5HYAA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchangerncx_mj soaked with 150 mm na+ and nominal ca2+
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
Knots found
sequence length
304
structure length
297
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRMGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 132
structure length 297
sequence length 304
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hyaA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hyaA02
5HXEA 5HYAA 5HXHA 5JDHA 5JDNA 5HXCA 5JDQA 3V5SA 5HXSA 5HWYA 5HWXA 5JDGA 5HXRA 5JDLA 5JDMA 5JDFA 3V5UA
chains in the Genus database with same CATH superfamily
4YTMA 5JTGA 5F5WA 1QUUA 2VB6A 4HWCA 3ONXA 5L3CB 2XQ7A 3N5LA 4U74A 1YKEB 3M1CA 3IBPA 3V5UA 2W00A 3T8OA 3BK9A 1KK7A 3FXDB 5J2UE 4DR2T 5CFBA 2NOXA 3GN5A 3PUAA 2BZBA 3CPZA 4QXCB 1UGOA 3UTKA 2G0UA 2V1DB 3ZSSA 1FEWA 5J2TE 4IE6A 3SFEA 2C5IT 3AY5A 2B76A 2XQAA 4CXXA 1KNZA 2CWOA 2J47A 4PK4A 5AQTB 1XDOA 3Q5EA 5JQGE 4PJNA 3X1DA 3NRYA 1E7PA 3AEAA 4UF0A 2ZM2A 1QLBA 1XNQT 2UXCT 3B13A 2CLYB 2ODUA 1JNRA 1S94A 2ZM8A 2FUPA 1M62A 3R84B 3SWHA 4QH1A 3RYIE 4JI6T 2XTLA 5TAOA 4CXYA 5CB4E 4HFDA 4AKGA 4DUZT 3O9XA 2XQ6A 1HNXT 3OJAA 2E8IA 1HCIA 1NEKA 4GIWA 2JQ9A 4BJMA 3ZYLA 4U2ZA 2WU2A 3I9WA 1ZOYA 4HN9A 1W09A 4U7IA 1IZNB 4K0KT 2WZHA 3LDQB 2AE9A 4AQFC 4YHHT 4IDNA 1MIWA 3FZLB 5T1DA 3KVAA 1IJ5A 3N9PA 3EHZA 4JBWF 3RKGA 2LJLA 3WURA 3C50A 5AQOB 1Y64B 4NIQA 4U7YA 3ZCJA 3QNUA 3N9LA 4YT0A 1FMWA 4DIDB 4ZI7E 2CHNA 2BG9A 2IDOB 2N2NA 3G06A 2LRLA 3P8CD 2X51A 2BVMA 1YKHB 4DNDA 4DR5T 5L3DB 4YSYA 3V5SA 2XHEB 5JDMA 5HXEA 5EZYE 2LHRA 5J1GA 3KDSE 4NUVA 3AEEA 5FVKA 2HPJA 5KXJA 1KF6A 1B7TA 2YKSA 2XASB 1M7KA 2CA5A 1D1CA 4GOUA 3AE8A 2XAQB 5HEJA 3FZKB 4B3TT 1UK5A 2D2SA 5AQIB 4XBFB 3UT5E 3MK7C 5JR9A 3ANWA 2X0CA 3FZHB 4YHJA 2X67A 4TWDA 5F8PA 4CI2B 2UXDT 1WCRA 2NW9A 1XMQT 3RIUC 4HWFA 2CE7A 2KLQA 5H6RB 4MFRA 1SJ8A 4EV6A 5HXRA 2JRKA 2XZEA 5AQHB 1MMNA 2FJAA 4PK5A 4QXHB 2L9QA 5AQMB 3S4UA 5ETWA 1HTJF 5A1LA 2XQ9A 2LQUA 1VRBA 5LOVE 2WDRA 4ZHQE 1WRDA 1H7CA 4U33A 3AB3B 5L47A 4YTPA 4EYYR 2VVSA 5J0ZA 3PU8A 4ZI3D 4I55E 3AE6A 5CA0E 1UUSA 2OV9A 4C91A 2IHR1 3ONJA 3EDVA 1WYBA 1YXRA 2WB5A 1FIOA 2NP9A 4WYVA 2V8SV 2YOEA 4KX6A 5LA6E 1UCUA 3CVRA 5FXVA 2WBLA 3R6NA 2BS2A 2XPKA 3Q5DA 2IC6A 5LB7B 2QYWA 2Y6XA 5DABA 2K3WA 3CX8B 4NPPA 3SFDA 2Y8DA 2BVLA 1D0YA 1HG5A 3L39A 3LK2B 2EHOD 2VL0A 5C8YE 4ONRA 2CBJA 2XQ5A 4ZS3A 5JRCB 3AXJA 2QRXA 3UUMA 3N9MA 1D1BA 3ONLC 2IMLA 2VKJA 2YN6A 2VKDA 2LKHA 2DI4A 3AE4A 4Z91A 4OHFA 4ADZA 3PV0F 2V7KA 4G63A 2W0GA 3GWHA 2X9HA 3PJAA 3ZMTB 3AAEB 1IAPA 5CGMA 5LYJE 2UU9T 2H3RA 1VCTA 5L3GB 2PBIA 2LRKA 4O2AE 3IHRA 2E9XC 5ABGA 4H9QC 4COFA 2KSRA 2DL1A 3I0OA 3VKGA 3I1AA 2D0TA 1J5ET 4ZXLA 5LBQB 4HFCA 2H7VC 2K9AA 4HKAA 3RPUA 5JDGA 1D0XA 4L0RA 2LM9A 5DQVA 2CEAA 2WWUA 3O4XE 2V7JA 2MTQA 2XM1A 2K5BB 2LOSA 1IJ6A 2LEHA 3JAFA 3GA8A 3AAIA 5KMGP 1IBKT 4O8SA 2X66A 3QOFA 4AQYT 3AEFA 3P4SA 2W61A 3JC6D 2ACXA 2M67A 3K8PC 4QHOA 3N2GE 3RX6A 3ZT6A 3ZYKA 3IF8B 4ISTA 5HEOA 3PU3A 4M1PA 4DV7T 5M4YA 3HL6A 4HGAA 4QXBB 4LF8T 4IE7A 3O1JA 4ASKA 2NTYA 5AQKB 2JQQA 3P4WA 2CXDA 1XNRT 4X5TA 3RI5A 2Z6EA 3C4WA 5HXHA 2HPLA 4MHCA 2MTCA 3LG7A 2DNXA 2WDVA 4O4JE 3UULA 3AAAB 1Y01A 4I50E 3EVYA 5AQFB 1OEDA 3UFGA 1MMDA 5JVDE 2BS3A 4TV9E 4IE5A 5AFUL 5FXZA 1HNWT 1HX8A 3A8YC 1ZEEA 4IDOA 2X0YA 3AA1B 3FXEB 3P4PA 4DR3T 4B3MT 1MNEA 5FP3A 3RYFE 4QX7B 3KBUA 3RQWA 3P4QA 4I4TE 3KFWX 2JMHA 4U72A 1OWAA 2UUCT 2YDRA 4ILCA 2XSAA 4DV5T 1XZYA 5LMNT 4B6XA 2UUBT 3ZN0B 3OYXA 4GKKT 3N9QA 4BJNA 4X1KE 3ZJ1A 4LMLA 5LJMA 1CUNA 4NXNT 2X68A 3DP7A 3L09A 5FY7A 2Q9QC 4MALA 3C4XA 2MYSA 2V6XA 5C3JA 3F57A 3RQUA 1O3XA 5DJQC 4J2CA 4ZI2D 2FJEA 2H7OA 3VHLA 3NVOA 4H63H 3CQGB 3HA4A 4PK6A 3H37A 3PUQA 1SJ7A 1MMGA 2LSYA 3CK6A 2VK9A 3EI0A 2L8KA 4HFEA 3WAKA 3ZJ2A 5FY1A 4EIWA 3P50A 2DWGA 3TLTA 2A3DA 4UR9A 5AQGB 5EK3A 2LT3A 2CXFA 3ETVA 4DVDA 4F8HA 4NUUA 2WU5A 3PUGA 4JI1T 3OKQA 5LHHB 2VURA 3EABA 4JI4T 3RRWA 1E1HB 2Y48B 1D1AA 3H3MA 4YY3T 2LSGA 3ABVA 1DU2A 4JEUB 2LM2A 4WW0A 1G8XA 4JUYA 1SE7A 2JMKA 3TLWA 3UU3A 2WCAA 5JDNA 3PHF1 3VU7H 4AISA 3PUVF 2E9XB 4LF7T 3NBXX 2WS3A 4LMJA 4HFHA 2XQ8A 2EHOA 1R8IA 4YJ2E 2IAKA 2KINB 4DBQA 2ACZA 3HR0A 3M65A 5AQLB 4N78D 2L10A 3K3NA 4HWIB 2V6YB 4AQGA 1ZP0A 4TNWA 4QWNB 3EAMA 1W0AA 4FJOA 2XUEA 2LLYA 3L3PA 3EDUA 3E0ZA 4CXWA 2E5LT 3ZMVB 4LFCT 5LGUB 3PJAJ 2PJQA 