5HYAA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchangerncx_mj soaked with 150 mm na+ and nominal ca2+
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
Knots found
sequence length
304
structure length
297
Chain Sequence
b'MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRMGGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 132
structure length 297
sequence length 304
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hyaA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hyaA02
5HXRA 5JDNA 5JDLA 5JDFA 5HXSA 5HWYA 3V5UA 5HXHA 5JDGA 3V5SA 5HXEA 5JDHA 5HYAA 5JDMA 5JDQA 5HXCA 5HWXA
chains in the Genus database with same CATH superfamily
4LF5T 3ESLA 4F8HA 1QLBA 4YHHT 4DVDA 2XY8B 4P0AA 3ZC1A 4GKJT 2WP9A 3ZN1B 5AQTB 4TZ4C 3T1HT 3A5XA 2E5VA 3N9QA 1YXRA 5JVDE 3A8YC 4N78D 4ZS3A 2NR4A 4H9QC 3B5MA 1FEWA 2UUCT 3PUVF 1JNRA 5HXSA 2EHOD 3QK6A 4ZI3C 5JDNA 3CIRA 2XQ8A 4WBOA 1JNZA 3PTRB 5LG4A 4LF7T 2F4VT 4BJMA 1KEYA 4QH1A 2WAUA 1J1JA 2X0YA 2V6XA 3F57A 5LXTE 4EB6E 2LLYA 4ZI2C 5AQLB 3ZC0A 5AQFB 3CQGB 4PAGA 2X51A 1N34T 4YJ2E 1SJ8A 4HFVA 4UV9B 4A5XA 1EZ3A 4ZOLE 2OLTA 1Z0PA 2VQET 3ZMUB 1N33T 1YKEB 2XQ9A 5FZTA 4GK5E 4LMLA 5HCMA 3DJBA 4O4JE 3F31A 5EK4A 2LSKA 4P1NA 1T8BA 5LCYA 5IWAT 4X1KE 4YSZA 3UU5A 4O2BE 5LHIB 4FJOA 1J5WA 2LEHA 2JQ9A 3JAEA 3MXZA 1XDPA 3GN5A 2HN1A 5F3JA 1BR1A 3HKEE 4IDZA 3ZMSB 3AA7B 4ECGA 3P7IA 3AE5A 3OBVE 3WURA 2C5IT 2E9XC 4PJMA 5LBQB 2MPKA 4O2AE 3O1HA 3E0ZA 4I0UA 3KV6A 3LK2B 4BA9A 2CPTA 2LQUA 1UUSA 1VRBA 1Z8UA 2X9XA 3PUZF 2V8SV 1V9DA 3E22E 3MA9A 4F7GB 5M4YA 5LP6E 4YSYA 4JV5T 1HFAA 4ZHQE 1HG2A 3AE3A 4AIUA 1WR6A 4AKIA 4W8PA 2IC9A 4CXYA 3O4XE 4U2ZA 5LHHB 3AAIA 4DR6T 3ZT7A 3UTKA 4PJNA 3UUMA 5L3CB 5F5WA 3CQCB 4HFEA 3RC8A 3AVSA 2H88A 5AQKB 4DV3T 3OVUA 3Q9DA 4IDNA 2XTLA 5T1DA 4OFZA 2BG9B 1KNPA 3J9X1 3AEFA 4HE8A 3UU8A 3ZMZB 2L7NA 4H9PC 5HWXA 4JI5T 1OWAA 3BQIA 3IHRA 5CJ5A 4COFA 4TX5A 2YOEA 4UVCB 1M62A 4QWNB 2CXDA 1Y01A 4KI0F 2VKJA 4OK0A 1QSDA 2WDVA 2WWUA 2UXDT 5FXVA 2UUAT 3FXDB 3ONLC 4PFPA 3EHZA 1HTJF 2FBWA 2IC6A 1D1CA 3HI2A 3ANWA 4JUYA 4QH5A 4JEUB 4JI0T 1X79A 3CX8B 3H3AA 4QHOA 3C51A 2XQAA 2PBIA 1SHZC 2IDOB 4GKKT 1XMQT 1YKHB 2CXLA 4I50E 3SS1A 4ANJA 1HR0T 4QXHB 2L8KA 3LK42 5LGNB 3PUAA 3ZSSA 1I6ZA 1MNDA 2I0MA 1KNZA 5L3EB 5JH7E 4LF9T 3CWZB 2W00A 2K24A 2M6BA 5LOVE 2YDRA 3ZMTB 2UXXB 2WWVA 4IGUA 3RKOA 3OKQA 4DV2T 5LNKA 5J2UE 2LJLA 2NOXA 4UELA 3PF0A 4DV4T 3C4XA 4BAYB 2W4XA 2EHOA 2LOSA 3P4SA 4IE0A 1UURA 2KZ7B 2IIUA 3KV4A 2X9YA 2DNXA 4P09A 4DMWA 2DL1A 3KBTA 2XM2A 3ZCJA 4CXWA 2V6YA 4IIJE 1YQ3A 3I0OA 2CE7A 2KINB 3OYZA 3QNUA 1E2AA 5FY1A 4LF8T 1W09A 2BG9C 3AECA 2VK9A 2VVNA 4DUYT 3WI3A 2Q9QB 1LVFA 4IDOA 3TLWA 3L09A 1UX5A 3HKCE 3WSCA 1XDOA 1FMWA 1XMOT 5HXHA 4DV7T 2UU9T 2W0GA 3AA1B 3FHNA 3PUWF 1W0AA 2W66A 2KWHA 3Q2MA 4CN1A 3MKDA 1HNZT 3TLVA 3AE9A 3PE0A 4L9IA 3R6NA 4I43B 2JIWA 3AXJA 2HH7A 2AXDS 3ZT6A 3QOFA 2CHOA 4JLEA 2KBBA 5EK2A 5AQPB 1SJ7A 2PJQA 3C4ZA 4H9OC 5LHGB 4DR1T 4GIWA 4UF0B 3CQXC 4A98A 1MMNA 2X9HA 4AXPA 2YEVC 5ABFA 4AKRB 4UV8B 3TKLB 4DNDA 2IMLA 4TV9E 4AKHA 2CM0A 4GYSA 3E08A 1HF8A 1R8IA 5CB4E 2HPJA 3EDUA 4YLHA 1SUMB 5CFBA 5KMGP 3HKDE 4O4LE 4TNWA 3I9YA 4EIWA 3NRYA 