DX9 0;  1V5P A;  1J19 A;  5DHA B;  2Z59 A;  4K2O A;  1DRO A;  2P8V A;  3MPX A;  2HTH B;  1U2B A;  3X23 A;  1J0W A;  1UNR A;  3DXC A;  2YSZ A;  1Y5O A;  4IFS A;  1QQG A;  4A6K A;  5JHH A;  2LOZ A;  3PZD A;  4WSF A;  5DHF B;  2I5F A;  1PLS A;  1U5G A;  5JHG A;  2CY4 A;  2RSG A;  2YS1 A;  1I2H A;  2P0F A;  5DI9 B;  5C5B B;  2W2X C;  2ELB A;  1EAZ A;  3U7D A;  3SV1 A;  4KHB A;  2CY5 A;  2Y7B A;  2D11 A;  1V5M A;  4KAX B;  2GCJ A;  2VSZ A;  2FJU B;  2Y8F A;  1UNQ A;  1MKE A;  4MK0 A;  1SGH A;  2COD A;  1RRP B;  2YS5 A;  2AL6 A;  3FM8 C;  3ULC A;  5I2S A;  4HAY B;  2L2I A;  3KRX A;  5HE3 A;  4HB2 B;  3N7C A;  1TQZ A;  1V61 A;  1FOE A;  4EJN A;  2KR0 A;  1FGZ A;  2D9X A;  3IVF A;  1XOD A;  2CRF A;  2GUM A;  4C0A A;  3A8P A;  4Y94 A;  2J0J A;  3ODO A;  3LJU X;  4D0N B;  1AWE A;  1DYN A;  1KZ7 A;  2DLW A;  4ZRI A;  2YS3 A;  2DHK A;  2DA0 A;  5KQ4 A;  3KSY A;  1IRS A;  3A58 A;  2G35 A;  2ZPY A;  1OY2 A;  1EF1 A;  1X1F A;  2M14 A;  3T06 A;  3VOQ A;  3BIN A;  4DIX A;  4HAT B;  3WA0 A;  4HB3 B;  4KHB B;  3QWM A;  2DHI A;  1MK7 B;  2N0Y A;  2LG1 A;  1X11 A;  2KGX B;  1WI1 A;  1MK9 B;  1Z87 A;  4WJ7 A;  2ADZ A;  2Y8G A;  3TVV A;  4KHO A;  1NTV A;  2R0D A;  1V5U A;  2EMS A;  1ZM0 A;  1UEF A;  5CLQ B;  1W1H A;  3NWD A;  3NSU A;  3A8Q A;  1XXM C;  1BAK A;  2P0D A;  1XCG A;  1PFJ A;  4HAW B;  4HAZ B;  4HAU B;  1MIZ B;  4A6F A;  4A6H A;  5C79 A;  5KQ1 A;  1E5W A;  1BTN A;  1LW3 A;  5LOP B;  4MT7 A;  4QJ3 B;  4YON A;  1TJ6 A;  2Z0P A;  2E2X A;  3U12 A;  2H7D A;  2RLO A;  1UPR A;  3O96 A;  4HSI A;  2Z14 A;  2J59 M;  2D9W A;  2G2U B;  4GOU A;  2DYN A;  2GJY A;  1WVH A;  2UZS A;  3ODW A;  1ZC3 B;  1FGY A;  3C4O B;  5HE0 A;  5J3Q A;  4GNK B;  5HE2 A;  1W1G A;  1OQN A;  1UPQ A;  2KIG A;  1WJ1 A;  1P3R A;  2L1C A;  4K17 A;  2DTC A;  2LKO A;  3QBV B;  4YL8 A;  2MDX A;  3V5W A;  1U5F A;  2UVM A;  4P7I A;  4QJ4 B;  3ODX A;  1U5E A;  4DXA B;  5DIF B;  4F7H A;  5AYW E;  2RUK B;  4DX8 A;  3D8F A;  1MIX A;  2D9V A;  4CYE A;  2Z0O A;  4DM5 A;  1FHX A;  4KHA A;  3QIJ A;  5JLJ B;  2V76 A;  1LB1 A;  2J0M A;  2NBV A;  5FI0 A;  1UNP A;  1XR0 B;  2K49 A;  4EMO A;  5KCV A;  4HDQ A;  4A6F B;  2DN6 A;  2Z4D A;  3OAN A;  5L81 A;  1MPH A;  2IFS A;  2UZR A;  2DFK A;  4ZRJ A;  3PSC A;  5IRS A;  3TFM A;  2Q13 A;  2P0H A;  1FAO A;  2CAY A;  1AQC A;  4L6E A;  2EJ8 A;  4GZU