3FVCA

Crystal structure of a trimeric variant of the epstein-barr virus glycoprotein b
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
638
structure length
559
Chain Sequence
QQTSFPFRVCELSSHGDLFRFSSDIQCPSFENHTEGLLMVFKDNIIPYSFKVRSYTKIVTNILIYNGHRADSVTNRHEEKFSVDSYETDQMDTIYQCYNAVKMTKDGLTRVYVDRDGVNITVNLKPTGGLANGVRRYASQTELYDAPGRVEATYRTRTTVNCLITDMMAKSNSPFDFFVTTTGQTVEMSPFYDGKNKETFHERADSFHVRTNYKIVDYDNRGTNPQGERRAFLDKGTYTLSWKLENRTAYCPLQHWQTFDSTIATETGKSIHFVTDEGTSSFVTNTTVGIELPDAFKCIEEQVNKTMHEKYEAVQDRYTKGQEAITYFITSGGLLLAWLPLTPRSLKSLGTLNNPATVQIQFAYDSLRRQINRMLGDLARAWCLEQKRQNMVLRELTKINPTTVMSSIYGKAVAAKRLGDVISVSQCVPVNQATVTLRKSMRMCYSRPLVSFSFTKTYEGQLGTDNEIFATSQYYFQSGNEIHVYNDYHHFKTIELDGIATLQTFISLNTSLIENIDFASLELYSRDEQRASNVFDLEGIFREYNFQAQNIAGLRKDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a trimeric variant of the Epstein-Barr virus glycoprotein B
pubmed doi rcsb
source organism Human herpesvirus 4
molecule tags Viral protein
molecule keywords Glycoprotein GP110
total genus 112
structure length 559
sequence length 638
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00606 Glycoprotein_B Herpesvirus Glycoprotein B ectodomain
A PF17416 Glycoprot_B_PH1 Herpesvirus Glycoprotein B
A PF17417 Glycoprot_B_PH2 Herpesvirus Glycoprotein B PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.100 Mainly Beta Roll PH-domain like PH-domain like 3fvcA03
3.30.1450.20 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 3fvcA01
3NWDA 4OSNA 4L1RA 3NWAA 4HSIA 3NW8A 4OT1A 3NWFA 2GUMA 3FVCA
chains in the Genus database with same CATH superfamily
2EMSA 2N23A 1DROA 1GC7A 2YT0A 5I2SA 1WGUA 4HAVB 4NY0A 1EGXA 4HAWB 3F0WA 5C5BB 3A98B 1XKEA 2RUKB 1XODA 3NWDA 1WGQA 2NZ8B 3PVWA 5M4YB 2Z59A 1ISNA 2IFSA 4KHAA 4KHOA 1NTVA 4F7UP 1J19A 3PP2A 3KRXA 1LW3A 3WA0A 4YONA 1FHWA 1P6SA 2DX1A 2K2UA 3C4OB 4XWXA 3F5RA 2Z4DA 2LULA 2RNRB 3ODXA 5D0OE 2GS0A 4GNKB 1P3RA 1I2HA 2YS5A 2LYDA 