3ZN0B 3KINB 5HWYA 3SRZA 1VCSA 2W67A 1WYCA 2E9XB 2LHNA 1MMDA 1ZP0A 4TN7B 3LBXB 2JMKA 3N9LA 4G2AA 2D5UA 2VKOA 4Q25A 4OYJA 2LKGA 2E2AA 2YKSA 3L39A 3O9XA 2XUEA 5L3DB 2XPKA 5AQJB 3U3IA 2VL0A 4IL4A 2XAGB 1N36T 3OPCA 4O4IE 3EDVA 3ZCIA 2CBJA 4X62T 5FYMA 4A56A 5HEGA 4CI2B 3T8OA 4X5TA 5L4HA 2FJDA 1OEDA 5JDGA 5FY7A 4U3CA 3RC3A 4CN6A 3UU4A 4JI1T 2Q9QC 3AEAA 3RYHE 5LYJE 4WW0A 1CUNA 4JEHB 2H7OA 3DTOA 1IAPA 3G06A 5JR9A 1L0VA 2EHOC 3IBPA 1YQ4A 3LJCA 4AQGA 2HN2A 4YXDA 1N32T 2JQKA 2BKOA 1FIOA 1OXZA 2XHEB 1MMGA 3K8PC 3Q5XA 1HG5A 4KBMB 3CX7B 2Y8DA 3M3ZB 2Y6XA 3LFMA 5AQVB 5J1GA 2QVAA 4YY3T 2D0UA 2K48A 4LF6T 5L2LA 2KSRA 5AQRB 2VURA 2WMOA 5HCJA 1Y64B 4CZZB 2V7IA 4ZI2D 3IF8B 5JR9B 1MNEA 3MACA 4GYRA 3VR9A 2UUBT 4WBNE 2ES0A 2CWYA 3FBZA 2WZHA 2UXCT 4Z8XA 3P4QA 2DWGA 4ILAA 3NRXA 3KVBA 5ADXL 1E1HB 1IBMT 3QC9A 3LK3B 5LMUT 2XJ7A 3N9OA 4PFOA 1LKXA 2A3DA 4X1IE 2WSSV 3MK7C 1VOMA 4HWHA 3P4RA 4MFRA 4TV8E 3WAJA 5C8YE 3PU8A 5CGMA 4CQIA 2L9QA 3FZKB 2C5KT 4Z91A 3D0TA 3QUJA 4ZZCA 4XAXB 3SWHA 3L3PA 2XM1A 1XNQT 2WDRA 3VR8A 4L0RA 2FUPA 3PUYF 5HXCA 3P50A 2J47A 4JBWF 2PFVA 3VU7H 2V5DA 3VRBA 4LF4T 5A1LA 3P8CD 1G73A 4JI6T 5HEHA 5L3GB 4EYYR 3UFEA 5JDHA 4TWHA 1NEKA 3I0QA 3GN5B 2XAJB 5ABGA 3V5UA 1SA0E 2P9BA 3B13A 4DV5T 1OEDE 3K3QC 5ABHA 1U5PA 5IYZE 2E5LT 4EGWA 2UXBT 2W63A 4WZXA 1E7PA 3JCFA 3ZYLA 4HWFA 3AEBA 2HHHT 5FKYA 3RH3A 4YT0A 3J7Yq 1BR4A 1YW0A 4ILCA 2KXPB 4EYUA 5FXXA 1IJ6A 2X68A 5TAOA 1ZEEA 1HNXT 3RI5A 3NVOA 2LE8A 3K3NA 2LSIA 3NZPA 4NPPA 1W0BA 3PJAJ 5JDQA 4OX9T 3N5LA 4U33A 2BKNA 3O1JA 3X1DA 5L4EA 3AE1A 5FL1A 4TWDA 4DMVA 2NWBA 1OEDC 4AISA 1ZOYA 2MTCA 3UFGA 3UQ7A 2RP4A 3UUXB 4JI7T 4BJNA 4X1YE 1D0ZA 4EEBA 3CPZA 5JRCA 2IUBA 3HA4A 5FXZA 3FBLA 3AY5A 1D0XA 5JR9C 4ZXLA 1WLXA 2CA5A 5AQNB 1HX1B 4E7SA 2PTFA 2NTXA 2LM9A 2CLYB 1YD8G 3AT7A 4YSXA 3AE2A 1B7TA 5JDLA 3UUNA 3CVRA 2BVMA 2J62A 2RPAA 4UVAB 3ANWB 2VKDA 3RHWA 3WAKA 4U31A 3UU6A 1KF6A 2ZM6T 2LRLA 4JYAT 5AQSB 2QA7A 2XASB 2N9DA 2L10A 5CA0E 2YN6A 2R6GF 1WRDA 3IEEA 2JQHA 5FVLA 2YU1A 3P4PA 4B6XA 3FZHB 2XAFB 4L5GA 1UCUA 3ETUA 4HTEA 3M65A 4GK0E 2WU2A 2XAHB 2XQ4A 2V7MA 3JC6C 4H9RC 4IE6A 3RRCA 5AFUL 2LOPA 1UX4A 2YK0A 3ZKRA 4DUZT 4HWCA 4YFSA 2UXNB 5J2TE 4UR9A 4PJJA 2H3RA 4WNKA 2JRKA 4PK6A 4BGOA 2WQYA 3BQLA 2DLRA 2VASA 2H7VC 3KVAA 1UK5A 3AE7A 5FVKA 3DYJA 2B76A 4H9NC 2QGSA 4K0UA 4NUVA 3ZYKA 4YTNA 4KMCA 2GK9A 3F2EA 4PJLA 5HXRA 2EHOB 3QB5K 4X65T 3EUHA 2JMHA 1MIWA 5FMNA 3PUXF 3UT5E 1NWMX 4TNVA 2V6YB 4QX8B 3N9NA 3UQ4A 2YDQA 2Y48B 3OYXA 2IW5B 3ONJA 3U78A 2ZMAA 4O4HE 2DCFA 5FL0A 1ZHCA 1HCIA 1T72A 2BS2A 3FYQA 3UULA 2D9DA 3HKBE 3VJZA 1WR0A 2DI4A 3RPUA 4HFIA 1H7CA 5H6QB 5EZYE 2KWIB 4C90A 3EAMA 3AEEA 3ZJ1A 2BDEA 1S35A 4QX7B 5HEJA 4EZ4A 2N1GA 4X66T 4JI8T 3PHF1 4G63A 4IHJE 2CLYC 2FJEA 3VRAA 1T98A 4UIGA 1ZKEA 4P0BA 2IHR1 3RQUA 5FY0A 3EABA 3AXJB 2XAQB 2VWAA 3N2OA 2LKHA 3ZYMA 2K5BB 3Q5DA 2C0SA 3ZJ2A 4KHPT 1X9BA 3RLFF 3ZSTA 5HYAA 4OHFA 5JQGE 3L8RA 4EAHA 1QUUA 1KNRA 3DP7A 2ZLYA 5ABFB 3RIUA 4QXBB 5J0ZA 3EI0A 1KFYA 3ETVA 1BR2A 4ASKA 2A9UA 2WBLA 2BS3A 4MLKA 3VKHA 5LB7B 2WZIA 4DBRA 3KFWX 2JJ9A 4IL9A 4OYKA 4DBQA 3NKZA 3AE4A 2BS4A 4H63V 5L3BB 3Q5EA 2K9AA 2V1DB 5HEOA 4UEMA 4JI3T 3LSVA 3RX6A 2KLQA 3KBUA 2VQFT 