The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
9
|
sequence length |
88
|
structure length |
88
|
Chain Sequence |
ERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Outer membrane protein assembly factor BamA
|
publication title |
Structure of the BAM complex and its implications for biogenesis of outer-membrane proteins
pubmed doi rcsb |
source organism |
Escherichia coli (strain k12)
|
molecule tags |
Membrane protein
|
total genus |
9
|
structure length |
88
|
sequence length |
88
|
ec nomenclature | |
pdb deposition date | 2015-09-14 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
E | PF04355 | SmpA_OmlA | SmpA / OmlA family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Beta-lactamase Inhibitory Protein; Chain:B, domain 1 | Beta-lactamase Inhibitory Protein; Chain:B, domain 1 |
#chains in the Genus database with same CATH superfamily 2YH9 A; 3E2K C; 3D4E A; 4DM5 A; 3C4O B; 3E2L C; 3C4P B; 5EKQ E; 3C7V B; 2B5R C; 5AYW E; 2G2U B; 5D0Q E; 2PXG A; 3N4I B; 2KM7 A; 1XXM C; 2G2W B; 3GMU B; 3C7U B; 2KXX A; 5D0O E; 1JTG B; 1S0W C; #chains in the Genus database with same CATH topology 2YH9 A; 3E2K C; 3D4E A; 4DM5 A; 3C4O B; 3E2L C; 3C4P B; 5EKQ E; 3C7V B; 3NWF A; 2B5R C; 4HSI A; 3NWA A; 5AYW E; 3NWD A; 2G2U B; 2GUM A; 5D0Q E; 2PXG A; 3N4I B; 2KM7 A; 3NW8 A; 1XXM C; 2G2W B; 4L1R A; 3GMU B; 3C7U B; 2KXX A; 3FVC A; 5D0O E; 1JTG B; 1S0W C; #chains in the Genus database with same CATH homology 2YH9 A; 3E2K C; 3D4E A; 4DM5 A; 3C4O B; 3E2L C; 3C4P B; 5EKQ E; 3C7V B; 3NWF A; 2B5R C; 4HSI A; 3NWA A; 5AYW E; 3NWD A; 2G2U B; 2GUM A; 5D0Q E; 2PXG A; 3N4I B; 2KM7 A; 3NW8 A; 1XXM C; 2G2W B; 4L1R A; 3GMU B; 3C7U B; 2KXX A; 3FVC A; 5D0O E; 1JTG B; 1S0W C;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...