A;  5D3X A;  4HB4 B;  4L1R A;  2FJL A;  3CXB B;  5GOW B;  3HSA A;  3HK0 A;  4D6W A;  2QKL A;  4Z2N A;  4F7U P;  2R09 A;  1GC7 A;  2ROZ B;  2MWN B;  4DBB A;  1I7A A;  5D27 A;  2YT0 A;  5M4Y B;  1EGX A;  2EMT A;  3B77 A;  2RVB B;  4NY0 A;  2B5R C;  3E2L C;  1Q67 A;  4WVF B;  3DXE A;  5D3V A;  3OHM B;  5I2M A;  2NZ8 B;  3ULB A;  3ZDT A;  4CHM A;  5D3Y A;  3C7U B;  1ISN A;  1W1D A;  3PP2 A;  2Z0Q A;  1DBH A;  5LON B;  1U5D A;  4HDO A;  2YT2 A;  3ML4 A;  2R2Y A;  5D3W A;  1X86 A;  3PVW A;  4TYZ A;  5J3T A;  5CLL B;  3M1I B;  2M38 A;  1JTG B;  2D9Z A;  4GPT B;  2D2Q A;  3ZVR A;  3TO1 A;  3D8D A;  2ELA A;  2D10 A;  3KZ1 A;  4GMV A;  3AJ4 A;  2PZ1 A;  1X1G A;  3SUZ A;  1P5T A;  2OQB A;  1NI2 A;  1ZYI A;  2LYD A;  4K81 A;  1U29 A;  3FSS A;  5C6R A;  3NW8 A;  3VIA A;  1GC6 A;  1NTY A;  2COC A;  2D9Y A;  1BWN A;  3NWA A;  4HB0 B;  3UZT A;  1MI1 A;  2I1J A;  2W2X D;  1BTK A;  3DXD A;  4Z2M B;  1ZC4 B;  4F7G A;  4IAP A;  1Y19 B;  3D4E A;  2HE7 A;  4BBK A;  1DDV A;  3HW2 B;  1K5D B;  4HAV B;  1H10 A;  3WYF B;  3TW1 A;  1GG3 A;  1WGQ A;  2VKI A;  2MKR A;  4MY6 A;  3SNH A;  1V88 A;  4QXA B;  3NWF A;  2DKP A;  1TXD A;  5HE1 A;  5LG4 B;  4H8S A;  1XX0 A;  3MDB C;  3A98 B;  3N4I B;  1DDM A;  1PMS A;  2DKQ A;  4A5K A;  1SHC A;  2K00 A;  2JP2 A;  2EC1 A;  1NU2 A;  3KY9 A;  2DX1 A;  3P6A A;  4TKN A;  1WG7 A;  4B6H A;  4PQ0 A;  2X18 A;  1M7R A;  3SO6 A;  1EVH A;  2RGN B;  4PNK A; 
#chains in the Genus database with same CATH homology
 3E2K C;  3HIE A;  3TVV A;  5M4Y B;  5D0Q E;  5EKQ E;  4KHO A;  2G2W B;  2Z13 A;  3GMU B;  1S0W C;  3NWD A;  2ZKM X;  2B5R C;  2PXG A;  2Z59 A;  3E2L C;  1XXM C;  3FVC A;  3OHM B;  5I2M A;  4IFS A;  3C7U B;  4CSQ A;  4QJ3 B;  2YT2 A;  3U12 A;  2R2Y A;  4HSI A;  2Z14 A;  4KHB A;  3C7V B;  2G2U B;  1JTG B;  4GOU A;  2GCJ A;  2FJU B;  3TO1 A;  3GYP A;  3C4O B;  4OT1 A;  4GNK B;  3GYO A;  1ZYI A;  3FSS A;  2KIG A;  5I2S A;  2KXX A;  3NW8 A;  3NWA A;  4QJ4 B;  2KUQ A;  5AYW E;  2KR0 A;  2KM7 A;  4Z2M B;  3D4E A;  2GUM A;  4DM5 A;  4KHA A;  3TW1 A;  5D0O E;  2NBV A;  4QXA B;  3NWF A;  2K49 A;  5LG4 B;  4OSN A;  2Z4D A;  3A58 A;  3N4I B;  5IRS A;  2RRF A;  4DIX A;  4L1R A;  4QJ5 B;  2GCL A;  4IOY X;  4D6W A;  4KHB B;  4Z2N A;  4PQ0 A;  2YH9 A;  3C4P B;  2KIE A;  2K8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...