5HYAA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchangerncx_mj soaked with 150 mm na+ and nominal ca2+
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
Knots found
sequence length
304
structure length
297
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRMGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
molecule keywords sodium,calcium exchanger
total genus 132
structure length 297
sequence length 304
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hyaA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hyaA02
5JDHA 5JDMA 5HXHA 5JDQA 3V5UA 5HXCA 5HWYA 5HWXA 3V5SA 5HXSA 5HYAA 5HXEA 5JDNA 5HXRA 5JDLA 5JDGA 5JDFA
chains in the Genus database with same CATH superfamily
3FXEB 4U2ZA 1W0BA 5FY7A 5ABHA 2L3LA 2E9XC 4H9PC 2E5VA 2W62A 1D0XA 2L8KA 2XPKA 4UVCB 4JI7T 3CIRA 3BQKA 4HWCA 4UVAB 1D0ZA 2ZM2A 4CN4A 4OYJA 2HN1A 4UV9B 4BJNA 3ZYMA 5LXTE 2YK0A 4HGAA 4HEAA 3RYFE 4TUYE 4H63H 2X0YA 4ZHQE 1UX4A 5CA0E 4AISA 2CHOA 2KWHA 2MOZA 1MMAA 4KBMB 4PJJA 2CA5A 4PJMA 2DI4A 3ONLC 4EYUA 3RX6A 3Q5EA 4EV6A 2EHOD 5LMUT 3ZJ1A 4Z91A 4DV0T 4IDPA 2XHEB 1OXZA 4UIGA 5EK3A 2EHOB 2X0HA 3P4SA 2HPJA 2VURA 5BR8T 2BVMA 2XQ8A 3AB3B 2C0SA 3O1JA 2MTCA 3CMLA 1D1AA 3GMIA 4UVBB 3L09A 4O2BE 4O2AE 3ZMZB 4F8HA 4DR7T 1YW0A 1NEKA 3AE6A 3NWIA 5FL1A 4ISSA 2J47A 2XQAA 2D9DA 3I0OA 2WZHA 3LDQB 4LMLA 3QUJA 3UQ4A 2WBLA 4CXXA 3LG7A 3N9MA 3HR0A 4ILBA 2HN2A 2NOXA 4TZ4C 1US7B 2Y48B 5HCMA 3AXJB 3TKLB 3CQCB 2XQ3A 5HXRA 1YXRA 3BQIA 4JI5T 4QX7B 4H9NC 4DR1T 2AXDS 3LK3B 1SE7A 2NW9A 2XY8B 4YT0A 1HNZT 5F5WA 3NBXX 3RLFF 3FZMB 4X1IE 1J5ET 1W0AA 4KI0F 3VR9A 3EI0A 1XDOA 2NW7A 3E22E 5JR9A 3ZMVB 2JMKA 3SWHA 2WMOA 2B76A 3CWZB 2VKDA 2A9UA 3RGLA 4ZI7E 2VKHA 5IWAT 3A7MA 2GK9A 2XM1A 4TX5A 1WCRA 2C5IT 3LK2B 2NP9A 5EZYE 2IHR1 3M3ZB 3PJAJ 4DV5T 4DMWA 5L2LA 4ZOLE 2BG9A 5ABGA 3ZLIA 2A3DA 3HKCE 2BS4A 2MBGA 2Q9QC 4KX6A 2I6HA 3NKZA 4JEUB 4EZHA 2H89A 5KX5E 5LHIB 1MMNA 4MALA 3RYIE 2K24A 1O3XA 1FJGT 2CWOA 3AE7A 5AQKB 3ZCIA 3T1YT 4LFAT 3FBLA 3AA1B 3L39A 5HEOA 3IF8B 2X0CA 4EEDA 3AEGA 2NR4A 4HWFA 4UR9A 5LHHB 5FNVE 3FB2A 3JAEA 2WY2A 4QH1A 4DBQA 3EVYA 1WRDA 5L3CB 3ZMTB 2E9XD 4TNWA 1N36T 2KZ7B 2VVNA 2XAFB 4E7SA 5AQUB 3ABVA 3AVRA 3P8CD 3PUGA 4EZ4A 4B3RT 2ZM0A 3AXJA 1JNRA 2UXNB 3C4XA 3C64A 4PK5A 2E8IA 3K3OA 4TV8E 5FY0A 3TLWA 1Y01A 1IBKT 4IHJE 2LSKA 2I0MA 3KV5A 1ZEEA 3ZN1B 3ZT6A 3O9XA 3QOFA 3AE9A 1VOMA 2J1DG 2V7LA 3AEFA 1HX8A 2BG9B 1VRBA 3O4XE 3UT5E 2QVAA 5F3JA 2ODUA 3AEDA 2NTXA 3LSVA 4UELA 1L0VA 2IC9A 2V1DB 2YINA 4U72A 3ESLA 3L3PA 4L5GA 4EGWA 4L9IA 2W2UA 4JI8T 4AKLA 1H7CA 2XSBA 2UXXB 3RIAA 3TLUA 3LBXB 1E2AA 3AECA 4GOUA 4X66T 4GYRA 4KP3C 2V8SV 4LF7T 1DU2A 3UU8A 4IDZA 2HH7A 5FZTA 4W8PA 2SPCA 4LMJA 4ILUA 4EOZB 1B7TA 5CJ5A 5JTGA 3ZEFB 4AQFA 2V6YA 2UU9T 4ANJA 4N78D 4MLKA 1D1CA 4HN9A 4M1PA 4A5XA 3A5XA 4DNDA 5JRCB 1FMVA 2JIWA 5JDQA 4DBRA 5LA6E 3DTOA 2FJEA 4JUYA 2WU5A 1J5WA 1I94T 1BR1A 4P0BA 5AQIB 1IBLT 2K9AA 3OKQA 4P1NA 4G63A 2WWUA 2M6BA 1X79A 4WW0A 3ZKRA 3OTOT 3MJXA 2BBHA 4WNKA 2XQ5A 2LLYA 3GA8A 1SJ8A 5IUXA 3SOLA 2G0UA 2J62A 2JQQA 1MNDA 4YXDA 2WDQA 3PU8A 2IAKA 3OPCA 3QB5A 1QSDA 3CKDA 3FZKB 5H6RB 3B57A 3K3QC 3ZSTA 5IHYA 2IIUA 2VKOA 2E9XA 4IDQA 5FVLA 5HAXA 2DNXA 3EHZA 3L8RA 2KNDA 3PUZF 2WWVA 1GQEA 1OEDC 4U3CA 1J1JA 3PF0A 5LBMA 4IREA 3K3NA 5C8YE 4I43B 4YJ3E 2CXLA 4I50E 5DABA 5F8PA 1SJ7A 4CI1B 2ACZA 3EUHA 2XAGB 3QK6A 4PNIA 5LMNT 2XAQB 5ETWA 2CLYC 2H7VC 2LHRA 5JH7E 2X51A 4DR6T 4BGOA 2YU2A 2W0GA 3EAMA 4MBQA 5AQSB 3CQXC 2VASA 2K5BB 2M6IA 4DV3T 2CM0A 3WAKA 2KWIB 4YFSA 2UUCT 2FJBA 5ABEA 3RRCA 2OLTA 5AQVB 1XWMA 4HWIB 4YSZA 2D2SA 4QWNB 1UGOA 1UURA 2FUPA 4U33A 3KINB 3N9OA 2BKPA 5HXCA 3TLTA 4DO0A 2UUAT 5AQRB 5DQWA 4QXCB 4YSYA 3OJAA 2BVLA 2XM2A 2WSSV 4U7IA 5JDHA 4YSXA 3P7IA 3FZFB 5LBQB 2BKOA 2WB5A 2FJDA 3JADA 3P4QA 4OK0A 4YHHT 2PJQA 5IYZE 3RH3A 4H9RC 2QRXA 4HFDA 3KV4A 4DV7T 5AQHB 1WR6A 4PK4A 4GK5E 4JI6T 2D0TA 3ONJA 4O8SA 1G8XA 4WZXA 5J2UE 2V5CA 2N9DA 5JDMA 1HNWT 4NUUA 3CX6B 2JQKA 4IGUA 3AEAA 2KXPB 4PFOA 4WYVA 4F7GB 3KVBA 4QH4A 5FXWA 2X0LB 2Z6EA 2YDQA 4DIDB 2OV9A 2QA7A 4LF5T 3MXZA 2M67A 3AE2A 5HEUA 1FIOA 1LKXA 2DWKA 2C5JA 2XJ7A 3B13A 3CK6A 4V1Av 3RPUA 3VHLA 4E7ZA 4WBNE 4B3TT 3AAAB 3FXDB 2KINB 1EZ3A 4HTEA 4I55E 4EXTA 3PDYA 5AQOB 2DLRA 3N9NA 5JR9C 4KMCA 3ZYKA 3A8YC 4ASKA 2MAWA 4ZEYA 4JI0T 2YOEA 4DUYT 2B1EA 3AEEA 1G73A 4HKAA 2LT3A 5L4HA 2X9WA 2YDRA 4X62T 2LM9A 3D0TA 