3FVCA

Crystal structure of a trimeric variant of the epstein-barr virus glycoprotein b
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
638
structure length
559
Chain Sequence
b'QQTSFPFRVCELSSHGDLFRFSSDIQCPSFENHTEGLLMVFKDNIIPYSFKVRSYTKIVTNILIYNGHRADSVTNRHEEKFSVDSYETDQMDTIYQCYNAVKMTKDGLTRVYVDRDGVNITVNLKPTGGLANGVRRYASQTELYDAPGRVEATYRTRTTVNCLITDMMAKSNSPFDFFVTTTGQTVEMSPFYDGKNKETFHERADSFHVRTNYKIVDYDNRGTNPQGERRAFLDKGTYTLSWKLENRTAYCPLQHWQTFDSTIATETGKSIHFVTDEGTSSFVTNTTVGIELPDAFKCIEEQVNKTMHEKYEAVQDRYTKGQEAITYFITSGGLLLAWLPLTPRSLKSLGTLNNPATVQIQFAYDSLRRQINRMLGDLARAWCLEQKRQNMVLRELTKINPTTVMSSIYGKAVAAKRLGDVISVSQCVPVNQATVTLRKSMRMCYSRPLVSFSFTKTYEGQLGTDNEIFATSQYYFQSGNEIHVYNDYHHFKTIELDGIATLQTFISLNTSLIENIDFASLELYSRDEQRASNVFDLEGIFREYNFQAQNIAGLRKDLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoprotein GP110
publication title Structure of a trimeric variant of the Epstein-Barr virus glycoprotein B
pubmed doi rcsb
source organism Human herpesvirus 4
molecule tags Viral protein
total genus 112
structure length 559
sequence length 638
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00606 Glycoprotein_B Herpesvirus Glycoprotein B ectodomain
A PF17416 Glycoprot_B_PH1 Herpesvirus Glycoprotein B
A PF17417 Glycoprot_B_PH2 Herpesvirus Glycoprotein B PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.100 Mainly Beta Roll PH-domain like PH-domain like 3fvcA03
3.30.1450.20 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 3fvcA01
3NWFA 3NWAA 3NWDA 4L1RA 3NW8A 4HSIA 3FVCA 4OSNA 4OT1A 2GUMA
chains in the Genus database with same CATH superfamily
2KUQA 2ZPYA 2LG1A 2DHIA 4NY0A 2V76A 1KI1B 2YS5A 2NMBA 4F7UP 4YL8A 1X86A 4B6HA 2K49A 3PVUA 2D9YA 2N0YA 5CLQB 3F0WA 4D0NB 3FSSA 3PVLA 4DXAB 2YVCA 3VIAA 4CHMA 3KSYA 1XXMC 1U29A 3CXBB 5DHAB 4XWXA 1IRSA 1U5EA 2H7DA 2VKIA 2X18A 3KZ1A 4KHBB 2COAA 3WYFB 4CYEA 1AWEA 4HB0B 3C4PB 2LULA 1BWNA 3G9WA 2L2IA 2UZRA 1ISNA 