4DR6T 1ZV4X 4X64T 4JEHB 2NR4A 1WYCA 5HAXA 3LBXA 2YDSA 3N2KE 2JIWA 2NWBA 4EAHA 3I0QA 4DV1T 3K3QC 4ILAA 3MJXA 1MIYA 4U2YA 1N33T 4B3ST 4P1NA 3J7Yq 1LVFA 3K1SA 3AEGA 2DHRA 3ZC1A 4AXPA 2A72A 3VRAA 4UF0B 3Q9DA 3AA0B 3JCFA 3PF0A 2ZM6T 3KINB 1S35A 5AQSB 3QB5K 1UX5A 5AQPB 2E5VA 2QVAA 5LNKA 5C2TA 3HKEE 4HWDA 3U78A 4L5GA 4PNIA 2F4VT 5HYAA 1BR0A 1GQEA 4TZ4C 1WR0A 2XSBA 4DMWA 3HI2A 4AQFA 5IWAT 2BKPA 5LG3A 2LE8A 3AEBA 2M6IA 2YDQA 4IREA 3IA3A 3F31A 5E0OA 2XQ3A 5ABHA 4PJMA 2QGSA 4JI0T 3BQKA 1X9BA 2RA1A 2LKGA 3A5XA 2CRBA 5HXSA 2K24A 2K48A 2KVPA 2JJ9A 4YJ3E 4KHZF 1NAFA 4TN7B 1OEDE 4EGWA 1G73A 2Q9QB 3TKLB 4CI1B 2VKHA 3QK6A 2BG9B 2X9XA 4WZXA 3RYHE 1N34T 5FL1A 2JPFA 3N2OA 4PW8A 3CMLA 2WDQA 4Z90A 1U4QA 4H9RC 2HN2A 2WP9A 2W67A 4JI2T 1L0VA 3KV9A 3L8RA 3CWZB 2J1DG 4G2AA 1N32T 5JDHA 4ZZCA 2E2AA 2YEVC 3O1HA 4CN4A 3DYJA 4LFBT 4WBOA 3LSVA 2I6HA 1XDPA 4ZOLE 5IUXA 5DQWA 3ZEFB 3CQCB 4IT4A 4KBMB 5AQUB 2VQET 4BGOA 3FHNA 1HG2A 5HCMA 2WSSV 1J1JA 2X0LB 3ANWB 4JYAT 4X1YE 3QB5A 4ILBA 4UVAB 3TLVA 4DUYT 5HXCA 3ZT7A 2V7LA 4LF9T 1T98A 4LF5T 1OEDC 3DJBA 4PJJA 1ZKEA 4ANJA 1IBMT 3UQ4A 2KNDA 3JADA 1HNZT 4O4HE 3PUYF 4DV6T 4WNKA 4Z8XA 4BAYB 3PUSA 1D0ZA 2PG8A 2FBWA 4AKHA 1YD8G 2XM2A 1KNPA 3AA7B 3TLSA 2H88A 2J4GA 4NXMT 3AECA 2A2FX 4CN6A 3MA9A 3Q5XA 5L3FB 5LBMA 3C4ZA 4AKRB 4DMVA 2MOZA 4DR7T 4UVCB 1KEYA 4KMCA 1HFAA 3BQLA 4B3RT 3B57A 3LFMA 2HHHT 2ES0A 3JAEA 2WAUA 4OFZA 2C0SA 4H9PC 2MPKA 2ZLYA 1Z0PA 4IE4A 2H89A 5AQVB 4XZCA 2GK9A 2XY8B 2UXBT 1IBLT 4A97A 1HF8A 2X0HA 2YK0A 3VR8A 2IUBA 2BKNA 1LRZA 5CA1E 1HR0T 2X9WA 2BG9E 4X20E 2YINA 4LFAT 4BA9A 2CCQA 3AVSA 3MZKB 1I94T 4DV0T 1WR6A 3AXJB 4QH4A 3NWIA 4PFOA 2V7IA 2XAGB 5HEHA 2PTFA 2XAJB 1YW0A 4ZI3C 3CIRA 3MXZA 2W62A 5FY0A 4AIUA 1T7SA 3OVUA 4DV3T 3AEDA 2D5UA 3KVBA 5GONE 4P09A 3K3OA 2E9XA 5HWXA 2M6BA 2VASA 3UUNA 3KV5A 2CM0A 2VL8A 3M3ZB 5FZTA 4H9SE 4F6RC 3LJCA 1E2AA 3RKOA 2D9DA 2V6YA 2WQYA 3UU8A 3SRZA 5ADXL 2QA7A 3GMIA 2FJDA 3ZT5A 3DTOA 3WI3A 1N36T 4UIGA 5FXXA 3HKDE 4JI7T 5AQJB 2CPTA 1T72A 2MBGA 2EHOC 5HEGA 5KDMC 4QX8B 4JLEA 2KT9A 2WM9A 4ZEYA 1MMAA 1KFYA 2OLTA 3AE2A 4GK5E 4DO0A 2VQFT 1I6ZA 4EZHA 2BG9C 4X62T 3T1HT 3PUWF 2BKOA 2IC9A 4IDZA 2DCFA 2C5KT 2R6GF 5EK2A 4IE0A 2V5CA 1T8BA 3FBLA 3N9OA 3P4RA 2IW5B 2UXXB 1QSDA 3SS1A 2MAWA 4YXDA 1SHZC 2JQKA 4KI0F 3U3IA 1HS7A 3ETUA 5JDQA 1KNRA 3SOLA 5L3BB 2N9DA 3MKDA 4XAXB 5L3EB 4KP3C 2A9UA 2UXNB 5FMNA 3C64A 5L4HA 1BR1A 3RLFF 2CXLA 3AT7A 3ESLA 5JR9C 3ZMUB 1JNZA 4CI3B 3OTOT 4O4LE 1UX4A 2KGXA 2N1GA 4UV9B 5F3JA 3RC3A 4O2BE 2BS4A 4LMKA 1LKXA 5LHGB 2OA5A 5ABFB 4KHPT 4C90A 2D0UA 4GYSA 4HE8A 3CKDA 2BBHA 4ISSA 4HTEA 5FXWA 3RIAA 1OEDB 5LXTE 3CX7B 5LHIB 2FJBA 3ZSTA 1US7B 2V26A 4EYUA 3RGLA 3W15B 2KXPB 2XJ7A 4OX9T 5HEUA 2HH7A 3B5MA 4TX5A 3AE9A 4A98A 3VRBA 3FBZA 4ECGA 4UV8B 3C98B 3JC6C 3UU4A 2LOPA 3ZCIA 4TWFA 2NW8A 4X1IE 2JQHA 4CZZB 4EOZB 2VKOA 1J5WA 3Q5WA 3VR9A 2Q9QA 4AKLA 3F2EA 3GN5B 2E9XD 5FL0A 4KUMB 3RC8A 2W4XA 4TUYE 5H6QB 3CQXC 2HN1A 5BMVE 4IDQA 4L9IA 2C5JA 2IIUA 3WAJA 2DLRA 4HFVA 2J62A 5HCJA 5LP6E 4ZZBA 5JRCA 5LGNB 1Z8UA 3ZYMA 4PJLA 5FVLA 4UXNB 3Q2MA 3AVRA 3KV6A 3EUHA 2W66A 4E7ZA 4P0BA 4GKJT 3ZPOA 4ZS2A 4JI5T 1LVKA 1SUMB 3FZFB 5LCYA 2V7MA 5LJNA 4I0UA 2KWIB 2WY2A 4HEAA 4EZ4A 2RP4A 2NW7A 5FKYA 1XWMA 4EXTA 2I59A 3KBTA 4YLHA 2YU2A 3RRCA 1MIVA 4MBQA 3P7IA 3A7MA 2BBJA 3AE3A 1V9DA 4YSZA 4I43B 4PAGA 3BQIA 3FZMB 2XQ4A 3PURA 3FB2A 2XQYA 3VKHA 4IGUA 3ZLIA 4P0AA 3J9X1 2ZMAA 3MACA 1CHUA 5CJ5A 3OYZA 2WMOA 4ZI2C 3UUXB 1WLXA 4A5XA 3IEEA 2CMRA 5LG4A 4UEMA 4EEBA 3HKCE 3RF1A 1W9RA 3KV4A 2XAFB 3H3AA 2EHOB 5FYMA 4DV4T 4OK0A 3UFEA 2PFVA 4FI5A 4F7GB 2RPAA 2NTXA 1HX1B 5ABEA 2KMFA 5L4EA 3NRXA 3RYCE 3ZMZB 5L2LA 2DWKA 3AE7A 4AKIA 4W8PA 4ILUA 3AE5A 4X66T 3ZN1B 4EEDA 3PDYA 1BR2A 2AXDS 5FNVE 3OBVE 4JI8T 1NENA 2L7NA 4ERRA 3FYQA 2BDEA 2CLYC 1VOMA 2Q9QD 3RIUA 4DBRA 3LBXB 3ZMSB 1BR4A 2I0MA 1FMVA 4U3CA 2UUAT 3O1IA 4IIJE 4DR4T 4AI6A 2X9YA 4Q25A 2WZIA 3PTRB 4H9OC 5JH7E 3NZQA 4MLKA 1YQ3A 5AQQB 2CBIA 5JR9B 4YSXA 4HFIA 3UU5A 2W63A 4IL9A 4QH5A 3UUBA 3AA6B 2LHNA 2SPCA 1VCSA 3UU6A 2KZ7B 4A56A 3N9NA 3TLUA 3UQ7A 4H9NC 4DV2T 2WMNA 4JV5T 5AQNB 4K0UA 5JDLA 2ZM0A 3CX6B 1OXZA 3PE0A 3T1YT 4E7SA 3PUXF 4UELA 2L3LA 2VWAA 4GYRA 3RH3A 1W0BA 2XAHB 4HWHA 5AQRB 4WBNE 4QKNA 1EZ3A 2V5DA 5IYZE 3OPCA 3VJZA 5JDFA 5KX5E 3RHWA 4YFSA 1YQ4A 2LSKA 5IHYA 3AE1A 2CWYA 4YTNA 2WWVA 4TNVA 2W2UA 4OYJA 3C51A 1XMOT 4EB6E 4JI3T 3PUZF 1SA0E 3QC9A 4UVBB 3ZC0A 5JREA 2VVNA 2KWHA 5LGTB 3NKZA 4V1Av 3LK3B 3ZKRA 4DR1T 3QUJA 2YU1A 3HKBE 3RIFA 4GK0E 3E08A 2P9BA 2CHOA 4LF6T 1WFDA 4X65T 1ZHCA 4LF4T 4CN1A 1UURA 3D0TA 2ODVA 4HFBA 5HWYA 1FJGT 2B1EA 5LMUT 5BR8T 4CQIA 3NZPA 1NWMX 4TV8E 3I9YA 5ABFA 3WSCA 1MNDA 2LSIA 1X79A 4OYKA 4IDPA 4PFPA 4U31A 1AJ3A 3LK42 4H63V 4TWHA 1U5PA 5EK4A 4O4IE 3E22E 4IL4A 4IHJE 2LSJA 2KBBA
