The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
34
|
sequence length |
114
|
structure length |
114
|
Chain Sequence |
MRTLLIRYILWRNDNDQTYYNDDFKKLMLLDELVDDGDVSTLIKNMRMTLSDGPLLDRLNQPVNNIEDAKRMIAISAKVARDIGERSEIRWEESFTILFRMIETYFDDLMIDLY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Functional and Structural Studies of the Vaccinia Virus Virulence Factor N1 Reveal a Bcl-2-Like Anti- Apoptotic Protein
pubmed doi rcsb |
molecule tags |
Viral protein
|
source organism |
Vaccinia virus
|
molecule keywords |
HYPOTHETICAL PROTEIN
|
total genus |
34
|
structure length |
114
|
sequence length |
114
|
chains with identical sequence |
B, C, D, E, F
|
ec nomenclature | |
pdb deposition date | 2007-03-28 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF06227 | Poxvirus | dsDNA Poxvirus |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Apoptosis Regulator Bcl-x | Apoptosis Regulator Bcl-x |
#chains in the Genus database with same CATH superfamily 2UXE A; 2VVW A; 4BBD A; 4BBB A; 4LQK A; 3JRV A; 4M0S A; 4BBC A; 2VVX A; 2I39 A; 2K36 A; 2VVY A; #chains in the Genus database with same CATH topology 3KZ0 A; 4QVX A; 4K5B C; 2O2N A; 3IIH A; 4ZIF A; 3IO9 A; 2JM6 B; 4WMR A; 2UXE A; 1AF3 A; 2ABO A; 4YK9 A; 4G35 A; 1TY4 A; 5FMI A; 1G5M A; 1F16 A; 4B4S A; 3D7V A; 2KUA A; 1GJH A; 1YSG A; 3JRV A; 2B48 A; 4MI8 A; 1R2I A; 5FDO A; 1OHU A; 2JBX A; 2ROC A; 3KJ2 A; 1YSN A; 4ZBI A; 4ZIE A; 1R2G A; 2BID A; 4BD6 A; 1BXL A; 2ME8 A; 5C3F A; 4ZII A; 3IIG A; 2XPX A; 3MQP A; 3KJ1 A; 1PQ1 A; 2IMT A; 2O42 A; 4BD2 A; 4BBB A; 4BDU A; 2O2M A; 2YV6 A; 2VTY A; 4U2V A; 1R2D A; 3ILC A; 4ZEQ A; 1R2H A; 4BPJ A; 2KBW A; 2A5Y A; 2O2F A; 1G5J A; 2MHS A; 4BBD A; 2O21 A; 1K3K A; 2K7W A; 3PK1 A; 4QNQ A; 2VOI A; 2I39 A; 5JSB A; 5C6H A; 1YSW A; 2PQK A; 1PQ0 A; 2NLA A; 3QBR A; 4D2L A; 4ZBF A; 2XA0 A; 2K36 A; 5FDR A; 4UF2 A; 3IHE A; 5FC4 A; 3DVU A; 2M5B A; 2O22 A; 1Q59 A; 2VOF A; 1DDB A; 3MK8 A; 2NL9 A; 4ZIH A; 2VOG A; 2V6Q A; 1ZY3 A; 4OQ6 A; 4BD7 A; 2LR1 A; 2MEJ A; 3CVA X; 3WIY A; 1LXL A; 2ROD A; 4OQ5 A; 4S0P A; 4UF3 A; 4ZIG A; 4BPI A; 1O0L A; 2VVY A; 3IHC A; 3BL2 A; 3I1H A; 4OYD A; 4HW3 A; 1MAZ A; 3WIX A; 1R2E A; 2VOH A; 1YSI A; 5IF4 A; 4UF1 A; 5KU9 A; 4D2M A; 2IMS A; 2WH6 A; 4YJ4 A; 2JBY A; 3IHD A; 3KJ0 A; 4M0S A; 4U2U A; 4BBC A; 1WSX A; 4HW2 A; 5KTG A; 2JCN A; 5IEZ A; 2BZW A; 2W3L A; 1MK3 A; 2VM6 A; 2VVW A; 4LQK A; 2VVX A; 4HW4 A; 4S0O A; 4BD8 A; #chains in the Genus database with same CATH homology 2O42 A; 4UF3 A; 4BBB A; 2VVY A; 4D2L A; 2VTY A; 2UXE A; 2K36 A; 4UF2 A; 4UF1 A; 4D2M A; 4BBD A; 2JBY A; 3JRV A; 4M0S A; 4BBC A; 2JBX A; 2VVW A; 4LQK A; 2I39 A; 2VVX A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...