2VVSA 1G8XA 4ZS2A 5LG3A 1IBKT 3PJAA 4CI3B 2AE9A 3MJXA 2M67A 5BMVE 2KVPA 5L3FB 5AQOB 2Q9QD 5BR8T 4YTPA 4KX6A 1IJ5A 2I59A 4Z90A 4YJ3E 2LSGA 2WM9A 1LVKA 3AB3B 3VHLA 2X0LB 1DU2A 5HXEA 1I94T 3N9MA 3RIAA 2V7LA 4ZI3D 3UU3A 3O1IA 2XQ7A 2XQ3A 4GOUA 2KNDA 2IAKA 2NTYA 1OEDB 3FXEB 4NXNT 4MBQA 3CK6A 2NP9A 1S94A 5AQUB 3LDQB 2KMFA 2ACXA 3GMIA 4JI2T 4ERRA 4DV6T 5E0OA 5C2TA 3PU3A 2X66A 1FJGT 3HL6A 3ZPOA 2MTQA 3GWHA 2K3WA 3EVYA 4F6RC 5LMNT 3I1AA 2NW7A 4AQYT 4IE7A 1D1AA 5AQHB 4AKLA 4HFDA 2D0TA 3H37A 3KV9A 2CXFA 2CRBA 2XQ6A 4XZCA 3N2KE 3SOLA 1US7B 4FI5A 2J4GA 4ONRA 3ONXA 2BBJA 2W61A 3ZT5A 4DV1T 4HKAA 2W2UA 4EV6A 4ILBA 2Z6EA 2KGXA 2KT9A 4DR3T 4CN4A 2LM2A 2V7JA 3RYFE 5DQVA 4YHJA 4U7IA 2JPFA 5LGTB 2M6IA 4HFHA 2E9XD 2BG9A 5F8PA 3FB2A 3HR0A 2FJBA 4XBFB 2L3LA 3IA3A 1WCRA 3RF1A 1XZYA 2WCAA 2QRXA 2BVLA 1KK7A 2OA5A 4EEDA 3RYIE 3AAAB 3B57A 4PK5A 5H6RB 3ZMVB 2J1DG 4X64T 1HX8A 3AA0B 3KV5A 4A97A 2V7KA 4ADZA 5LJMA 2OV9A 2XQ5A 4V1Av 1HNWT 5DJQC 5L47A 2W62A 3PDYA 3RIUC 3AE8A 1IBLT 2ACZA 1GQEA 2NW8A 5AQIB 5AQMB 1NAFA 3TLUA 4U72A 5JDMA 1D1BA 1FMVA 2XSAA 2E8IA 2ZM2A 3PURA 3FZLB 4TWFA 4HFCA 4IDPA 1T7SA 3CKDA 4X20E 4KHZF 4DV0T 3TLSA 4B3MT 5LA6E 4I4TE 3A7MA 4IE5A 3OTOT 1ZV4X 2MAWA 4H63H 4U2YA 3N2GE 1WYBA 4JI4T 3KDSE 1MIYA 4IREA 4LMJA 2A2FX 2LSYA 3NZQA 4O8SA 4PNIA 5HAXA 5C3JA 4ISTA 2VL8A 4ZEYA 2WU5A 4ZI7E 1SE7A 1O3XA 4QH4A 5DQWA 5IUXA 5KDMC 5KXJA 2MBGA 3C4WA 3SFDA 2N2NA 4NXMT 2B1EA 1HS7A 4DR4T 3TLTA 2H89A 2ZM8A 3ABVA 4WYVA 4TUYE 3GA8A 3AEGA 4ZZBA 2YDSA 2BZBA 5JDFA 1D0YA 4AQFA 4EOZB 4YTMA 1U4QA 4IE4A 4HFBA 1NENA 5KX5E 2LRKA 1WFDA 2X0HA 5JRCB 3P4WA 3RRWA 2HPLA 2DWKA 3JADA 3K1SA 4AKGA 4LMKA 3AAEB 4DR5T 4B3TT 4DR7T 3BQKA 4PK4A 5FNVE 4PW8A 2BG9E 3PUGA 5FP3A 2JQQA 2Q9QA 4UXNB 5EK3A 4KP3C 4LFBT 4B3ST 2LSJA 3JC6D 2CMRA 5JTGA 3FZMB 2V5CA 3K3OA 2NW9A 2VB6A 3T1YT 3AA6B 4E7ZA 4QKNA 2WMNA 5LGUB 4HGAA 4K0KT 3FZFB 4C91A 2G0UA 3PV0F 3W15B 2D2SA 2ZM0A 2PG8A 2V26A 5LJNA 3AVRA 1BR0A 1XWMA 5IHYA 4B3RT 2CWOA 2LT3A 4U74A 3R84B 1MMAA 3C50A 3M1CA 4J2CA 3AEDA 4CI1B 2CEAA 1AJ3A 2LHRA 2WDQA 2CHNA 4UF0A 3ZLIA 1CHUA 1XNRT 2WS3A 3QB5A 5AQGB 4QXCB 2XQYA 3PUSA 4U7YA 3CMLA 4DR2T 3AE6A 2RA1A 5CA1E 5LBMA 3V5SA 3RQWA 4NUUA 5FXWA 1LRZA 5GONE 4NIQA 4M1PA 3BK9A 2FJAA 2X67A 2XZEA 4EXTA 4ISSA 3Q5WA 2X0CA 3I9WA 4HN9A 4MALA 5AQQB 2BKPA 2YU2A 3OJAA 4MHCA 3NWIA 1VCTA 5ABEA 3RIFA 2E9XA 5JREA 2SPCA 3RGLA 3S4UA 4HWIB 2MYSA 2A72A 3LBXA 2CCQA 3RKGA 4UVBB 3NBXX 4LFCT 1MIVA 3UUBA 2DHRA 2MOZA 3ZEFB 2WB5A 3RYCE 1J5ET 2I6HA 5HEUA 4H9SE 4ILUA 1W9RA 2QYWA 4I55E 2C5JA 3MZKB 4IT4A 4KUMB 4EZHA 2ODVA 1IZNB 4AI6A 4DIDB 3CX6B 4DO0A 3C64A 4CXXA 5ETWA 4LFAT 3VKGA 3C98B 2CBIA 3LG7A 4AQFC 4HEAA 2WY2A 4HWDA 1M7KA 2X9WA 3N9PA 3SFEA 2BBHA 3JAFA 2VKHA 2ODUA 1UGOA 4IDQA 3PUQA 2XSBA 2YINA 3H3MA 5DABA
chains in the Genus database with same CATH topology