chains in the Genus database with same CATH topology
5HYAA 5LYJE 1QUUA 2VB6A 1BR0A 2D0UA 2H3RA 4GYSA 4HE8A 3ONXA 4TZ4C 3CKDA 3N5LA 5L3CB 5HXEA 5L3GB 4DMWA 3HI2A 4ISSA 1YKEB 4HTEA 4U74A 2PBIA 5FXWA 4AQFA 3M1CA 3IBPA 3V5UA 4O2AE 2W00A 5LXTE 2LE8A 3IHRA 3CX7B 2E9XC 5LHIB 3T8OA 4H9QC 3BK9A 1KK7A 1US7B 2V26A 3I0OA 3VKGA 3I1AA 4EYUA 3F31A 5E0OA 2D0TA 3FXDB 3W15B 2KXPB 5J2UE 5LBQB 2HH7A 4PJMA 2QGSA 4TX5A 2H7VC 2K9AA 2NOXA 3FBZA 3GN5A 3PUAA 4HKAA 3RPUA 5JDGA 3BQKA 4ECGA 4UV8B 2RA1A 3C98B 3A5XA 3JC6C 1D0XA 2LOPA 4L0RA 3ZCIA 2LM9A 2NW8A 2BZBA 3CPZA 4QXCB 4X1IE 5DQVA 2CEAA 2K24A 5HXSA 4CZZB 3UTKA 2K48A 2WWUA 3O4XE 2VKOA 2V7JA 4EOZB 2MTQA 3Q5WA 2Q9QA 2G0UA 4AKLA 2JJ9A 3F2EA 3GN5B 2V1DB 4YJ3E 2E9XD 1NAFA 4KUMB 3RC8A 1FEWA 2K5BB 4TN7B 5J2TE 2LOSA 4TUYE 1IJ6A 2LEHA 4IE6A 5H6QB 3CQXC 2C5IT 3GA8A 3AAIA 5KMGP 1G73A 4CXXA 1KNZA 5BMVE 2Q9QB 4L9IA 3TKLB 2C5JA 4O8SA 2CWOA 4CI1B 2X66A 2DLRA 4HFVA 3WAJA 2VKHA 4PK4A 3QK6A 5LP6E 2W61A 2X9XA 3RYHE 3JC6D 5JRCA 2ACXA 5LGNB 2M67A 2JPFA 3K8PC 4QHOA 5JQGE 3N2OA 3N2GE 3ZYMA 4PW8A 4PJNA 3RX6A 3NRYA 3CMLA 3ZYKA 4PJLA 3IF8B 4UXNB 1U4QA 4H9RC 3Q2MA 4ISTA 3AVRA 3KV6A 3KV9A 3EUHA 3CWZB 4UF0A 2J1DG 4G2AA 3PU3A 2ZM2A 4M1PA 4E7ZA 5M4YA 4P0BA 3HL6A 3ZPOA 5JDHA 4HGAA 3B13A 4ZS2A 2YEVC 2CLYB 4QXBB 3O1HA 3O1JA 4IE7A 2ODUA 4ASKA 1S94A 2NTYA 1LVKA 2JQQA 2ZM8A 2CXDA 5LCYA 4WBOA 2V7MA 5LJNA 3R84B 3SWHA 2Z6EA 3RYIE 3C4WA 5HXHA 2HPLA 4MHCA 2XTLA 5TAOA 4CXYA 2MTCA 3LG7A 2KWIB 4ZOLE 2DNXA 5DQWA 4HEAA 3ZEFB 4EZ4A 3CQCB 4KBMB 4O4JE 5CB4E 4BGOA 4AKGA 3UULA 2RP4A 2NW7A 3O9XA 3AAAB 4I50E 3EVYA 3FHNA 1HG2A 1MMDA 2WSSV 2X0LB 3ANWB 4EXTA 5JVDE 4X1YE 4TV9E 4UVAB 4IE5A 2I59A 3OJAA 2E8IA 5AFUL 5HXCA 5FXZA 3KBTA 1HX8A 1HCIA 4GIWA 4YLHA 2V7LA 4BJMA 2YU2A 3RRCA 1MIVA 4MBQA 1T98A 3P7IA 1ZEEA 3ZYLA 3DJBA 3AA1B 3FXEB 1V9DA 3I9WA 4PJJA 1ZKEA 4HN9A 4I43B 4PAGA 1MNEA 4ANJA 3BQIA 5FP3A 2KNDA 3RYFE 1IZNB 3PURA 3FB2A 2XQYA 3KBUA 4QX7B 3VKHA 4IGUA 3ZLIA 4O4HE 4P0AA 4AQFC 4I4TE 3KFWX 2JMHA 3J9X1 2ZMAA 1MIWA 4U72A 1OWAA 3MACA 5T1DA 3KVAA 1IJ5A 3N9PA 3OYZA 4WNKA 4Z8XA 4BAYB 3PUSA 1D0ZA 2PG8A 4B6XA 4AKHA 1YD8G 2WMOA 4ZI2C 3AA7B 3UUXB 3ZN0B 2LJLA 1WLXA 3OYXA 3IEEA 3WURA 2CMRA 3N9QA 3C50A 4UEMA 4BJNA 5LG4A 3HKCE 1Y64B 3KV4A 2A2FX 3ZCJA 3MA9A 3N9LA 3Q5XA 4X1KE 5L3FB 2XAFB 1FMWA 3ZJ1A 5LBMA 3C4ZA 4AKRB 4ZI7E 5LJMA 4DMVA 2MOZA 3H3AA 1CUNA 2EHOB 2N2NA 5FYMA 4OK0A 4UVCB 3UFEA 2PFVA 2X68A 4FI5A 3DP7A 3L09A 3P8CD 5FY7A 2X51A 2NTXA 2Q9QC 4KMCA 4MALA 1HFAA 3C4XA 2KMFA 2BVMA 3BQLA 1YKHB 3B57A 2MYSA 4DNDA 5L3DB 3F57A 3V5SA 3LFMA 2XHEB 1O3XA 5DJQC 5JDMA 2ES0A 2WAUA 4J2CA 4OFZA 5EZYE 4ZI2D 2LHRA 2C0SA 3NRXA 3KDSE 5J1GA 3RYCE 4NUVA 3ZMZB 2H7OA 5L2LA 3VHLA 2DWKA 4H9PC 4H63H 3CQGB 3HA4A 4AKIA 4PK6A 2HPJA 3H37A 3PUQA 4ILUA 2ZLYA 1Z0PA 4IE4A 3ZN1B 1MMGA 2LSYA 3PDYA 1BR2A 1B7TA 2VK9A 5FNVE 3OBVE 4XZCA 2XASB 2GK9A 2CA5A 2L8KA 1D1CA 4ERRA 4GOUA 3WAKA 3ZJ2A 5FY1A 4EIWA 2BDEA 2CLYC 2DWGA 1VOMA 2Q9QD 1HF8A 4DBRA 2XAQB 3LBXB 1BR4A 2A3DA 3ZMSB 1FMVA 2D2SA 2YK0A 4XBFB 3UT5E 3MK7C 5EK3A 3O1IA 5JR9A 4IIJE 1LRZA 5CA1E 2LT3A 2X9WA 3ANWA 4AI6A 2X9YA 2CXFA 3ETVA 4YHJA 4DVDA 2X67A 4X20E 2YINA 3PTRB 5F8PA 4CI2B 4H9OC 5JH7E 4NUUA 2NW9A 3NZQA 4MLKA 3PUGA 3OKQA 4BA9A 2CCQA 3AVSA 5LHHB 3MZKB 5JR9B 2CE7A 1WR6A 2KLQA 4PFOA 2V7IA 5H6RB 4MFRA 2XAGB 3RRWA 1E1HB 2XAJB 1YW0A 2W63A 4ZI3C 3MXZA 2Y48B 5HXRA 2W62A 2JRKA 5FY0A 1MMNA 4PK5A 4QXHB 1D1AA 3AA6B 2LHNA 2SPCA 2D5UA 2L9QA 3S4UA 3KVBA 2KZ7B 5ETWA 5GONE 2LSGA 4P09A 1HTJF 5A1LA 3K3OA 4A56A 2LQUA 4JEUB 1VRBA 2E9XA 5LOVE 5HWXA 4WW0A 1G8XA 4JUYA 3N9NA 2JMKA 4ZHQE 1WRDA 2VASA 3UUNA 1H7CA 3KV5A 4H9NC 3AB3B 2WMNA 2CM0A 2VL8A 4K0UA 5JDNA 3PHF1 2ZM0A 3CX6B 1OXZA 3VU7H 5JDLA 4H9SE 2E9XB 4EYYR 4F6RC 3NBXX 3PE0A 3LJCA 3RKOA 3PU8A 4ZI3D 4I55E 4E7SA 5CA0E 2EHOA 3SRZA 2L3LA 2VWAA 4UELA 2IAKA 4YJ2E 2KINB 5ADXL 2QA7A 4GYRA 3GMIA 3RH3A 4C91A 4DBQA 3DTOA 3WI3A 3HR0A 2XAHB 4UIGA 4WBNE 5FXXA 3M65A 4N78D 3K3NA 3EDVA 4QKNA 3HKDE 1EZ3A 4AQGA 1WYBA 4QWNB 