4UXNB 3AY5A 3AT7A 5LCYA 3N2KE 2JPFA 3F31A 3TLVA 2Q9QA 3B5MA 3ETVA 1LVKA 3UFGA 4CXYA 4LFCT 2CBJA 4OFZA 1N32T 4H9SE 5HCJA 2RA1A 2C5KT 1N33T 4IE4A 2YU1A 4X1KE 2YKSA 3NZQA 1ZKEA 2WCAA 4IL4A 5JVDE 3ZN0B 2ODVA 2JJ9A 3AEBA 5CFBA 5JQGE 3UQ7A 3T8OA 4ZI3D 2A72A 1YKEB 5AQGB 2WU2A 4DVDA 1D0YA 3F57A 4XAXB 4MHCA 1CHUA 3IA3A 4YLHA 2JQHA 2MTQA 2J4GA 2XQ7A 2BS2A 2UXBT 2Y6XA 3CVRA 4IL9A 4PK6A 3U3IA 1SA0E 4UF0B 2P9BA 1WFDA 4FI5A 1M7KA 2W00A 4OYKA 5J0ZA 2E5LT 1SHZC 3PUYF 3RYHE 1MIYA 3VRBA 2CHNA 4P09A 4AXPA 2UXDT 3QNUA 1LRZA 1S94A 5J2TE 3RQWA 4NXNT 3J9X1 5AQPB 3IHRA 1XDPA 2BZBA 2IDOB 3AA7B 1Z0PA 4TWHA 4ZZCA 2V7KA 4O4IE 3S4UA 1M62A 3ANWA 3C4ZA 5LYJE 3ZPOA 4NUVA 4IE7A 3UUBA 1V9DA 2W63A 3HKDE 5JDLA 3JC6C 5LOVE 4UEMA 2PFVA 2VWAA 4QXHB 4LMKA 3RRWA 3NRYA 2CLYB 2LSJA 3V5SA 5DQVA 5AQQB 4TWFA 3CX8B 3LK42 2F4VT 1IZNB 4IIJE 4HFVA 2LKGA 3F2EA 3R84B 5LG3A 4JI4T 4ZXLA 3FHNA 4JLEA 1HFAA 5HYAA 2HPLA 1UX5A 3E08A 3Q5WA 5JREA 2ZMAA 4GKKT 4B3MT 4CN1A 2V26A 4F6RC 4DV4T 2KVPA 4ZI2D 4TWDA 4O4LE 1OWAA 2KT9A 1YQ3A 2CCQA 3AA0B 1W9RA 1YD8G 1JNZA 3AE8A 3ANWB 4DV2T 4U2YA 5L4EA 5LB7B 2W66A 2K3WA 4LF8T 4EEBA 2KMFA 1OEDA 2VB6A 3N9PA 4TNVA 2YEVC 3SFEA 4X64T 3WAJA 4NXMT 4IE0A 3AE3A 2XQ6A 3N2OA 3HI2A 2EHOC 4EIWA 2XTLA 5ABFA 2BG9E 4XZCA 1HNXT 3MZKB 4A98A 1MIVA 2LKHA 3PUWF 4HFCA 3PTRB 4I4TE 3UUXB 2QGSA 3VJZA 3PHF1 1LVFA 3I0QA 1ZOYA 2LSYA 2IW5B 4U74A 1QLBA 4B6XA 4JEHB 5JDNA 1HX1B 3C50A 2CWYA 1KNPA 1BR2A 2ACXA 2LJLA 2V6YB 3RIFA 4LF9T 3R6NA 4OX9T 1HR0T 3PUQA 3VKGA 2V7MA 4GKJT 1E7PA 1FEWA 4HFBA 2WS3A 3RC8A 3IBPA 3PV0F 2IMLA 2PG8A 3AE5A 3ZSSA 5C3JA 3MACA 4NIQA 3ZJ2A 5AQFB 2QYWA 3SS1A 2XAJB 1Y64B 2Q9QB 4NPPA 3TLSA 4EAHA 4U7YA 5A1LA 4IT4A 5LHGB 1KNZA 3M1CA 3M65A 3UUNA 5FY1A 3AAIA 4ISTA 4TV9E 2WMNA 1HG5A 1UUSA 2XQYA 2ZM8A 4HE8A 5HEGA 4IDOA 4X5TA 3LFMA 4ZS2A 1KEYA 2PTFA 3Q5XA 5LJNA 4YHJA 4Z8XA 3OYZA 3AE1A 3VR8A 5JRCA 1WYCA 3GN5B 4IDNA 5LGUB 2XASB 1ZP0A 2W4XA 4CQIA 4EB6E 4AQFC 1WLXA 2KLQA 3N9QA 3UUMA 3WSCA 4X20E 4HWHA 2HHHT 2WQYA 1XNRT 2ES0A 2ZLYA 3RI5A 5HXEA 2JMHA 3KDSE 4AIUA 4AQYT 4XBFB 3ZYLA 5JDFA 4YJ2E 5HXHA 2VL0A 2VK9A 1XZYA 4IE5A 2LSIA 4QX8B 4AKIA 3VU7H 2W61A 4BJMA 3J7Yq 3I9WA 4PAGA 5AFUL 5ABFB 2L7NA 3FYQA 3MKDA 3P4WA 2JRKA 5CGMA 1YKHB 4QH5A 1W09A 3SRZA 2CRBA 1VCTA 2FBWA 2R6GF 5L47A 2H7OA 3SFDA 4YTNA 2WAUA 3JCFA 4HWDA 2XSAA 3KBTA 4MFRA 3WI3A 1BR0A 1WYBA 2VQET 2WDRA 4H9QC 5FKYA 4CZZB 4O4JE 2BG9C 3CPZA 5AQNB 1VCSA 4JYAT 3W15B 1Z8UA 5LNKA 4DR4T 5AQLB 5J1GA 3C98B 3KV9A 2CBIA 5HWYA 4BA9A 4K0KT 3N2GE 1WR0A 3PUAA 1D1BA 4AI6A 2YN6A 3NRXA 3NVOA 4GIWA 4ILCA 1HS7A 1HTJF 4ZI3C 4DR3T 2XUEA 3VKHA 3NZPA 3O1HA 2LHNA 1ZV4X 3C4WA 2K48A 4KHZF 4ZS3A 5TAOA 4AKRB 3OBVE 1XMOT 3AAEB 2OA5A 3AE4A 3ONXA 2MPKA 2N1GA 2NW8A 5AQTB 5HEJA 1KFYA 3UTKA 3PU3A 3RHWA 3H3AA 3I9YA 3GWHA 3WURA 3EABA 4UV8B 5FVKA 3IEEA 1OEDE 3FZLB 3PE0A 3RQUA 4HFIA 2XQ4A 1NENA 5ADXL 2V6XA 4J2CA 3ZT7A 4Q25A 1AJ3A 1CUNA 3N9LA 5CB4E 2LOSA 2DCFA 4IE6A 2I59A 2LRLA 3PUSA 3T1HT 2XQ9A 4PJLA 2UUBT 2H3RA 4KUMB 3X1DA 3P4RA 4WBOA 2YDSA 4COFA 4C91A 1R8IA 4JI3T 2RPAA 3RF1A 2E2AA 4AKGA 3EDVA 1OEDB 4ECGA 1X9BA 3UU4A 3AVSA 2WDVA 4HFEA 3H3MA 2X9YA 4CI3B 5HWXA 4DV1T 5LG4A 2L9QA 4BAYB 2CMRA 2MYSA 4K0UA 3RYCE 4DUZT 4CN6A 1XNQT 1XMQT 5M4YA 3HKBE 2KSRA 4QHOA 2DHRA 2A2FX 1BR4A 2XZEA 2DWGA 2LRKA 4GK0E 2XAHB 4L0RA 3JAFA 2WP9A 3EDUA 2X9XA 1KF6A 1HCIA 5KMGP 4A56A 4AQGA 2BS3A 1I6ZA 3RIUC 2KGXA 2Y8DA 5EK2A 5KXJA 1S35A 3P50A 4O4HE 2CE7A 2H88A 2D5UA 4DV6T 1UK5A 3OVUA 4UF0A 1U4QA 2X67A 4QKNA 4JV5T 3FBZA 4PFPA 2LEHA 3K1SA 3ZMSB 2X68A 5GONE 3ZC0A 3K8PC 3G06A 3FZHB 4ADZA 4EYYR 3QB5K 2CEAA 2CXDA 5L3BB 3E0ZA 1MMGA 4PJNA 1QUUA 3UULA 4CXWA 2VQFT 1KNRA 1MNEA 4LF4T 3UU6A 1E1HB 2PBIA 3PJAA 1U5PA 4Z90A 3KV6A 4GYSA 4HFHA 4ZI2C 4LF6T 3Q2MA 4DR2T 3V5UA 5L3FB 2DL1A 2ZM6T 4ILAA 5FL0A 3U78A 5HXSA 2UXCT 2L10A 3RIUA 3HKEE 4X1YE 4G2AA 5JDGA 3PUXF 4H63V 2N2NA 3RKGA 4QXBB 3OYXA 5H6QB 1HG2A 5LJMA 4TN7B 2CPTA 1ZHCA 3Q5DA 2X9HA 3CQGB 3MA9A 3ZCJA 2LM2A 5JR9B 3KFWX 2LQUA 2WZIA 4YTPA 4I0UA 3H37A 2NTYA 3GN5A 4FJOA 1NWMX 2V5DA 5BMVE 5LP6E 3JC6D 1MIWA 2IUBA 2LOPA 2VKJA 2AE9A 5DJQC 3KVAA 3UU5A 1T8BA 4X65T 1IAPA 5FYMA 3UU3A 3BK9A 1HF8A 4C90A 2EHOA 5HEHA 2CXFA 3KBUA 4YY3T 4KHPT 4ERRA 2V7JA 5FXZA 2D0UA 3VRAA 1T98A 3ZC1A 4JI1T 3ZMUB 1MMDA 2JQ9A 4JBWF 2VL8A 2Q9QD 4U31A 3ZT5A 2NWBA 5CA1E 5LGTB 4H9OC 3HA4A 3ETUA 2FJAA 3CX7B 2IC6A 3I1AA 1KK7A 4B3ST 1IBMT 4LFBT 3DYJA 1NAFA 1T7SA 3MK7C 2VVSA 2WM9A 2RP4A 3PURA 3Q9DA 5FXXA 3DP7A 5C2TA 5L3EB 4P0AA 3PUVF 5FMNA 1SUMB 4PW8A 4A97A 3RC3A 4ZZBA 3HL6A 5KDMC 1IJ6A 3C51A 3BQLA 5FXVA 4JI2T 4DMVA 5L3DB 5LGNB 4AKHA 2KBBA 3P4PA 5T1DA 2BKNA 2LE8A 3AA6B 3O1IA 4ONRA 3N5LA 4YTMA 1IJ5A 5L3GB 3RKOA 1N34T 1T72A 2X66A 2LSGA 3QC9A 1FMWA 1UCUA 2W67A 2BDEA 2E9XB 3DJBA 5AQJB 2V7IA 3LJCA 5AQMB 5EK4A 5FP3A 4DR5T 4CI2B 4OHFA 3UFEA 2BBJA 1YQ4A 3LBXA 5E0OA