2CA5A 2KWHA 3ESLA 3Q2MA 4E7SA 2V7JA 3RYFE 4DVDA 2NTXA 5DQVA 2LM9A 4YHJA 4P0AA 2CLYB 3MKDA 3ZC1A 1YD8G 2JPFA 3AT7A 5LGTB 3PE0A 4L9IA 1B7TA 5JDLA 3R6NA 3ZN1B 2E9XD 4I43B 3UUNA 3CVRA 2BVMA 4TZ4C 3A5XA 3N9QA 5JVDE 5F8PA 2HH7A 4UVAB 3FB2A 4N78D 3ANWB 3HR0A 2VKDA 4ZS3A 4XBFB 4H9QC 1FEWA 2L3LA 3WAKA 4JLEA 5EK2A 2PJQA 2QA7A 2XASB 3C4ZA 4H9OC 2N9DA 2BVLA 5CA0E 5LHGB 5HXSA 2EHOD 1KK7A 2OA5A 3QK6A 4GIWA 4UF0B 3RYIE 3AAAB 3B57A 3CQXC 4PK5A 5H6RB 4ZI3C 3ZMVB 1MMNA 2J1DG 5JDNA 1WRDA 2X9HA 3IEEA 4AXPA 1HX8A 3AA0B 3KV5A 2YEVC 2V7KA 4ADZA 5LJMA 4WBOA 4AKRB 4V1Av 2YU1A 5DJQC 4B6XA 4UV8B 3PTRB 2XAFB 5LG4A 4L5GA 2W62A 3TKLB 1UCUA 3ETUA 3PDYA 4DNDA 4HTEA 4TV9E 3M65A 4GK0E 4BJMA 4AKHA 2WAUA 2XAHB 2V7MA 2CM0A 4GYSA 3E08A 3F57A 1HF8A 3JC6C 5LXTE 4H9RC 5CB4E 4EB6E 2HPJA 3EDUA 4YLHA 4ZI2C 2NW8A 4IE6A 5KMGP 3ZC0A 3RRCA 1NAFA 5AFUL 3HKDE 4U72A 3CQGB 4O4LE 5JDMA 4PAGA 2X51A 1D1BA 2LOPA 3I9YA 1UX4A 4EIWA 2YK0A 4YJ2E 3NRYA 1FMVA 2E8IA 2ZM2A 4YFSA 4HFVA 2UXNB 4UV9B 3ZN0B 4PJJA 5J2TE 2H3RA 3PURA 3KINB 4WNKA 2JRKA 4PK6A 5HWYA 3CKDA 4BGOA 4X20E 3SRZA 1EZ3A 5LA6E 3BQLA 4I4TE 2DLRA 4IE5A 4ZOLE 1ZV4X 1Z0PA 2VASA 4H63H 3ZMUB 3N2GE 1WYBA 1WYCA 2E9XB 2H7VC 1YKEB 3KVAA 3KDSE 4GK5E 2LHNA 1MIYA 1MMDA 3DJBA 4O4JE 3F31A 5EK4A 2LSKA 5LCYA 4TN7B 2A2FX 3LBXB 2LSYA 4X1KE 3NZQA 4O8SA 4PNIA 5HAXA 2JMKA 3N9LA 4G2AA 4ISTA 2D5UA 2VKOA 2VL8A 4H9NC 2QGSA 4K0UA 4OYJA 4ZI7E 4NUVA 4O2BE 5LHIB 4FJOA 1O3XA 3ZYKA 5DQWA 3O9XA 2XUEA 5KDMC 2LEHA 4KMCA 2MBGA 5L3DB 2GK9A 3F2EA 4PJLA 5HXRA 2EHOB 3U3IA 3EUHA 2XAGB 3C4WA 2JMHA 2N2NA 3MXZA 3GN5A 1MIWA 5FMNA 4O4IE 5F3JA 3EDVA 2B1EA 3UT5E 3ZCIA 1HS7A 1BR1A 1NWMX 5FYMA 3HKEE 4IDZA 4A56A 3ZMSB 3AA7B 4ECGA 2ZM8A 3P7IA 4CI2B 4QX8B 4TUYE 3GA8A 3N9NA 3T8OA 3OBVE 3WURA 2C5IT 2Y48B 3OYXA 5JDGA 2IW5B 2E9XC 4PJMA 5LBQB 2BZBA 5FY7A 5JDFA 3RC3A 3U78A 1D0YA 2ZMAA 4O2AE 4AQFA 3O1HA 4O4HE 4EOZB 2DCFA 3E0ZA 1U4QA 4IE4A 3KV6A 3LK2B 1ZHCA 2Q9QC 1HCIA 4BA9A 2LQUA 3RYHE 1VRBA 5LYJE 4WW0A 3UULA 5KX5E 3HKBE 2X9XA 3VJZA 1CUNA 4JEHB 1V9DA 2H7OA 3E22E 3DTOA 1IAPA 3MA9A 2DI4A 3RPUA 5M4YA 5JR9A 5LP6E 1H7CA 5H6QB 5JRCB 5EZYE 2KWIB 3RRWA 2EHOC 1HFAA 4ZHQE 1HG2A 2DWKA 2HPLA 4C90A 1WR6A 3IBPA 3LJCA 4AQGA 4AKIA 4AKGA 3ZJ1A 2BDEA 2IC9A 4CXYA 3O4XE 1S35A 4QX7B 4EZ4A 3AAEB 5LHHB 1FIOA 2N1GA 1OXZA 3PHF1 2XHEB 1MMGA 3AAIA 3BQKA 4G63A 4IHJE 4PK4A 3K8PC 3Q5XA 3UTKA 4PJNA 2CLYC 3UUMA 1HG5A 5L3CB 1T98A 4KBMB 4UIGA 3CX7B 1ZKEA 2Y8DA 3CQCB 5FNVE 4P0BA 2Y6XA 4PW8A 3RC8A 3LFMA 3AVSA 5J1GA 3PUGA 3Q9DA 5FP3A 2XTLA 2D0UA 5FY0A 2JQQA 4OFZA 5T1DA 2Q9QA 4UXNB 5EK3A 2K48A 3J9X1 2XAQB 2VWAA 5L2LA 4HE8A 3N2OA 4KP3C 2LSJA 2WMOA 3ZYMA 3ZMZB 2K5BB 1Y64B 2C0SA 3JC6D 3ZJ2A 4CZZB 2CMRA 4H9PC 5HWXA 1OWAA 2V7IA 3BQIA 3K3OA 4ZI2D 3IF8B 3IHRA 2NW9A 2VB6A 3AA6B 4E7ZA 5JR9B 5HYAA 1MNEA 4TX5A 4OHFA 4QKNA 2WMNA 3MACA 4GYRA 5JQGE 4UVCB 5LGUB 4QWNB 4EAHA 1QUUA 2CXDA 3DP7A 4OK0A 2VKJA 1QSDA 2ES0A 2CWYA 2WWUA 3FBZA 4WBNE 4HGAA 4Z8XA 4C91A 2G0UA 2ZLYA 3W15B 2DWGA 2D2SA 2ZM0A 5FXVA 2PG8A 3FXDB 4QXBB 3NRXA 2V26A 3KVBA 5ADXL 5LJNA 1E1HB 4PFPA 3QC9A 3AVRA 3LK3B 3N9OA 4PFOA 1HTJF 1BR0A 1LKXA 3ETVA 2IC6A 2A3DA 4X1IE 1D1CA 1BR2A 3HI2A 4ASKA 2WSSV 3MK7C 1VOMA 5IHYA 3ANWA 4MFRA 4JUYA 4TV8E 2WBLA 3WAJA 4JEUB 4MLKA 5C8YE 3VKHA 1X79A 2CWOA 2LT3A 3PU8A 4U74A 3CX8B 3H3AA 3R84B 4QHOA 1MMAA 3C50A 3C51A 4DBRA 3M1CA 4J2CA 2PBIA 3KFWX 2L9QA 4CQIA 4CI1B 2CEAA 1SHZC 2JJ9A 1AJ3A 2C5KT 2LHRA 4OYKA 3D0TA 4UF0A 1YKHB 3QUJA 2CXLA 4I50E 3ZLIA 4DBQA 4H63V 5L3BB 4XAXB 3SWHA 2K9AA 3L3PA 3SS1A 4QXCB 4ANJA 2XQYA 2V1DB 