5IYZE 4FJOA 2MBGA 3VJZA 2XUEA 5JDFA 2EHOC 1FIOA 2NP9A 5KDMC 3L3PA 5KX5E 3EDUA 4QX8B 4YFSA 4JLEA 2KT9A 2WM9A 2LSKA 1MMAA 5IHYA 5LA6E 1UCUA 2CWYA 3E0ZA 4CXWA 3CVRA 4GK5E 5FXVA 2WBLA 3R6NA 4DO0A 4EZHA 3ZMVB 2IC9A 4IDZA 2IC6A 2PJQA 4OYJA 5LGUB 1ZV4X 2Y6XA 3C51A 4JEHB 2DCFA 5DABA 4EB6E 2C5KT 5EK2A 4IE0A 1SA0E 3CX8B 1WYCA 3QC9A 4UVBB 3ZC0A 5JREA 3FBLA 5HAXA 3N9OA 2KWHA 3LBXA 2Y8DA 2BVLA 2IW5B 5LGTB 3N2KE 1D0YA 1HG5A 2UXXB 1QSDA 4V1Av 3LK3B 3SS1A 3LK2B 2EHOD 2NWBA 4EAHA 3I0QA 3QUJA 1SHZC 5C8YE 2YU1A 3HKBE 4ONRA 3K3QC 4GK0E 3E08A 3MJXA 3U3IA 1HS7A 3ETUA 1MIYA 5JDQA 2P9BA 3SOLA 5L3BB 2N9DA 3MKDA 4XAXB 4ZS3A 5L3EB 5JRCB 4KP3C 1ZHCA 2UXNB 3J7Yq 5FMNA 3C64A 3D0TA 2ODVA 1LVFA 1BR1A 3UUMA 2DHRA 3N9MA 3ZC1A 1D1BA 4AXPA 5HWYA 2A72A 2CXLA 2VKJA 3AT7A 2VKDA 2B1EA 4UF0B 3ESLA 3Q9DA 2DI4A 3AA0B 3PF0A 3KINB 5JR9C 1S35A 4CQIA 3ZMUB 4CI3B 3NZPA 4O4LE 1NWMX 4OHFA 4TV8E 1UX4A 4ADZA 3I9YA 3WSCA 1MNDA 2LSIA 1X79A 4OYKA 2N1GA 1UX5A 5LNKA 4PFPA 2V7KA 3HKEE 4G63A 4UV9B 2W0GA 3GWHA 5F3JA 3RC3A 4O2BE 2X9HA 3U78A 1AJ3A 3ZMTB 3LK42 4H63V 1LKXA 1U5PA 3AAEB 5LHGB 2OA5A 5EK4A 4O4IE 4L5GA 3E22E 1IAPA 4IHJE 4C90A 2LSJA 4PNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXE A;  5HYA A;  5HXH A;  5JDH A;  5JDN A;  5HXC A;  5JDQ A;  3V5S A;  5HXS A;  5HWY A;  5HWX A;  5JDG A;  5HXR A;  5JDL A;  5JDM A;  5JDF A;  3V5U A; 
#chains in the Genus database with same CATH topology
 4YTM A;  5JTG A;  5F5W A;  1QUU A;  2VB6 A;  4HWC A;  3ONX A;  5L3C B;  2XQ7 A;  3N5L A;  4U74 A;  1YKE B;  3M1C A;  3IBP A;  3V5U A;  2W00 A;  3T8O A;  3BK9 A;  1KK7 A;  3FXD B;  5J2U E;  4DR2 T;  5CFB A;  2NOX A;  3GN5 A;  3PUA A;  2BZB A;  3CPZ A;  4QXC B;  1UGO A;  3UTK A;  2G0U A;  2V1D B;  3ZSS A;  1FEW A;  5J2T E;  4IE6 A;  3SFE A;  2C5I T;  3AY5 A;  2B76 A;  2XQA A;  4CXX A;  1KNZ A;  2CWO A;  2J47 A;  4PK4 A;  5AQT B;  1XDO A;  3Q5E A;  5JQG E;  4PJN A;  3X1D A;  3NRY A;  1E7P A;  3AEA A;  4UF0 A;  2ZM2 A;  1QLB A;  1XNQ T;  2UXC T;  3B13 A;  2CLY B;  2ODU A;  1JNR A;  1S94 A;  2ZM8 A;  2FUP A;  1M62 A;  3R84 B;  3SWH A;  4QH1 A;  3RYI E;  4JI6 T;  2XTL A;  5TAO A;  4CXY A;  5CB4 E;  4HFD A;  4AKG A;  4DUZ T;  3O9X A;  2XQ6 A;  1HNX T;  3OJA A;  2E8I A;  1HCI A;  1NEK A;  4GIW A;  2JQ9 A;  4BJM A;  3ZYL A;  4U2Z A;  2WU2 A;  3I9W A;  1ZOY A;  4HN9 A;  1W09 A;  4U7I A;  1IZN B;  4K0K T;  2WZH A;  3LDQ B;  2AE9 A;  4AQF C;  4YHH T;  4IDN A;  1MIW A;  3FZL B;  5T1D A;  3KVA A;  1IJ5 A;  3N9P A;  3EHZ A;  4JBW F;  3RKG A;  2LJL A;  3WUR A;  3C50 A;  5AQO B;  1Y64 B;  4NIQ A;  4U7Y A;  3ZCJ A;  3QNU A;  3N9L A;  4YT0 A;  1FMW A;  4DID B;  4ZI7 E;  2CHN A;  2BG9 A;  2IDO B;  2N2N A;  3G06 A;  2LRL A;  3P8C D;  2X51 A;  2BVM A;  1YKH B;  4DND A;  4DR5 T;  5L3D B;  4YSY A;  3V5S A;  2XHE B;  5JDM A;  5HXE A;  5EZY E;  2LHR A;  5J1G A;  3KDS E;  4NUV A;  3AEE A;  5FVK A;  2HPJ A;  5KXJ A;  1KF6 A;  1B7T A;  2YKS A;  2XAS B;  1M7K A;  2CA5 A;  1D1C A;  4GOU A;  3AE8 A;  2XAQ B;  5HEJ A;  3FZK B;  4B3T T;  1UK5 A;  2D2S A;  5AQI B;  4XBF B;  3UT5 E;  3MK7 C;  5JR9 A;  3ANW A;  2X0C A;  3FZH B;  4YHJ A;  2X67 A;  4TWD A;  5F8P A;  4CI2 B;  2UXD T;  1WCR A;  2NW9 A;  1XMQ T;  3RIU C;  4HWF A;  2CE7 A;  2KLQ A;  5H6R B;  4MFR A;  1SJ8 A;  4EV6 A;  5HXR A;  2JRK A;  2XZE A;  5AQH B;  1MMN A;  2FJA A;  4PK5 A;  4QXH B;  2L9Q A;  5AQM B;  3S4U A;  5ETW A;  1HTJ F;  5A1L A;  2XQ9 A;  2LQU A;  1VRB A;  5LOV E;  2WDR A;  4ZHQ E;  1WRD A;  1H7C A;  4U33 A;  3AB3 B;  5L47 A;  4YTP A;  4EYY R;  2VVS A;  5J0Z A;  3PU8 A;  4ZI3 D;  4I55 E;  3AE6 A;  5CA0 E;  1UUS A;  2OV9 A;  4C91 A;  2IHR 1;  3ONJ A;  3EDV A;  1WYB A;  1YXR A;  2WB5 A;  1FIO A;  2NP9 A;  4WYV A;  2V8S V;  2YOE A;  4KX6 A;  5LA6 E;  1UCU A;  3CVR A;  5FXV A;  2WBL A;  3R6N A;  2BS2 A;  2XPK A;  3Q5D A;  2IC6 A;  5LB7 B;  2QYW A;  2Y6X A;  5DAB A;  2K3W A;  3CX8 B;  4NPP A;  3SFD A;  2Y8D A;  2BVL A;  1D0Y A;  1HG5 A;  3L39 A;  3LK2 B;  2EHO D;  2VL0 A;  5C8Y E;  4ONR A;  2CBJ A;  2XQ5 A;  4ZS3 A;  5JRC B;  3AXJ A;  2QRX A;  3UUM A;  3N9M A;  1D1B A;  3ONL C;  2IML A;  2VKJ A;  2YN6 A;  2VKD A;  2LKH A;  2DI4 A;  3AE4 A;  4Z91 A;  4OHF A;  4ADZ A;  3PV0 F;  2V7K A;  4G63 A;  2W0G A;  3GWH A;  2X9H A;  3PJA A;  3ZMT B;  3AAE B;  1IAP A;  5CGM A;  5LYJ E;  2UU9 T;  2H3R A;  1VCT A;  