5HYAA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchangerncx_mj soaked with 150 mm na+ and nominal ca2+
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
Knots found
sequence length
304
structure length
297
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRMGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
total genus 132
structure length 297
sequence length 304
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hyaA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hyaA02
5HWYA 5HXRA 5HYAA 5HXCA 5HXHA 3V5SA 5JDHA 5JDFA 5HXEA 5JDLA 5JDGA 5JDQA 5JDMA 5HXSA 5HWXA 5JDNA 3V5UA
chains in the Genus database with same CATH superfamily
2UU9T 3C4XA 2ZM0A 2BBJA 4EZ4A 3OYXA 3VKGA 2YINA 1UGOA 4YTMA 4AKGA 2B1EA 3ZJ1A 2OLTA 4YTPA 4K0KT 3PUQA 4MLKA 4X64T 5DQWA 5LG3A 1D0XA 2XSBA 4V1Av 2UUBT 2L8KA 4PK6A 4NPPA 4XZCA 2FJAA 4DR1T 2E9XB 2GK9A 4HFHA 2MBGA 3RRWA 4EZHA 3HI2A 3LSVA 1MIVA 4EB6E 4O4JE 3QNUA 1AJ3A 3MACA 5LJMA 2C5JA 5ABFA 3DTOA 5FY7A 5JH7E 3DYJA 3PTRB 3ZN1B 2E2AA 3WAJA 5H6RB 3B5MA 4YXDA 4NXNT 1WLXA 5TAOA 4E7SA 4ZI2C 1IBMT 3MZKB 3ZYKA 5L4HA 3CX8B 2KWHA 3ZSTA 3P4PA 4ZI3D 2J47A 5AQJB 1W0AA 2CPTA 2E9XD 3HR0A 3K1SA 5AQSB 3AXJA 2QYWA 4LFBT 2WBLA 3PUYF 2W63A 3N9NA 3A7MA 4OX9T 2YOEA 2J1DG 2V7IA 3OKQA 3SFDA 2V6YB 1YD8G 4LFCT 4ZZBA 2V7KA 5L3BB 1HF8A 2WU5A 2VASA 5DJQC 4AIUA 2BBHA 5FY1A 5LHGB 5LJNA 5J1GA 4B6XA 3AY5A 5H6QB 2A9UA 2JQHA 2LRLA 2XAFB 3KVAA 5HYAA 1M7KA 4DUZT 2WWVA 2CXDA 1SA0E 4DV4T 3VR8A 3KV9A 2BVMA 3OBVE 3NZQA 3KBUA 3BQLA 2I0MA 2LEHA 2DNXA 4ERRA 4QX7B 2LE8A 5F8PA 4OFZA 5AQVB 4BJNA 4GOUA 1SHZC 4LF8T 4CN6A 4YJ3E 1X9BA 3UUMA 5DQVA 1KNRA 3O1IA 2V5CA 2Y8DA 2IW5B 4PW8A 3AE9A 4UELA 1OWAA 4EV6A 3CX6B 1MMDA 3E0ZA 3P4RA 4AQFA 2KGXA 5HWYA 4HE8A 5ABFB 3CK6A 4UV8B 1EZ3A 3VRBA 2W0GA 4CI2B 4UIGA 4DR7T 3CMLA 2NW8A 1FEWA 2WDQA 3AAEB 2KZ7B 5EZYE 4JI0T 3LG7A 1L0VA 3KFWX 3P4QA 3UQ4A 5JDNA 4WYVA 3RPUA 2EHOD 3P7IA 5C3JA 2D0TA 2Q9QA 3PHF1 2UXCT 3EABA 3HL6A 2XAJB 3AXJB 4HKAA 2KXPB 3CVRA 4KUMB 4HWCA 1R8IA 5CJ5A 4OYKA 1D0YA 4WW0A 1WYCA 3AA0B 3VU7H 5JDLA 4LF4T 2VL8A 4TNWA 2VKHA 1HG2A 3ZCJA 5CA1E 4LMJA 1I94T 1MNEA 2M67A 4I50E 5FXXA 1IJ6A 2CE7A 4PJMA 2WY2A 4DUYT 2ES0A 4U31A 4IE0A 3A8YC 1NAFA 2KT9A 3LBXB 3RYFE 4CZZB 3NBXX 1VCSA 3NKZA 2LSKA 4I43B 3RLFF 3T1YT 1SUMB 5JRCA 4UVAB 4IT4A 3HA4A 1UCUA 4X5TA 1QLBA 4YSYA 1OEDE 5DABA 5BMVE 2DHRA 1HTJF 5JR9C 2X66A 5AQQB 4AQYT 1I6ZA 4U2ZA 5HCMA 4ONRA 2PTFA 1XZYA 3ONJA 3IEEA 4O2BE 3O9XA 2JQKA 2W2UA 1HX8A 5L3FB 3F57A 4F8HA 4JLEA 2JIWA 1LVKA 4AXPA 2E5LT 2IDOB 1E7PA 1NENA 2XM1A 4HEAA 3UU4A 4DR3T 4DMVA 3I9YA 4QKNA 4H9RC 1UUSA 4MBQA 3RI5A 4A56A 3PUSA 1BR2A 3Q9DA 2AE9A 2P9BA 2DLRA 2VWAA 5FYMA 1MMNA 2ZM6T 3VRAA 4LF5T 4BGOA 3L39A 2CBJA 4BJMA 5KMGP 4DBQA 1W09A 4JI4T 4AI6A 1KEYA 3ONXA 4H9QC 4F6RC 2X68A 3AE4A 2BS2A 2VURA 1WR0A 2K3WA 5CFBA 3CKDA 4IDNA 4IE4A 2Q9QB 4DV6T 2V1DB 2X51A 2LM2A 3RX6A 1YKEB 4Z91A 3Q5EA 2HN1A 2J4GA 4F7GB 2XQ3A 2A3DA 5AFUL 1CUNA 4ZI3C 2VKDA 2H88A 3EDVA 1XDOA 5AQHB 2CXLA 1KNZA 3HKCE 3AE8A 5L4EA 5LB7B 2ZM2A 1MIYA 4A97A 4CXYA 5LGUB 1E2AA 3ZJ2A 2WU2A 2X0HA 1VCTA 4PAGA 5FL0A 2LT3A 2BKOA 4DR5T 3ABVA 2ZLYA 5L2LA 3FB2A 3WI3A 2Q9QD 1ZHCA 3F2EA 4B3ST 1FJGT 1CHUA 2V26A 3AB3B 2IC6A 2D5UA 2V6YA 5LBQB 4EYUA 4ILAA 5FNVE 5JRCB 4YSZA 3C4WA 4JI2T 3NVOA 3PJAJ 3AEDA 4QX8B 3O1JA 2YU2A 2OV9A 2W67A 3OJAA 3TLSA 4NXMT 2WS3A 3ZYLA 2LHRA 2H7OA 4YJ2E 1N33T 2K48A 3UU8A 3JAFA 3X1DA 2JRKA 2BG9E 4IDQA 5JDMA 3SWHA 3MXZA 2X9HA 3GA8A 2WZHA 3Q5DA 5LOVE 5LGTB 4JV5T 3ZSSA 3FZMB 3N2OA 4C91A 1J5ET 1U4QA 2YDRA 3L09A 1ZV4X 2CHOA 4ILUA 2XUEA 4TNVA 2VVSA 1N34T 4ANJA 4B3RT 1VOMA 3PUZF 5J2TE 3ZMZB 3P50A 3NRXA 2A2FX 1S94A 3N5LA 4HWDA 5EK4A 3FZFB 4ZEYA 2W61A 3C64A 2JPFA 2X0YA 4AKRB 2X67A 5JVDE 2X9XA 4CN4A 4H9OC 2XJ7A 4DV7T 3EUHA 4H63H 3JCFA 3RIUA 1VRBA 5HEHA 1J1JA 2CLYC 1XMOT 4WBOA 5LXTE 3OYZA 2KVPA 3BQKA 2XPKA 3VR9A 4H9SE 1WFDA 3AAIA 3M65A 3RIUC 3AEBA 5JDQA 5HAXA 4UV9B 2XQ7A 3GWHA 2WB5A 3LK2B 1YKHB 2V8SV 2BKNA 2NWBA 2XHEB 3C98B 4KI0F 4JEHB 5KX5E 1IZNB 3ZMUB 3UU6A 5AQIB 2XAGB 3RIAA 4HFBA 4J2CA 2DL1A 4QWNB 4P1NA 3N9OA 4U3CA 1BR1A 4I55E 3RC8A 5BR8T 3B13A 2X0CA 4YHJA 5T1DA 3BK9A 2AXDS 2KINB 5AQMB 3LBXA 5LMNT 1ZKEA 5CB4E 4LF9T 1KK7A 2MAWA 4TWFA 4IDOA 4GIWA 3AEEA 2XY8B 2YDSA 2NTXA 4PFPA 2HPLA 3DP7A 3RH3A 1KNPA 4ZS3A 3F31A 4UF0A 2UUAT 1SJ8A 4X1IE 2RPAA 3I0QA 2D0UA 3DJBA 4ILCA 2WMOA 2KBBA 4WNKA 