3PUSA 4QXHB 2L8KA 3LK42 4L0RA 5LGNB 3CMLA 3PUAA 4UEMA 5HXCA 3RX6A 2KLQA 3KBUA 2RA1A 5CA1E 2PFVA 5LBMA 3VU7H 1MNDA 3V5SA 1KNZA 5L3EB 1G8XA 4ZS2A 5JH7E 4NUUA 5FXWA 5A1LA 3P8CD 1LRZA 1G73A 4CI3B 5GONE 4M1PA 3MJXA 2M67A 5BMVE 3BK9A 5L3GB 2X67A 5L3FB 4EYYR 3UFEA 4EXTA 2Q9QD 4ISSA 3Q5WA 5JDHA 1IJ5A 3CWZB 2I59A 2W00A 3I9WA 3I0QA 2K24A 4YJ3E 2LSGA 3GN5B 4HN9A 4MALA 2XAJB 2WM9A 5LOVE 1LVKA 3ZMTB 2YU2A 2UXXB 3AB3B 3VHLA 3V5UA 1SA0E 2P9BA 2X0LB 3OJAA 4MHCA 5HXEA 3N9MA 4IGUA 2V7LA 2E9XA 3B13A 3RKOA 4ZI3D 3OKQA 5JREA 3O1IA 3K3QC 2SPCA 1U5PA 4GOUA 2KNDA 2IAKA 2NTYA 5IYZE 3S4UA 5LNKA 5J2UE 3FXEB 2LJLA 2MYSA 2A72A 3LBXA 2NOXA 4UELA 2CCQA 4UVBB 3NBXX 2W63A 3PF0A 4MBQA 2NP9A 3ZYLA 3C4XA 1S94A 1MIVA 3RH3A 3J7Yq 1BR4A 2DHRA 1YW0A 2MOZA 4BAYB 3ZEFB 2EHOA 2LOSA 2KXPB 2KMFA 4EYUA 5FXXA 1IJ6A 2ACXA 2X68A 4IE0A 3RYCE 4H9SE 2KZ7B 4ILUA 1ZEEA 3GMIA 3KV4A 4I55E 5TAOA 2X9YA 2DNXA 2C5JA 4P09A 4DMWA 5E0OA 3KBTA 3MZKB 4ERRA 2LE8A 3K3NA 2LSIA 3PU3A 3NZPA 3ZCJA 4KUMB 4EZHA 4CXWA 5JDQA 2X66A 2ODVA 4IIJE 1IZNB 3N5LA 3I0OA 3O1JA 2CE7A 2KINB 4AI6A 3HL6A 3ZPOA 3OYZA 2MTQA 3CX6B 3GWHA 4DO0A 3C64A 4CXXA 4DMVA 5ETWA 3EVYA 2NWBA 4F6RC 3VKGA 5FY1A 3I1AA 2NW7A 4IE7A 1D1AA 3C98B 2VK9A 3LG7A 4AKLA 4AQFC 2MTCA 4HEAA 3WI3A 2Q9QB 1LVFA 2D0TA 3L09A 1UX5A 3HKCE 2RP4A 3H37A 3KV9A 2CXFA 3UUXB 4XZCA 4BJNA 3N2KE 3WSCA 2X9WA 3SOLA 4X1YE 3N9PA 1D0ZA 1US7B 4FI5A 3CPZA 4ONRA 5JRCA 2VKHA 3ONXA 1FMWA 2ODUA 2W61A 3HA4A 5FXZA 5HXHA 4HKAA 3FBLA 2W0GA 1D0XA 3AA1B 3PUQA 5JR9C 3FHNA 2YINA 2Z6EA 5DABA 2KT9A 1WLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXR A;  5JDN A;  5JDL A;  5JDF A;  5HXS A;  5HWY A;  3V5U A;  5HXH A;  5JDG A;  3V5S A;  5HXE A;  5JDH A;  5HYA A;  5JDM A;  5JDQ A;  5HXC A;  5HWX A; 
#chains in the Genus database with same CATH topology
 4LF5 T;  3ESL A;  4F8H A;  1QLB A;  4YHH T;  4DVD A;  2XY8 B;  4P0A A;  3ZC1 A;  4GKJ T;  2WP9 A;  3ZN1 B;  5AQT B;  4TZ4 C;  3T1H T;  3A5X A;  2E5V A;  3N9Q A;  1YXR A;  5JVD E;  3A8Y C;  4N78 D;  4ZS3 A;  2NR4 A;  4H9Q C;  3B5M A;  1FEW A;  2UUC T;  3PUV F;  1JNR A;  5HXS A;  2EHO D;  3QK6 A;  4ZI3 C;  5JDN A;  3CIR A;  2XQ8 A;  4WBO A;  1JNZ A;  3PTR B;  5LG4 A;  4LF7 T;  2F4V T;  4BJM A;  1KEY A;  4QH1 A;  2WAU A;  1J1J A;  2X0Y A;  2V6X A;  3F57 A;  5LXT E;  4EB6 E;  2LLY A;  4ZI2 C;  5AQL B;  3ZC0 A;  5AQF B;  3CQG B;  4PAG A;  2X51 A;  1N34 T;  4YJ2 E;  1SJ8 A;  4HFV A;  4UV9 B;  4A5X A;  1EZ3 A;  4ZOL E;  2OLT A;  1Z0P A;  2VQE T;  3ZMU B;  1N33 T;  1YKE B;  2XQ9 A;  5FZT A;  4GK5 E;  4LML A;  5HCM A;  3DJB A;  4O4J E;  3F31 A;  5EK4 A;  2LSK A;  4P1N A;  1T8B A;  5LCY A;  5IWA T;  4X1K E;  4YSZ A;  3UU5 A;  4O2B E;  5LHI B;  4FJO A;  1J5W A;  2LEH A;  2JQ9 A;  3JAE A;  3MXZ A;  1XDP A;  3GN5 A;  2HN1 A;  5F3J A;  1BR1 A;  3HKE E;  4IDZ A;  3ZMS B;  3AA7 B;  4ECG A;  3P7I A;  3AE5 A;  3OBV E;  3WUR A;  2C5I T;  2E9X C;  4PJM A;  5LBQ B;  2MPK A;  4O2A E;  3O1H A;  3E0Z A;  4I0U A;  3KV6 A;  3LK2 B;  4BA9 A;  2CPT A;  2LQU A;  1UUS A;  1VRB A;  1Z8U A;  2X9X A;  3PUZ F;  2V8S V;  1V9D A;  3E22 E;  3MA9 A;  4F7G B;  5M4Y A;  5LP6 E;  4YSY A;  4JV5 T;  1HFA A;  4ZHQ E;  