5L3G B;  2PBI A;  2LRK A;  4O2A E;  3IHR A;  2E9X C;  5ABG A;  4H9Q C;  4COF A;  2KSR A;  2DL1 A;  3I0O A;  3VKG A;  3I1A A;  2D0T A;  1J5E T;  4ZXL A;  5LBQ B;  4HFC A;  2H7V C;  2K9A A;  4HKA A;  3RPU A;  5JDG A;  1D0X A;  4L0R A;  2LM9 A;  5DQV A;  2CEA A;  2WWU A;  3O4X E;  2V7J A;  2MTQ A;  2XM1 A;  2K5B B;  2LOS A;  1IJ6 A;  2LEH A;  3JAF A;  3GA8 A;  3AAI A;  5KMG P;  1IBK T;  4O8S A;  2X66 A;  3QOF A;  4AQY T;  3AEF A;  3P4S A;  2W61 A;  3JC6 D;  2ACX A;  2M67 A;  3K8P C;  4QHO A;  3N2G E;  3RX6 A;  3ZT6 A;  3ZYK A;  3IF8 B;  4IST A;  5HEO A;  3PU3 A;  4M1P A;  4DV7 T;  5M4Y A;  3HL6 A;  4HGA A;  4QXB B;  4LF8 T;  4IE7 A;  3O1J A;  4ASK A;  2NTY A;  5AQK B;  2JQQ A;  3P4W A;  2CXD A;  1XNR T;  4X5T A;  3RI5 A;  2Z6E A;  3C4W A;  5HXH A;  2HPL A;  4MHC A;  2MTC A;  3LG7 A;  2DNX A;  2WDV A;  4O4J E;  3UUL A;  3AAA B;  1Y01 A;  4I50 E;  3EVY A;  5AQF B;  1OED A;  3UFG A;  1MMD A;  5JVD E;  2BS3 A;  4TV9 E;  4IE5 A;  5AFU L;  5FXZ A;  1HNW T;  1HX8 A;  3A8Y C;  1ZEE A;  4IDO A;  2X0Y A;  3AA1 B;  3FXE B;  3P4P A;  4DR3 T;  4B3M T;  1MNE A;  5FP3 A;  3RYF E;  4QX7 B;  3KBU A;  3RQW A;  3P4Q A;  4I4T E;  3KFW X;  2JMH A;  4U72 A;  1OWA A;  2UUC T;  2YDR A;  4ILC A;  2XSA A;  4DV5 T;  1XZY A;  5LMN T;  4B6X A;  2UUB T;  3ZN0 B;  3OYX A;  4GKK T;  3N9Q A;  4BJN A;  4X1K E;  3ZJ1 A;  4LML A;  5LJM A;  1CUN A;  4NXN T;  2X68 A;  3DP7 A;  3L09 A;  5FY7 A;  2Q9Q C;  4MAL A;  3C4X A;  2MYS A;  2V6X A;  5C3J A;  3F57 A;  3RQU A;  1O3X A;  5DJQ C;  4J2C A;  4ZI2 D;  2FJE A;  2H7O A;  3VHL A;  3NVO A;  4H63 H;  3CQG B;  3HA4 A;  4PK6 A;  3H37 A;  3PUQ A;  1SJ7 A;  1MMG A;  2LSY A;  3CK6 A;  2VK9 A;  3EI0 A;  2L8K A;  4HFE A;  3WAK A;  3ZJ2 A;  5FY1 A;  4EIW A;  3P50 A;  2DWG A;  3TLT A;  2A3D A;  4UR9 A;  5AQG B;  5EK3 A;  2LT3 A;  2CXF A;  3ETV A;  4DVD A;  4F8H A;  4NUU A;  2WU5 A;  3PUG A;  4JI1 T;  3OKQ A;  5LHH B;  2VUR A;  3EAB A;  4JI4 T;  3RRW A;  1E1H B;  2Y48 B;  1D1A A;  3H3M A;  4YY3 T;  2LSG A;  3ABV A;  1DU2 A;  4JEU B;  2LM2 A;  4WW0 A;  1G8X A;  4JUY A;  1SE7 A;  2JMK A;  3TLW A;  3UU3 A;  2WCA A;  5JDN A;  3PHF 1;  3VU7 H;  4AIS A;  3PUV F;  2E9X B;  4LF7 T;  3NBX X;  2WS3 A;  4LMJ A;  4HFH A;  2XQ8 A;  2EHO A;  1R8I A;  4YJ2 E;  2IAK A;  2KIN B;  4DBQ A;  2ACZ A;  3HR0 A;  3M65 A;  5AQL B;  4N78 D;  2L10 A;  3K3N A;  4HWI B;  2V6Y B;  4AQG A;  1ZP0 A;  4TNW A;  4QWN B;  3EAM A;  1W0A A;  4FJO A;  2XUE A;  2LLY A;  3L3P A;  3EDU A;  3E0Z A;  4CXW A;  2E5L T;  3ZMV B;  4LFC T;  5LGU B;  3PJA J;  2PJQ A;  4DR6 T;  1ZV4 X;  4X64 T;  4JEH B;  2NR4 A;  1WYC A;  5HAX A;  3LBX A;  2YDS A;  3N2K E;  2JIW A;  2NWB A;  4EAH A;  3I0Q A;  4DV1 T;  3K3Q C;  4ILA A;  3MJX A;  1MIY A;  4U2Y A;  1N33 T;  4B3S T;  4P1N A;  3J7Y q;  1LVF A;  3K1S A;  3AEG A;  2DHR A;  3ZC1 A;  4AXP A;  2A72 A;  3VRA A;  4UF0 B;  3Q9D A;  3AA0 B;  3JCF A;  3PF0 A;  2ZM6 T;  3KIN B;  1S35 A;  5AQS B;  3QB5 K;  1UX5 A;  5AQP B;  2E5V A;  2QVA A;  5LNK A;  5C2T A;  3HKE E;  4HWD A;  3U78 A;  4L5G A;  4PNI A;  2F4V T;  5HYA A;  1BR0 A;  1GQE A;  4TZ4 C;  1WR0 A;  2XSB A;  4DMW A;  3HI2 A;  4AQF A;  5IWA T;  2BKP A;  5LG3 A;  2LE8 A;  3AEB A;  2M6I A;  2YDQ A;  4IRE A;  3IA3 A;  3F31 A;  5E0O A;  2XQ3 A;  5ABH A;  4PJM A;  2QGS A;  4JI0 T;  3BQK A;  1X9B A;  2RA1 A;  2LKG A;  3A5X A;  2CRB A;  5HXS A;  2K24 A;  2K48 A;  2KVP A;  2JJ9 A;  4YJ3 E;  4KHZ F;  1NAF A;  4TN7 B;  1OED E;  4EGW A;  1G73 A;  2Q9Q B;  3TKL B;  4CI1 B;  2VKH A;  3QK6 A;  2BG9 B;  2X9X A;  4WZX A;  3RYH E;  1N34 T;  5FL1 A;  2JPF A;  3N2O A;  4PW8 A;  3CML A;  2WDQ A;  4Z90 A;  1U4Q A;  4H9R C;  2HN2 A;  2WP9 A;  2W67 A;  4JI2 T;  1L0V A;  3KV9 A;  3L8R A;  3CWZ B;  2J1D G;  4G2A A;  1N32 T;  5JDH A;  4ZZC A;  2E2A A;  2YEV C;  3O1H A;  4CN4 A;  3DYJ A;  4LFB T;  4WBO A;  3LSV A;  2I6H A;  1XDP A;  4ZOL E;  5IUX A;  5DQW A;  3ZEF B;  3CQC B;  4IT4 A;  4KBM B;  5AQU B;  2VQE T;  4BGO A;  3FHN A;  1HG2 A;  5HCM A;  2WSS V;  1J1J A;  2X0L B;  3ANW B;  4JYA T;  4X1Y E;  3QB5 A;  4ILB A;  4UVA B;  3TLV A;  4DUY T;  5HXC A;  3ZT7 A;  2V7L A;  4LF9 T;  1T98 A;  4LF5 T;  1OED C;  3DJB A;  4PJJ A;  1ZKE A;  4ANJ A;  1IBM T;  3UQ4 A;  2KND A;  3JAD A;  1HNZ T;  4O4H E;  3PUY F;  4DV6 T;  4WNK A;  4Z8X A;  4BAY B;  3PUS A;  1D0Z A;  2PG8 