chains in the Genus database with same CATH topology
3FXEB 5FY7A 2L3LA 2E9XC 4H9PC 2W62A 1D0XA 2L8KA 4UVCB 3BQKA 4UVAB 1D0ZA 2ZM2A 4OYJA 4UV9B 4BJNA 3ZYMA 5LXTE 2YK0A 4HGAA 4HEAA 3RYFE 4TUYE 4H63H 5CA0E 4ZHQE 1UX4A 2KWHA 2MOZA 1MMAA 4KBMB 4PJJA 2CA5A 4PJMA 2DI4A 4EYUA 3RX6A 2EHOD 3ZJ1A 2XHEB 1OXZA 4UIGA 5EK3A 2EHOB 2HPJA 2BVMA 3AB3B 2C0SA 3O1JA 2MTCA 3CMLA 1D1AA 3GMIA 4UVBB 3L09A 4O2BE 4O2AE 3ZMZB 1YW0A 4ISSA 3I0OA 3QUJA 2WBLA 4CXXA 3LG7A 3N9MA 3HR0A 4TZ4C 2NOXA 5EK2A 1US7B 2Y48B 3TKLB 4BA9A 3CQCB 5HXRA 3BQIA 4QX7B 4H9NC 3LK3B 2NW9A 3NBXX 4X1IE 5JR9A 2NW7A 3E22E 3ZMVB 2JMKA 3SWHA 2WMOA 3CWZB 2VKDA 4ZI7E 2VKHA 2GK9A 3RRCA 4TX5A 3LK2B 2C5IT 5EZYE 2NP9A 4DMWA 5L2LA 4ZOLE 3ZLIA 2A3DA 3HKCE 2MBGA 2Q9QC 5KX5E 4JEUB 4EZHA 5LHIB 1MMNA 4MALA 3RYIE 2K24A 1O3XA 2CWOA 3ZCIA 3FBLA 3AA1B 3IF8B 5LHHB 5FNVE 3FB2A 4DBQA 3EVYA 1WRDA 5L3CB 3ZMTB 2E9XD 2KZ7B 2XAFB 4E7SA 3AVRA 3P8CD 3PUGA 4EZ4A 2ZM0A 2UXNB 3C4XA 4PK5A 3C64A 4TV8E 2E8IA 3K3OA 5FY0A 4IHJE 2LSKA 3KV5A 3O9XA 1ZEEA 3ZN1B 1VOMA 2J1DG 2V7LA 1HX8A 3O4XE 1VRBA 3UT5E 5F3JA 2ODUA 2NTXA 4UELA 2IC9A 2V1DB 2YINA 4U72A 3ESLA 3L3PA 4L5GA 4L9IA 4AKLA 1H7CA 2UXXB 3LBXB 4GOUA 4GYRA 4KP3C 4IDZA 2HH7A 2SPCA 4ILUA 4EOZB 1B7TA 3ZEFB 4AQFA 4ANJA 4N78D 4MLKA 1D1CA 4HN9A 4M1PA 4DNDA 3A5XA 5JRCB 1FMVA 5JDQA 4DBRA 5LA6E 3DTOA 4JUYA 1BR1A 4P0BA 2K9AA 3OKQA 4G63A 2WWUA 4WW0A 1X79A 3MJXA 4WNKA 3GA8A 3SOLA 2G0UA 2JQQA 1MNDA 3PU8A 2IAKA 5H6RB 1QSDA 3CKDA 1AJ3A 3B57A 3K3QC 5IHYA 2VKOA 4CI1B 2E9XA 5HAXA 2DNXA 2KNDA 3PF0A 5LBMA 3K3NA 5C8YE 4I43B 4YJ3E 2CXLA 4I50E 5DABA 5F8PA 3EUHA 2XAGB 3QK6A 4PNIA 2XAQB 5ETWA 2CLYC 2H7VC 2LHRA 5JH7E 2X51A 4BGOA 2YU2A 2W0GA 4MBQA 3CQXC 2VASA 2K5BB 2CM0A 3WAKA 2KWIB 4YFSA 2D2SA 4QWNB 5HXCA 3KINB 3N9OA 4DO0A 5DQWA 4QXCB 3OJAA 2BVLA 2WSSV 5JDHA 3P7IA 5LBQB 4OK0A 2PJQA 5IYZE 3RH3A 4H9RC 3KV4A 1WR6A 4PK4A 4GK5E 2D0TA 4O8SA 5J2UE 1G8XA 5JDMA 2N9DA 4NUUA 3CX6B 4IGUA 2KXPB 4PFOA 3KVBA 5FXWA 2X0LB 2Z6EA 2QA7A 3MXZA 2M67A 1FIOA 1LKXA 2DWKA 2C5JA 3B13A 3VHLA 4V1Av 3RPUA 4E7ZA 4WBNE 3AAAB 3FXDB 2KINB 1EZ3A 4HTEA 4I55E 4EXTA 3PDYA 2DLRA 3N9NA 5JR9C 4KMCA 3ZYKA 4ASKA 2B1EA 1G73A 4HKAA 2LT3A 2X9WA 2LM9A 3D0TA 4UXNB 3AT7A 5LCYA 3N2KE 2JPFA 3F31A 2Q9QA 3ETVA 1LVKA 4CXYA 4OFZA 4H9SE 2RA1A 2C5KT 4IE4A 2YU1A 4X1KE 3NZQA 1ZKEA 5JVDE 3ZN0B 2ODVA 2JJ9A 5JQGE 3T8OA 4ZI3D 2A72A 1YKEB 4DVDA 1D0YA 3F57A 4XAXB 4MHCA 4YLHA 2MTQA 2Y6XA 3CVRA 4PK6A 3U3IA 1SA0E 4UF0B 2P9BA 4FI5A 2W00A 4OYKA 1SHZC 3RYHE 1MIYA 4P09A 4AXPA 1LRZA 1S94A 5J2TE 3J9X1 3IHRA 2BZBA 3AA7B 1Z0PA 2V7KA 4O4IE 3S4UA 3ANWA 3C4ZA 5LYJE 3ZPOA 4NUVA 4IE7A 1V9DA 2W63A 3HKDE 5JDLA 3JC6C 5LOVE 4UEMA 2PFVA 2VWAA 4QXHB 3RRWA 3NRYA 2CLYB 2LSJA 3V5SA 5DQVA 3CX8B 3LK42 1IZNB 4IIJE 4HFVA 3R84B 3F2EA 3FHNA 4JLEA 1HFAA 5HYAA 2HPLA 1UX5A 3E08A 3Q5WA 5JREA 2ZMAA 2V26A 4F6RC 4ZI2D 4O4LE 1OWAA 2KT9A 2CCQA 3AA0B 1YD8G 3ANWB 2KMFA 2VB6A 3N9PA 2YEVC 3WAJA 4IE0A 3N2OA 3HI2A 2EHOC 4EIWA 2XTLA 4XZCA 3MZKB 1MIVA 4I4TE 3PTRB 3UUXB 2QGSA 3VJZA 3PHF1 1LVFA 3I0QA 2LSYA 2IW5B 5JDNA 4U74A 4B6XA 4JEHB 3C50A 2CWYA 1BR2A 2ACXA 2LJLA 3R6NA 3PUQA 3VKGA 2V7MA 1FEWA 3RC8A 3IBPA 2PG8A 3MACA 3ZJ2A 3SS1A 5A1LA 2XAJB 1Y64B 2Q9QB 4EAHA 5LHGB 1KNZA 3M1CA 3M65A 3UUNA 5FY1A 3AAIA 4ISTA 4TV9E 2WMNA 1HG5A 2XQYA 4HE8A 2ZM8A 3LFMA 4ZS2A 3Q5XA 5LJNA 4YHJA 4Z8XA 3OYZA 5JRCA 1WYCA 3GN5B 5LGUB 2XASB 4CQIA 4EB6E 4AQFC 1WLXA 2KLQA 3N9QA 3UUMA 3WSCA 4X20E 2ES0A 2ZLYA 5HXEA 2JMHA 3KDSE 4XBFB 3ZYLA 5JDFA 4YJ2E 5HXHA 2VK9A 4IE5A 2LSIA 4QX8B 4AKIA 3VU7H 2W61A 4BJMA 3J7Yq 3I9WA 4PAGA 5AFUL 3MKDA 2JRKA 1YKHB 3SRZA 2H7OA 2WAUA 3KBTA 4MFRA 3WI3A 1BR0A 1WYBA 4H9QC 4CZZB 4O4JE 3CPZA 3W15B 5LNKA 5J1GA 3C98B 3KV9A 5HWYA 3N2GE 3PUAA 1D1BA 4AI6A 3NRXA 4GIWA 1HS7A 1HTJF 4ZI3C 3VKHA 2XUEA 3NZPA 3O1HA 2LHNA 1ZV4X 3C4WA 2K48A 5TAOA 4ZS3A 4AKRB 3OBVE 3AAEB 2OA5A 3ONXA 2N1GA 2NW8A 3UTKA 3PU3A 3H3AA 3I9YA 3GWHA 3WURA 4UV8B 3IEEA 3PE0A 5ADXL 4J2CA 1CUNA 3N9LA 5CB4E 