The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
24
|
sequence length |
111
|
structure length |
111
|
Chain Sequence |
MSVETIIERIKARVGAVDPNGPRKVLGVFQLNIKTASGVEQWIVDLKQLKVDQGVFASPDVTVTVGLEDMLAISGKTLTVGDALKQGKIELSGDADLAAKLAEVIHHHHHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution Nuclear Magnetic Resonance Studies of Sterol Carrier Protein 2 Like 2 (SCP2L2) Reveal the Insecticide Specific Structural Characteristics of SCP2 Proteins in Aedes aegypti Mosquitoes
pubmed doi rcsb |
| molecule keywords |
Sterol carrier protein 2-like 2
|
| molecule tags |
Lipid transport
|
| source organism |
Aedes aegypti
|
| total genus |
24
|
| structure length |
111
|
| sequence length |
111
|
| ec nomenclature | |
| pdb deposition date | 2016-03-07 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02036 | SCP2 | SCP-2 sterol transfer family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Nonspecific Lipid-transfer Protein; Chain A | SCP2 sterol-binding domain |
#chains in the Genus database with same CATH superfamily 2CG3 A; 3BDQ A; 2KSH A; 2NBM A; 2YHE A; 3SXO A; 2OZG A; 5EBV A; 4MY3 A; 4AV7 A; 2NBN A; 3RYO A; 4QB9 A; 4JD6 A; 3BKS A; 2QZT A; 2CFU A; 5EC4 A; 4PDX A; 3BN8 A; 5IV0 A; 5AJL A; 3R1K A; 4AXH A; 2CX7 A; 2C0L B; 3BKR A; 4NUR A; 1WFR A; 1QND A; 2KSI A; 1IKT A; 4JGX A; 2CG2 A; 2HV2 A; 3N7Z A; 1PZ4 A; 3SXN A; 4UEI A; 2CFZ A; 4MY0 A; 3CNU A; 1C44 A; 3UY5 A; 5AIJ A; 2I00 A; 5A23 A; #chains in the Genus database with same CATH topology 2CG3 A; 3BDQ A; 3SSN A; 3SSO A; 2KSH A; 2NBM A; 2YHE A; 2NSF A; 3SXO A; 2OZG A; 5EBV A; 4MY3 A; 4AV7 A; 2NBN A; 3RYO A; 4QB9 A; 4JD6 A; 3BKS A; 4ZY7 A; 2QZT A; 2CFU A; 5EC4 A; 4PDX A; 3BN8 A; 5IV0 A; 5AJL A; 3R1K A; 4AXH A; 2CX7 A; 4NSS A; 2C0L B; 3BKR A; 4NUR A; 1WFR A; 1QND A; 2KSI A; 1IKT A; 4JGX A; 2CG2 A; 2HV2 A; 3N7Z A; 1PZ4 A; 3SSM A; 3SXN A; 4UEI A; 2NSG A; 2CFZ A; 4MY0 A; 3CNU A; 1C44 A; 3UY5 A; 5AIJ A; 2I00 A; 5A23 A; #chains in the Genus database with same CATH homology 2CG3 A; 3BDQ A; 2KSH A; 2NBM A; 2YHE A; 3SXO A; 2OZG A; 5EBV A; 4MY3 A; 4AV7 A; 2NBN A; 3RYO A; 4QB9 A; 4JD6 A; 3BKS A; 2QZT A; 2CFU A; 5EC4 A; 4PDX A; 3BN8 A; 5IV0 A; 5AJL A; 3R1K A; 4AXH A; 2CX7 A; 2C0L B; 3BKR A; 4NUR A; 1WFR A; 1QND A; 2KSI A; 1IKT A; 4JGX A; 2CG2 A; 2HV2 A; 3N7Z A; 1PZ4 A; 3SXN A; 4UEI A; 2CFZ A; 4MY0 A; 3CNU A; 1C44 A; 3UY5 A; 5AIJ A; 2I00 A; 5A23 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...