3ZVRA 4WSFA 1V5PA 3PSCA 1XCGA 2XQNM 4H8SA 2Z0OA 1KI1B 2DFKA 1BTNA 3RCPA 3D8EA 2MFQA 2GUMA 3M1IB 2P0DA 5GOWB 2UZRA 4B6HA 1SGHA 4K2OA 4TKNA 2RVBB 3NSUA 4KVGB 1ZC3B 5EFXA 5JHGA 2PXGA 4L1RA 2OQBA 4K2PA 4A6KA 1PLSA 5LOPB 1FGYA 2KCJA 1W1DA 2J0MA 5HE0A 2YSZA 2H7DA 1DDWA 4A6HA 1BTKA 1JTGB 2KM7A 4OT1A 2EJ8A 4K17A 4DBBA 4HAXB 2AEHA 4QJ3B 4IAPA 1Y5OA 5JLJB 2CY5A 3MDBC 3D8FA 1WJMA 5FI0A 1NI2A 2ADZA 2QKLA 2VRWB 2V76A 2Z13A 5D3YA 1GG3A 1U27A 4Y94A 4TYZA 5D3WA 2GJYA 2X18A 3KY9A 1XD4A 4QJ5B 1WJ1A 4KHBB 2N0YA 2D4QA 4HAUB 2LKOA 2Y7BA 3AU5A 4GZUA 5D3VA 2GCLA 2I1JA 3TCAA 5LONB 3DXCA 4QJ4B 3O96A 2G2WB 2D9ZA 2CY4A 3HIEA 1EAZA 4A6FB 3LJUX 1U5DA 1I7AA 1MK7B 2ROZB 4MT7A 5KQ4A 4HAYB 2Q13A 4IOYX 5IRSA 2D9WA 2RGNB 1S0WC 3NWFA 3C7VB 1UEFA 2K00A 4HB4B 1P5TA 4GOUA 3HW2B 4IFSA 2J0KA 3PZDA 2YVCA 1SHCA 2PZ1A 2DHKA 2G35A 3KRWA 4HHVA 5C6RA 5DHAB 1PMSA 2NMBA 1FOEA 3WYFB 2B5RC 1Z87A 3N4IB 1TXDA 3HK0A 2COAA 4DXAB 1QC6A 3DCXA 1OQNA 3G9WA 1MIZB 2LG1A 2KIGA 3DXEA 3N7CA 3FEHA 2M14A 4GMXB 2DX5A 1X1FA 2YT1A 1FHXA 3BJIA 3B77A 3QBVB 2ROVA 3TO1A 5JHHA 1K5GB 3DXDA 1U29A 3AJ4A 5HE2A 1PFJA 1Q67A 1UNPA 2Z14A 1MKEA 2EMTA 4HATB 2Y8GA 2IYBA 4CHJA 3P6AA 4DIXA 3A8PA 2KXXA 1U5EA 4ZRIA 5J3YA 1W1HA 2FJLA 1V5MA 2VSZA 1M7RA 2CAYA 3X23A 2HE7A 2D11A 2VKIA 4HB0B 2W2WA 4MK0A 4D0NB 3OANA 1MIXA 1U5FA 5DHFB 1AQCA 5D27A 2Y8FA 5C16A 4OSNA 2P0HA 3A58A 3NW8A 5FI1A 1V88A 2DYNA 5D3XA 1K5DB 2RLOA 2P8VA 2RRFA 4PNKA 1EF1A 3A8QA 1X11A 1ZYIA 5CLLB 4EKUA 1OMWA 4PQ0A 1E5WA 5HE3A 2D10A 2K49A 1RRPB 2EC1A 3CXBB 3HQCA 4HAZB 4WJ7A 1X05A 3BINA 3IVFA 3ML4A 1FGZA 1J0WA 2KIEA 1WVHA 5DH9B 2OTXA 4MY6A 2BCJA 2KGXB 2UZSA 5DIFB 2MWNB 2YT2A 4WVFB 3D4EA 3E2KC 4GPTB 2COCA 5KQ1A 3QIJA 3E2LC 3KSYA 4HDOA 2KR0A 1V89A 3GMUB 3ODWA 4DM5A 5JP4A 1FHOA 1IRSA 4K81A 2DYQA 1MK9B 4F7HA 2D2QA 1XR0B 4Z2NA 1FB8A 2COFA 2LOZA 1H4RA 2W2XC 1U2BA 1W1GA 4A5KA 2ZPYA 3TW1A 1Y19B 2K8EA 5AYWE 3SO6A 2D9YA 3ULBA 2YH9A 5EKQE 3GYPA 3PEGA 5J3QA 2GCJA 3SV1A 3SUZA 