4CI3B 2Y48B 3N2GE 4DNDA 3PJAA 3JADA 5HXSA 4Z90A 2L3LA 1T7SA 2FJEA 4ECGA 3M3ZB 4X66T 3ZT7A 1BR4A 1MIWA 1ZOYA 1T98A 4B3TT 4Z8XA 2WSSV 3AA1B 1KFYA 4OHFA 4IDZA 2V5DA 4QXCB 4EEBA 2YEVC 2QRXA 4DVDA 4NUUA 2CLYB 2V7MA 2CMRA 2LLYA 3KVBA 5IHYA 3UU3A 4A5XA 2W00A 1XNRT 3SS1A 3C4ZA 3IHRA 3RGLA 2CRBA 3EI0A 4XAXB 2DCFA 2D2SA 3O1HA 5ABHA 3ZPOA 2WDVA 4EXTA 3EAMA 4LMKA 4TV9E 3QB5A 2WZIA 1T72A 3K3OA 1XMQT 4ILBA 3N9LA 5AQOB 3IBPA 3Q2MA 2CWOA 1N32T 3TLTA 2C0SA 4I4TE 4QH1A 4ZOLE 5CA0E 2WAUA 1J5WA 2FUPA 4UEMA 4OYJA 4YHHT 1Z0PA 1HS7A 4HWIB 3W15B 3GN5A 4MALA 3TKLB 4EYYR 4PNIA 3WAKA 3MJXA 2PFVA 3MA9A 4O4HE 4JEUB 2I6HA 4EEDA 4PJJA 5IYZE 5LHIB 1X79A 2YKSA 4AQGA 4CQIA 2DWGA 4JI8T 2ZMAA 1KF6A 4QXHB 2KWIB 3UFEA 4ZI7E 2H3RA 3IA3A 3PUVF 4GYRA 4U33A 2WCAA 3UQ7A 3PU8A 3KINB 1D0ZA 3AECA 3PUWF 5JR9A 5JQGE 2XTLA 4IL4A 5FVLA 1BR0A 3AE6A 2LSJA 4KX6A 2I59A 2V7JA 2MOZA 4UF0B 2CM0A 5IWAT 4YFSA 5F5WA 3PUAA 2LSIA 2XAQB 2YDQA 4B3MT 4YT0A 4G63A 2NR4A 1QSDA 4IE6A 3K3QC 2IIUA 4KMCA 2LKHA 3ZC0A 3AE2A 4DR6T 3SRZA 4X20E 4CI1B 3K8PC 3LK3B 3QK6A 3KV5A 5L47A 3LK42 5AQGB 4DBRA 1HNWT 4OK0A 4QHOA 3TLWA 2W66A 1JNZA 1HR0T 1IAPA 1N36T 3CQGB 1XDPA 4YLHA 5L3GB 4EAHA 5FXWA 5LGNB 3QOFA 3P8CD 2C5IT 2JQ9A 2L9QA 3R84B 4DV2T 3N9PA 5FXZA 4L9IA 2J62A 3P4SA 3RIFA 3AVRA 4HWFA 2K5BB 3P4WA 4NIQA 3KV4A 3E08A 5JDFA 4ISTA 4DIDB 2VK9A 1G8XA 2NW7A 3CQCB 2XQ6A 2NOXA 4BAYB 4GK0E 5A1LA 2E9XC 1M62A 2YN6A 3BQIA 4TZ4C 4X62T 5ABEA 3G06A 3GN5B 2B76A 3AEGA 1MNDA 1WYBA 4QH5A 4FJOA 5ABGA 4JBWF 2UXBT 3AE5A 4ASKA 3SOLA 5LHHB 3AE3A 2VKJA 3NWIA 4MFRA 4IL9A 3AA6B 2FJDA 4X1YE 2NP9A 1UX4A 5JR9B 2WM9A 3LDQB 1LKXA 3NRYA 2IUBA 5F3JA 2ACZA 3LJCA 5JDGA 2V7LA 5AQUB 5HWXA 3C51A 2ODVA 4TWDA 4DV5T 4ZZCA 2YK0A 4M1PA 4O2AE 3UUXB 3JC6D 4QXBB 2XZEA 3I1AA 2QA7A 2W4XA 5LP6E 4PK4A 2MTQA 2C5KT 3H37A 5AQPB 4AKIA 3OPCA 3AE1A 3J7Yq 4P09A 2HN2A 2FBWA 2PJQA 4ZS2A 2UXXB 2M6BA 3ZMVB 2HPJA 3VKHA 1UX5A 4TUYE 2IMLA 4KHZF 4YSXA 4LFAT 3Q5WA 4H9NC 4MHCA 3AE7A 4X65T 4G2AA 3CQXC 4HFDA 4Q25A 3OVUA 2VQFT 3CX7B 3FZLB 3PUGA 2M6IA 4UVBB 2MPKA 4PJLA 1D1BA 4IDPA 2XASB 3GMIA 5HCJA 4JI6T 1YW0A 4PJNA 1YXRA 4C90A 2V6XA 5FVKA 3V5SA 4E7ZA 1W9RA 3I0OA 2EHOA 1Y64B 4DV3T 3CPZA 2SPCA 3ETUA 3ZYMA 5GONE 3RKGA 1MMAA 2VVNA 4LMLA 3H3MA 3J9X1 2EHOC 1OEDA 1FIOA 4NUVA 3S4UA 4EOZB 3FBZA 1IBLT 2YU1A 3RRCA 2X9YA 5C2TA 2IC9A 5ETWA 3AVSA 5FXVA 2CCQA 2CA5A 4EGWA 5KXJA 4JUYA 2X9WA 1OEDC 4WZXA 5FL1A 1SJ7A 1B7TA 1YQ3A 4JI5T 2MTCA 3RYCE 4DR2T 1NEKA 2VL0A 2X0LB 5AQKB 4PK5A 2LOSA 2WQYA 3FZKB 3ZT5A 4CXWA 1V9DA 2LOPA 4DV0T 3CWZB 2F4VT 4U72A 2N1GA 3ZLIA 1OXZA 1WCRA 3FXDB 2WP9A 2CEAA 4ZHQE 3AT7A 4JI7T 4COFA 5FMNA 4K0UA 2LQUA 5EK2A 2VB6A 4TN7B 3PUXF 2KSRA 4AISA 5LBMA 4I0UA 3FZHB 2XAHB 5HEGA 4ISSA 1ZP0A 3RQWA 3U78A 3ANWA 3MKDA 1MMGA 1DU2A 4BA9A 4QH4A 3ESLA 4FI5A 2ACXA 4TWHA 3UUNA 3RYHE 2L10A 4DV1T 2IAKA 1IJ5A 2DI4A 2JQQA 5AQNB 3ZCIA 1T8BA 2N9DA 4GKKT 3V5UA 2E8IA 3WURA 5FKYA 2R6GF 3K3NA 4TV8E 2LSGA 3ETVA 1JNRA 1US7B 3KDSE 5L3EB 2WMNA 3AA7B 1HCIA 4JI1T 2EHOB 4KP3C 4P0BA 2RA1A 3FBLA 4U2YA 5LG4A 5M4YA 4HFCA 2IHR1 4AKHA 3PURA 5HXRA 2BDEA 1OEDB 4X1KE 2BS4A 4YY3T 3JAEA 4O8SA 5C8YE 4EIWA 2OA5A 4DO0A 2JMHA 4AQFC 5HEJA 3UTKA 2BG9A 1LVFA 4O4LE 1U5PA 2UUCT 1XWMA 2N2NA 2XQYA 3HKDE 1W0BA 4ZI2D 3OTOT 3LFMA 3T8OA 5JREA 5CGMA 2HHHT 3L3PA 1UURA 2BG9C 4GK5E 4UVCB 3A5XA 2XQ9A 5FZTA 3RF1A 5KDMC 2CHNA 2Q9QC 4WBNE 3MK7C 4IREA 2XQ8A 2CWYA 3RQUA 4GYSA 2NW9A 5L3CB 5AQLB 2LHNA 3RKOA 2XQ4A 1WRDA 4PFOA 2KMFA 4KHPT 2FJBA 4IE5A 4ZXLA 5LA6E 2UXDT 4L5GA 2WWUA 4A98A 3QUJA 3QB5K 4HN9A 2LM9A 2MYSA 3JC6C 2DWKA 3TLVA 2XSAA 1UK5A 2K9AA 2A72A 3I9WA 2NTYA 2BZBA 2ZM8A 2BKPA 3SFEA 4H63V 5LMUT 3D0TA 3ANWB 5FP3A 2QVAA 1O3XA 1HX1B 2ODUA 2LJLA 2D9DA 3U3IA 3O4XE 3RYIE 2QGSA 4HFVA 2E5VA 4HFIA 3L8RA 4U7IA 4CXXA 3UT5E 2H7VC 1D1CA 3WSCA 3ZEFB 4N78D 3ZC1A 5AQFB 1XNQT 5EK3A 4U74A 4IHJE 3KBTA 4HFEA 4GKJT 2PG8A 2XQAA 2CBIA 3RHWA 1SE7A 4O4IE 1ZEEA 3TLUA 3N2KE 2W62A 1GQEA 5AQRB 3QC9A 3EVYA 1H7CA 3PU3A 2BS3A 3UULA 4UR9A 1FMVA 3FHNA 1NWMX 5LNKA 1IBKT 3FXEB 3HKEE 2LRKA 2G0UA 2KNDA 3ZMSB 2XQ5A 4XBFB 2E9XA 3VJZA 5J2UE 4IGUA 2Z6EA 4UXNB 5HXEA 5HEUA 3ZN0B 3EHZA 3C50A 5L3DB 4HGAA 3M1CA 2BG9B 3ZT6A 3PV0F 2BVLA 2H89A 5AQTB 4P0AA 3KV6A 2HH7A 3PDYA 4U7YA 4ADZA 3FYQA 3UU5A 1FMWA 1D1AA 4L0RA 3IF8B 3T1HT 5FY0A 5IUXA 1HG5A 5HXHA 4LF6T 3NZPA 3AEFA 5LCYA 1HNZT 2UXNB 2KLQA 2LSYA 2PBIA 4DR4T 2VKOA 3ZMTB 2L7NA 2JJ9A 5HXCA 3B57A 1YQ4A 1HNXT 3H3AA 3ONLC 4IIJE 3PE0A 5HEOA 5E0OA 3UFGA 4KBMB 4AKLA 1E1HB 3R6NA 3RC3A 4JI3T 4HTEA 1HFAA 1WR6A 2Y6XA 4JYAT 5J0ZA 1QUUA 3UUBA 5JTGA 4H9PC 2XM2A 4YTNA 3AEAA 3HKBE 2JMKA 4LF7T 2RP4A 1Z8UA 4HWHA 5JDHA 2VQET 2LKGA 3PF0A 3EDUA 4IE7A 2K24A 3AAAB 2CXFA 1S35A 3Q5XA 4W8PA 3ZKRA 3E22E 4CN1A 1LRZA 4TX5A 3N9MA 2WDRA 3CIRA 1G73A 5LYJE 1Y01A 4DMWA 5ADXL 3VHLA 3N9QA