1HG2 A;  3AE3 A;  4AIU A;  1WR6 A;  4AKI A;  4W8P A;  2IC9 A;  4CXY A;  3O4X E;  4U2Z A;  5LHH B;  3AAI A;  4DR6 T;  3ZT7 A;  3UTK A;  4PJN A;  3UUM A;  5L3C B;  5F5W A;  3CQC B;  4HFE A;  3RC8 A;  3AVS A;  2H88 A;  5AQK B;  4DV3 T;  3OVU A;  3Q9D A;  4IDN A;  2XTL A;  5T1D A;  4OFZ A;  2BG9 B;  1KNP A;  3J9X 1;  3AEF A;  4HE8 A;  3UU8 A;  3ZMZ B;  2L7N A;  4H9P C;  5HWX A;  4JI5 T;  1OWA A;  3BQI A;  3IHR A;  5CJ5 A;  4COF A;  4TX5 A;  2YOE A;  4UVC B;  1M62 A;  4QWN B;  2CXD A;  1Y01 A;  4KI0 F;  2VKJ A;  4OK0 A;  1QSD A;  2WDV A;  2WWU A;  2UXD T;  5FXV A;  2UUA T;  3FXD B;  3ONL C;  4PFP A;  3EHZ A;  1HTJ F;  2FBW A;  2IC6 A;  1D1C A;  3HI2 A;  3ANW A;  4JUY A;  4QH5 A;  4JEU B;  4JI0 T;  1X79 A;  3CX8 B;  3H3A A;  4QHO A;  3C51 A;  2XQA A;  2PBI A;  1SHZ C;  2IDO B;  4GKK T;  1XMQ T;  1YKH B;  2CXL A;  4I50 E;  3SS1 A;  4ANJ A;  1HR0 T;  4QXH B;  2L8K A;  3LK4 2;  5LGN B;  3PUA A;  3ZSS A;  1I6Z A;  1MND A;  2I0M A;  1KNZ A;  5L3E B;  5JH7 E;  4LF9 T;  3CWZ B;  2W00 A;  2K24 A;  2M6B A;  5LOV E;  2YDR A;  3ZMT B;  2UXX B;  2WWV A;  4IGU A;  3RKO A;  3OKQ A;  4DV2 T;  5LNK A;  5J2U E;  2LJL A;  2NOX A;  4UEL A;  3PF0 A;  4DV4 T;  3C4X A;  4BAY B;  2W4X A;  2EHO A;  2LOS A;  3P4S A;  4IE0 A;  1UUR A;  2KZ7 B;  2IIU A;  3KV4 A;  2X9Y A;  2DNX A;  4P09 A;  4DMW A;  2DL1 A;  3KBT A;  2XM2 A;  3ZCJ A;  4CXW A;  2V6Y A;  4IIJ E;  1YQ3 A;  3I0O A;  2CE7 A;  2KIN B;  3OYZ A;  3QNU A;  1E2A A;  5FY1 A;  4LF8 T;  1W09 A;  2BG9 C;  3AEC A;  2VK9 A;  2VVN A;  4DUY T;  3WI3 A;  2Q9Q B;  1LVF A;  4IDO A;  3TLW A;  3L09 A;  1UX5 A;  3HKC E;  3WSC A;  1XDO A;  1FMW A;  1XMO T;  5HXH A;  4DV7 T;  2UU9 T;  2W0G A;  3AA1 B;  3FHN A;  3PUW F;  1W0A A;  2W66 A;  2KWH A;  3Q2M A;  4CN1 A;  3MKD A;  1HNZ T;  3TLV A;  3AE9 A;  3PE0 A;  4L9I A;  3R6N A;  4I43 B;  2JIW A;  3AXJ A;  2HH7 A;  2AXD S;  3ZT6 A;  3QOF A;  2CHO A;  4JLE A;  2KBB A;  5EK2 A;  5AQP B;  1SJ7 A;  2PJQ A;  3C4Z A;  4H9O C;  5LHG B;  4DR1 T;  4GIW A;  4UF0 B;  3CQX C;  4A98 A;  1MMN A;  2X9H A;  4AXP A;  2YEV C;  5ABF A;  4AKR B;  4UV8 B;  3TKL B;  4DND A;  2IML A;  4TV9 E;  4AKH A;  2CM0 A;  4GYS A;  3E08 A;  1HF8 A;  1R8I A;  5CB4 E;  2HPJ A;  3EDU A;  4YLH A;  1SUM B;  5CFB A;  5KMG P;  3HKD E;  4O4L E;  4TNW A;  3I9Y A;  4EIW A;  3NRY A;  3ZN0 B;  3KIN B;  5HWY A;  3SRZ A;  1VCS A;  2W67 A;  1WYC A;  2E9X B;  2LHN A;  1MMD A;  1ZP0 A;  4TN7 B;  3LBX B;  2JMK A;  3N9L A;  4G2A A;  2D5U A;  2VKO A;  4Q25 A;  4OYJ A;  2LKG A;  2E2A A;  2YKS A;  3L39 A;  3O9X A;  2XUE A;  5L3D B;  2XPK A;  5AQJ B;  3U3I A;  2VL0 A;  4IL4 A;  2XAG B;  1N36 T;  3OPC A;  4O4I E;  3EDV A;  3ZCI A;  2CBJ A;  4X62 T;  5FYM A;  4A56 A;  5HEG A;  4CI2 B;  3T8O A;  4X5T A;  5L4H A;  2FJD A;  1OED A;  5JDG A;  5FY7 A;  4U3C A;  3RC3 A;  4CN6 A;  3UU4 A;  4JI1 T;  2Q9Q C;  3AEA A;  3RYH E;  5LYJ E;  4WW0 A;  1CUN A;  4JEH B;  2H7O A;  3DTO A;  1IAP A;  3G06 A;  5JR9 A;  1L0V A;  2EHO C;  3IBP A;  1YQ4 A;  3LJC A;  4AQG A;  2HN2 A;  4YXD A;  1N32 T;  2JQK A;  2BKO A;  1FIO A;  1OXZ A;  2XHE B;  1MMG A;  3K8P C;  3Q5X A;  1HG5 A;  4KBM B;  3CX7 