4L6EA 3ZDTA 1MAIA 1WG7A 1FAOA 2J59M 2R09A 3QWMA 3SYXA 4YL8A 1OY2A 3VOQA 5D0QE 2DTCA 5KCVA 3GYOA 1DBHA 4P7IA 3SNHA 4NSWA 4BBKA 1NTYA 1B55A 4QXAB 2CRFA 2D9VA 1M7EA 1QQGA 3PG7A 3UZTA 1DYNA 3TFMA 2FJUB 2YF0A 4KHBA 1NU2A 1WI1A 5L81A 1ZC4B 3AU4A 3KZ1A 1N3HA 4HDQA 4DX8A 3ULCA 2KUPA 4C0AA 2MDXA 2R0DA 5C5BA 3TVVA 1X86A 3NWAA 2I5FA 3P7ZA 2YS1A 1ZSQA 2K2JA 1DDVA 3FVCA 2ZKMX 1X1GA 1RJ2A 2J0JA 1UPRA 1UNRA 2Z0PA 2DHIA 1AWEA 2LOXA 1XX0A 1EVHA 2YS3A 2HTHB 1KZGA 4A6FA 4GMVA 2DKQA 2ELBA 3C7UB 3PVLA 2W2XD 2M38A 2L1CA 5J3TA 1H10A 1ZM0A 4DX90 2JP2A 2R2YA 2G2UB 3D8DA 5C79A 4HSIA 4KAXB 2DA0A 2KUQA 3FM8C 2RSGA 2CODA 2ELAA 5LG4B 3T06A 4GN1A 1BWNA 3CIKA 2YRYA 2NBVA 3U7DA 4EJNA 3MPXA 4Z2MB 1U5GA 1LB1A 2QKMA 3U12A 3HSAA 5HE1A 1DDMA 1XXMC 2P0FA 4EMOA 1MPHA 2H7EA 2DHJA 1BAKA 1GC6A 2MKRA 3PVUA 4CYEA 2I1KA 4GXBA 4ZRJA 3V5WA 2E2XA 4HB3B 3FSSA 1T77A 2AL6A 5DI9B 4D6WA 4CHMA 3OHMB 4HB2B 4CSQA 2I5CA 4F7GA 5CLQB 2Z0QA 1MI1A 1UNQA 2UVMA 2D9XA 1V5UA 1KZ7A 2DLWA 5I2MA 3ODOA 2DN6A 3U8ZA 1UPQA 4ZRKA 1TJ6A 1ZVRA 1V61A 2DKPA 3VIAA 3C4PB 1TQZA 2L2IA
chains in the Genus database with same CATH topology
2FJUB 4KHBA 5I2SA 4QJ5B 4KHBB 2GCLA 3TVVA 3NWDA 4OSNA 3NWAA 3A58A 3NW8A 5M4YB 4QJ4B 2Z59A 2ZKMX 3FVCA 2RRFA 2G2WB 4KHAA 4KHOA 1ZYIA 3HIEA 4PQ0A 2K49A 4IOYX 3C4OB 5IRSA 3C7UB 1S0WC 2Z4DA 3NWFA 3C7VB 5D0OE 4GNKB 2KIEA 4GOUA 2R2YA 2G2UB 3D4EA 4IFSA 2YT2A 4HSIA 3E2KC 2KUQA 2GUMA 5LG4B 3E2LC 2NBVA 4Z2MB 2KR0A 3GMUB 2B5RC 3U12A 4DM5A 3N4IB 1XXMC 2PXGA 4L1RA 2KIGA 4Z2NA 3FSSA 3TW1A 2K8EA 4D6WA 5AYWE 3OHMB 2YH9A 3TO1A 3GYPA 5EKQE 1JTGB 4CSQA 2GCJA 2KM7A 4OT1A 2Z14A 4QJ3B 5D0QE 5I2MA 4DIXA 3GYOA 2KXXA 3C4PB 4QXAB 2Z13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NWD A;  4OSN A;  4L1R A;  3NWA A;  4HSI A;  3NW8 A;  4OT1 A;  3NWF A;  2GUM A;  3FVC A; 
#chains in the Genus database with same CATH topology