chains in the Genus database with same CATH topology
4BJMA 5FMNA 3C4XA 4UEMA 4OYJA 1Z0PA 4K0UA 2LQUA 5KMGP 2ZM0A 4DBQA 5EK2A 1HS7A 3W15B 2VB6A 3GN5A 4EZ4A 4TN7B 4MALA 3TKLB 4EYYR 4AI6A 3OYXA 4PNIA 3WAKA 3ONXA 4H9QC 3MJXA 2PFVA 3MA9A 4O4HE 4JEUB 4F6RC 2X68A 3VKGA 2YINA 4PJJA 5IYZE 5LHIB 5LBMA 1X79A 4AKGA 2XAHB 3CKDA 2B1EA 4AQGA 3ZJ1A 4CQIA 4IE4A 2Q9QB 2DWGA 4ISSA 3U78A 3ANWA 3MKDA 3PUQA 1MMGA 4MLKA 2V1DB 2ZMAA 4QXHB 2X51A 5DQWA 2KWIB 3RX6A 3UFEA 1YKEB 3ESLA 4BA9A 2H3RA 4GYRA 4ZI7E 4FI5A 1D0XA 3PU8A 3KINB 2ACXA 1D0ZA 2A3DA 4V1Av 1CUNA 3UUNA 2L8KA 5AFUL 3RYHE 4ZI3C 4PK6A 2VKDA 3EDVA 5JR9A 5JQGE 2XTLA 4XZCA 2CXLA 2IAKA 1KNZA 1IJ5A 2DI4A 2E9XB 2JQQA 3HKCE 1BR0A 2GK9A 3ZCIA 2N9DA 2MBGA 2ZM2A 3RRWA 3V5UA 2LSJA 1MIYA 2E8IA 2I59A 2V7JA 4CXYA 5LGUB 3WURA 4EZHA 2MOZA 4UF0B 3HI2A 2CM0A 3ZJ2A 4YFSA 1MIVA 4EB6E 4O4JE 3PUAA 1AJ3A 3MACA 3K3NA 2LSIA 2XAQB 4TV8E 5LJMA 2C5JA 4PAGA 2LSGA 3DTOA 3ETVA 2LT3A 1US7B 5FY7A 5JH7E 3KDSE 4G63A 5L3EB 1QSDA 3PTRB 3ZN1B 4IE6A 2WMNA 2ZLYA 3K3QC 5L2LA 3WAJA 3AA7B 5H6RB 3FB2A 3WI3A 2Q9QD 1ZHCA 3F2EA 1HCIA 1WLXA 5TAOA 2V26A 3AB3B 4KMCA 2IC6A 2D5UA 2EHOB 4E7SA 4KP3C 4ZI2C 3ZC0A 4P0BA 2RA1A 3MZKB 3SRZA 4X20E 5LBQB 4CI1B 3FBLA 4EYUA 3ZYKA 3CX8B 2KWHA 3K8PC 5FNVE 5JRCB 3C4WA 3LK3B 3QK6A 5LG4A 5M4YA 4ZI3D 3KV5A 4AKHA 3PURA 2E9XD 3HR0A 4QX8B 3LK42 5HXRA 4DBRA 2BDEA 3O1JA 2YU2A 4X1KE 4OK0A 4QHOA 3OJAA 2WBLA 4O8SA 1IAPA 2W63A 3ZYLA 5C8YE 4EIWA 3N9NA 2LHRA 2H7OA 2OA5A 4YJ2E 3CQGB 4DO0A 4YLHA 2K48A 5L3GB 2JMHA 4EAHA 4AQFC 2JRKA 3UTKA 2J1DG 5FXWA 5JDMA 5LGNB 3SWHA 3MXZA 1LVFA 3P8CD 2C5IT 3R84B 2L9QA 1U5PA 2V7IA 3OKQA 3N9PA 4O4LE 5FXZA 1YD8G 2X9HA 3GA8A 4L9IA 2N2NA 2XQYA 3HKDE 2V7KA 5L3BB 5LOVE 4ZI2D 3AVRA 5LGTB 3LFMA 3T8OA 1HF8A 5JREA 2VASA 5DJQC 3L3PA 4GK5E 4UVCB 2K5BB 3N2OA 5FY1A 3A5XA 5LHGB 3WSCA 4C91A 3KV4A 5LJNA 1U4QA 5J1GA 3E08A 5KDMC 5JDFA 4B6XA 2Q9QC 4WBNE 4ISTA 3MK7C 2VK9A 3L09A 5H6QB 1G8XA 1ZV4X 2NW7A 3CQCB 4ILUA 2CWYA 2XUEA 4GYSA 2NOXA 2XAFB 3KVAA 2NW9A 5L3CB 5HYAA 4BAYB 2LHNA 3RKOA 4ANJA 1WRDA 4PFOA 2CXDA 1VOMA 1SA0E 2KMFA 5J2TE 4GK0E 3KV9A 3ZMZB 2BVMA 5A1LA 3OBVE 3NZQA 4IE5A 2E9XC 3NRXA 2A2FX 5LA6E 3BQIA 3KBUA 2WWUA 1S94A 3N5LA 4L5GA 3QUJA 4TZ4C 4HN9A 2LM9A 5EK4A 2W61A 3BQLA 3GN5B 2MYSA 3JC6C 1MNDA 2LEHA 3C64A 2JPFA 2DWKA 1WYBA 4AKRB 2DNXA 2X67A 4FJOA 4ERRA 5JVDE 4QX7B 2K9AA 2A72A 2X9XA 3I9WA 2NTYA 2BZBA 4H9OC 2LE8A 3EUHA 4ASKA 2ZM8A 4H63H 3SOLA 5LHHB 5F8PA 2VKJA 1VRBA 4OFZA 4H63V 4MFRA 4BJNA 2CLYC 3D0TA 4GOUA 4WBOA 3AA6B 1SHZC 3ANWB 5FP3A 5LXTE 3OYZA 4X1YE 1O3XA 3BQKA 4YJ3E 2ODUA 3UUMA 2LJLA 2NP9A 5DQVA 3O1IA 4H9SE 3AAIA 1UX4A 2Y8DA 3M65A 5JR9B 3U3IA 5JDQA 3O4XE 2WM9A 2IW5B 1LKXA 4PW8A 3NRYA 3RYIE 4UELA 5F3JA 2QGSA 4HFVA 5HAXA 3LJCA 5JDGA 1OWAA 2V7LA 3CX6B 1MMDA 5HWXA 4UV9B 3C51A 3E0ZA 2ODVA 3GWHA 4CXXA 3LK2B 3UT5E 1YKHB 4AQFA 2YK0A 4M1PA 5HWYA 2NWBA 2H7VC 2XHEB 1D1CA 4O2AE 3UUXB 3C98B 4HE8A 4JEHB 5KX5E 1IZNB 3JC6D 3ZMUB 3ZEFB 4N78D 4QXBB 3ZC1A 4UV8B 1EZ3A 3I1AA 2XAGB 2W0GA 5EK3A 2QA7A 4U74A 4IHJE 4CI2B 4UIGA 5LP6E 4PK4A 3KBTA 3CMLA 2MTQA 2NW8A 1FEWA 2PG8A 2C5KT 3H37A 4J2CA 4QWNB 3AAEB 3N9OA 2KZ7B 4AKIA 5EZYE 1BR1A 3LG7A 4O4IE 3J7Yq 3KFWX 1ZEEA 4P09A 3N2KE 4I55E 3RC8A 5JDNA 2W62A 3RPUA 3QC9A 2EHOD 2PJQA 3P7IA 4ZS2A 3EVYA 2D0TA 2UXXB 3ZMVB 2Q9QA 1H7CA 3B13A 3PU3A 3PHF1 2HPJA 3UULA 3VKHA 1UX5A 1FMVA 4TUYE 4YHJA 5T1DA 3FHNA 3BK9A 1NWMX 3HL6A 5LNKA 3Q5WA 2XAJB 3FXEB 4H9NC 4MHCA 3HKEE 2KINB 3LBXA 4HKAA 2KXPB 3CVRA 1ZKEA 2G0UA 2KNDA 4G2AA 4KUMB 5CB4E 3CQXC 3ZMSB 1KK7A 4OYKA 1D0YA 4WW0A 4GIWA 4XBFB 1WYCA 3AA0B 2E9XA 2NTXA 3CX7B 3VU7H 3PUGA 4PFPA 5JDLA 2HPLA 3VJZA 5J2UE 4UVBB 4IGUA 3DP7A 2Z6EA 3RH3A 4PJLA 4UXNB 2VL8A 4ZS3A 1D1BA 3ZN0B 5HXEA 3F31A 2VKHA 3C50A 2XASB 3GMIA 4UF0A 5L3DB 1HG2A 4HGAA 3ZCJA 3M1CA 4X1IE 1YW0A 4PJNA 2BVLA 5CA1E 1MNEA 2M67A 4P0AA 3KV6A 4C90A 2HH7A 3I0QA 3PDYA 2D0UA 3DJBA 4I50E 4ADZA 5FXXA 1FMWA 1IJ6A 2CE7A 2WMOA 4PJMA 1D1AA 4WNKA 4L0RA 2ES0A 3V5SA 4E7ZA 4CI3B 