3A58A 2M38A 3N7CA 2GJYA 3NWAA 3FM8C 5C5BA 2DA0A 2K2JA 2NZ8B 2MFQA 2Y8FA 4HAZB 1GG3A 3SUZA 2KGXB 4C0AA 2UZSA 4ZRKA 2COFA 3HW2B 4GOUA 4F7GA 4K2OA 2CY5A 3D4EA 4CSQA 3C7UB 3T06A 5C16A 3SNHA 4KHOA 2G2UB 1M7RA 1V5PA 5J3TA 1EAZA 4GZUA 2DLWA 3OHMB 1WGQA 1K5DB 2KIEA 2R09A 3V5WA 1X1FA 3A8QA 1LB1A 1ZM0A 1N3HA 2ROVA 3ODWA 1TXDA 5HE0A 2D10A 2YT0A 2CODA 2GCJA 2ELBA 1RJ2A 4OSNA 4OT1A 4HB4B 2RNRB 4CHJA 4QJ3B 4HATB 4HAWB 1XCGA 2W2XD 2UVMA 5DHFB 4D6WA 4K81A 2K8EA 1V89A 1LW3A 2D9VA 3P6AA 1FAOA 1XX0A 2FJUB 2IFSA 1ZSQA 1DBHA 1P5TA 2P0HA 1P3RA 2DKPA 3X23A 1MI1A 1NTYA 2H7EA 3SV1A 4PQ0A 2J0MA 3DXCA 2AEHA 5EKQE 1UNQA 5HE3A 4A6KA 3ULCA 2RUKB 2RVBB 1WJMA 1DDMA 5J3QA 1UPRA 4IOYX 3U8ZA 3MPXA 3AU4A 4HB3B 3TFMA 1W1DA 1FHOA 1XR0B 1ZVRA 2I5CA 2VSZA 1Z87A 4IFSA 4Z2MB 4ZRJA 3P7ZA 4GPTB 4YONA 1ZYIA 1ZC3B 4QJ4B 4K2PA 1SHCA 2DYQA 3MDBC 3KY9A 3GYOA 3GMUB 1PFJA 4IAPA 2W2XC 4HB2B 2I5FA 5D3YA 1NTVA 1U2BA 3ODOA 2ELAA 3NWDA 2KM7A 5LG4B 2W2WA 1EVHA 4KHAA 2LYDA 2KR0A 3E2LC 3PG7A 5AYWE 4HAYB 3UZTA 3TVVA 1KZ7A 5M4YB 2MWNB 1OMWA 5I2SA 1KZGA 3SYXA 1FHWA 2YT2A 1MIZB 4HDOA 1MK9B 3TO1A 1BAKA 2AL6A 2Z0OA 2QKMA 1H4RA 1WGUA 2M14A 3DXDA 3BINA 4MT7A 2KUPA 2CRFA 1OQNA 2DN6A 5FI0A 5I2MA 3BJIA 1EGXA 5KCVA 5FI1A 1J19A 4HDQA 3B77A 1TJ6A 3OANA 2KCJA 2CAYA 2BCJA 3F5RA 2Z59A 2DTCA 3C4OB 4TYZA 1WJ1A 1WVHA 2Z13A 2Y7BA 3PZDA 2QKLA 3WA0A 5DIFB 3NWFA 1ZC4B 5CLLB 1U5GA 2OQBA 2PXGA 4HAVB 5JP4A 2J0KA 2PZ1A 1W1GA 4DM5A 1DDWA 4A6FA 1SGHA 2CY4A 1X05A 3CIKA 1E5WA 3ML4A 2HE7A 4Y94A 2HTHB 2D2QA 3U12A 1X1GA 3M1IB 3A98B 4DIXA 3FVCA 1BTNA 1B55A 3D8FA 2DFKA 4GMVA 2LOZA 3TW1A 3AJ4A 2YSZA 1Q67A 3RCPA 2K00A 2NBVA 2Z0QA 2GUMA 2B5RC 2YS3A 1MIXA 5J3YA 2ROZB 3FEHA 5L81A 2YT1A 3QBVB 1MAIA 5LOPB 5JHGA 2KIGA 2Z0PA 5EFXA 1GC7A 1I2HA 5KQ4A 1MK7B 5D3VA 2DX1A 3GYPA 2ADZA 1MKEA 4KHBA 1U27A 3QIJA 4P7IA 4DX8A 5D3XA 1NU2A 4A5KA 1V88A 3C7VB 5D0OE 4EKUA 1T77A 3E2KC 3D8EA 4BBKA 4HAXB 1NI2A 4HHVA 1X11A 2JP2A 4F7HA 2E2XA 4L1RA 4MK0A 2R0DA 4GXBA 