 2EMS A;  2N23 A;  1DRO A;  1GC7 A;  2YT0 A;  5I2S A;  1WGU A;  4HAV B;  4NY0 A;  1EGX A;  4HAW B;  3F0W A;  5C5B B;  3A98 B;  1XKE A;  2RUK B;  1XOD A;  3NWD A;  1WGQ A;  2NZ8 B;  3PVW A;  5M4Y B;  2Z59 A;  1ISN A;  2IFS A;  4KHA A;  4KHO A;  1NTV A;  4F7U P;  1J19 A;  3PP2 A;  3KRX A;  1LW3 A;  3WA0 A;  4YON A;  1FHW A;  1P6S A;  2DX1 A;  2K2U A;  3C4O B;  4XWX A;  3F5R A;  2Z4D A;  2LUL A;  2RNR B;  3ODX A;  5D0O E;  2GS0 A;  4GNK B;  1P3R A;  1I2H A;  2YS5 A;  2LYD A;  3ZVR A;  4WSF A;  1V5P A;  3PSC A;  1XCG A;  2XQN M;  4H8S A;  2Z0O A;  1KI1 B;  2DFK A;  1BTN A;  3RCP A;  3D8E A;  2MFQ A;  2GUM A;  3M1I B;  2P0D A;  5GOW B;  2UZR A;  4B6H A;  1SGH A;  4K2O A;  4TKN A;  2RVB B;  3NSU A;  4KVG B;  1ZC3 B;  5EFX A;  5JHG A;  2PXG A;  4L1R A;  2OQB A;  4K2P A;  4A6K A;  1PLS A;  5LOP B;  1FGY A;  2KCJ A;  1W1D A;  2J0M A;  5HE0 A;  2YSZ A;  2H7D A;  1DDW A;  4A6H A;  1BTK A;  1JTG B;  2KM7 A;  4OT1 A;  2EJ8 A;  4K17 A;  4DBB A;  4HAX B;  2AEH A;  4QJ3 B;  4IAP A;  1Y5O A;  5JLJ B;  2CY5 A;  3MDB C;  3D8F A;  1WJM A;  5FI0 A;  1NI2 A;  2ADZ A;  2QKL A;  2VRW B;  2V76 A;  2Z13 A;  5D3Y A;  1GG3 A;  1U27 A;  4Y94 A;  4TYZ A;  5D3W A;  2GJY A;  2X18 A;  3KY9 A;  1XD4 A;  4QJ5 B;  1WJ1 A;  4KHB B;  2N0Y A;  2D4Q A;  4HAU B;  2LKO A;  2Y7B A;  3AU5 A;  4GZU A;  5D3V A;  2GCL A;  2I1J A;  3TCA A;  5LON B;  3DXC A;  4QJ4 B;  3O96 A;  2G2W B;  2D9Z A;  2CY4 A;  3HIE A;  1EAZ A;  4A6F B;  3LJU X;  1U5D A;  1I7A A;  1MK7 B;  2ROZ B;  4MT7 A;  5KQ4 A;  4HAY B;  2Q13 A;  4IOY X;  5IRS A;  2D9W A;  2RGN B;  1S0W C;  3NWF A;  3C7V B;  1UEF A;  2K00 A;  4HB4 B;  1P5T A;  4GOU A;  3HW2 B;  4IFS A;  2J0K A;  3PZD A;  2YVC A;  1SHC A;  2PZ1 A;  2DHK A;  2G35 A;  3KRW A;  4HHV A;  5C6R A;  5DHA B;  1PMS A;  2NMB A;  1FOE A;  3WYF B;  2B5R C;  1Z87 A;  3N4I B;  1TXD A;  3HK0 A;  2COA A;  4DXA B;  1QC6 A;  3DCX A;  1OQN A;  3G9W A;  1MIZ B;  2LG1 A;  2KIG A;  3DXE A;  3N7C A;  3FEH A;  2M14 A;  4GMX B;  2DX5 A;  1X1F A;  2YT1 A;  1FHX A;  