2Y48B 3N2GE 4IE0A 3IF8B 4DNDA 5FY0A 1HG5A 3I0OA 1NAFA 2KT9A 5HXHA 3LBXB 2EHOA 3RYFE 4CZZB 1Y64B 3NZPA 3NBXX 5LCYA 5HXSA 2L3LA 2SPCA 3CPZA 2LSKA 4I43B 3ETUA 3ZYMA 5GONE 2UXNB 1MMAA 5JRCA 2KLQA 4ECGA 2LSYA 2PBIA 1BR4A 1MIWA 3HA4A 4UVAB 1UCUA 1T98A 2VKOA 3ZMTB 5DABA 5BMVE 2JJ9A 4Z8XA 5HXCA 3J9X1 3B57A 2EHOC 2WSSV 3AA1B 1FIOA 4NUVA 4OHFA 3S4UA 2DHRA 3H3AA 4IDZA 4EOZB 1HTJF 4IIJE 3FBZA 2YU1A 5JR9C 3PE0A 4QXCB 2X66A 3RRCA 2X9YA 5E0OA 2IC9A 5ETWA 3AVSA 2YEVC 4KBMB 4AKLA 1E1HB 5FXVA 2CCQA 2CA5A 3R6NA 4DVDA 3RC3A 4NUUA 2CLYB 2V7MA 4JUYA 2X9WA 4HTEA 4ONRA 1HFAA 2CMRA 1WR6A 3IEEA 2Y6XA 1B7TA 3KVBA 4O2BE 2MTCA 5IHYA 3RYCE 4BGOA 2W00A 3O9XA 3SS1A 1QUUA 1HX8A 4H9PC 5L3FB 3C4ZA 2X0LB 3IHRA 3HKBE 4PK5A 3F57A 2LOSA 4JLEA 2JMKA 1LVKA 4AXPA 4XAXB 2RP4A 2DCFA 2D2SA 5JDHA 4HEAA 4CXWA 1V9DA 2LOPA 3O1HA 3ZPOA 3PF0A 3EDUA 4DMVA 3CWZB 4IE7A 4EXTA 3I9YA 4QKNA 2K24A 4H9RC 4TV9E 3AAAB 2CXFA 1S35A 3Q5XA 4MBQA 4U72A 2N1GA 4A56A 3ZLIA 3K3OA 3PUSA 1OXZA 3E22E 1LRZA 3N9LA 4TX5A 1BR2A 3Q9DA 3FXDB 3N9MA 3IBPA 2P9BA 2DLRA 2CWOA 3Q2MA 1G73A 2CEAA 2C0SA 4I4TE 4ZHQE 4ZOLE 2VWAA 5LYJE 5FYMA 1MMNA 4DMWA 5CA0E 5ADXL 3AT7A 3VHLA 2WAUA 3N9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWY A;  5HXR A;  5HYA A;  5HXC A;  5HXH A;  3V5S A;  5JDH A;  5JDF A;  5HXE A;  5JDL A;  5JDG A;  5JDQ A;  5JDM A;  5HXS A;  5HWX A;  5JDN A;  3V5U A; 
#chains in the Genus database with same CATH topology
 2UU9 T;  3C4X A;  2ZM0 A;  2BBJ A;  4EZ4 A;  3OYX A;  3VKG A;  2YIN A;  1UGO A;  4YTM A;  4AKG A;  2B1E A;  3ZJ1 A;  2OLT A;  4YTP A;  4K0K T;  3PUQ A;  4MLK A;  4X64 T;  5DQW A;  5LG3 A;  1D0X A;  2XSB A;  4V1A v;  2UUB T;  2L8K A;  4PK6 A;  4NPP A;  4XZC A;  2FJA A;  4DR1 T;  2E9X B;  2GK9 A;  4HFH A;  2MBG A;  3RRW A;  4EZH A;  3HI2 A;  3LSV A;  1MIV A;  4EB6 E;  4O4J E;  3QNU A;  1AJ3 A;  3MAC A;  5LJM A;  2C5J A;  5ABF A;  3DTO A;  5FY7 A;  5JH7 E;  3DYJ A;  3PTR B;  3ZN1 B;  2E2A A;  3WAJ A;  5H6R B;  3B5M A;  4YXD A;  4NXN T;  1WLX A;  5TAO A;  4E7S A;  4ZI2 C;  1IBM T;  3MZK B;  3ZYK A;  5L4H A;  3CX8 B;  2KWH A;  3ZST A;  3P4P A;  4ZI3 D;  2J47 A;  5AQJ B;  1W0A A;  2CPT A;  2E9X D;  3HR0 A;  3K1S A;  5AQS B;  3AXJ A;  2QYW A;  4LFB T;  2WBL A;  3PUY F;  2W63 A;  3N9N A;  3A7M A;  4OX9 T;  2YOE A;  2J1D G;  2V7I A;  3OKQ A;  3SFD A;  2V6Y B;  1YD8 G;  4LFC T;  4ZZB A;  2V7K A;  5L3B B;  1HF8 A;  2WU5 A;  2VAS A;  5DJQ C;  4AIU A;  2BBH A;  5FY1 A;  5LHG B;  5LJN A;  5J1G A;  4B6X A;  3AY5 A;  5H6Q B;  2A9U A;  2JQH A;  2LRL A;  2XAF B;  3KVA A;  5HYA A;  1M7K A;  4DUZ T;  2WWV A;  2CXD A;  1SA0 E;  4DV4 T;  3VR8 A;  3KV9 A;  2BVM A;  3OBV E;  3NZQ A;  3KBU A;  3BQL A;  2I0M A;  2LEH A;  2DNX A;  4ERR A;  4QX7 B;  2LE8 A;  5F8P A;  4OFZ A;  5AQV B;  4BJN A;  4GOU A;  1SHZ C;  4LF8 T;  4CN6 A;  4YJ3 E;  1X9B A;  3UUM A;  5DQV A;  1KNR A;  3O1I A;  2V5C A;  2Y8D A;  2IW5 B;  4PW8 A;  3AE9 A;  4UEL A;  1OWA A;  4EV6 A;  3CX6 B;  1MMD A;  3E0Z A;  3P4R A;  4AQF A;  2KGX A;  5HWY A;  4HE8 A;  5ABF B;  3CK6 A;  4UV8 B;  1EZ3 A;  3VRB A;  2W0G A;  4CI2 B;  4UIG A;  4DR7 T;  3CML A;  2NW8 A;  1FEW A;  2WDQ A;  3AAE B;  2KZ7 B;  5EZY E;  4JI0 T;  3LG7 A;  1L0V A;  3KFW X;  3P4Q A;  3UQ4 A;  5JDN A;  4WYV A;  3RPU A;  2EHO D;  3P7I A;  5C3J A;  2D0T A;  2Q9Q A;  3PHF 1;  2UXC T;  3EAB A;  3HL6 A;  2XAJ B;  3AXJ B;  4HKA A;  2KXP B;  3CVR A;  4KUM B;  4HWC A;  1R8I A;  5CJ5 A;  4OYK A;  1D0Y A;  4WW0 A;  1WYC A;  3AA0 B;  3VU7 H;  5JDL A;  4LF4 T;  2VL8 A;  4TNW A;  2VKH A;  1HG2 A;  3ZCJ A;  5CA1 E;  4LMJ A;  1I94 T;  1MNE A;  2M67 A;  4I50 E;  5FXX A;  1IJ6 A;  2CE7 A;  4PJM A;  2WY2 A;  4DUY T;  2ES0 A;  4U31 A;  4IE0 A;  3A8Y C;  1NAF A;  2KT9 A;  3LBX B;  3RYF E;  4CZZ B;  3NBX X;  1VCS A;  3NKZ A;  2LSK A;  4I43 B;  3RLF F;  3T1Y T;  1SUM B;  5JRC A;  4UVA B;  4IT4 A;  3HA4 A;  1UCU A;  4X5T A;  1QLB A;  4YSY A;  1OED E;  5DAB A;  5BMV E;  2DHR A;  1HTJ F;  5JR9 C;  2X66 A;  5AQQ B;  4AQY T;  1I6Z A;  4U2Z A;  5HCM A;  4ONR A;  2PTF A;  1XZY A;  3ONJ A;  3IEE A;  4O2B E;  3O9X A;  2JQK A;  2W2U A;  1HX8 A;  5L3F B;  3F57 A;  4F8H A;  4JLE A;  2JIW A;  1LVK A;  4AXP A;  2E5L T;  2IDO B;  1E7P A;  1NEN A;  2XM1 A;  4HEA A;  3UU4 A;  4DR3 T;  4DMV A;  3I9Y A;  4QKN A;  4H9R C;  1UUS A;  4MBQ A;  3RI5 A;  4A56 A;  3PUS A;  1BR2 