1DYNA 1XODA 5LONB 1QQGA 1PLSA 2P8VA 4EMOA 1BTKA 3PP2A 4A6HA 1W1HA 3HK0A 4K17A 2G35A 2Y8GA 4GMXB 1K5GB 1UPQA 2MDXA 3ZVRA 1FB8A 1TQZA 1I7AA 2K2UA 4WSFA 2Z4DA 4HAUB 4H8SA 5D27A 2IYBA 2YRYA 2I1KA 2DHKA 3O96A 1MPHA 1XKEA 3HIEA 5JLJB 3N4IB 1U5FA 4ZRIA 2I1JA 2J59M 1UNPA 3D8DA 3U7DA 3ULBA 3QWMA 3PVWA 2EC1A 1OY2A 2G2WB 3DXEA 4WJ7A 1Y19B 2P0FA 3SO6A 1U5DA 1V61A 2OTXA 4DBBA 2KXXA 2P0DA 1UEFA 3KRXA 4PNKA 1UNRA 1H10A 2D4QA 2DHJA 2RGNB 3HSAA 5HE2A 3HQCA 4DX90 3TCAA 3LJUX 2Z14A 5C79A 2YS1A 5DI9B 4NSWA 1V5MA 1FGZA 2GCLA 1GC6A 1V5UA 2LOXA 4QXAB 5D0QE 1RRPB 2D9ZA 2GS0A 2LKOA 2D9XA 2ZKMX 2XQNM 1S0WC 4QJ5B 2R2YA 4HSIA 5D3WA 5C5BB 5C6RA 2YH9A 2EMSA 4GNKB 2N23A 1Y5OA 1WI1A 2RSGA 1AQCA 3AU5A 3PEGA 2DYNA 1FGYA 1XD4A 4TKNA 2FJLA 2EMTA 1EF1A 2DKQA 4KVGB 2YF0A 4GN1A 2Q13A 2MKRA 1M7EA 3PSCA 4WVFB 1JTGB 1WG7A 1FHXA 3DCXA 3A8PA 2COCA 2RLOA 5JHHA 5HE1A 1FOEA 2J0JA 2RRFA 2D11A 3IVFA 4MY6A 1PMSA 3ZDTA 1DROA 4L6EA 1DDVA 2VRWB 4KAXB 5IRSA 5DH9B 2DX5A 3NW8A 2L1CA 4Z2NA 3VOQA 1P6SA 2D9WA 1J0WA 1QC6A 3KRWA 4EJNA 3NSUA 3ODXA 4A6FB 5KQ1A 5GOWB 2EJ8A
chains in the Genus database with same CATH topology
2Z4DA 2KUQA 3C4OB 2FJUB 2Z13A 3HIEA 3N4IB 3NWFA 4PQ0A 5EKQE 2K49A 2PXGA 2G2WB 3FSSA 4DM5A 2KXXA 4IOYX 1XXMC 4IFSA 4Z2MB 4KHBB 2Z14A 3U12A 4DIXA 3C4PB 1ZYIA 3FVCA 4QJ4B 2GCLA 3TW1A 4QXAB 3A58A 2NBVA 5D0QE 2ZKMX 2GUMA 2B5RC 3GYOA 3GMUB 1S0WC 3NWAA 4QJ5B 2R2YA 4HSIA 2YH9A 4GNKB 2KIGA 3NWDA 2KM7A 5LG4B 4KHAA 3GYPA 2KR0A 4KHBA 3E2LC 5AYWE 4GOUA 3D4EA 4CSQA 3TVVA 5M4YB 3C7UB 5I2SA 4KHOA 2G2UB 2YT2A 1JTGB 3C7VB 2RRFA 3TO1A 5D0OE 3OHMB 3E2KC 2KIEA 5IRSA 4L1RA 3NW8A 2GCJA 4Z2NA 4OSNA 5I2MA 4OT1A 4QJ3B 4D6WA 2K8EA 2Z59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NWF A;  3NWA A;  3NWD A;  4L1R A;  3NW8 A;  4HSI A;  3FVC A;  4OSN A;  4OT1 A;  2GUM A; 
#chains in the Genus database with same CATH topology