3BJI A;  3B77 A;  3QBV B;  2ROV A;  3TO1 A;  5JHH A;  1K5G B;  3DXD A;  1U29 A;  3AJ4 A;  5HE2 A;  1PFJ A;  1Q67 A;  1UNP A;  2Z14 A;  1MKE A;  2EMT A;  4HAT B;  2Y8G A;  2IYB A;  4CHJ A;  3P6A A;  4DIX A;  3A8P A;  2KXX A;  1U5E A;  4ZRI A;  5J3Y A;  1W1H A;  2FJL A;  1V5M A;  2VSZ A;  1M7R A;  2CAY A;  3X23 A;  2HE7 A;  2D11 A;  2VKI A;  4HB0 B;  2W2W A;  4MK0 A;  4D0N B;  3OAN A;  1MIX A;  1U5F A;  5DHF B;  1AQC A;  5D27 A;  2Y8F A;  5C16 A;  4OSN A;  2P0H A;  3A58 A;  3NW8 A;  5FI1 A;  1V88 A;  2DYN A;  5D3X A;  1K5D B;  2RLO A;  2P8V A;  2RRF A;  4PNK A;  1EF1 A;  3A8Q A;  1X11 A;  1ZYI A;  5CLL B;  4EKU A;  1OMW A;  4PQ0 A;  1E5W A;  5HE3 A;  2D10 A;  2K49 A;  1RRP B;  2EC1 A;  3CXB B;  3HQC A;  4HAZ B;  4WJ7 A;  1X05 A;  3BIN A;  3IVF A;  3ML4 A;  1FGZ A;  1J0W A;  2KIE A;  1WVH A;  5DH9 B;  2OTX A;  4MY6 A;  2BCJ A;  2KGX B;  2UZS A;  5DIF B;  2MWN B;  2YT2 A;  4WVF B;  3D4E A;  3E2K C;  4GPT B;  2COC A;  5KQ1 A;  3QIJ A;  3E2L C;  3KSY A;  4HDO A;  2KR0 A;  1V89 A;  3GMU B;  3ODW A;  4DM5 A;  5JP4 A;  1FHO A;  1IRS A;  4K81 A;  2DYQ A;  1MK9 B;  4F7H A;  2D2Q A;  1XR0 B;  4Z2N A;  1FB8 A;  2COF A;  2LOZ A;  1H4R A;  2W2X C;  1U2B A;  1W1G A;  4A5K A;  2ZPY A;  3TW1 A;  1Y19 B;  2K8E A;  5AYW E;  3SO6 A;  2D9Y A;  3ULB A;  2YH9 A;  5EKQ E;  3GYP A;  3PEG A;  5J3Q A;  2GCJ A;  3SV1 A;  3SUZ A;  4L6E A;  3ZDT A;  1MAI A;  1WG7 A;  1FAO A;  2J59 M;  2R09 A;  3QWM A;  3SYX A;  4YL8 A;  1OY2 A;  3VOQ A;  5D0Q E;  2DTC A;  5KCV A;  3GYO A;  1DBH A;  4P7I A;  3SNH A;  4NSW A;  4BBK A;  1NTY A;  1B55 A;  4QXA B;  2CRF A;  2D9V A;  1M7E A;  1QQG A;  3PG7 A;  3UZT A;  1DYN A;  3TFM A;  2FJU B;  2YF0 A;  4KHB A;  1NU2 A;  1WI1 A;  5L81 A;  1ZC4 B;  3AU4 A;  3KZ1 A;  1N3H A;  4HDQ A;  4DX8 A;  3ULC A;  2KUP A;  4C0A A;  2MDX A;  2R0D A;  5C5B A;  3TVV A;  1X86 A;  3NWA A;  2I5F A;  3P7Z A;  2YS1 A;  1ZSQ A;  2K2J A;  1DDV A;  3FVC A;  2ZKM