A;  3Q9D A;  2AE9 A;  2P9B A;  2DLR A;  2VWA A;  5FYM A;  1MMN A;  2ZM6 T;  3VRA A;  4LF5 T;  4BGO A;  3L39 A;  2CBJ A;  4BJM A;  5KMG P;  4DBQ A;  1W09 A;  4JI4 T;  4AI6 A;  1KEY A;  3ONX A;  4H9Q C;  4F6R C;  2X68 A;  3AE4 A;  2BS2 A;  2VUR A;  1WR0 A;  2K3W A;  5CFB A;  3CKD A;  4IDN A;  4IE4 A;  2Q9Q B;  4DV6 T;  2V1D B;  2X51 A;  2LM2 A;  3RX6 A;  1YKE B;  4Z91 A;  3Q5E A;  2HN1 A;  2J4G A;  4F7G B;  2XQ3 A;  2A3D A;  5AFU L;  1CUN A;  4ZI3 C;  2VKD A;  2H88 A;  3EDV A;  1XDO A;  5AQH B;  2CXL A;  1KNZ A;  3HKC E;  3AE8 A;  5L4E A;  5LB7 B;  2ZM2 A;  1MIY A;  4A97 A;  4CXY A;  5LGU B;  1E2A A;  3ZJ2 A;  2WU2 A;  2X0H A;  1VCT A;  4PAG A;  5FL0 A;  2LT3 A;  2BKO A;  4DR5 T;  3ABV A;  2ZLY A;  5L2L A;  3FB2 A;  3WI3 A;  2Q9Q D;  1ZHC A;  3F2E A;  4B3S T;  1FJG T;  1CHU A;  2V26 A;  3AB3 B;  2IC6 A;  2D5U A;  2V6Y A;  5LBQ B;  4EYU A;  4ILA A;  5FNV E;  5JRC B;  4YSZ A;  3C4W A;  4JI2 T;  3NVO A;  3PJA J;  3AED A;  4QX8 B;  3O1J A;  2YU2 A;  2OV9 A;  2W67 A;  3OJA A;  3TLS A;  4NXM T;  2WS3 A;  3ZYL A;  2LHR A;  2H7O A;  4YJ2 E;  1N33 T;  2K48 A;  3UU8 A;  3JAF A;  3X1D A;  2JRK A;  2BG9 E;  4IDQ A;  5JDM A;  3SWH A;  3MXZ A;  2X9H A;  3GA8 A;  2WZH A;  3Q5D A;  5LOV E;  5LGT B;  4JV5 T;  3ZSS A;  3FZM B;  3N2O A;  4C91 A;  1J5E T;  1U4Q A;  2YDR A;  3L09 A;  1ZV4 X;  2CHO A;  4ILU A;  2XUE A;  4TNV A;  2VVS A;  1N34 T;  4ANJ A;  4B3R T;  1VOM A;  3PUZ F;  5J2T E;  3ZMZ B;  3P50 A;  3NRX A;  2A2F X;  1S94 A;  3N5L A;  4HWD A;  5EK4 A;  3FZF B;  4ZEY A;  2W61 A;  3C64 A;  2JPF A;  2X0Y A;  4AKR B;  2X67 A;  5JVD E;  2X9X A;  4CN4 A;  4H9O C;  2XJ7 A;  4DV7 T;  3EUH A;  4H63 H;  3JCF A;  3RIU A;  1VRB A;  5HEH A;  1J1J A;  2CLY C;  1XMO T;  4WBO A;  5LXT E;  3OYZ A;  2KVP A;  3BQK A;  2XPK A;  3VR9 A;  4H9S E;  1WFD A;  3AAI A;  3M65 A;  3RIU C;  3AEB A;  5JDQ A;  5HAX A;  4UV9 B;  2XQ7 A;  3GWH A;  2WB5 A;  3LK2 B;  1YKH B;  2V8S V;  2BKN A;  2NWB A;  2XHE B;  3C98 B;  4KI0 F;  4JEH B;  5KX5 E;  1IZN B;  3ZMU B;  3UU6 A;  5AQI B;  2XAG B;  3RIA A;  4HFB A;  4J2C A;  2DL1 A;  4QWN B;  4P1N A;  3N9O A;  4U3C A;  1BR1 A;  4I55 E;  3RC8 A;  5BR8 T;  3B13 A;  2X0C A;  4YHJ A;  5T1D A;  3BK9 A;  2AXD S;  2KIN B;  5AQM B;  3LBX A;  5LMN T;  1ZKE A;  5CB4 E;  4LF9 T;  1KK7 A;  2MAW A;  4TWF A;  4IDO A;  4GIW A;  3AEE A;  2XY8 B;  2YDS A;  2NTX A;  4PFP A;  2HPL A;  3DP7 A;  3RH3 A;  1KNP A;  4ZS3 A;  3F31 A;  4UF0 A;  2UUA T;  1SJ8 A;  4X1I E;  2RPA A;  3I0Q A;  2D0U A;  3DJB A;  4ILC A;  2WMO A;  2KBB A;  4WNK A;  4CI3 B;  2Y48 B;  3N2G E;  4DND A;  3PJA A;  3JAD A;  5HXS A;  4Z90 A;  2L3L A;  1T7S A;  2FJE A;  4ECG A;  3M3Z B;  4X66 T;  3ZT7 A;  1BR4 A;  1MIW A;  1ZOY A;  1T98 A;  4B3T T;  4Z8X A;  2WSS V;  3AA1 B;  1KFY A;  4OHF A;  4IDZ A;  2V5D A;  4QXC B;  4EEB A;  2YEV C;  2QRX A;  4DVD A;  4NUU A;  2CLY B;  2V7M A;  2CMR A;  2LLY A;  3KVB A;  5IHY A;  3UU3 A;  4A5X A;  2W00 A;  1XNR T;  3SS1 A;  3C4Z A;  3IHR A;  3RGL A;  2CRB A;  3EI0 A;  4XAX B;  2DCF A;  2D2S A;  3O1H A;  5ABH A;  3ZPO A;  2WDV A;  4EXT A;  3EAM A;  4LMK A;  4TV9 E;  3QB5 A;  2WZI A;  1T72 A;  3K3O A;  1XMQ T;  4ILB A;  3N9L A;  5AQO B;  3IBP A;  3Q2M A;  2CWO A;  1N32 T;  3TLT A;  2C0S A;  4I4T E;  4QH1 A;  4ZOL E;  5CA0 E;  2WAU A;  1J5W A;  2FUP A;  4UEM A;  4OYJ A;  4YHH T;  1Z0P A;  1HS7 A;  4HWI B;  3W15 B;  3GN5 A;  4MAL A;  3TKL B;  4EYY R;  4PNI A;  3WAK A;  3MJX A;  2PFV A;  3MA9 A;  4O4H E;  4JEU B;  2I6H A;  4EED A;  4PJJ A;  5IYZ E;  5LHI B;  1X79 A;  2YKS A;  4AQG A;  4CQI A;  2DWG A;  4JI8 T;  2ZMA A;  1KF6 A;  4QXH B;  2KWI B;  3UFE A;  4ZI7 E;  2H3R A;  3IA3 A;  3PUV F;  4GYR A;  4U33 A;  2WCA A;  3UQ7 A;  3PU8 A;  3KIN B;  1D0Z A;  3AEC A;  3PUW F;  5JR9 A;  5JQG E;  2XTL A;  4IL4 A;  5FVL A;  1BR0 A;  3AE6 A;  2LSJ A;  4KX6 A;  2I59 A;  2V7J A;  2MOZ A;  4UF0 B;  2CM0 A;  5IWA T;  4YFS A;  5F5W A;  3PUA A;  2LSI A;  2XAQ B;  2YDQ A;  4B3M T;  4YT0 A;  4G63 A;  2NR4 A;  1QSD A;  4IE6 A;  3K3Q C;  2IIU A;  4KMC A;  2LKH A;  3ZC0 A;  3AE2 A;  4DR6 T;  3SRZ A;  4X20 E;  4CI1 B;  3K8P C;  3LK3 B;  3QK6 A;  3KV5 A;  5L47 A;  3LK4 2;  5AQG B;  4DBR A;  1HNW T;  4OK0 A;  4QHO A;  3TLW A;  2W66 A;  1JNZ A;  1HR0 T;  1IAP A;  1N36 T;  3CQG B;  1XDP A;  4YLH A;  5L3G B;  4EAH A;  5FXW A;  