B;  2Y8D A;  3M3Z B;  2Y6X A;  3LFM A;  5AQV B;  5J1G A;  2QVA A;  4YY3 T;  2D0U A;  2K48 A;  4LF6 T;  5L2L A;  2KSR A;  5AQR B;  2VUR A;  2WMO A;  5HCJ A;  1Y64 B;  4CZZ B;  2V7I A;  4ZI2 D;  3IF8 B;  5JR9 B;  1MNE A;  3MAC A;  4GYR A;  3VR9 A;  2UUB T;  4WBN E;  2ES0 A;  2CWY A;  3FBZ A;  2WZH A;  2UXC T;  4Z8X A;  3P4Q A;  2DWG A;  4ILA A;  3NRX A;  3KVB A;  5ADX L;  1E1H B;  1IBM T;  3QC9 A;  3LK3 B;  5LMU T;  2XJ7 A;  3N9O A;  4PFO A;  1LKX A;  2A3D A;  4X1I E;  2WSS V;  3MK7 C;  1VOM A;  4HWH A;  3P4R A;  4MFR A;  4TV8 E;  3WAJ A;  5C8Y E;  3PU8 A;  5CGM A;  4CQI A;  2L9Q A;  3FZK B;  2C5K T;  4Z91 A;  3D0T A;  3QUJ A;  4ZZC A;  4XAX B;  3SWH A;  3L3P A;  2XM1 A;  1XNQ T;  2WDR A;  3VR8 A;  4L0R A;  2FUP A;  3PUY F;  5HXC A;  3P50 A;  2J47 A;  4JBW F;  2PFV A;  3VU7 H;  2V5D A;  3VRB A;  4LF4 T;  5A1L A;  3P8C D;  1G73 A;  4JI6 T;  5HEH A;  5L3G B;  4EYY R;  3UFE A;  5JDH A;  4TWH A;  1NEK A;  3I0Q A;  3GN5 B;  2XAJ B;  5ABG A;  3V5U A;  1SA0 E;  2P9B A;  3B13 A;  4DV5 T;  1OED E;  3K3Q C;  5ABH A;  1U5P A;  5IYZ E;  2E5L T;  4EGW A;  2UXB T;  2W63 A;  4WZX A;  1E7P A;  3JCF A;  3ZYL A;  4HWF A;  3AEB A;  2HHH T;  5FKY A;  3RH3 A;  4YT0 A;  3J7Y q;  1BR4 A;  1YW0 A;  4ILC A;  2KXP B;  4EYU A;  5FXX A;  1IJ6 A;  2X68 A;  5TAO A;  1ZEE A;  1HNX T;  3RI5 A;  3NVO A;  2LE8 A;  3K3N A;  2LSI A;  3NZP A;  4NPP A;  1W0B A;  3PJA J;  5JDQ A;  4OX9 T;  3N5L A;  4U33 A;  2BKN A;  3O1J A;  3X1D A;  5L4E A;  3AE1 A;  5FL1 A;  4TWD A;  4DMV A;  2NWB A;  1OED C;  4AIS A;  1ZOY A;  2MTC A;  3UFG A;  3UQ7 A;  2RP4 A;  3UUX B;  4JI7 T;  4BJN A;  4X1Y E;  1D0Z A;  4EEB A;  3CPZ A;  5JRC A;  2IUB A;  3HA4 A;  5FXZ A;  3FBL A;  3AY5 A;  1D0X A;  5JR9 C;  4ZXL A;  1WLX A;  2CA5 A;  5AQN B;  1HX1 B;  4E7S A;  2PTF A;  2NTX A;  2LM9 A;  2CLY B;  1YD8 G;  3AT7 A;  4YSX A;  3AE2 A;  1B7T A;  5JDL A;  3UUN A;  3CVR A;  2BVM A;  2J62 A;  2RPA A;  4UVA B;  3ANW B;  2VKD A;  3RHW A;  3WAK A;  4U31 A;  3UU6 A;  1KF6 A;  2ZM6 T;  2LRL A;  4JYA T;  5AQS B;  2QA7 A;  2XAS B;  2N9D A;  2L10 A;  5CA0 E;  2YN6 A;  2R6G F;  1WRD A;  3IEE A;  2JQH A;  5FVL A;  2YU1 A;  3P4P A;  4B6X A;  3FZH B;  2XAF B;  4L5G A;  1UCU A;  3ETU A;  4HTE A;  3M65 A;  4GK0 E;  2WU2 A;  2XAH B;  2XQ4 A;  2V7M A;  3JC6 C;  4H9R C;  4IE6 A;  3RRC A;  5AFU L;  2LOP A;  1UX4 A;  2YK0 A;  3ZKR A;  4DUZ T;  4HWC A;  4YFS A;  2UXN B;  5J2T E;  4UR9 A;  4PJJ A;  2H3R A;  4WNK A;  2JRK A;  4PK6 A;  4BGO A;  2WQY A;  3BQL A;  2DLR A;  2VAS A;  2H7V C;  3KVA A;  1UK5 A;  3AE7 A;  5FVK A;  3DYJ A;  2B76 A;  4H9N C;  2QGS A;  4K0U A;  4NUV A;  3ZYK A;  4YTN A;  4KMC A;  2GK9 A;  3F2E A;  4PJL A;  5HXR A;  2EHO B;  3QB5 K;  4X65 T;  3EUH A;  2JMH A;  1MIW A;  5FMN A;  3PUX F;  3UT5 E;  1NWM X;  4TNV A;  2V6Y B;  4QX8 B;  3N9N A;  3UQ4 A;  2YDQ A;  2Y48 B;  3OYX A;  2IW5 B;  3ONJ A;  3U78 A;  2ZMA A;  4O4H E;  2DCF A;  5FL0 A;  1ZHC A;  1HCI A;  1T72 A;  2BS2 A;  3FYQ A;  3UUL A;  2D9D A;  3HKB E;  3VJZ A;  1WR0 A;  2DI4 A;  3RPU A;  4HFI A;  1H7C A;  5H6Q B;  5EZY E;  2KWI B;  4C90 A;  3EAM A;  3AEE A;  3ZJ1 A;  2BDE A;  1S35 A;  4QX7 