A;  2FBW A;  4AKH A;  1YD8 G;  2XM2 A;  1KNP A;  3AA7 B;  3TLS A;  2H88 A;  2J4G A;  4NXM T;  3AEC A;  2A2F X;  4CN6 A;  3MA9 A;  3Q5X A;  5L3F B;  5LBM A;  3C4Z A;  4AKR B;  4DMV A;  2MOZ A;  4DR7 T;  4UVC B;  1KEY A;  4KMC A;  1HFA A;  3BQL A;  4B3R T;  3B57 A;  3LFM A;  2HHH T;  2ES0 A;  3JAE A;  2WAU A;  4OFZ A;  2C0S A;  4H9P C;  2MPK A;  2ZLY A;  1Z0P A;  4IE4 A;  2H89 A;  5AQV B;  4XZC A;  2GK9 A;  2XY8 B;  2UXB T;  1IBL T;  4A97 A;  1HF8 A;  2X0H A;  2YK0 A;  3VR8 A;  2IUB A;  2BKN A;  1LRZ A;  5CA1 E;  1HR0 T;  2X9W A;  2BG9 E;  4X20 E;  2YIN A;  4LFA T;  4BA9 A;  2CCQ A;  3AVS A;  3MZK B;  1I94 T;  4DV0 T;  1WR6 A;  3AXJ B;  4QH4 A;  3NWI A;  4PFO A;  2V7I A;  2XAG B;  5HEH A;  2PTF A;  2XAJ B;  1YW0 A;  4ZI3 C;  3CIR A;  3MXZ A;  2W62 A;  5FY0 A;  4AIU A;  1T7S A;  3OVU A;  4DV3 T;  3AED A;  2D5U A;  3KVB A;  5GON E;  4P09 A;  3K3O A;  2E9X A;  5HWX A;  2M6B A;  2VAS A;  3UUN A;  3KV5 A;  2CM0 A;  2VL8 A;  3M3Z B;  5FZT A;  4H9S E;  4F6R C;  3LJC A;  1E2A A;  3RKO A;  2D9D A;  2V6Y A;  2WQY A;  3UU8 A;  3SRZ A;  5ADX L;  2QA7 A;  3GMI A;  2FJD A;  3ZT5 A;  3DTO A;  3WI3 A;  1N36 T;  4UIG A;  5FXX A;  3HKD E;  4JI7 T;  5AQJ B;  2CPT A;  1T72 A;  2MBG A;  2EHO C;  5HEG A;  5KDM C;  4QX8 B;  4JLE A;  2KT9 A;  2WM9 A;  4ZEY A;  1MMA A;  1KFY A;  2OLT A;  3AE2 A;  4GK5 E;  4DO0 A;  2VQF T;  1I6Z A;  4EZH A;  2BG9 C;  4X62 T;  3T1H T;  3PUW F;  2BKO A;  2IC9 A;  4IDZ A;  2DCF A;  2C5K T;  2R6G F;  5EK2 A;  4IE0 A;  2V5C A;  1T8B A;  3FBL A;  3N9O A;  3P4R A;  2IW5 B;  2UXX B;  1QSD A;  3SS1 A;  2MAW A;  4YXD A;  1SHZ C;  2JQK A;  4KI0 F;  3U3I A;  1HS7 A;  3ETU A;  5JDQ A;  1KNR A;  3SOL A;  5L3B B;  2N9D A;  3MKD A;  4XAX B;  5L3E B;  4KP3 C;  2A9U A;  2UXN B;  5FMN A;  3C64 A;  5L4H A;  1BR1 A;  3RLF F;  2CXL A;  3AT7 A;  3ESL A;  5JR9 C;  3ZMU B;  1JNZ A;  4CI3 B;  3OTO T;  4O4L E;  1UX4 A;  2KGX A;  2N1G A;  4UV9 B;  5F3J A;  3RC3 A;  4O2B E;  2BS4 A;  4LMK A;  1LKX A;  5LHG B;  2OA5 A;  5ABF B;  4KHP T;  4C90 A;  2D0U A;  4GYS A;  4HE8 A;  3CKD A;  2BBH A;  4ISS A;  4HTE A;  5FXW A;  3RIA A;  1OED B;  5LXT E;  3CX7 B;  5LHI B;  2FJB A;  3ZST A;  1US7 B;  2V26 A;  4EYU A;  3RGL A;  3W15 B;  2KXP B;  2XJ7 A;  4OX9 T;  5HEU A;  2HH7 A;  3B5M A;  4TX5 A;  3AE9 A;  4A98 A;  3VRB A;  3FBZ A;  4ECG A;  4UV8 B;  3C98 B;  3JC6 C;  3UU4 A;  2LOP A;  3ZCI A;  4TWF A;  2NW8 A;  4X1I E;  2JQH A;  4CZZ B;  4EOZ B;  2VKO A;  1J5W A;  3Q5W A;  3VR9 A;  2Q9Q A;  4AKL A;  3F2E A;  3GN5 B;  2E9X D;  5FL0 A;  4KUM B;  3RC8 A;  2W4X A;  4TUY E;  5H6Q B;  3CQX C;  2HN1 A;  5BMV E;  4IDQ A;  4L9I A;  2C5J A;  2IIU A;  3WAJ A;  2DLR A;  4HFV A;  2J62 A;  5HCJ A;  5LP6 E;  4ZZB A;  5JRC A;  5LGN B;  1Z8U A;  3ZYM A;  4PJL A;  5FVL A;  4UXN B;  3Q2M A;  3AVR A;  3KV6 A;  3EUH A;  2W66 A;  4E7Z A;  4P0B A;  4GKJ T;  3ZPO A;  4ZS2 A;  4JI5 T;  1LVK A;  1SUM B;  3FZF B;  5LCY A;  2V7M A;  5LJN A;  4I0U A;  2KWI B;  2WY2 A;  4HEA A;  4EZ4 A;  2RP4 A;  2NW7 A;  5FKY A;  1XWM A;  4EXT A;  2I59 A;  3KBT A;  4YLH A;  2YU2 A;  3RRC A;  1MIV A;  4MBQ A;  3P7I A;  3A7M A;  2BBJ A;  3AE3 A;  1V9D A;  4YSZ A;  4I43 B;  4PAG A;  3BQI A;  3FZM B;  2XQ4 A;  3PUR A;  3FB2 A;  2XQY A;  3VKH A;  4IGU A;  3ZLI A;  4P0A A;  3J9X 1;  2ZMA A;  3MAC A;  1CHU A;  5CJ5 A;  3OYZ A;  2WMO A;  4ZI2 C;  3UUX B;  1WLX A;  4A5X A;  3IEE A;  2CMR A;  5LG4 A;  4UEM A;  4EEB A;  3HKC E;  3RF1 A;  1W9R A;  3KV4 A;  2XAF B;  3H3A A;  2EHO B;  5FYM A;  4DV4 T;  4OK0 A;  3UFE A;  2PFV A;  4FI5 A;  4F7G B;  2RPA A;  2NTX A;  1HX1 B;  5ABE A;  2KMF A;  5L4E A;  3NRX A;  3RYC E;  3ZMZ B;  5L2L A;  2DWK A;  3AE7 A;  4AKI A;  4W8P A;  4ILU A;  3AE5 A;  4X66 T;  3ZN1 B;  4EED A;  3PDY A;  1BR2 A;  2AXD S;  5FNV E;  3OBV E;  4JI8 T;  1NEN A;  2L7N A;  4ERR A;  3FYQ A;  2BDE A;  2CLY C;  1VOM A;  2Q9Q D;  3RIU A;  4DBR A;  3LBX B;  3ZMS B;  1BR4 A;  2I0M A;  1FMV A;  4U3C A;  2UUA T;  3O1I A;  4IIJ E;  4DR4 T;  4AI6 A;  2X9Y A;  4Q25 A;  2WZI A;  3PTR B;  4H9O C;  5JH7 E;  3NZQ A;  4MLK A;  1YQ3 A;  5AQQ B;  2CBI A;  5JR9 B;  4YSX A;  4HFI A;  3UU5 A;  2W63 A;  4IL9 A;  4QH5 A;  3UUB A;  3AA6 B;  2LHN A;  2SPC A;  1VCS A;  3UU6 A;  2KZ7 B;  4A56 A;  3N9N A;  3TLU A;  3UQ7 A;  4H9N C;  4DV2 T;  2WMN A;  4JV5 T;  5AQN B;  4K0U A;  