5LGN B;  3QOF A;  3P8C D;  2C5I T;  2JQ9 A;  2L9Q A;  3R84 B;  4DV2 T;  3N9P A;  5FXZ A;  4L9I A;  2J62 A;  3P4S A;  3RIF A;  3AVR A;  4HWF A;  2K5B B;  3P4W A;  4NIQ A;  3KV4 A;  3E08 A;  5JDF A;  4IST A;  4DID B;  2VK9 A;  1G8X A;  2NW7 A;  3CQC B;  2XQ6 A;  2NOX A;  4BAY B;  4GK0 E;  5A1L A;  2E9X C;  1M62 A;  2YN6 A;  3BQI A;  4TZ4 C;  4X62 T;  5ABE A;  3G06 A;  3GN5 B;  2B76 A;  3AEG A;  1MND A;  1WYB A;  4QH5 A;  4FJO A;  5ABG A;  4JBW F;  2UXB T;  3AE5 A;  4ASK A;  3SOL A;  5LHH B;  3AE3 A;  2VKJ A;  3NWI A;  4MFR A;  4IL9 A;  3AA6 B;  2FJD A;  4X1Y E;  2NP9 A;  1UX4 A;  5JR9 B;  2WM9 A;  3LDQ B;  1LKX A;  3NRY A;  2IUB A;  5F3J A;  2ACZ A;  3LJC A;  5JDG A;  2V7L A;  5AQU B;  5HWX A;  3C51 A;  2ODV A;  4TWD A;  4DV5 T;  4ZZC A;  2YK0 A;  4M1P A;  4O2A E;  3UUX B;  3JC6 D;  4QXB B;  2XZE A;  3I1A A;  2QA7 A;  2W4X A;  5LP6 E;  4PK4 A;  2MTQ A;  2C5K T;  3H37 A;  5AQP B;  4AKI A;  3OPC A;  3AE1 A;  3J7Y q;  4P09 A;  2HN2 A;  2FBW A;  2PJQ A;  4ZS2 A;  2UXX B;  2M6B A;  3ZMV B;  2HPJ A;  3VKH A;  1UX5 A;  4TUY E;  2IML A;  4KHZ F;  4YSX A;  4LFA T;  3Q5W A;  4H9N C;  4MHC A;  3AE7 A;  4X65 T;  4G2A A;  3CQX C;  4HFD A;  4Q25 A;  3OVU A;  2VQF T;  3CX7 B;  3FZL B;  3PUG A;  2M6I A;  4UVB B;  2MPK A;  4PJL A;  1D1B A;  4IDP A;  2XAS B;  3GMI A;  5HCJ A;  4JI6 T;  1YW0 A;  4PJN A;  1YXR A;  4C90 A;  2V6X A;  5FVK A;  3V5S A;  4E7Z A;  1W9R A;  3I0O A;  2EHO A;  1Y64 B;  4DV3 T;  3CPZ A;  2SPC A;  3ETU A;  3ZYM A;  5GON E;  3RKG A;  1MMA A;  2VVN A;  4LML A;  3H3M A;  3J9X 1;  2EHO C;  1OED A;  1FIO A;  4NUV A;  3S4U A;  4EOZ B;  3FBZ A;  1IBL T;  2YU1 A;  3RRC A;  2X9Y A;  5C2T A;  2IC9 A;  5ETW A;  3AVS A;  5FXV A;  2CCQ A;  2CA5 A;  4EGW A;  5KXJ A;  4JUY A;  2X9W A;  1OED C;  4WZX A;  5FL1 A;  1SJ7 A;  1B7T A;  1YQ3 A;  4JI5 T;  2MTC A;  3RYC E;  4DR2 T;  1NEK A;  2VL0 A;  2X0L B;  5AQK B;  4PK5 A;  2LOS A;  2WQY A;  3FZK B;  3ZT5 A;  4CXW A;  1V9D A;  2LOP A;  4DV0 T;  3CWZ B;  2F4V T;  4U72 A;  2N1G A;  3ZLI A;  1OXZ A;  1WCR A;  3FXD B;  2WP9 A;  2CEA A;  4ZHQ E;  3AT7 A;  4JI7 T;  4COF A;  5FMN A;  4K0U A;  2LQU A;  5EK2 A;  2VB6 A;  4TN7 B;  3PUX F;  2KSR A;  4AIS A;  5LBM A;  4I0U A;  3FZH B;  2XAH B;  5HEG A;  4ISS A;  1ZP0 A;  3RQW A;  3U78 A;  3ANW A;  3MKD A;  1MMG A;  1DU2 A;  4BA9 A;  4QH4 A;  3ESL A;  4FI5 A;  2ACX A;  4TWH A;  3UUN A;  3RYH E;  2L10 A;  4DV1 T;  2IAK A;  1IJ5 A;  2DI4 A;  2JQQ A;  5AQN B;  3ZCI A;  1T8B A;  2N9D A;  4GKK T;  3V5U A;  2E8I A;  3WUR A;  5FKY A;  2R6G F;  3K3N A;  4TV8 E;  2LSG A;  3ETV A;  1JNR A;  1US7 B;  3KDS E;  5L3E B;  2WMN A;  3AA7 B;  1HCI A;  4JI1 T;  2EHO B;  4KP3 C;  4P0B A;  2RA1 A;  3FBL A;  4U2Y A;  5LG4 A;  5M4Y A;  4HFC A;  2IHR 1;  4AKH A;  3PUR A;  5HXR A;  2BDE A;  1OED B;  4X1K E;  2BS4 A;  4YY3 T;  3JAE A;  4O8S A;  5C8Y E;  4EIW A;  2OA5 A;  4DO0 A;  2JMH A;  4AQF C;  5HEJ A;  3UTK A;  2BG9 A;  1LVF A;  4O4L E;  1U5P A;  2UUC T;  1XWM A;  2N2N A;  2XQY A;  3HKD E;  1W0B A;  4ZI2 D;  3OTO T;  3LFM A;  3T8O A;  5JRE A;  5CGM A;  2HHH T;  3L3P A;  1UUR A;  2BG9 C;  4GK5 E;  4UVC B;  3A5X A;  2XQ9 A;  5FZT A;  3RF1 A;  5KDM C;  2CHN A;  2Q9Q C;  4WBN E;  3MK7 C;  4IRE A;  2XQ8 A;  2CWY A;  3RQU A;  4GYS A;  2NW9 A;  5L3C B;  5AQL B;  2LHN A;  3RKO A;  2XQ4 A;  1WRD A;  4PFO A;  2KMF A;  4KHP T;  2FJB A;  4IE5 A;  4ZXL A;  5LA6 E;  2UXD T;  4L5G A;  2WWU A;  4A98 A;  3QUJ A;  3QB5 K;  4HN9 A;  2LM9 A;  2MYS A;  3JC6 C;  2DWK A;  3TLV A;  2XSA A;  1UK5 A;  2K9A A;  2A72 A;  3I9W A;  2NTY A;  2BZB A;  2ZM8 A;  2BKP A;  3SFE A;  4H63 V;  5LMU T;  3D0T A;  3ANW B;  5FP3 A;  2QVA A;  1O3X A;  1HX1 B;  2ODU A;  2LJL A;  2D9D A;  3U3I A;  3O4X E;  3RYI E;  2QGS A;  4HFV A;  2E5V A;  4HFI A;  3L8R A;  4U7I A;  4CXX A;  3UT5 E;  2H7V C;  1D1C A;  3WSC A;  3ZEF B;  4N78 D;  3ZC1 A;  5AQF B;  1XNQ T;  5EK3 A;  4U74 A;  4IHJ E;  3KBT A;  4HFE A;  4GKJ T;  2PG8 A;  2XQA A;  2CBI A;  3RHW A;  1SE7 A;  4O4I E;  1ZEE A;  3TLU A;  3N2K E;  2W62 A;  1GQE A;  5AQR B;  3QC9 A;  3EVY A;  1H7C A;  3PU3 A;  2BS3 A;  3UUL A;  4UR9 A;  1FMV A;  3FHN A;  1NWM X;  5LNK A;  1IBK T;  3FXE B;  3HKE E;  2LRK A;  2G0U A;  2KND A;  3ZMS B;  2XQ5 A;  4XBF B;  2E9X A;  3VJZ A;  5J2U E;  4IGU A;  2Z6E A;  4UXN B;  5HXE A;  5HEU A;  3ZN0 