2LOSA 2DCFA 4IE6A 2I59A 3PUSA 4PJLA 2H3RA 4KUMB 4WBOA 4C91A 4AKGA 3EDVA 3AVSA 2X9YA 5HWXA 5LG4A 2L9QA 4BAYB 2CMRA 2MYSA 4K0UA 3RYCE 5M4YA 3HKBE 4QHOA 2DHRA 2A2FX 1BR4A 2DWGA 4GK0E 2XAHB 4L0RA 3EDUA 2X9XA 1HCIA 5KMGP 4A56A 4AQGA 2Y8DA 1S35A 4O4HE 2CE7A 2D5UA 4UF0A 1U4QA 2X67A 4QKNA 3FBZA 4PFPA 2LEHA 3ZMSB 2X68A 5GONE 3ZC0A 3K8PC 4ADZA 4EYYR 2CEAA 2CXDA 5L3BB 3E0ZA 1MMGA 4PJNA 1QUUA 3UULA 4CXWA 1MNEA 1E1HB 2PBIA 1U5PA 3KV6A 4GYSA 4ZI2C 3Q2MA 3V5UA 5L3FB 3U78A 5HXSA 3HKEE 4X1YE 4G2AA 5JDGA 4H63V 2N2NA 4QXBB 3OYXA 5H6QB 1HG2A 5LJMA 4TN7B 4ECGA 1ZHCA 3ZCJA 2X9HA 3CQGB 3MA9A 5JR9B 2LQUA 3KFWX 3H37A 2NTYA 3GN5A 4FJOA 1NWMX 5BMVE 5LP6E 3JC6D 1MIWA 2LOPA 2VKJA 5DJQC 3KVAA 1IAPA 5FYMA 4C90A 3BK9A 1HF8A 2EHOA 2CXFA 3KBUA 4ERRA 2V7JA 5FXZA 2D0UA 3ZC1A 1T98A 3ZMUB 1MMDA 2VL8A 2Q9QD 5CA1E 5LGTB 2NWBA 4H9OC 3HA4A 3ETUA 3CX7B 3I1AA 2IC6A 1KK7A 1NAFA 3MK7C 3PURA 2WM9A 2RP4A 5L3EB 3Q9DA 5FXXA 3DP7A 4P0AA 5FMNA 4PW8A 3RC3A 5KDMC 3HL6A 5LGNB 1IJ6A 3C51A 3BQLA 5FXVA 4DMVA 5L3DB 4AKHA 5T1DA 2LE8A 3AA6B 3O1IA 4ONRA 3N5LA 5L3GB 1IJ5A 3RKOA 2X66A 2LSGA 3QC9A 1FMWA 1UCUA 2BDEA 2E9XB 3DJBA 2V7IA 3LJCA 5EK4A 5FP3A 4CI2B 4OHFA 3UFEA 4CI3B 3LBXA 5E0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDH A;  5JDM A;  5HXH A;  5JDQ A;  3V5U A;  5HXC A;  5HWY A;  5HWX A;  3V5S A;  5HXS A;  5HYA A;  5HXE A;  5JDN A;  5HXR A;  5JDL A;  5JDG A;  5JDF A; 
#chains in the Genus database with same CATH topology
 3FXE B;  4U2Z A;  1W0B A;  5FY7 A;  5ABH A;  2L3L A;  2E9X C;  4H9P C;  2E5V A;  2W62 A;  1D0X A;  2L8K A;  2XPK A;  4UVC B;  4JI7 T;  3CIR A;  3BQK A;  4HWC A;  4UVA B;  1D0Z A;  2ZM2 A;  4CN4 A;  4OYJ A;  2HN1 A;  4UV9 B;  4BJN A;  3ZYM A;  5LXT E;  2YK0 A;  4HGA A;  4HEA A;  3RYF E;  4TUY E;  4H63 H;  2X0Y A;  4ZHQ E;  1UX4 A;  5CA0 E;  4AIS A;  2CHO A;  2KWH A;  2MOZ A;  1MMA A;  4KBM B;  4PJJ A;  2CA5 A;  4PJM A;  2DI4 A;  3ONL C;  4EYU A;  3RX6 A;  3Q5E A;  4EV6 A;  2EHO D;  5LMU T;  3ZJ1 A;  4Z91 A;  4DV0 T;  4IDP A;  2XHE B;  1OXZ A;  4UIG A;  5EK3 A;  2EHO B;  2X0H A;  3P4S A;  2HPJ A;  2VUR A;  5BR8 T;  2BVM A;  2XQ8 A;  3AB3 B;  2C0S A;  3O1J A;  2MTC A;  3CML A;  1D1A A;  3GMI A;  4UVB B;  3L09 A;  4O2B E;  4O2A E;  3ZMZ B;  4F8H A;  4DR7 T;  1YW0 A;  1NEK A;  3AE6 A;  3NWI A;  5FL1 A;  4ISS A;  2J47 A;  2XQA A;  2D9D A;  3I0O A;  2WZH A;  3LDQ B;  4LML A;  3QUJ A;  3UQ4 A;  2WBL A;  4CXX A;  3LG7 A;  3N9M A;  3HR0 A;  4ILB A;  2HN2 A;  2NOX A;  4TZ4 C;  1US7 B;  2Y48 B;  5HCM A;  3AXJ B;  3TKL B;  3CQC B;  2XQ3 A;  5HXR A;  1YXR A;  3BQI A;  4JI5 T;  4QX7 B;  4H9N C;  4DR1 T;  2AXD S;  3LK3 B;  1SE7 A;  2NW9 A;  2XY8 B;  4YT0 A;  1HNZ T;  5F5W A;  3NBX X;  3RLF F;  3FZM B;  4X1I E;  1J5E T;  1W0A A;  4KI0 F;  3VR9 A;  3EI0 A;  1XDO A;  2NW7 A;  3E22 E;  5JR9 A;  3ZMV B;  2JMK A;  3SWH A;  2WMO A;  2B76 A;  3CWZ B;  2VKD A;  2A9U A;  3RGL A;  4ZI7 E;  2VKH A;  5IWA T;  3A7M A;  2GK9 A;  2XM1 A;  4TX5 A;  1WCR A;  2C5I T;  3LK2 B;  2NP9 A;  5EZY E;  2IHR 1;  3M3Z B;  3PJA J;  4DV5 T;  4DMW A;  5L2L A;  4ZOL E;  2BG9 A;  5ABG A;  3ZLI A;  2A3D A;  3HKC E;  2BS4 A;  2MBG A;  2Q9Q C;  4KX6 A;  2I6H A;  3NKZ A;  4JEU B;  4EZH A;  2H89 A;  5KX5 E;  5LHI B;  1MMN A;  4MAL A;  3RYI E;  2K24 A;  1O3X A;  1FJG T;  2CWO A;  3AE7 A;  5AQK B;  3ZCI A;  3T1Y T;  4LFA T;  3FBL A;  3AA1 B;  3L39 A;  5HEO A;  3IF8 B;  2X0C A;  4EED A;  3AEG A;  2NR4 A;  4HWF A;  4UR9 A;  5LHH B;  5FNV E;  3FB2 A;  3JAE A;  2WY2 A;  4QH1 A;  4DBQ A;  3EVY A;  1WRD A;  5L3C B;  3ZMT B;  2E9X D;  4TNW A;  1N36 T;  2KZ7 B;  2VVN A;  2XAF B;  4E7S A;  5AQU B;  3ABV A;  3AVR A;  3P8C D;  3PUG A;  4EZ4 A;  4B3R T;  2ZM0 A;  3AXJ A;  1JNR A;  2UXN B;  3C4X A;  3C64 A;  4PK5 A;  2E8I A;  3K3O A;  4TV8 E;  5FY0 A;  3TLW A;  1Y01 A;  1IBK T;  4IHJ E;  2LSK A;  2I0M A;  3KV5 A;  1ZEE A;  3ZN1 B;  3ZT6 A;  3O9X A;  3QOF A;  3AE9 A;  1VOM A;  2J1D G;  2V7L A;  3AEF A;  1HX8 A;  2BG9 B;  1VRB A;  3O4X E;  3UT5 E;  2QVA A;  5F3J A;  2ODU A;  3AED A;  2NTX A;  3LSV A;  4UEL A;  1L0V A;  2IC9 A;  2V1D B;  2YIN A;  4U72 A;  3ESL A;  3L3P A;  4L5G A;  4EGW A;  4L9I A;  2W2U A;  4JI8 T;  4AKL A;  1H7C A;  2XSB A;  2UXX B;  3RIA A;  3TLU A;  3LBX B;  1E2A A;  3AEC A;  4GOU A;  4X66 T;  4GYR A;  4KP3 C;  2V8S V;  4LF7 T;  1DU2 A;  3UU8 A;  4IDZ A;  