 2KUQ A;  2ZPY A;  2LG1 A;  2DHI A;  4NY0 A;  2V76 A;  1KI1 B;  2YS5 A;  2NMB A;  4F7U P;  4YL8 A;  1X86 A;  4B6H A;  2K49 A;  3PVU A;  2D9Y A;  2N0Y A;  5CLQ B;  3F0W A;  4D0N B;  3FSS A;  3PVL A;  4DXA B;  2YVC A;  3VIA A;  4CHM A;  3KSY A;  1XXM C;  1U29 A;  3CXB B;  5DHA B;  4XWX A;  1IRS A;  1U5E A;  2H7D A;  2VKI A;  2X18 A;  3KZ1 A;  4KHB B;  2COA A;  3WYF B;  4CYE A;  1AWE A;  4HB0 B;  3C4P B;  2LUL A;  1BWN A;  3G9W A;  2L2I A;  2UZR A;  1ISN A;  3A58 A;  2M38 A;  3N7C A;  2GJY A;  3NWA A;  3FM8 C;  5C5B A;  2DA0 A;  2K2J A;  2NZ8 B;  2MFQ A;  2Y8F A;  4HAZ B;  1GG3 A;  3SUZ A;  2KGX B;  4C0A A;  2UZS A;  4ZRK A;  2COF A;  3HW2 B;  4GOU A;  4F7G A;  4K2O A;  2CY5 A;  3D4E A;  4CSQ A;  3C7U B;  3T06 A;  5C16 A;  3SNH A;  4KHO A;  2G2U B;  1M7R A;  1V5P A;  5J3T A;  1EAZ A;  4GZU A;  2DLW A;  3OHM B;  1WGQ A;  1K5D B;  2KIE A;  2R09 A;  3V5W A;  1X1F A;  3A8Q A;  1LB1 A;  1ZM0 A;  1N3H A;  2ROV A;  3ODW A;  1TXD A;  5HE0 A;  2D10 A;  2YT0 A;  2COD A;  2GCJ A;  2ELB A;  1RJ2 A;  4OSN A;  4OT1 A;  4HB4 B;  2RNR B;  4CHJ A;  4QJ3 B;  4HAT B;  4HAW B;  1XCG A;  2W2X D;  2UVM A;  5DHF B;  4D6W A;  4K81 A;  2K8E A;  1V89 A;  1LW3 A;  2D9V A;  3P6A A;  1FAO A;  1XX0 A;  2FJU B;  2IFS A;  1ZSQ A;  1DBH A;  1P5T A;  2P0H A;  1P3R A;  2DKP A;  3X23 A;  1MI1 A;  1NTY A;  2H7E A;  3SV1 A;  4PQ0 A;  2J0M A;  3DXC A;  2AEH A;  5EKQ E;  1UNQ A;  5HE3 A;  4A6K A;  3ULC A;  2RUK B;  2RVB B;  1WJM A;  1DDM A;  5J3Q A;  1UPR A;  4IOY X;  3U8Z A;  3MPX A;  3AU4 A;  4HB3 B;  3TFM A;  1W1D A;  1FHO A;  1XR0 B;  1ZVR A;  2I5C A;  2VSZ A;  1Z87 A;  4IFS A;  4Z2M B;  4ZRJ A;  3P7Z A;  4GPT B;  4YON A;  1ZYI A;  1ZC3 B;  4QJ4 B;  4K2P A;  1SHC A;  2DYQ A;  3MDB C;  3KY9 A;  3GYO A;  3GMU B;  1PFJ A;  4IAP A;  2W2X C;  4HB2 B;  2I5F A;  5D3Y A;  1NTV A;  1U2B A;  3ODO A;  2ELA A;  3NWD A;  2KM7 A;  5LG4 B;  2W2W A;  1EVH A;  4KHA A;  2LYD A;  2KR0 A;  3E2L C;  3PG7 A;  5AYW E;  4HAY B;  3UZT A;  3TVV A;  1KZ7 A;  5M4Y B;  2MWN B;  1OMW