B;  3EHZ A;  3C50 A;  5L3D B;  4HGA A;  3M1C A;  2BG9 B;  3ZT6 A;  3PV0 F;  2BVL A;  2H89 A;  5AQT B;  4P0A A;  3KV6 A;  2HH7 A;  3PDY A;  4U7Y A;  4ADZ A;  3FYQ A;  3UU5 A;  1FMW A;  1D1A A;  4L0R A;  3IF8 B;  3T1H T;  5FY0 A;  5IUX A;  1HG5 A;  5HXH A;  4LF6 T;  3NZP A;  3AEF A;  5LCY A;  1HNZ T;  2UXN B;  2KLQ A;  2LSY A;  2PBI A;  4DR4 T;  2VKO A;  3ZMT B;  2L7N A;  2JJ9 A;  5HXC A;  3B57 A;  1YQ4 A;  1HNX T;  3H3A A;  3ONL C;  4IIJ E;  3PE0 A;  5HEO A;  5E0O A;  3UFG A;  4KBM B;  4AKL A;  1E1H B;  3R6N A;  3RC3 A;  4JI3 T;  4HTE A;  1HFA A;  1WR6 A;  2Y6X A;  4JYA T;  5J0Z A;  1QUU A;  3UUB A;  5JTG A;  4H9P C;  2XM2 A;  4YTN A;  3AEA A;  3HKB E;  2JMK A;  4LF7 T;  2RP4 A;  1Z8U A;  4HWH A;  5JDH A;  2VQE T;  2LKG A;  3PF0 A;  3EDU A;  4IE7 A;  2K24 A;  3AAA B;  2CXF A;  1S35 A;  3Q5X A;  4W8P A;  3ZKR A;  3E22 E;  4CN1 A;  1LRZ A;  4TX5 A;  3N9M A;  2WDR A;  3CIR A;  1G73 A;  5LYJ E;  1Y01 A;  4DMW A;  5ADX L;  3VHL A;  3N9Q A; 
#chains in the Genus database with same CATH homology
 4BJM A;  5FMN A;  3C4X A;  4UEM A;  4OYJ A;  1Z0P A;  4K0U A;  2LQU A;  5KMG P;  2ZM0 A;  4DBQ A;  5EK2 A;  1HS7 A;  3W15 B;  2VB6 A;  3GN5 A;  4EZ4 A;  4TN7 B;  4MAL A;  3TKL B;  4EYY R;  4AI6 A;  3OYX A;  4PNI A;  3WAK A;  3ONX A;  4H9Q C;  3MJX A;  2PFV A;  3MA9 A;  4O4H E;  4JEU B;  4F6R C;  2X68 A;  3VKG A;  2YIN A;  4PJJ A;  5IYZ E;  5LHI B;  5LBM A;  1X79 A;  4AKG A;  2XAH B;  3CKD A;  2B1E A;  4AQG A;  3ZJ1 A;  4CQI A;  4IE4 A;  2Q9Q B;  2DWG A;  4ISS A;  3U78 A;  3ANW A;  3MKD A;  3PUQ A;  1MMG A;  4MLK A;  2V1D B;  2ZMA A;  4QXH B;  2X51 A;  5DQW A;  2KWI B;  3RX6 A;  3UFE A;  1YKE B;  3ESL A;  4BA9 A;  2H3R A;  4GYR A;  4ZI7 E;  4FI5 A;  1D0X A;  3PU8 A;  3KIN B;  2ACX A;  1D0Z A;  2A3D A;  4V1A v;  1CUN A;  3UUN A;  2L8K A;  5AFU L;  3RYH E;  4ZI3 C;  4PK6 A;  2VKD A;  3EDV A;  5JR9 A;  5JQG E;  2XTL A;  4XZC A;  2CXL A;  2IAK A;  1KNZ A;  1IJ5 A;  2DI4 A;  2E9X B;  2JQQ A;  3HKC E;  1BR0 A;  2GK9 A;  3ZCI A;  2N9D A;  2MBG A;  2ZM2 A;  3RRW A;  3V5U A;  2LSJ A;  1MIY A;  2E8I A;  2I59 A;  2V7J A;  4CXY A;  5LGU B;  3WUR A;  4EZH A;  2MOZ A;  4UF0 B;  3HI2 A;  2CM0 A;  3ZJ2 A;  4YFS A;  1MIV A;  4EB6 E;  4O4J E;  3PUA A;  1AJ3 A;  3MAC A;  3K3N A;  2LSI A;  2XAQ B;  4TV8 E;  5LJM A;  2C5J A;  4PAG A;  2LSG A;  3DTO A;  3ETV A;  2LT3 A;  1US7 B;  5FY7 A;  5JH7 E;  3KDS E;  4G63 A;  5L3E B;  1QSD A;  3PTR B;  3ZN1 B;  4IE6 A;  2WMN A;  2ZLY A;  3K3Q C;  5L2L A;  3WAJ A;  3AA7 B;  5H6R B;  3FB2 A;  3WI3 A;  2Q9Q D;  1ZHC A;  3F2E A;  1HCI A;  1WLX A;  5TAO A;  2V26 A;  3AB3 B;  4KMC A;  2IC6 A;  2D5U A;  2EHO B;  4E7S A;  4KP3 C;  4ZI2 C;  3ZC0 A;  4P0B A;  2RA1 A;  3MZK B;  3SRZ A;  4X20 E;  5LBQ B;  4CI1 B;  3FBL A;  4EYU A;  3ZYK A;  3CX8 B;  2KWH A;  3K8P C;  5FNV E;  5JRC B;  3C4W A;  3LK3 B;  3QK6 A;  5LG4 A;  5M4Y A;  4ZI3 D;  3KV5 A;  4AKH A;  3PUR A;  2E9X D;  3HR0 A;  4QX8 B;  3LK4 2;  5HXR A;  4DBR A;  2BDE A;  3O1J A;  2YU2 A;  4X1K E;  4OK0 A;  4QHO A;  3OJA A;  2WBL A;  4O8S A;  1IAP A;  2W63 A;  3ZYL A;  5C8Y E;  4EIW A;  3N9N A;  2LHR A;  2H7O A;  2OA5 A;  4YJ2 E;  3CQG B;  4DO0 A;  4YLH A;  2K48 A;  5L3G B;  2JMH A;  4EAH A;  4AQF C;  2JRK A;  3UTK A;  2J1D G;  5FXW A;  5JDM A;  5LGN B;  3SWH A;  3MXZ A;  1LVF A;  3P8C D;  2C5I T;  3R84 B;  2L9Q A;  1U5P A;  2V7I A;  3OKQ A;  3N9P A;  4O4L E;  5FXZ A;  1YD8 G;  2X9H A;  3GA8 A;  4L9I A;  2N2N A;  2XQY A;  3HKD E;  2V7K A;  5L3B B;  5LOV E;  4ZI2 D;  3AVR A;  5LGT B;  3LFM A;  3T8O A;  1HF8 A;  5JRE A;  2VAS A;  5DJQ C;  3L3P A;  4GK5 E;  4UVC B;  2K5B B;  3N2O A;  5FY1 A;  3A5X A;  5LHG B;  3WSC A;  4C91 A;  3KV4 A;  5LJN A;  1U4Q A;  5J1G A;  3E08 A;  5KDM C;  5JDF A;  4B6X A;  2Q9Q C;  4WBN E;  4IST A;  3MK7 C;  2VK9 A;  3L09 A;  5H6Q B;  1G8X A;  1ZV4 X;  2NW7 A;  3CQC B;  4ILU A;  2CWY A;  2XUE A;  4GYS A;  2NOX A;  2XAF B;  3KVA A;  2NW9 A;  5L3C B;  5HYA A;  4BAY B;  2LHN A;  3RKO A;  4ANJ A;  1WRD A;  4PFO A;  2CXD A;  1VOM A;  1SA0 E;  2KMF A;  5J2T E;  4GK0 E;  3KV9 A;  3ZMZ B;  2BVM A;  5A1L A;  3OBV E;  3NZQ A;  4IE5 A;  2E9X C;  3NRX A;  2A2F X;  5LA6 E;  3BQI A;  3KBU A;  2WWU A;  1S94 A;  3N5L A;  4L5G A;  3QUJ A;  4TZ4 C;  4HN9 A;  2LM9 A;  5EK4 A;  2W61 A;  3BQL A;  3GN5 B;  2MYS A;  3JC6 C;  