5AYWE

Structure of a membrane complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
88
structure length
88
Chain Sequence
b'ERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein assembly factor BamA
publication title Structure of the BAM complex and its implications for biogenesis of outer-membrane proteins
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Membrane protein
total genus 9
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF04355 SmpA_OmlA SmpA / OmlA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 5aywE01
3D4EA 2PXGA 3N4IB 2G2UB 2G2WB 5EKQE 5AYWE 3C7UB 3C4OB 5D0QE 3GMUB 2KXXA 3C7VB 1S0WC 2KM7A 5D0OE 3E2KC 2B5RC 3C4PB 1XXMC 4DM5A 3E2LC 1JTGB 2YH9A
chains in the Genus database with same CATH superfamily
3D4EA 3NW8A 2PXGA 3NWAA 3N4IB 2G2UB 2GUMA 2G2WB 5EKQE 3NWFA 5AYWE 3FVCA 3C7UB 3C4OB 5D0QE 4L1RA 3GMUB 2KXXA 3C7VB 1S0WC 2KM7A 5D0OE 3E2KC 4HSIA 3NWDA 2B5RC 3C4PB 1XXMC 4DM5A 3E2LC 1JTGB 2YH9A
chains in the Genus database with same CATH topology
3D4EA 3NW8A 2PXGA 3NWAA 3N4IB 2G2UB 2GUMA 2G2WB 5EKQE 3NWFA 5AYWE 3FVCA 3C7UB 3C4OB 5D0QE 4L1RA 3GMUB 2KXXA 3C7VB 1S0WC 2KM7A 5D0OE 3E2KC 4HSIA 3NWDA 2B5RC 3C4PB 1XXMC 4DM5A 3E2LC 1JTGB 2YH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4E A;  2PXG A;  3N4I B;  2G2U B;  2G2W B;  5EKQ E;  5AYW E;  3C7U B;  3C4O B;  5D0Q E;  3GMU B;  2KXX A;  3C7V B;  1S0W C;  2KM7 A;  5D0O E;  3E2K C;  2B5R C;  3C4P B;  1XXM C;  4DM5 A;  3E2L C;  1JTG B;  2YH9 A; 
#chains in the Genus database with same CATH topology
 3D4E A;  3NW8 A;  2PXG A;  3NWA A;  3N4I B;  2G2U B;  2GUM A;  2G2W B;  5EKQ E;  3NWF A;  5AYW E;  3FVC A;  3C7U B;  3C4O B;  5D0Q E;  4L1R A;  3GMU B;  2KXX A;  3C7V B;  1S0W C;  2KM7 A;  5D0O E;  3E2K C;  4HSI A;  3NWD A;  2B5R C;  3C4P B;  1XXM C;  4DM5 A;  3E2L C;  1JTG B;  2YH9 A; 
#chains in the Genus database with same CATH homology
 3D4E A;  3NW8 A;  2PXG A;  3NWA A;  3N4I B;  2G2U B;  2GUM A;  2G2W B;  5EKQ E;  3NWF A;  5AYW E;  3FVC A;  3C7U B;  3C4O B;  5D0Q E;  4L1R A;  3GMU B;  2KXX A;  3C7V B;  1S0W C;  2KM7 A;  5D0O E;  3E2K C;  4HSI A;  3NWD A;  2B5R C;  3C4P B;  1XXM C;  4DM5 A;  3E2L C;  1JTG B;  2YH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...