5JDL A;  2ZM0 A;  3CX6 B;  1OXZ A;  3PE0 A;  3T1Y T;  4E7S A;  3PUX F;  4UEL A;  2L3L A;  2VWA A;  4GYR A;  3RH3 A;  1W0B A;  2XAH B;  4HWH A;  5AQR B;  4WBN E;  4QKN A;  1EZ3 A;  2V5D A;  5IYZ E;  3OPC A;  3VJZ A;  5JDF A;  5KX5 E;  3RHW A;  4YFS A;  1YQ4 A;  2LSK A;  5IHY A;  3AE1 A;  2CWY A;  4YTN A;  2WWV A;  4TNV A;  2W2U A;  4OYJ A;  3C51 A;  1XMO T;  4EB6 E;  4JI3 T;  3PUZ F;  1SA0 E;  3QC9 A;  4UVB B;  3ZC0 A;  5JRE A;  2VVN A;  2KWH A;  5LGT B;  3NKZ A;  4V1A v;  3LK3 B;  3ZKR A;  4DR1 T;  3QUJ A;  2YU1 A;  3HKB E;  3RIF A;  4GK0 E;  3E08 A;  2P9B A;  2CHO A;  4LF6 T;  1WFD A;  4X65 T;  1ZHC A;  4LF4 T;  4CN1 A;  1UUR A;  3D0T A;  2ODV A;  4HFB A;  5HWY A;  1FJG T;  2B1E A;  5LMU T;  5BR8 T;  4CQI A;  3NZP A;  1NWM X;  4TV8 E;  3I9Y A;  5ABF A;  3WSC A;  1MND A;  2LSI A;  1X79 A;  4OYK A;  4IDP A;  4PFP A;  4U31 A;  1AJ3 A;  3LK4 2;  4H63 V;  4TWH A;  1U5P A;  5EK4 A;  4O4I E;  3E22 E;  4IL4 A;  4IHJ E;  2LSJ A;  2KBB A; 
#chains in the Genus database with same CATH homology
 5HYA A;  5LYJ E;  1QUU A;  2VB6 A;  1BR0 A;  2D0U A;  2H3R A;  4GYS A;  4HE8 A;  3ONX A;  4TZ4 C;  3CKD A;  3N5L A;  5L3C B;  5HXE A;  5L3G B;  4DMW A;  3HI2 A;  4ISS A;  1YKE B;  4HTE A;  4U74 A;  2PBI A;  5FXW A;  4AQF A;  3M1C A;  3IBP A;  3V5U A;  4O2A E;  2W00 A;  5LXT E;  2LE8 A;  3IHR A;  3CX7 B;  2E9X C;  5LHI B;  3T8O A;  4H9Q C;  3BK9 A;  1KK7 A;  1US7 B;  2V26 A;  3I0O A;  3VKG A;  3I1A A;  4EYU A;  3F31 A;  5E0O A;  2D0T A;  3FXD B;  3W15 B;  2KXP B;  5J2U E;  5LBQ B;  2HH7 A;  4PJM A;  2QGS A;  4TX5 A;  2H7V C;  2K9A A;  2NOX A;  3FBZ A;  3GN5 A;  3PUA A;  4HKA A;  3RPU A;  5JDG A;  3BQK A;  4ECG A;  4UV8 B;  2RA1 A;  3C98 B;  3A5X A;  3JC6 C;  1D0X A;  2LOP A;  4L0R A;  3ZCI A;  2LM9 A;  2NW8 A;  2BZB A;  3CPZ A;  4QXC B;  4X1I E;  5DQV A;  2CEA A;  2K24 A;  5HXS A;  4CZZ B;  3UTK A;  2K48 A;  2WWU A;  3O4X E;  2VKO A;  2V7J A;  4EOZ B;  2MTQ A;  3Q5W A;  2Q9Q A;  2G0U A;  4AKL A;  2JJ9 A;  3F2E A;  3GN5 B;  2V1D B;  4YJ3 E;  2E9X D;  1NAF A;  4KUM B;  3RC8 A;  1FEW A;  2K5B B;  4TN7 B;  5J2T E;  2LOS A;  4TUY E;  1IJ6 A;  2LEH A;  4IE6 A;  5H6Q B;  3CQX C;  2C5I T;  3GA8 A;  3AAI A;  5KMG P;  1G73 A;  4CXX A;  1KNZ A;  5BMV E;  2Q9Q B;  4L9I A;  3TKL B;  2C5J A;  4O8S A;  2CWO A;  4CI1 B;  2X66 A;  2DLR A;  4HFV A;  3WAJ A;  2VKH A;  4PK4 A;  3QK6 A;  5LP6 E;  2W61 A;  2X9X A;  3RYH E;  3JC6 D;  5JRC A;  2ACX A;  5LGN B;  2M67 A;  2JPF A;  3K8P C;  4QHO A;  5JQG E;  3N2O A;  3N2G E;  3ZYM A;  4PW8 A;  4PJN A;  3RX6 A;  3NRY A;  3CML A;  3ZYK A;  4PJL A;  3IF8 B;  4UXN B;  1U4Q A;  4H9R C;  3Q2M A;  4IST A;  3AVR A;  3KV6 A;  3KV9 A;  3EUH A;  3CWZ B;  4UF0 A;  2J1D G;  4G2A A;  3PU3 A;  2ZM2 A;  4M1P A;  4E7Z A;  5M4Y A;  4P0B A;  3HL6 A;  3ZPO A;  5JDH A;  4HGA A;  3B13 A;  4ZS2 A;  2YEV C;  2CLY B;  4QXB B;  3O1H A;  3O1J A;  4IE7 A;  2ODU A;  4ASK A;  1S94 A;  2NTY A;  1LVK A;  2JQQ A;  2ZM8 A;  2CXD A;  5LCY A;  4WBO A;  2V7M A;  5LJN A;  3R84 B;  3SWH A;  2Z6E A;  3RYI E;  3C4W A;  5HXH A;  2HPL A;  4MHC A;  2XTL A;  5TAO A;  4CXY A;  2MTC A;  3LG7 A;  2KWI B;  4ZOL E;  2DNX A;  5DQW A;  4HEA A;  3ZEF B;  4EZ4 A;  3CQC B;  4KBM B;  4O4J E;  5CB4 E;  4BGO A;  4AKG A;  3UUL A;  2RP4 A;  2NW7 A;  3O9X A;  3AAA B;  4I50 E;  3EVY A;  3FHN A;  1HG2 A;  1MMD A;  2WSS V;  2X0L B;  3ANW B;  4EXT A;  5JVD E;  4X1Y E;  4TV9 E;  4UVA B;  4IE5 A;  2I59 A;  3OJA A;  2E8I A;  5AFU L;  5HXC A;  5FXZ A;  3KBT A;  1HX8 A;  1HCI A;  4GIW A;  4YLH A;  2V7L A;  4BJM A;  2YU2 A;  3RRC A;  1MIV A;  4MBQ A;  1T98 A;  3P7I A;  1ZEE A;  3ZYL A;  3DJB A;  3AA1 B;  3FXE B;  1V9D A;  3I9W A;  4PJJ A;  1ZKE A;  4HN9 A;  4I43 B;  4PAG A;  1MNE A;  4ANJ A;  3BQI A;  5FP3 A;  2KND A;  3RYF E;  1IZN B;  3PUR A;  3FB2 A;  2XQY A;  3KBU A;  4QX7 B;  3VKH A;  4IGU A;  3ZLI A;  4O4H E;  4P0A A;  4AQF C;  4I4T E;  3KFW X;  2JMH A;  3J9X 1;  2ZMA A;  1MIW A;  4U72 A;  1OWA A;  3MAC A;  5T1D A;  3KVA A;  1IJ5 A;  3N9P A;  3OYZ A;  4WNK A;  4Z8X A;  4BAY B;  3PUS A;  1D0Z A;  2PG8 A;  4B6X A;  4AKH A;  1YD8 G;  2WMO A;  4ZI2 C;  3AA7 B;  3UUX B;  3ZN0 B;  2LJL A;  1WLX A;  3OYX A;  3IEE A;  3WUR A;  2CMR A;  3N9Q A;  3C50 A;  4UEM A;  4BJN A;  5LG4 A;  3HKC E;  1Y64 B;  3KV4 A;  2A2F X;  3ZCJ A;  3MA9 A;  