1MND A;  2LEH A;  3C64 A;  2JPF A;  2DWK A;  1WYB A;  4AKR B;  2DNX A;  2X67 A;  4FJO A;  4ERR A;  5JVD E;  4QX7 B;  2K9A A;  2A72 A;  2X9X A;  3I9W A;  2NTY A;  2BZB A;  4H9O C;  2LE8 A;  3EUH A;  4ASK A;  2ZM8 A;  4H63 H;  3SOL A;  5LHH B;  5F8P A;  2VKJ A;  1VRB A;  4OFZ A;  4H63 V;  4MFR A;  4BJN A;  2CLY C;  3D0T A;  4GOU A;  4WBO A;  3AA6 B;  1SHZ C;  3ANW B;  5FP3 A;  5LXT E;  3OYZ A;  4X1Y E;  1O3X A;  3BQK A;  4YJ3 E;  2ODU A;  3UUM A;  2LJL A;  2NP9 A;  5DQV A;  3O1I A;  4H9S E;  3AAI A;  1UX4 A;  2Y8D A;  3M65 A;  5JR9 B;  3U3I A;  5JDQ A;  3O4X E;  2WM9 A;  2IW5 B;  1LKX A;  4PW8 A;  3NRY A;  3RYI E;  4UEL A;  5F3J A;  2QGS A;  4HFV A;  5HAX A;  3LJC A;  5JDG A;  1OWA A;  2V7L A;  3CX6 B;  1MMD A;  5HWX A;  4UV9 B;  3C51 A;  3E0Z A;  2ODV A;  3GWH A;  4CXX A;  3LK2 B;  3UT5 E;  1YKH B;  4AQF A;  2YK0 A;  4M1P A;  5HWY A;  2NWB A;  2H7V C;  2XHE B;  1D1C A;  4O2A E;  3UUX B;  3C98 B;  4HE8 A;  4JEH B;  5KX5 E;  1IZN B;  3JC6 D;  3ZMU B;  3ZEF B;  4N78 D;  4QXB B;  3ZC1 A;  4UV8 B;  1EZ3 A;  3I1A A;  2XAG B;  2W0G A;  5EK3 A;  2QA7 A;  4U74 A;  4IHJ E;  4CI2 B;  4UIG A;  5LP6 E;  4PK4 A;  3KBT A;  3CML A;  2MTQ A;  2NW8 A;  1FEW A;  2PG8 A;  2C5K T;  3H37 A;  4J2C A;  4QWN B;  3AAE B;  3N9O A;  2KZ7 B;  4AKI A;  5EZY E;  1BR1 A;  3LG7 A;  4O4I E;  3J7Y q;  3KFW X;  1ZEE A;  4P09 A;  3N2K E;  4I55 E;  3RC8 A;  5JDN A;  2W62 A;  3RPU A;  3QC9 A;  2EHO D;  2PJQ A;  3P7I A;  4ZS2 A;  3EVY A;  2D0T A;  2UXX B;  3ZMV B;  2Q9Q A;  1H7C A;  3B13 A;  3PU3 A;  3PHF 1;  2HPJ A;  3UUL A;  3VKH A;  1UX5 A;  1FMV A;  4TUY E;  4YHJ A;  5T1D A;  3FHN A;  3BK9 A;  1NWM X;  3HL6 A;  5LNK A;  3Q5W A;  2XAJ B;  3FXE B;  4H9N C;  4MHC A;  3HKE E;  2KIN B;  3LBX A;  4HKA A;  2KXP B;  3CVR A;  1ZKE A;  2G0U A;  2KND A;  4G2A A;  4KUM B;  5CB4 E;  3CQX C;  3ZMS B;  1KK7 A;  4OYK A;  1D0Y A;  4WW0 A;  4GIW A;  4XBF B;  1WYC A;  3AA0 B;  2E9X A;  2NTX A;  3CX7 B;  3VU7 H;  3PUG A;  4PFP A;  5JDL A;  2HPL A;  3VJZ A;  5J2U E;  4UVB B;  4IGU A;  3DP7 A;  2Z6E A;  3RH3 A;  4PJL A;  4UXN B;  2VL8 A;  4ZS3 A;  1D1B A;  3ZN0 B;  5HXE A;  3F31 A;  2VKH A;  3C50 A;  2XAS B;  3GMI A;  4UF0 A;  5L3D B;  1HG2 A;  4HGA A;  3ZCJ A;  3M1C A;  4X1I E;  1YW0 A;  4PJN A;  2BVL A;  5CA1 E;  1MNE A;  2M67 A;  4P0A A;  3KV6 A;  4C90 A;  2HH7 A;  3I0Q A;  3PDY A;  2D0U A;  3DJB A;  4I50 E;  4ADZ A;  5FXX A;  1FMW A;  1IJ6 A;  2CE7 A;  2WMO A;  4PJM A;  1D1A A;  4WNK A;  4L0R A;  2ES0 A;  3V5S A;  4E7Z A;  4CI3 B;  2Y48 B;  3N2G E;  4IE0 A;  3IF8 B;  4DND A;  5FY0 A;  1HG5 A;  3I0O A;  1NAF A;  2KT9 A;  5HXH A;  3LBX B;  2EHO A;  3RYF E;  4CZZ B;  1Y64 B;  3NZP A;  3NBX X;  5LCY A;  5HXS A;  2L3L A;  2SPC A;  3CPZ A;  2LSK A;  4I43 B;  3ETU A;  3ZYM A;  5GON E;  2UXN B;  1MMA A;  5JRC A;  2KLQ A;  4ECG A;  2LSY A;  2PBI A;  1BR4 A;  1MIW A;  3HA4 A;  4UVA B;  1UCU A;  1T98 A;  2VKO A;  3ZMT B;  5DAB A;  5BMV E;  2JJ9 A;  4Z8X A;  5HXC A;  3J9X 1;  3B57 A;  2EHO C;  2WSS V;  3AA1 B;  1FIO A;  4NUV A;  4OHF A;  3S4U A;  2DHR A;  3H3A A;  4IDZ A;  4EOZ B;  1HTJ F;  4IIJ E;  3FBZ A;  2YU1 A;  5JR9 C;  3PE0 A;  4QXC B;  2X66 A;  3RRC A;  2X9Y A;  5E0O A;  2IC9 A;  5ETW A;  3AVS A;  2YEV C;  4KBM B;  4AKL A;  1E1H B;  5FXV A;  2CCQ A;  2CA5 A;  3R6N A;  4DVD A;  3RC3 A;  4NUU A;  2CLY B;  2V7M A;  4JUY A;  2X9W A;  4HTE A;  4ONR A;  1HFA A;  2CMR A;  1WR6 A;  3IEE A;  2Y6X A;  1B7T A;  3KVB A;  4O2B E;  2MTC A;  5IHY A;  3RYC E;  4BGO A;  2W00 A;  3O9X A;  3SS1 A;  1QUU A;  1HX8 A;  4H9P C;  5L3F B;  3C4Z A;  2X0L B;  3IHR A;  3HKB E;  4PK5 A;  3F57 A;  2LOS A;  4JLE A;  2JMK A;  1LVK A;  4AXP A;  4XAX B;  2RP4 A;  2DCF A;  2D2S A;  5JDH A;  4HEA A;  4CXW A;  1V9D A;  2LOP A;  3O1H A;  3ZPO A;  3PF0 A;  3EDU A;  4DMV A;  3CWZ B;  4IE7 A;  4EXT A;  3I9Y A;  4QKN A;  2K24 A;  4H9R C;  4TV9 E;  3AAA B;  2CXF A;  1S35 A;  3Q5X A;  4MBQ A;  4U72 A;  2N1G A;  4A56 A;  3ZLI A;  3K3O A;  3PUS A;  1OXZ A;  3E22 E;  1LRZ A;  3N9L A;  4TX5 A;  1BR2 A;  3Q9D A;  3FXD B;  3N9M A;  3IBP A;  2P9B A;  2DLR A;  2CWO A;  3Q2M A;  1G73 A;  2CEA A;  2C0S A;  4I4T E;  4ZHQ E;  4ZOL E;  2VWA A;  5LYJ E;  5FYM A;  1MMN A;  4DMW A;  5CA0 E;  5ADX L;  3AT7 A;  3VHL A;  2WAU A;  3N9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...