The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
62
|
sequence length |
186
|
structure length |
186
|
Chain Sequence |
MQDILDFYEEVEKTINPPNYFEWNTYRVFKKLGSYKNLVPNFKLDDSGHPIGNAIPGVEDILVEYEHFSILIECSLTIGEKQLDYEGDSVVRHLQEYKKKGIEAYTLFLGKSIDLSFARHIGFNKESEPVIPLTVDQFKKLVTQLKGDGEHFNPNKLKEILIKLLRSDLGYDQAEEWLTFIEYNLK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural analysis of the heterodimeric type IIS restriction endonuclease R.BspD6I acting as a complex between a monomeric site-specific nickase and a catalytic subunit.
pubmed doi rcsb |
| molecule keywords |
Heterodimeric restriction endonuclease R.BspD6I small subuni
|
| molecule tags |
Hydrolase
|
| source organism |
Bacillus sp.
|
| total genus |
62
|
| structure length |
186
|
| sequence length |
186
|
| ec nomenclature |
ec
3.1.21.4: Type II site-specific deoxyribonuclease. |
| pdb deposition date | 2007-03-02 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF09491 | RE_AlwI | AlwI restriction endonuclease |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Restriction Endonuclease | Restriction Endonuclease |
#chains in the Genus database with same CATH superfamily 2EWF A; 2P14 A; #chains in the Genus database with same CATH topology 3MQY A; 3DPG A; 3V1Z A; 5CZN A; 2PFJ A; 4E5L A; 5D9J A; 3HW3 A; 2FQZ A; 2FOK A; 2XI5 A; 2EWF A; 5D42 A; 4E5F A; 5CCY A; 1VRR A; 3WVI A; 1FZR A; 3EBJ A; 3WVG A; 5DES A; 5JHV A; 4F0P A; 4E5G A; 3DW9 A; 4ZQQ A; 5JHT A; 5DEB A; 3V20 A; 5CL0 A; 4AWG A; 1BAM A; 4AWM A; 4E5I A; 1M0I A; 3V21 A; 3HW4 A; 5DBS A; 1KNV A; 3HW6 A; 4AWK A; 3WVH A; 4R28 A; 4E5E A; 2P14 A; 4E5H A; 3DVO A; 3MQ6 A; 3WVP A; 1M0D A; 5FDD A; 5D2O A; 3BM3 A; 1DC1 A; 3N78 A; 3A4K A; 5I13 A; 4E5J A; 4AWH A; 1ESG A; 1D2I A; 2BAM A; 4NFZ A; 3HW5 A; 1CFR A; 1SDO A; 4AVQ A; 5FDG A; 4ZHZ A; 5CGV A; 4YYL A; 3CAE A; 4CHC A; 5D8U A; 2E52 A; 3N7B A; 4ZI0 A; 1FOK A; 1ES8 A; 1DFM A; 4AVL A; 3ODH A; 1BHM A; 5D4G A; 4AVG A; 2P0J A; 4F0Q A; 5EGA A; 4AWF A; 3WVK A; 3BAM A; 4OC8 A; 2GB7 A; 4CGS A; 2XI7 A; 4CGX A; #chains in the Genus database with same CATH homology 3MQY A; 3DPG A; 3V1Z A; 5CZN A; 2PFJ A; 4E5L A; 5D9J A; 3HW3 A; 2FQZ A; 2FOK A; 2XI5 A; 2EWF A; 5D42 A; 4E5F A; 5CCY A; 1VRR A; 3WVI A; 1FZR A; 3EBJ A; 3WVG A; 5DES A; 5JHV A; 4F0P A; 4E5G A; 3DW9 A; 4ZQQ A; 5JHT A; 5DEB A; 3V20 A; 5CL0 A; 4AWG A; 1BAM A; 4AWM A; 4E5I A; 1M0I A; 3V21 A; 3HW4 A; 5DBS A; 1KNV A; 3HW6 A; 4AWK A; 3WVH A; 4R28 A; 4E5E A; 2P14 A; 4E5H A; 3DVO A; 3MQ6 A; 3WVP A; 1M0D A; 5FDD A; 5D2O A; 3BM3 A; 1DC1 A; 3N78 A; 3A4K A; 5I13 A; 4E5J A; 4AWH A; 1ESG A; 1D2I A; 2BAM A; 4NFZ A; 3HW5 A; 1CFR A; 1SDO A; 4AVQ A; 5FDG A; 4ZHZ A; 5CGV A; 4YYL A; 3CAE A; 4CHC A; 5D8U A; 2E52 A; 3N7B A; 4ZI0 A; 1FOK A; 1ES8 A; 1DFM A; 4AVL A; 3ODH A; 1BHM A; 5D4G A; 4AVG A; 2P0J A; 4F0Q A; 5EGA A; 4AWF A; 3WVK A; 3BAM A; 4OC8 A; 2GB7 A; 4CGS A; 2XI7 A; 4CGX A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...