A;  5I2S A;  1KZG A;  3SYX A;  1FHW A;  2YT2 A;  1MIZ B;  4HDO A;  1MK9 B;  3TO1 A;  1BAK A;  2AL6 A;  2Z0O A;  2QKM A;  1H4R A;  1WGU A;  2M14 A;  3DXD A;  3BIN A;  4MT7 A;  2KUP A;  2CRF A;  1OQN A;  2DN6 A;  5FI0 A;  5I2M A;  3BJI A;  1EGX A;  5KCV A;  5FI1 A;  1J19 A;  4HDQ A;  3B77 A;  1TJ6 A;  3OAN A;  2KCJ A;  2CAY A;  2BCJ A;  3F5R A;  2Z59 A;  2DTC A;  3C4O B;  4TYZ A;  1WJ1 A;  1WVH A;  2Z13 A;  2Y7B A;  3PZD A;  2QKL A;  3WA0 A;  5DIF B;  3NWF A;  1ZC4 B;  5CLL B;  1U5G A;  2OQB A;  2PXG A;  4HAV B;  5JP4 A;  2J0K A;  2PZ1 A;  1W1G A;  4DM5 A;  1DDW A;  4A6F A;  1SGH A;  2CY4 A;  1X05 A;  3CIK A;  1E5W A;  3ML4 A;  2HE7 A;  4Y94 A;  2HTH B;  2D2Q A;  3U12 A;  1X1G A;  3M1I B;  3A98 B;  4DIX A;  3FVC A;  1BTN A;  1B55 A;  3D8F A;  2DFK A;  4GMV A;  2LOZ A;  3TW1 A;  3AJ4 A;  2YSZ A;  1Q67 A;  3RCP A;  2K00 A;  2NBV A;  2Z0Q A;  2GUM A;  2B5R C;  2YS3 A;  1MIX A;  5J3Y A;  2ROZ B;  3FEH A;  5L81 A;  2YT1 A;  3QBV B;  1MAI A;  5LOP B;  5JHG A;  2KIG A;  2Z0P A;  5EFX A;  1GC7 A;  1I2H A;  5KQ4 A;  1MK7 B;  5D3V A;  2DX1 A;  3GYP A;  2ADZ A;  1MKE A;  4KHB A;  1U27 A;  3QIJ A;  4P7I A;  4DX8 A;  5D3X A;  1NU2 A;  4A5K A;  1V88 A;  3C7V B;  5D0O E;  4EKU A;  1T77 A;  3E2K C;  3D8E A;  4BBK A;  4HAX B;  1NI2 A;  4HHV A;  1X11 A;  2JP2 A;  4F7H A;  2E2X A;  4L1R A;  4MK0 A;  2R0D A;  4GXB A;  1DYN A;  1XOD A;  5LON B;  1QQG A;  1PLS A;  2P8V A;  4EMO A;  1BTK A;  3PP2 A;  4A6H A;  1W1H A;  3HK0 A;  4K17 A;  2G35 A;  2Y8G A;  4GMX B;  1K5G B;  1UPQ A;  2MDX A;  3ZVR A;  1FB8 A;  1TQZ A;  1I7A A;  2K2U A;  4WSF A;  2Z4D A;  4HAU B;  4H8S A;  5D27 A;  2IYB A;  2YRY A;  2I1K A;  2DHK A;  3O96 A;  1MPH A;  1XKE A;  3HIE A;  5JLJ B;  3N4I B;  1U5F A;  4ZRI A;  2I1J A;  2J59 M;  1UNP A;  3D8D A;  3U7D A;  3ULB A;  3QWM A;  3PVW A;  2EC1 A;  1OY2 A;  2G2W B;  3DXE A;  4WJ7 A;  1Y19 B;  2P0F A;  3SO6 A;  1U5D A;  1V61 A;  2OTX A;  4DBB A;  