3N9L A;  3Q5X A;  4X1K E;  5L3F B;  2XAF B;  1FMW A;  3ZJ1 A;  5LBM A;  3C4Z A;  4AKR B;  4ZI7 E;  5LJM A;  4DMV A;  2MOZ A;  3H3A A;  1CUN A;  2EHO B;  2N2N A;  5FYM A;  4OK0 A;  4UVC B;  3UFE A;  2PFV A;  2X68 A;  4FI5 A;  3DP7 A;  3L09 A;  3P8C D;  5FY7 A;  2X51 A;  2NTX A;  2Q9Q C;  4KMC A;  4MAL A;  1HFA A;  3C4X A;  2KMF A;  2BVM A;  3BQL A;  1YKH B;  3B57 A;  2MYS A;  4DND A;  5L3D B;  3F57 A;  3V5S A;  3LFM A;  2XHE B;  1O3X A;  5DJQ C;  5JDM A;  2ES0 A;  2WAU A;  4J2C A;  4OFZ A;  5EZY E;  4ZI2 D;  2LHR A;  2C0S A;  3NRX A;  3KDS E;  5J1G A;  3RYC E;  4NUV A;  3ZMZ B;  2H7O A;  5L2L A;  3VHL A;  2DWK A;  4H9P C;  4H63 H;  3CQG B;  3HA4 A;  4AKI A;  4PK6 A;  2HPJ A;  3H37 A;  3PUQ A;  4ILU A;  2ZLY A;  1Z0P A;  4IE4 A;  3ZN1 B;  1MMG A;  2LSY A;  3PDY A;  1BR2 A;  1B7T A;  2VK9 A;  5FNV E;  3OBV E;  4XZC A;  2XAS B;  2GK9 A;  2CA5 A;  2L8K A;  1D1C A;  4ERR A;  4GOU A;  3WAK A;  3ZJ2 A;  5FY1 A;  4EIW A;  2BDE A;  2CLY C;  2DWG A;  1VOM A;  2Q9Q D;  1HF8 A;  4DBR A;  2XAQ B;  3LBX B;  1BR4 A;  2A3D A;  3ZMS B;  1FMV A;  2D2S A;  2YK0 A;  4XBF B;  3UT5 E;  3MK7 C;  5EK3 A;  3O1I A;  5JR9 A;  4IIJ E;  1LRZ A;  5CA1 E;  2LT3 A;  2X9W A;  3ANW A;  4AI6 A;  2X9Y A;  2CXF A;  3ETV A;  4YHJ A;  4DVD A;  2X67 A;  4X20 E;  2YIN A;  3PTR B;  5F8P A;  4CI2 B;  4H9O C;  5JH7 E;  4NUU A;  2NW9 A;  3NZQ A;  4MLK A;  3PUG A;  3OKQ A;  4BA9 A;  2CCQ A;  3AVS A;  5LHH B;  3MZK B;  5JR9 B;  2CE7 A;  1WR6 A;  2KLQ A;  4PFO A;  2V7I A;  5H6R B;  4MFR A;  2XAG B;  3RRW A;  1E1H B;  2XAJ B;  1YW0 A;  2W63 A;  4ZI3 C;  3MXZ A;  2Y48 B;  5HXR A;  2W62 A;  2JRK A;  5FY0 A;  1MMN A;  4PK5 A;  4QXH B;  1D1A A;  3AA6 B;  2LHN A;  2SPC A;  2D5U A;  2L9Q A;  3S4U A;  3KVB A;  2KZ7 B;  5ETW A;  5GON E;  2LSG A;  4P09 A;  1HTJ F;  5A1L A;  3K3O A;  4A56 A;  2LQU A;  4JEU B;  1VRB A;  2E9X A;  5LOV E;  5HWX A;  4WW0 A;  1G8X A;  4JUY A;  3N9N A;  2JMK A;  4ZHQ E;  1WRD A;  2VAS A;  3UUN A;  1H7C A;  3KV5 A;  4H9N C;  3AB3 B;  2WMN A;  2CM0 A;  2VL8 A;  4K0U A;  5JDN A;  3PHF 1;  2ZM0 A;  3CX6 B;  1OXZ A;  3VU7 H;  5JDL A;  4H9S E;  2E9X B;  4EYY R;  4F6R C;  3NBX X;  3PE0 A;  3LJC A;  3RKO A;  3PU8 A;  4ZI3 D;  4I55 E;  4E7S A;  5CA0 E;  2EHO A;  3SRZ A;  2L3L A;  2VWA A;  4UEL A;  2IAK A;  4YJ2 E;  2KIN B;  5ADX L;  2QA7 A;  4GYR A;  3GMI A;  3RH3 A;  4C91 A;  4DBQ A;  3DTO A;  3WI3 A;  3HR0 A;  2XAH B;  4UIG A;  4WBN E;  5FXX A;  3M65 A;  4N78 D;  3K3N A;  3EDV A;  4QKN A;  3HKD E;  1EZ3 A;  4AQG A;  1WYB A;  4QWN B;  5IYZ E;  4FJO A;  2MBG A;  3VJZ A;  2XUE A;  5JDF A;  2EHO C;  1FIO A;  2NP9 A;  5KDM C;  3L3P A;  5KX5 E;  3EDU A;  4QX8 B;  4YFS A;  4JLE A;  2KT9 A;  2WM9 A;  2LSK A;  1MMA A;  5IHY A;  5LA6 E;  1UCU A;  2CWY A;  3E0Z A;  4CXW A;  3CVR A;  4GK5 E;  5FXV A;  2WBL A;  3R6N A;  4DO0 A;  4EZH A;  3ZMV B;  2IC9 A;  4IDZ A;  2IC6 A;  2PJQ A;  4OYJ A;  5LGU B;  1ZV4 X;  2Y6X A;  3C51 A;  4JEH B;  2DCF A;  5DAB A;  4EB6 E;  2C5K T;  5EK2 A;  4IE0 A;  1SA0 E;  3CX8 B;  1WYC A;  3QC9 A;  4UVB B;  3ZC0 A;  5JRE A;  3FBL A;  5HAX A;  3N9O A;  2KWH A;  3LBX A;  2Y8D A;  2BVL A;  2IW5 B;  5LGT B;  3N2K E;  1D0Y A;  1HG5 A;  2UXX B;  1QSD A;  4V1A v;  3LK3 B;  3SS1 A;  3LK2 B;  2EHO D;  2NWB A;  4EAH A;  3I0Q A;  3QUJ A;  1SHZ C;  5C8Y E;  2YU1 A;  3HKB E;  4ONR A;  3K3Q C;  4GK0 E;  3E08 A;  3MJX A;  3U3I A;  1HS7 A;  3ETU A;  1MIY A;  5JDQ A;  2P9B A;  3SOL A;  5L3B B;  2N9D A;  3MKD A;  4XAX B;  4ZS3 A;  5L3E B;  5JRC B;  4KP3 C;  1ZHC A;  2UXN B;  3J7Y q;  5FMN A;  3C64 A;  3D0T A;  2ODV A;  1LVF A;  1BR1 A;  3UUM A;  2DHR A;  3N9M A;  3ZC1 A;  1D1B A;  4AXP A;  5HWY A;  2A72 A;  2CXL A;  2VKJ A;  3AT7 A;  2VKD A;  2B1E A;  4UF0 B;  3ESL A;  3Q9D A;  2DI4 A;  3AA0 B;  3PF0 A;  3KIN B;  5JR9 C;  1S35 A;  4CQI A;  3ZMU B;  4CI3 B;  3NZP A;  4O4L E;  1NWM X;  4OHF A;  4TV8 E;  1UX4 A;  4ADZ A;  3I9Y A;  3WSC A;  1MND A;  2LSI A;  1X79 A;  4OYK A;  2N1G A;  1UX5 A;  5LNK A;  4PFP A;  2V7K A;  3HKE E;  4G63 A;  4UV9 B;  2W0G A;  3GWH A;  5F3J A;  3RC3 A;  4O2B E;  2X9H A;  3U78 A;  1AJ3 A;  3ZMT B;  3LK4 2;  4H63 V;  1LKX A;  1U5P A;  3AAE B;  5LHG B;  2OA5 A;  5EK4 A;  4O4I E;  4L5G A;  3E22 E;  1IAP A;  4IHJ E;  4C90 A;  2LSJ A;  4PNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...