3C4OB

Crystal structure of the shv-1 beta-lactamase/beta-lactamase inhibitor protein (blip) e73m/s130k/s146m complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
165
structure length
165
Chain Sequence
b'AGVMTGAKFTQIQFGMTRQQVLDIAGAENCETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQMKLLAPSAPTLTLAKFNQVTVGMTRAQVLATVGQGSCTTWSEYYPAYPSTAGVTLSLKCFDVDGYSSTGFYRGMAHLWFTDGVLQGKRQWDLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Computational redesign of the SHV-1 beta-lactamase/beta-lactamase inhibitor protein interface.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07467 BLIP Beta-lactamase inhibitor (BLIP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 3c4oB01
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 3c4oB02
1XXMC 3E2KC 2B5RC 1S0WC 1JTGB 2G2UB 2YH9A 3C7VB 5AYWE 4DM5A 3D4EA 3C4OB 5EKQE 2G2WB 3E2LC 3C4PB 3C7UB 5D0OE 2KXXA 2KM7A 3N4IB 2PXGA 5D0QE 3GMUB
chains in the Genus database with same CATH superfamily
3NWDA 1XXMC 3E2KC 2B5RC 1S0WC 1JTGB 3NW8A 2G2UB 2YH9A 3C7VB 5AYWE 4L1RA 4DM5A 3D4EA 3C4OB 5EKQE 2G2WB 4HSIA 3E2LC 3C4PB 3C7UB 5D0OE 3FVCA 2KXXA 2GUMA 2KM7A 3NWAA 3N4IB 2PXGA 5D0QE 3GMUB 3NWFA
chains in the Genus database with same CATH topology
3NWDA 1XXMC 3E2KC 2B5RC 1S0WC 1JTGB 3NW8A 2G2UB 2YH9A 3C7VB 5AYWE 4L1RA 4DM5A 3D4EA 3C4OB 5EKQE 2G2WB 4HSIA 3E2LC 3C4PB 3C7UB 5D0OE 3FVCA 2KXXA 2GUMA 2KM7A 3NWAA 3N4IB 2PXGA 5D0QE 3GMUB 3NWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XXM C;  3E2K C;  2B5R C;  1S0W C;  1JTG B;  2G2U B;  2YH9 A;  3C7V B;  5AYW E;  4DM5 A;  3D4E A;  3C4O B;  5EKQ E;  2G2W B;  3E2L C;  3C4P B;  3C7U B;  5D0O E;  2KXX A;  2KM7 A;  3N4I B;  2PXG A;  5D0Q E;  3GMU B; 
#chains in the Genus database with same CATH topology
 3NWD A;  1XXM C;  3E2K C;  2B5R C;  1S0W C;  1JTG B;  3NW8 A;  2G2U B;  2YH9 A;  3C7V B;  5AYW E;  4L1R A;  4DM5 A;  3D4E A;  3C4O B;  5EKQ E;  2G2W B;  4HSI A;  3E2L C;  3C4P B;  3C7U B;  5D0O E;  3FVC A;  2KXX A;  2GUM A;  2KM7 A;  3NWA A;  3N4I B;  2PXG A;  5D0Q E;  3GMU B;  3NWF A; 
#chains in the Genus database with same CATH homology
 3NWD A;  1XXM C;  3E2K C;  2B5R C;  1S0W C;  1JTG B;  3NW8 A;  2G2U B;  2YH9 A;  3C7V B;  5AYW E;  4L1R A;  4DM5 A;  3D4E A;  3C4O B;  5EKQ E;  2G2W B;  4HSI A;  3E2L C;  3C4P B;  3C7U B;  5D0O E;  3FVC A;  2KXX A;  2GUM A;  2KM7 A;  3NWA A;  3N4I B;  2PXG A;  5D0Q E;  3GMU B;  3NWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...