2HH7 A;  5FZT A;  4W8P A;  2SPC A;  4LMJ A;  4ILU A;  4EOZ B;  1B7T A;  5CJ5 A;  5JTG A;  3ZEF B;  4AQF A;  2V6Y A;  2UU9 T;  4ANJ A;  4N78 D;  4MLK A;  1D1C A;  4HN9 A;  4M1P A;  4A5X A;  3A5X A;  4DND A;  5JRC B;  1FMV A;  2JIW A;  5JDQ A;  4DBR A;  5LA6 E;  3DTO A;  2FJE A;  4JUY A;  2WU5 A;  1J5W A;  1I94 T;  1BR1 A;  4P0B A;  5AQI B;  1IBL T;  2K9A A;  3OKQ A;  4P1N A;  4G63 A;  2WWU A;  2M6B A;  1X79 A;  4WW0 A;  3ZKR A;  3OTO T;  3MJX A;  2BBH A;  4WNK A;  2XQ5 A;  2LLY A;  3GA8 A;  1SJ8 A;  5IUX A;  3SOL A;  2G0U A;  2J62 A;  2JQQ A;  1MND A;  4YXD A;  2WDQ A;  3PU8 A;  2IAK A;  3OPC A;  3QB5 A;  1QSD A;  3CKD A;  3FZK B;  5H6R B;  3B57 A;  3K3Q C;  3ZST A;  5IHY A;  2IIU A;  2VKO A;  2E9X A;  4IDQ A;  5FVL A;  5HAX A;  2DNX A;  3EHZ A;  3L8R A;  2KND A;  3PUZ F;  2WWV A;  1GQE A;  1OED C;  4U3C A;  1J1J A;  3PF0 A;  5LBM A;  4IRE A;  3K3N A;  5C8Y E;  4I43 B;  4YJ3 E;  2CXL A;  4I50 E;  5DAB A;  5F8P A;  1SJ7 A;  4CI1 B;  2ACZ A;  3EUH A;  2XAG B;  3QK6 A;  4PNI A;  5LMN T;  2XAQ B;  5ETW A;  2CLY C;  2H7V C;  2LHR A;  5JH7 E;  2X51 A;  4DR6 T;  4BGO A;  2YU2 A;  2W0G A;  3EAM A;  4MBQ A;  5AQS B;  3CQX C;  2VAS A;  2K5B B;  2M6I A;  4DV3 T;  2CM0 A;  3WAK A;  2KWI B;  4YFS A;  2UUC T;  2FJB A;  5ABE A;  3RRC A;  2OLT A;  5AQV B;  1XWM A;  4HWI B;  4YSZ A;  2D2S A;  4QWN B;  1UGO A;  1UUR A;  2FUP A;  4U33 A;  3KIN B;  3N9O A;  2BKP A;  5HXC A;  3TLT A;  4DO0 A;  2UUA T;  5AQR B;  5DQW A;  4QXC B;  4YSY A;  3OJA A;  2BVL A;  2XM2 A;  2WSS V;  4U7I A;  5JDH A;  4YSX A;  3P7I A;  3FZF B;  5LBQ B;  2BKO A;  2WB5 A;  2FJD A;  3JAD A;  3P4Q A;  4OK0 A;  4YHH T;  2PJQ A;  5IYZ E;  3RH3 A;  4H9R C;  2QRX A;  4HFD A;  3KV4 A;  4DV7 T;  5AQH B;  1WR6 A;  4PK4 A;  4GK5 E;  4JI6 T;  2D0T A;  3ONJ A;  4O8S A;  1G8X A;  4WZX A;  5J2U E;  2V5C A;  2N9D A;  5JDM A;  1HNW T;  4NUU A;  3CX6 B;  2JQK A;  4IGU A;  3AEA A;  2KXP B;  4PFO A;  4WYV A;  4F7G B;  3KVB A;  4QH4 A;  5FXW A;  2X0L B;  2Z6E A;  2YDQ A;  4DID B;  2OV9 A;  2QA7 A;  4LF5 T;  3MXZ A;  2M67 A;  3AE2 A;  5HEU A;  1FIO A;  1LKX A;  2DWK A;  2C5J A;  2XJ7 A;  3B13 A;  3CK6 A;  4V1A v;  3RPU A;  3VHL A;  4E7Z A;  4WBN E;  4B3T T;  3AAA B;  3FXD B;  2KIN B;  1EZ3 A;  4HTE A;  4I55 E;  4EXT A;  3PDY A;  5AQO B;  2DLR A;  3N9N A;  5JR9 C;  4KMC A;  3ZYK A;  3A8Y C;  4ASK A;  2MAW A;  4ZEY A;  4JI0 T;  2YOE A;  4DUY T;  2B1E A;  3AEE A;  1G73 A;  4HKA A;  2LT3 A;  5L4H A;  2X9W A;  2YDR A;  4X62 T;  2LM9 A;  3D0T A;  4UXN B;  3AY5 A;  3AT7 A;  5LCY A;  3N2K E;  2JPF A;  3F31 A;  3TLV A;  2Q9Q A;  3B5M A;  3ETV A;  1LVK A;  3UFG A;  4CXY A;  4LFC T;  2CBJ A;  4OFZ A;  1N32 T;  4H9S E;  5HCJ A;  2RA1 A;  2C5K T;  1N33 T;  4IE4 A;  2YU1 A;  4X1K E;  2YKS A;  3NZQ A;  1ZKE A;  2WCA A;  4IL4 A;  5JVD E;  3ZN0 B;  2ODV A;  2JJ9 A;  3AEB A;  5CFB A;  5JQG E;  3UQ7 A;  3T8O A;  4ZI3 D;  2A72 A;  1YKE B;  5AQG B;  2WU2 A;  4DVD A;  1D0Y A;  3F57 A;  4XAX B;  4MHC A;  1CHU A;  3IA3 A;  4YLH A;  2JQH A;  2MTQ A;  2J4G A;  2XQ7 A;  2BS2 A;  2UXB T;  2Y6X A;  3CVR A;  4IL9 A;  4PK6 A;  3U3I A;  1SA0 E;  4UF0 B;  2P9B A;  1WFD A;  4FI5 A;  1M7K A;  2W00 A;  4OYK A;  5J0Z A;  2E5L T;  1SHZ C;  3PUY F;  3RYH E;  1MIY A;  3VRB A;  2CHN A;  4P09 A;  4AXP A;  2UXD T;  3QNU A;  1LRZ A;  1S94 A;  5J2T E;  3RQW A;  4NXN T;  3J9X 1;  5AQP B;  3IHR A;  1XDP A;  2BZB A;  2IDO B;  3AA7 B;  1Z0P A;  4TWH A;  4ZZC A;  2V7K A;  4O4I E;  3S4U A;  1M62 A;  3ANW A;  3C4Z A;  5LYJ E;  3ZPO A;  4NUV A;  4IE7 A;  3UUB A;  1V9D A;  2W63 A;  3HKD E;  5JDL A;  3JC6 C;  5LOV E;  4UEM A;  2PFV A;  2VWA A;  4QXH B;  4LMK A;  3RRW A;  3NRY A;  2CLY B;  2LSJ A;  3V5S A;  5DQV A;  5AQQ B;  4TWF A;  3CX8 B;  3LK4 2;  2F4V T;  1IZN B;  4IIJ E;  4HFV A;  2LKG A;  3F2E A;  3R84 B;  5LG3 A;  4JI4 T;  4ZXL A;  3FHN A;  4JLE A;  1HFA A;  5HYA A;  2HPL A;  1UX5 A;  3E08 A;  3Q5W A;  5JRE A;  2ZMA A;  4GKK T;  4B3M T;  4CN1 A;  2V26 A;  4F6R C;  4DV4 T;  2KVP A;  4ZI2 D;  4TWD A;  4O4L E;  1OWA A;  2KT9 A;  1YQ3 A;  2CCQ A;  3AA0 B;  1W9R A;  1YD8 G;  1JNZ A;  3AE8 A;  3ANW B;  4DV2 T;  4U2Y A;  5L4E A;  5LB7 B;  2W66 A;  2K3W A;  4LF8 T;  4EEB A;  2KMF A;  1OED A;  2VB6 A;  3N9P A;  4TNV A;  2YEV C;  3SFE A;  4X64 T;  3WAJ A;  4NXM T;  4IE0 A;  3AE3 A;  2XQ6 A;  3N2O A;  