The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
99
|
sequence length |
251
|
structure length |
251
|
Chain Sequence |
ATAPLDLVGPVSDYKIYVTENIEELVSHTQKFTDAVKKGDIATAKKLYAPTRVYYESVEPIAELFSDLDASIDSRVDDHEQGVAAEDFTGFHRLEYALFSQNTTKDQGPIADKLLSDVKDLEKRVADLTFPPEKVVGGAAALLEEVAATKISGEEDRYSHTDLYDFQGNIDGAKKIVDLFRPQIEQQDKAFSSKVDKNFATVDKILAKYKTKDGGFETYDKVKENDRKALVGPVNTLAEDLSTLRGKLGLN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural and Functional Role of the Imelysin- Like Protein Efem from Pseudomonas Syringae Pv. Syringae and Implications in Bacterial Iron Transport
rcsb |
| molecule keywords |
EFEM M75 PEPTIDASE
|
| molecule tags |
Hydrolase
|
| source organism |
Pseudomonas syringae pv. syringae
|
| total genus |
99
|
| structure length |
251
|
| sequence length |
251
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2013-03-28 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF09375 | Peptidase_M75 | Imelysin |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | A middle domain of Talin 1 | A middle domain of Talin 1 |
#chains in the Genus database with same CATH superfamily 3PF0 A; 3WSC A; 4ECG A; 4BGO A; 3AT7 A; #chains in the Genus database with same CATH topology 3FYQ A; 3PF0 A; 2L7N A; 5HXC A; 3V5S A; 5JDL A; 5FZT A; 2XQY A; 1SJ8 A; 3DYJ A; 2LQU A; 1SJ7 A; 3PHF 1; 5JDQ A; 3WSC A; 4ECG A; 5HWX A; 2L10 A; 5JDF A; 5JDH A; 5JDN A; 3AY5 A; 2X0C A; 3M1C A; 3V5U A; 4BGO A; 5HXS A; 5T1D A; 4W8P A; 3AT7 A; 5HXR A; 5JDM A; 5HXE A; 2KGX A; 2KBB A; 5HYA A; 4ONR A; 4F7G B; 2MTC A; 3WUR A; 5HXH A; 2KVP A; 5JDG A; 5HWY A; 3VJZ A; #chains in the Genus database with same CATH homology 3PF0 A; 5HXC A; 3V5S A; 5JDL A; 2XQY A; 2LQU A; 3PHF 1; 5JDQ A; 3WSC A; 4ECG A; 5HWX A; 5JDF A; 5JDH A; 5JDN A; 3M1C A; 3V5U A; 4BGO A; 5HXS A; 5T1D A; 3AT7 A; 5HXR A; 5JDM A; 5HXE A; 5HYA A; 4ONR A; 2MTC A; 3WUR A; 5HXH A; 5JDG A; 5HWY A; 3VJZ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...