2KXX A;  2P0D A;  1UEF A;  3KRX A;  4PNK A;  1UNR A;  1H10 A;  2D4Q A;  2DHJ A;  2RGN B;  3HSA A;  5HE2 A;  3HQC A;  4DX9 0;  3TCA A;  3LJU X;  2Z14 A;  5C79 A;  2YS1 A;  5DI9 B;  4NSW A;  1V5M A;  1FGZ A;  2GCL A;  1GC6 A;  1V5U A;  2LOX A;  4QXA B;  5D0Q E;  1RRP B;  2D9Z A;  2GS0 A;  2LKO A;  2D9X A;  2ZKM X;  2XQN M;  1S0W C;  4QJ5 B;  2R2Y A;  4HSI A;  5D3W A;  5C5B B;  5C6R A;  2YH9 A;  2EMS A;  4GNK B;  2N23 A;  1Y5O A;  1WI1 A;  2RSG A;  1AQC A;  3AU5 A;  3PEG A;  2DYN A;  1FGY A;  1XD4 A;  4TKN A;  2FJL A;  2EMT A;  1EF1 A;  2DKQ A;  4KVG B;  2YF0 A;  4GN1 A;  2Q13 A;  2MKR A;  1M7E A;  3PSC A;  4WVF B;  1JTG B;  1WG7 A;  1FHX A;  3DCX A;  3A8P A;  2COC A;  2RLO A;  5JHH A;  5HE1 A;  1FOE A;  2J0J A;  2RRF A;  2D11 A;  3IVF A;  4MY6 A;  1PMS A;  3ZDT A;  1DRO A;  4L6E A;  1DDV A;  2VRW B;  4KAX B;  5IRS A;  5DH9 B;  2DX5 A;  3NW8 A;  2L1C A;  4Z2N A;  3VOQ A;  1P6S A;  2D9W A;  1J0W A;  1QC6 A;  3KRW A;  4EJN A;  3NSU A;  3ODX A;  4A6F B;  5KQ1 A;  5GOW B;  2EJ8 A; 
#chains in the Genus database with same CATH homology
 2Z4D A;  2KUQ A;  3C4O B;  2FJU B;  2Z13 A;  3HIE A;  3N4I B;  3NWF A;  4PQ0 A;  5EKQ E;  2K49 A;  2PXG A;  2G2W B;  3FSS A;  4DM5 A;  2KXX A;  4IOY X;  1XXM C;  4IFS A;  4Z2M B;  4KHB B;  2Z14 A;  3U12 A;  4DIX A;  3C4P B;  1ZYI A;  3FVC A;  4QJ4 B;  2GCL A;  3TW1 A;  4QXA B;  3A58 A;  2NBV A;  5D0Q E;  2ZKM X;  2GUM A;  2B5R C;  3GYO A;  3GMU B;  1S0W C;  3NWA A;  4QJ5 B;  2R2Y A;  4HSI A;  2YH9 A;  4GNK B;  2KIG A;  3NWD A;  2KM7 A;  5LG4 B;  4KHA A;  3GYP A;  2KR0 A;  4KHB A;  3E2L C;  5AYW E;  4GOU A;  3D4E A;  4CSQ A;  3TVV A;  5M4Y B;  3C7U B;  5I2S A;  4KHO A;  2G2U B;  2YT2 A;  1JTG B;  3C7V B;  2RRF A;  3TO1 A;  5D0O E;  3OHM B;  3E2K C;  2KIE A;  5IRS A;  4L1R A;  3NW8 A;  2GCJ A;  4Z2N A;  4OSN A;  5I2M A;  4OT1 A;  4QJ3 B;  4D6W A;  2K8E A;  2Z59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...