3HI2 A;  2EHO C;  4EIW A;  2XTL A;  5ABF A;  2BG9 E;  4XZC A;  1HNX T;  3MZK B;  4A98 A;  1MIV A;  2LKH A;  3PUW F;  4HFC A;  3PTR B;  4I4T E;  3UUX B;  2QGS A;  3VJZ A;  3PHF 1;  1LVF A;  3I0Q A;  1ZOY A;  2LSY A;  2IW5 B;  4U74 A;  1QLB A;  4B6X A;  4JEH B;  5JDN A;  1HX1 B;  3C50 A;  2CWY A;  1KNP A;  1BR2 A;  2ACX A;  2LJL A;  2V6Y B;  3RIF A;  4LF9 T;  3R6N A;  4OX9 T;  1HR0 T;  3PUQ A;  3VKG A;  2V7M A;  4GKJ T;  1E7P A;  1FEW A;  4HFB A;  2WS3 A;  3RC8 A;  3IBP A;  3PV0 F;  2IML A;  2PG8 A;  3AE5 A;  3ZSS A;  5C3J A;  3MAC A;  4NIQ A;  3ZJ2 A;  5AQF B;  2QYW A;  3SS1 A;  2XAJ B;  1Y64 B;  2Q9Q B;  4NPP A;  3TLS A;  4EAH A;  4U7Y A;  5A1L A;  4IT4 A;  5LHG B;  1KNZ A;  3M1C A;  3M65 A;  3UUN A;  5FY1 A;  3AAI A;  4IST A;  4TV9 E;  2WMN A;  1HG5 A;  1UUS A;  2XQY A;  2ZM8 A;  4HE8 A;  5HEG A;  4IDO A;  4X5T A;  3LFM A;  4ZS2 A;  1KEY A;  2PTF A;  3Q5X A;  5LJN A;  4YHJ A;  4Z8X A;  3OYZ A;  3AE1 A;  3VR8 A;  5JRC A;  1WYC A;  3GN5 B;  4IDN A;  5LGU B;  2XAS B;  1ZP0 A;  2W4X A;  4CQI A;  4EB6 E;  4AQF C;  1WLX A;  2KLQ A;  3N9Q A;  3UUM A;  3WSC A;  4X20 E;  4HWH A;  2HHH T;  2WQY A;  1XNR T;  2ES0 A;  2ZLY A;  3RI5 A;  5HXE A;  2JMH A;  3KDS E;  4AIU A;  4AQY T;  4XBF B;  3ZYL A;  5JDF A;  4YJ2 E;  5HXH A;  2VL0 A;  2VK9 A;  1XZY A;  4IE5 A;  2LSI A;  4QX8 B;  4AKI A;  3VU7 H;  2W61 A;  4BJM A;  3J7Y q;  3I9W A;  4PAG A;  5AFU L;  5ABF B;  2L7N A;  3FYQ A;  3MKD A;  3P4W A;  2JRK A;  5CGM A;  1YKH B;  4QH5 A;  1W09 A;  3SRZ A;  2CRB A;  1VCT A;  2FBW A;  2R6G F;  5L47 A;  2H7O A;  3SFD A;  4YTN A;  2WAU A;  3JCF A;  4HWD A;  2XSA A;  3KBT A;  4MFR A;  3WI3 A;  1BR0 A;  1WYB A;  2VQE T;  2WDR A;  4H9Q C;  5FKY A;  4CZZ B;  4O4J E;  2BG9 C;  3CPZ A;  5AQN B;  1VCS A;  4JYA T;  3W15 B;  1Z8U A;  5LNK A;  4DR4 T;  5AQL B;  5J1G A;  3C98 B;  3KV9 A;  2CBI A;  5HWY A;  4BA9 A;  4K0K T;  3N2G E;  1WR0 A;  3PUA A;  1D1B A;  4AI6 A;  2YN6 A;  3NRX A;  3NVO A;  4GIW A;  4ILC A;  1HS7 A;  1HTJ F;  4ZI3 C;  4DR3 T;  2XUE A;  3VKH A;  3NZP A;  3O1H A;  2LHN A;  1ZV4 X;  3C4W A;  2K48 A;  4KHZ F;  4ZS3 A;  5TAO A;  4AKR B;  3OBV E;  1XMO T;  3AAE B;  2OA5 A;  3AE4 A;  3ONX A;  2MPK A;  2N1G A;  2NW8 A;  5AQT B;  5HEJ A;  1KFY A;  3UTK A;  3PU3 A;  3RHW A;  3H3A A;  3I9Y A;  3GWH A;  3WUR A;  3EAB A;  4UV8 B;  5FVK A;  3IEE A;  1OED E;  3FZL B;  3PE0 A;  3RQU A;  4HFI A;  2XQ4 A;  1NEN A;  5ADX L;  2V6X A;  4J2C A;  3ZT7 A;  4Q25 A;  1AJ3 A;  1CUN A;  3N9L A;  5CB4 E;  2LOS A;  2DCF A;  4IE6 A;  2I59 A;  2LRL A;  3PUS A;  3T1H T;  2XQ9 A;  4PJL A;  2UUB T;  2H3R A;  4KUM B;  3X1D A;  3P4R A;  4WBO A;  2YDS A;  4COF A;  4C91 A;  1R8I A;  4JI3 T;  2RPA A;  3RF1 A;  2E2A A;  4AKG A;  3EDV A;  1OED B;  4ECG A;  1X9B A;  3UU4 A;  3AVS A;  2WDV A;  4HFE A;  3H3M A;  2X9Y A;  4CI3 B;  5HWX A;  4DV1 T;  5LG4 A;  2L9Q A;  4BAY B;  2CMR A;  2MYS A;  4K0U A;  3RYC E;  4DUZ T;  4CN6 A;  1XNQ T;  1XMQ T;  5M4Y A;  3HKB E;  2KSR A;  4QHO A;  2DHR A;  2A2F X;  1BR4 A;  2XZE A;  2DWG A;  2LRK A;  4GK0 E;  2XAH B;  4L0R A;  3JAF A;  2WP9 A;  3EDU A;  2X9X A;  1KF6 A;  1HCI A;  5KMG P;  4A56 A;  4AQG A;  2BS3 A;  1I6Z A;  3RIU C;  2KGX A;  2Y8D A;  5EK2 A;  5KXJ A;  1S35 A;  3P50 A;  4O4H E;  2CE7 A;  2H88 A;  2D5U A;  4DV6 T;  1UK5 A;  3OVU A;  4UF0 A;  1U4Q A;  2X67 A;  4QKN A;  4JV5 T;  3FBZ A;  4PFP A;  2LEH A;  3K1S A;  3ZMS B;  2X68 A;  5GON E;  3ZC0 A;  3K8P C;  3G06 A;  3FZH B;  4ADZ A;  4EYY R;  3QB5 K;  2CEA A;  2CXD A;  5L3B B;  3E0Z A;  1MMG A;  4PJN A;  1QUU A;  3UUL A;  4CXW A;  2VQF T;  1KNR A;  1MNE A;  4LF4 T;  3UU6 A;  1E1H B;  2PBI A;  3PJA A;  1U5P A;  4Z90 A;  3KV6 A;  4GYS A;  4HFH A;  4ZI2 C;  4LF6 T;  3Q2M A;  4DR2 T;  3V5U A;  5L3F B;  2DL1 A;  2ZM6 T;  4ILA A;  5FL0 A;  3U78 A;  5HXS A;  2UXC T;  2L10 A;  3RIU A;  3HKE E;  4X1Y E;  4G2A A;  5JDG A;  3PUX F;  4H63 V;  2N2N A;  3RKG A;  4QXB B;  3OYX A;  5H6Q B;  1HG2 A;  5LJM A;  4TN7 B;  2CPT A;  1ZHC A;  3Q5D A;  2X9H A;  3CQG B;  3MA9 A;  3ZCJ A;  2LM2 A;  5JR9 B;  3KFW X;  2LQU A;  2WZI A;  4YTP A;  4I0U A;  3H37 A;  2NTY A;  3GN5 A;  4FJO A;  1NWM X;  2V5D A;  5BMV E;  5LP6 E;  3JC6 D;  1MIW A;  2IUB A;  2LOP A;  2VKJ A;  2AE9 A;  5DJQ C;  3KVA A;  3UU5 A;  1T8B A;  4X65 T;  1IAP A;  5FYM A;  3UU3 A;  3BK9 A;  1HF8 A;  4C90 