The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
44
|
sequence length |
114
|
structure length |
114
|
Chain Sequence |
MRTLLIRYILWRNDNDQTYYNDDFKKLMLLDELVDDGDVSTLIKNMRMTLSDGPLLDYLNQPVNNIEDAKRMIAISAKVARDIGERSEIRWEESFTILFRMIETYFDDLMIDLY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Inhibition of Apoptosis and NF-kappaB Activation by Vaccinia Protein N1 Occur Via Distinct Binding Surfaces and Make Different Contributions to Virulence.
pubmed doi rcsb |
| molecule keywords |
N1L
|
| molecule tags |
Viral protein
|
| source organism |
Vaccinia virus
|
| total genus |
44
|
| structure length |
114
|
| sequence length |
114
|
| chains with identical sequence |
B, C, D, E, F
|
| ec nomenclature | |
| pdb deposition date | 2012-09-21 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF06227 | Poxvirus | dsDNA Poxvirus |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Apoptosis Regulator Bcl-x | Apoptosis Regulator Bcl-x |
#chains in the Genus database with same CATH superfamily 2VVX A; 4LQK A; 4BBC A; 2VVY A; 3JRV A; 2I39 A; 4M0S A; 2UXE A; 2VVW A; 4BBB A; 4BBD A; 2K36 A; #chains in the Genus database with same CATH topology 4ZBF A; 3WIX A; 1Q59 A; 2K36 A; 4MI8 A; 3IHD A; 1GJH A; 1PQ0 A; 4UF3 A; 4BBC A; 1PQ1 A; 1WSX A; 3QBR A; 4G35 A; 2JBY A; 4BDU A; 1R2I A; 4ZIH A; 1G5J A; 2VOI A; 1BXL A; 5FMI A; 4U2V A; 2K7W A; 2O22 A; 4D2L A; 2B48 A; 2JBX A; 2ROC A; 1MAZ A; 2UXE A; 1OHU A; 4BBD A; 4ZII A; 2W3L A; 3IHE A; 4YJ4 A; 3CVA X; 4ZIE A; 2MHS A; 2O42 A; 5FDR A; 3WIY A; 4M0S A; 5C3F A; 2O2N A; 5JSB A; 4UF2 A; 1O0L A; 5KTG A; 2KUA A; 2KBW A; 2NL9 A; 4BPJ A; 2O2M A; 2VTY A; 1R2G A; 1YSW A; 1TY4 A; 4HW3 A; 2VOF A; 3DVU A; 2A5Y A; 3IIG A; 4UF1 A; 1R2H A; 1R2D A; 2V6Q A; 2MEJ A; 4BD2 A; 4ZIF A; 2ME8 A; 2VVX A; 3IO9 A; 1F16 A; 1YSI A; 2O21 A; 4B4S A; 1MK3 A; 4OYD A; 4S0P A; 2VVY A; 3KJ0 A; 2JM6 B; 2VM6 A; 3D7V A; 2M5B A; 3IHC A; 4ZIG A; 2VVW A; 3PK1 A; 4QVX A; 1G5M A; 5KU9 A; 5FC4 A; 5FDO A; 2ABO A; 2I39 A; 2O2F A; 4BD7 A; 3KJ1 A; 2XA0 A; 4U2U A; 3ILC A; 2IMS A; 5C6H A; 2BZW A; 1LXL A; 4QNQ A; 1AF3 A; 2VOH A; 4BD6 A; 4ZEQ A; 4BBB A; 2YV6 A; 2XPX A; 4ZBI A; 4D2M A; 3BL2 A; 4HW2 A; 3KJ2 A; 4YK9 A; 2ROD A; 4K5B C; 1ZY3 A; 4HW4 A; 4OQ5 A; 1K3K A; 4OQ6 A; 5IEZ A; 3MK8 A; 3I1H A; 3KZ0 A; 5IF4 A; 3JRV A; 4BD8 A; 1YSN A; 4S0O A; 2WH6 A; 1R2E A; 3IIH A; 1DDB A; 2IMT A; 2JCN A; 4BPI A; 4LQK A; 4WMR A; 2VOG A; 1YSG A; 2PQK A; 2NLA A; 3MQP A; 2BID A; 2LR1 A; #chains in the Genus database with same CATH homology 4D2M A; 2O42 A; 2VVY A; 4M0S A; 4UF2 A; 2K36 A; 4UF3 A; 4BBC A; 3JRV A; 2VVW A; 2JBY A; 2VTY A; 2I39 A; 4D2L A; 2JBX A; 4LQK A; 4UF1 A; 2UXE A; 4BBB A; 4BBD A; 2VVX A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...