X;  1X1G A;  1RJ2 A;  2J0J A;  1UPR A;  1UNR A;  2Z0P A;  2DHI A;  1AWE A;  2LOX A;  1XX0 A;  1EVH A;  2YS3 A;  2HTH B;  1KZG A;  4A6F A;  4GMV A;  2DKQ A;  2ELB A;  3C7U B;  3PVL A;  2W2X D;  2M38 A;  2L1C A;  5J3T A;  1H10 A;  1ZM0 A;  4DX9 0;  2JP2 A;  2R2Y A;  2G2U B;  3D8D A;  5C79 A;  4HSI A;  4KAX B;  2DA0 A;  2KUQ A;  3FM8 C;  2RSG A;  2COD A;  2ELA A;  5LG4 B;  3T06 A;  4GN1 A;  1BWN A;  3CIK A;  2YRY A;  2NBV A;  3U7D A;  4EJN A;  3MPX A;  4Z2M B;  1U5G A;  1LB1 A;  2QKM A;  3U12 A;  3HSA A;  5HE1 A;  1DDM A;  1XXM C;  2P0F A;  4EMO A;  1MPH A;  2H7E A;  2DHJ A;  1BAK A;  1GC6 A;  2MKR A;  3PVU A;  4CYE A;  2I1K A;  4GXB A;  4ZRJ A;  3V5W A;  2E2X A;  4HB3 B;  3FSS A;  1T77 A;  2AL6 A;  5DI9 B;  4D6W A;  4CHM A;  3OHM B;  4HB2 B;  4CSQ A;  2I5C A;  4F7G A;  5CLQ B;  2Z0Q A;  1MI1 A;  1UNQ A;  2UVM A;  2D9X A;  1V5U A;  1KZ7 A;  2DLW A;  5I2M A;  3ODO A;  2DN6 A;  3U8Z A;  1UPQ A;  4ZRK A;  1TJ6 A;  1ZVR A;  1V61 A;  2DKP A;  3VIA A;  3C4P B;  1TQZ A;  2L2I A; 
#chains in the Genus database with same CATH homology
 2FJU B;  4KHB A;  5I2S A;  4QJ5 B;  4KHB B;  2GCL A;  3TVV A;  3NWD A;  4OSN A;  3NWA A;  3A58 A;  3NW8 A;  5M4Y B;  4QJ4 B;  2Z59 A;  2ZKM X;  3FVC A;  2RRF A;  2G2W B;  4KHA A;  4KHO A;  1ZYI A;  3HIE A;  4PQ0 A;  2K49 A;  4IOY X;  3C4O B;  5IRS A;  3C7U B;  1S0W C;  2Z4D A;  3NWF A;  3C7V B;  5D0O E;  4GNK B;  2KIE A;  4GOU A;  2R2Y A;  2G2U B;  3D4E A;  4IFS A;  2YT2 A;  4HSI A;  3E2K C;  2KUQ A;  2GUM A;  5LG4 B;  3E2L C;  2NBV A;  4Z2M B;  2KR0 A;  3GMU B;  2B5R C;  3U12 A;  4DM5 A;  3N4I B;  1XXM C;  2PXG A;  4L1R A;  2KIG A;  4Z2N A;  3FSS A;  3TW1 A;  2K8E A;  4D6W A;  5AYW E;  3OHM B;  2YH9 A;  3TO1 A;  3GYP A;  5EKQ E;  1JTG B;  4CSQ A;  2GCJ A;  2KM7 A;  4OT1 A;  2Z14 A;  4QJ3 B;  5D0Q E;  5I2M A;  4DIX A;  3GYO A;  2KXX A;  3C4P B;  4QXA B;  2Z13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...