A;  2EHO A;  5HEH A;  2CXF A;  3KBU A;  4YY3 T;  4KHP T;  4ERR A;  2V7J A;  5FXZ A;  2D0U A;  3VRA A;  1T98 A;  3ZC1 A;  4JI1 T;  3ZMU B;  1MMD A;  2JQ9 A;  4JBW F;  2VL8 A;  2Q9Q D;  4U31 A;  3ZT5 A;  2NWB A;  5CA1 E;  5LGT B;  4H9O C;  3HA4 A;  3ETU A;  2FJA A;  3CX7 B;  2IC6 A;  3I1A A;  1KK7 A;  4B3S T;  1IBM T;  4LFB T;  3DYJ A;  1NAF A;  1T7S A;  3MK7 C;  2VVS A;  2WM9 A;  2RP4 A;  3PUR A;  3Q9D A;  5FXX A;  3DP7 A;  5C2T A;  5L3E B;  4P0A A;  3PUV F;  5FMN A;  1SUM B;  4PW8 A;  4A97 A;  3RC3 A;  4ZZB A;  3HL6 A;  5KDM C;  1IJ6 A;  3C51 A;  3BQL A;  5FXV A;  4JI2 T;  4DMV A;  5L3D B;  5LGN B;  4AKH A;  2KBB A;  3P4P A;  5T1D A;  2BKN A;  2LE8 A;  3AA6 B;  3O1I A;  4ONR A;  3N5L A;  4YTM A;  1IJ5 A;  5L3G B;  3RKO A;  1N34 T;  1T72 A;  2X66 A;  2LSG A;  3QC9 A;  1FMW A;  1UCU A;  2W67 A;  2BDE A;  2E9X B;  3DJB A;  5AQJ B;  2V7I A;  3LJC A;  5AQM B;  5EK4 A;  5FP3 A;  4DR5 T;  4CI2 B;  4OHF A;  3UFE A;  2BBJ A;  1YQ4 A;  3LBX A;  5E0O A; 
#chains in the Genus database with same CATH homology
 3FXE B;  5FY7 A;  2L3L A;  2E9X C;  4H9P C;  2W62 A;  1D0X A;  2L8K A;  4UVC B;  3BQK A;  4UVA B;  1D0Z A;  2ZM2 A;  4OYJ A;  4UV9 B;  4BJN A;  3ZYM A;  5LXT E;  2YK0 A;  4HGA A;  4HEA A;  3RYF E;  4TUY E;  4H63 H;  5CA0 E;  4ZHQ E;  1UX4 A;  2KWH A;  2MOZ A;  1MMA A;  4KBM B;  4PJJ A;  2CA5 A;  4PJM A;  2DI4 A;  4EYU A;  3RX6 A;  2EHO D;  3ZJ1 A;  2XHE B;  1OXZ A;  4UIG A;  5EK3 A;  2EHO B;  2HPJ A;  2BVM A;  3AB3 B;  2C0S A;  3O1J A;  2MTC A;  3CML A;  1D1A A;  3GMI A;  4UVB B;  3L09 A;  4O2B E;  4O2A E;  3ZMZ B;  1YW0 A;  4ISS A;  3I0O A;  3QUJ A;  2WBL A;  4CXX A;  3LG7 A;  3N9M A;  3HR0 A;  4TZ4 C;  2NOX A;  5EK2 A;  1US7 B;  2Y48 B;  3TKL B;  4BA9 A;  3CQC B;  5HXR A;  3BQI A;  4QX7 B;  4H9N C;  3LK3 B;  2NW9 A;  3NBX X;  4X1I E;  5JR9 A;  2NW7 A;  3E22 E;  3ZMV B;  2JMK A;  3SWH A;  2WMO A;  3CWZ B;  2VKD A;  4ZI7 E;  2VKH A;  2GK9 A;  3RRC A;  4TX5 A;  3LK2 B;  2C5I T;  5EZY E;  2NP9 A;  4DMW A;  5L2L A;  4ZOL E;  3ZLI A;  2A3D A;  3HKC E;  2MBG A;  2Q9Q C;  5KX5 E;  4JEU B;  4EZH A;  5LHI B;  1MMN A;  4MAL A;  3RYI E;  2K24 A;  1O3X A;  2CWO A;  3ZCI A;  3FBL A;  3AA1 B;  3IF8 B;  5LHH B;  5FNV E;  3FB2 A;  4DBQ A;  3EVY A;  1WRD A;  5L3C B;  3ZMT B;  2E9X D;  2KZ7 B;  2XAF B;  4E7S A;  3AVR A;  3P8C D;  3PUG A;  4EZ4 A;  2ZM0 A;  2UXN B;  3C4X A;  4PK5 A;  3C64 A;  4TV8 E;  2E8I A;  3K3O A;  5FY0 A;  4IHJ E;  2LSK A;  3KV5 A;  3O9X A;  1ZEE A;  3ZN1 B;  1VOM A;  2J1D G;  2V7L A;  1HX8 A;  3O4X E;  1VRB A;  3UT5 E;  5F3J A;  2ODU A;  2NTX A;  4UEL A;  2IC9 A;  2V1D B;  2YIN A;  4U72 A;  3ESL A;  3L3P A;  4L5G A;  4L9I A;  4AKL A;  1H7C A;  2UXX B;  3LBX B;  4GOU A;  4GYR A;  4KP3 C;  4IDZ A;  2HH7 A;  2SPC A;  4ILU A;  4EOZ B;  1B7T A;  3ZEF B;  4AQF A;  4ANJ A;  4N78 D;  4MLK A;  1D1C A;  4HN9 A;  4M1P A;  4DND A;  3A5X A;  5JRC B;  1FMV A;  5JDQ A;  4DBR A;  5LA6 E;  3DTO A;  4JUY A;  1BR1 A;  4P0B A;  2K9A A;  3OKQ A;  4G63 A;  2WWU A;  4WW0 A;  1X79 A;  3MJX A;  4WNK A;  3GA8 A;  3SOL A;  2G0U A;  2JQQ A;  1MND A;  3PU8 A;  2IAK A;  5H6R B;  1QSD A;  3CKD A;  1AJ3 A;  3B57 A;  3K3Q C;  5IHY A;  2VKO A;  4CI1 B;  2E9X A;  5HAX A;  2DNX A;  2KND A;  3PF0 A;  5LBM A;  3K3N A;  5C8Y E;  4I43 B;  4YJ3 E;  2CXL A;  4I50 E;  5DAB A;  5F8P A;  3EUH A;  2XAG B;  3QK6 A;  4PNI A;  2XAQ B;  5ETW A;  2CLY C;  2H7V C;  2LHR A;  5JH7 E;  2X51 A;  4BGO A;  2YU2 A;  2W0G A;  4MBQ A;  3CQX C;  2VAS A;  2K5B B;  2CM0 A;  3WAK A;  2KWI B;  4YFS A;  2D2S A;  4QWN B;  5HXC A;  3KIN B;  3N9O A;  4DO0 A;  5DQW A;  4QXC B;  3OJA A;  2BVL A;  2WSS V;  5JDH A;  3P7I A;  5LBQ B;  4OK0 A;  2PJQ A;  5IYZ E;  3RH3 A;  4H9R C;  3KV4 A;  1WR6 A;  4PK4 A;  4GK5 E;  2D0T A;  4O8S A;  5J2U E;  1G8X A;  5JDM A;  2N9D A;  4NUU A;  3CX6 B;  4IGU A;  2KXP B;  4PFO A;  3KVB A;  5FXW A;  2X0L B;  2Z6E A;  2QA7 A;  3MXZ A;  2M67 A;  1FIO A;  1LKX A;  2DWK A;  2C5J A;  3B13 A;  3VHL A;  4V1A v;  3RPU A;  4E7Z A;  4WBN E;  3AAA B;  3FXD B;  2KIN B;  1EZ3 A;  4HTE A;  4I55 E;  4EXT A;  3PDY A;  2DLR A;  3N9N A;  5JR9 C;  4KMC A;  3ZYK A;  4ASK A;  2B1E A;  1G73 A;  4HKA A;  2LT3 A;  2X9W A;  2LM9 A;  3D0T A;  4UXN B;  3AT7 A;  5LCY A;  3N2K E;  2JPF A;  3F31 A;  2Q9Q A;  3ETV A;  1LVK A;  4CXY A;  4OFZ A;  4H9S