3C4PB

Crystal structure of the shv-1 beta-lactamase/beta-lactamase inhibitor protein (blip) e73m complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
165
structure length
165
Chain Sequence
b'AGVMTGAKFTQIQFGMTRQQVLDIAGAENCETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQMKLLAPSAPTLTLAKFNQVTVGMTRAQVLATVGQGSCTTWSEYYPAYPSTAGVTLSLSCFDVDGYSSTGFYRGSAHLWFTDGVLQGKRQWDLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Computational redesign of the SHV-1 beta-lactamase/beta-lactamase inhibitor protein interface.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
total genus 46
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07467 BLIP Beta-lactamase inhibitor (BLIP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 3c4pB01
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 3c4pB02
2G2WB 2YH9A 5D0OE 3GMUB 3C7VB 1S0WC 5EKQE 5AYWE 1XXMC 3E2LC 5D0QE 4DM5A 2KXXA 3C4PB 1JTGB 3C7UB 3D4EA 3C4OB 2G2UB 2PXGA 2KM7A 3N4IB 3E2KC 2B5RC
chains in the Genus database with same CATH superfamily
2G2WB 2YH9A 5D0OE 3GMUB 3C7VB 3FVCA 1S0WC 5EKQE 5AYWE 1XXMC 3E2LC 5D0QE 4DM5A 2KXXA 3C4PB 1JTGB 3NWAA 3C7UB 3NWFA 3D4EA 4HSIA 3NWDA 3C4OB 3NW8A 4L1RA 2GUMA 2G2UB 2PXGA 2KM7A 3N4IB 3E2KC 2B5RC
chains in the Genus database with same CATH topology
2G2WB 2YH9A 5D0OE 3GMUB 3C7VB 3FVCA 1S0WC 5EKQE 5AYWE 1XXMC 3E2LC 5D0QE 4DM5A 2KXXA 3C4PB 1JTGB 3NWAA 3C7UB 3NWFA 3D4EA 4HSIA 3NWDA 3C4OB 3NW8A 4L1RA 2GUMA 2G2UB 2PXGA 2KM7A 3N4IB 3E2KC 2B5RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G2W B;  2YH9 A;  5D0O E;  3GMU B;  3C7V B;  1S0W C;  5EKQ E;  5AYW E;  1XXM C;  3E2L C;  5D0Q E;  4DM5 A;  2KXX A;  3C4P B;  1JTG B;  3C7U B;  3D4E A;  3C4O B;  2G2U B;  2PXG A;  2KM7 A;  3N4I B;  3E2K C;  2B5R C; 
#chains in the Genus database with same CATH topology
 2G2W B;  2YH9 A;  5D0O E;  3GMU B;  3C7V B;  3FVC A;  1S0W C;  5EKQ E;  5AYW E;  1XXM C;  3E2L C;  5D0Q E;  4DM5 A;  2KXX A;  3C4P B;  1JTG B;  3NWA A;  3C7U B;  3NWF A;  3D4E A;  4HSI A;  3NWD A;  3C4O B;  3NW8 A;  4L1R A;  2GUM A;  2G2U B;  2PXG A;  2KM7 A;  3N4I B;  3E2K C;  2B5R C; 
#chains in the Genus database with same CATH homology
 2G2W B;  2YH9 A;  5D0O E;  3GMU B;  3C7V B;  3FVC A;  1S0W C;  5EKQ E;  5AYW E;  1XXM C;  3E2L C;  5D0Q E;  4DM5 A;  2KXX A;  3C4P B;  1JTG B;  3NWA A;  3C7U B;  3NWF A;  3D4E A;  4HSI A;  3NWD A;  3C4O B;  3NW8 A;  4L1R A;  2GUM A;  2G2U B;  2PXG A;  2KM7 A;  3N4I B;  3E2K C;  2B5R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...