E;  2RA1 A;  2C5K T;  4IE4 A;  2YU1 A;  4X1K E;  3NZQ A;  1ZKE A;  5JVD E;  3ZN0 B;  2ODV A;  2JJ9 A;  5JQG E;  3T8O A;  4ZI3 D;  2A72 A;  1YKE B;  4DVD A;  1D0Y A;  3F57 A;  4XAX B;  4MHC A;  4YLH A;  2MTQ A;  2Y6X A;  3CVR A;  4PK6 A;  3U3I A;  1SA0 E;  4UF0 B;  2P9B A;  4FI5 A;  2W00 A;  4OYK A;  1SHZ C;  3RYH E;  1MIY A;  4P09 A;  4AXP A;  1LRZ A;  1S94 A;  5J2T E;  3J9X 1;  3IHR A;  2BZB A;  3AA7 B;  1Z0P A;  2V7K A;  4O4I E;  3S4U A;  3ANW A;  3C4Z A;  5LYJ E;  3ZPO A;  4NUV A;  4IE7 A;  1V9D A;  2W63 A;  3HKD E;  5JDL A;  3JC6 C;  5LOV E;  4UEM A;  2PFV A;  2VWA A;  4QXH B;  3RRW A;  3NRY A;  2CLY B;  2LSJ A;  3V5S A;  5DQV A;  3CX8 B;  3LK4 2;  1IZN B;  4IIJ E;  4HFV A;  3R84 B;  3F2E A;  3FHN A;  4JLE A;  1HFA A;  5HYA A;  2HPL A;  1UX5 A;  3E08 A;  3Q5W A;  5JRE A;  2ZMA A;  2V26 A;  4F6R C;  4ZI2 D;  4O4L E;  1OWA A;  2KT9 A;  2CCQ A;  3AA0 B;  1YD8 G;  3ANW B;  2KMF A;  2VB6 A;  3N9P A;  2YEV C;  3WAJ A;  4IE0 A;  3N2O A;  3HI2 A;  2EHO C;  4EIW A;  2XTL A;  4XZC A;  3MZK B;  1MIV A;  4I4T E;  3PTR B;  3UUX B;  2QGS A;  3VJZ A;  3PHF 1;  1LVF A;  3I0Q A;  2LSY A;  2IW5 B;  5JDN A;  4U74 A;  4B6X A;  4JEH B;  3C50 A;  2CWY A;  1BR2 A;  2ACX A;  2LJL A;  3R6N A;  3PUQ A;  3VKG A;  2V7M A;  1FEW A;  3RC8 A;  3IBP A;  2PG8 A;  3MAC A;  3ZJ2 A;  3SS1 A;  5A1L A;  2XAJ B;  1Y64 B;  2Q9Q B;  4EAH A;  5LHG B;  1KNZ A;  3M1C A;  3M65 A;  3UUN A;  5FY1 A;  3AAI A;  4IST A;  4TV9 E;  2WMN A;  1HG5 A;  2XQY A;  4HE8 A;  2ZM8 A;  3LFM A;  4ZS2 A;  3Q5X A;  5LJN A;  4YHJ A;  4Z8X A;  3OYZ A;  5JRC A;  1WYC A;  3GN5 B;  5LGU B;  2XAS B;  4CQI A;  4EB6 E;  4AQF C;  1WLX A;  2KLQ A;  3N9Q A;  3UUM A;  3WSC A;  4X20 E;  2ES0 A;  2ZLY A;  5HXE A;  2JMH A;  3KDS E;  4XBF B;  3ZYL A;  5JDF A;  4YJ2 E;  5HXH A;  2VK9 A;  4IE5 A;  2LSI A;  4QX8 B;  4AKI A;  3VU7 H;  2W61 A;  4BJM A;  3J7Y q;  3I9W A;  4PAG A;  5AFU L;  3MKD A;  2JRK A;  1YKH B;  3SRZ A;  2H7O A;  2WAU A;  3KBT A;  4MFR A;  3WI3 A;  1BR0 A;  1WYB A;  4H9Q C;  4CZZ B;  4O4J E;  3CPZ A;  3W15 B;  5LNK A;  5J1G A;  3C98 B;  3KV9 A;  5HWY A;  3N2G E;  3PUA A;  1D1B A;  4AI6 A;  3NRX A;  4GIW A;  1HS7 A;  1HTJ F;  4ZI3 C;  3VKH A;  2XUE A;  3NZP A;  3O1H A;  2LHN A;  1ZV4 X;  3C4W A;  2K48 A;  5TAO A;  4ZS3 A;  4AKR B;  3OBV E;  3AAE B;  2OA5 A;  3ONX A;  2N1G A;  2NW8 A;  3UTK A;  3PU3 A;  3H3A A;  3I9Y A;  3GWH A;  3WUR A;  4UV8 B;  3IEE A;  3PE0 A;  5ADX L;  4J2C A;  1CUN A;  3N9L A;  5CB4 E;  2LOS A;  2DCF A;  4IE6 A;  2I59 A;  3PUS A;  4PJL A;  2H3R A;  4KUM B;  4WBO A;  4C91 A;  4AKG A;  3EDV A;  3AVS A;  2X9Y A;  5HWX A;  5LG4 A;  2L9Q A;  4BAY B;  2CMR A;  2MYS A;  4K0U A;  3RYC E;  5M4Y A;  3HKB E;  4QHO A;  2DHR A;  2A2F X;  1BR4 A;  2DWG A;  4GK0 E;  2XAH B;  4L0R A;  3EDU A;  2X9X A;  1HCI A;  5KMG P;  4A56 A;  4AQG A;  2Y8D A;  1S35 A;  4O4H E;  2CE7 A;  2D5U A;  4UF0 A;  1U4Q A;  2X67 A;  4QKN A;  3FBZ A;  4PFP A;  2LEH A;  3ZMS B;  2X68 A;  5GON E;  3ZC0 A;  3K8P C;  4ADZ A;  4EYY R;  2CEA A;  2CXD A;  5L3B B;  3E0Z A;  1MMG A;  4PJN A;  1QUU A;  3UUL A;  4CXW A;  1MNE A;  1E1H B;  2PBI A;  1U5P A;  3KV6 A;  4GYS A;  4ZI2 C;  3Q2M A;  3V5U A;  5L3F B;  3U78 A;  5HXS A;  3HKE E;  4X1Y E;  4G2A A;  5JDG A;  4H63 V;  2N2N A;  4QXB B;  3OYX A;  5H6Q B;  1HG2 A;  5LJM A;  4TN7 B;  4ECG A;  1ZHC A;  3ZCJ A;  2X9H A;  3CQG B;  3MA9 A;  5JR9 B;  2LQU A;  3KFW X;  3H37 A;  2NTY A;  3GN5 A;  4FJO A;  1NWM X;  5BMV E;  5LP6 E;  3JC6 D;  1MIW A;  2LOP A;  2VKJ A;  5DJQ C;  3KVA A;  1IAP A;  5FYM A;  4C90 A;  3BK9 A;  1HF8 A;  2EHO A;  2CXF A;  3KBU A;  4ERR A;  2V7J A;  5FXZ A;  2D0U A;  3ZC1 A;  1T98 A;  3ZMU B;  1MMD A;  2VL8 A;  2Q9Q D;  5CA1 E;  5LGT B;  2NWB A;  4H9O C;  3HA4 A;  3ETU A;  3CX7 B;  3I1A A;  2IC6 A;  1KK7 A;  1NAF A;  3MK7 C;  3PUR A;  2WM9 A;  2RP4 A;  5L3E B;  3Q9D A;  5FXX A;  3DP7 A;  4P0A A;  5FMN A;  4PW8 A;  3RC3 A;  5KDM C;  3HL6 A;  5LGN B;  1IJ6 A;  3C51 A;  3BQL A;  5FXV A;  4DMV A;  5L3D B;  4AKH A;  5T1D A;  2LE8 A;  3AA6 B;  3O1I A;  4ONR A;  3N5L A;  5L3G B;  1IJ5 A;  3RKO A;  2X66 A;  2LSG A;  3QC9 A;  1FMW A;  1UCU A;  2BDE A;  2E9X B;  3DJB A;  2V7I A;  3LJC A;  5EK4 A;  5FP3 A;  4CI2 B;  4OHF A;  3UFE A;  4CI3 B;  3LBX A;  5E0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...