B;  5HEJ A;  4EZ4 A;  2N1G A;  4X66 T;  4JI8 T;  3PHF 1;  4G63 A;  4IHJ E;  2CLY C;  2FJE A;  3VRA A;  1T98 A;  4UIG A;  1ZKE A;  4P0B A;  2IHR 1;  3RQU A;  5FY0 A;  3EAB A;  3AXJ B;  2XAQ B;  2VWA A;  3N2O A;  2LKH A;  3ZYM A;  2K5B B;  3Q5D A;  2C0S A;  3ZJ2 A;  4KHP T;  1X9B A;  3RLF F;  3ZST A;  5HYA A;  4OHF A;  5JQG E;  3L8R A;  4EAH A;  1QUU A;  1KNR A;  3DP7 A;  2ZLY A;  5ABF B;  3RIU A;  4QXB B;  5J0Z A;  3EI0 A;  1KFY A;  3ETV A;  1BR2 A;  4ASK A;  2A9U A;  2WBL A;  2BS3 A;  4MLK A;  3VKH A;  5LB7 B;  2WZI A;  4DBR A;  3KFW X;  2JJ9 A;  4IL9 A;  4OYK A;  4DBQ A;  3NKZ A;  3AE4 A;  2BS4 A;  4H63 V;  5L3B B;  3Q5E A;  2K9A A;  2V1D B;  5HEO A;  4UEM A;  4JI3 T;  3LSV A;  3RX6 A;  2KLQ A;  3KBU A;  2VQF T;  2VVS A;  1G8X A;  4ZS2 A;  5LG3 A;  1IBK T;  3PJA A;  4CI3 B;  2AE9 A;  3MJX A;  2M67 A;  5BMV E;  2KVP A;  5L3F B;  5AQO B;  2Q9Q D;  5BR8 T;  4YTP A;  4KX6 A;  1IJ5 A;  2I59 A;  4Z90 A;  4YJ3 E;  2LSG A;  2WM9 A;  1LVK A;  3AB3 B;  3VHL A;  2X0L B;  1DU2 A;  5HXE A;  1I94 T;  3N9M A;  3RIA A;  2V7L A;  4ZI3 D;  3UU3 A;  3O1I A;  2XQ7 A;  2XQ3 A;  4GOU A;  2KND A;  2IAK A;  2NTY A;  1OED B;  3FXE B;  4NXN T;  4MBQ A;  3CK6 A;  2NP9 A;  1S94 A;  5AQU B;  3LDQ B;  2KMF A;  2ACX A;  3GMI A;  4JI2 T;  4ERR A;  4DV6 T;  5E0O A;  5C2T A;  3PU3 A;  2X66 A;  1FJG T;  3HL6 A;  3ZPO A;  2MTQ A;  3GWH A;  2K3W A;  3EVY A;  4F6R C;  5LMN T;  3I1A A;  2NW7 A;  4AQY T;  4IE7 A;  1D1A A;  5AQH B;  4AKL A;  4HFD A;  2D0T A;  3H37 A;  3KV9 A;  2CXF A;  2CRB A;  2XQ6 A;  4XZC A;  3N2K E;  3SOL A;  1US7 B;  4FI5 A;  2J4G A;  4ONR A;  3ONX A;  2BBJ A;  2W61 A;  3ZT5 A;  4DV1 T;  4HKA A;  2W2U A;  4EV6 A;  4ILB A;  2Z6E A;  2KGX A;  2KT9 A;  4DR3 T;  4CN4 A;  2LM2 A;  2V7J A;  3RYF E;  5DQV A;  4YHJ A;  4U7I A;  2JPF A;  5LGT B;  2M6I A;  4HFH A;  2E9X D;  2BG9 A;  5F8P A;  3FB2 A;  3HR0 A;  2FJB A;  4XBF B;  2L3L A;  3IA3 A;  1WCR A;  3RF1 A;  1XZY A;  2WCA A;  2QRX A;  2BVL A;  1KK7 A;  2OA5 A;  4EED A;  3RYI E;  3AAA B;  3B57 A;  4PK5 A;  5H6R B;  3ZMV B;  2J1D G;  4X64 T;  1HX8 A;  3AA0 B;  3KV5 A;  4A97 A;  2V7K A;  4ADZ A;  5LJM A;  2OV9 A;  2XQ5 A;  4V1A v;  1HNW T;  5DJQ C;  5L47 A;  2W62 A;  3PDY A;  3RIU C;  3AE8 A;  1IBL T;  2ACZ A;  1GQE A;  2NW8 A;  5AQI B;  5AQM B;  1NAF A;  3TLU A;  4U72 A;  5JDM A;  1D1B A;  1FMV A;  2XSA A;  2E8I A;  2ZM2 A;  3PUR A;  3FZL B;  4TWF A;  4HFC A;  4IDP A;  1T7S A;  3CKD A;  4X20 E;  4KHZ F;  4DV0 T;  3TLS A;  4B3M T;  5LA6 E;  4I4T E;  3A7M A;  4IE5 A;  3OTO T;  1ZV4 X;  2MAW A;  4H63 H;  4U2Y A;  3N2G E;  1WYB A;  4JI4 T;  3KDS E;  1MIY A;  4IRE A;  4LMJ A;  2A2F X;  2LSY A;  3NZQ A;  4O8S A;  4PNI A;  5HAX A;  5C3J A;  4IST A;  2VL8 A;  4ZEY A;  2WU5 A;  4ZI7 E;  1SE7 A;  1O3X A;  4QH4 A;  5DQW A;  5IUX A;  5KDM C;  5KXJ A;  2MBG A;  3C4W A;  3SFD A;  2N2N A;  4NXM T;  2B1E A;  1HS7 A;  4DR4 T;  3TLT A;  2H89 A;  2ZM8 A;  3ABV A;  4WYV A;  4TUY E;  3GA8 A;  3AEG A;  4ZZB A;  2YDS A;  2BZB A;  5JDF A;  1D0Y A;  4AQF A;  4EOZ B;  4YTM A;  1U4Q A;  4IE4 A;  4HFB A;  1NEN A;  5KX5 E;  2LRK A;  1WFD A;  2X0H A;  5JRC B;  3P4W A;  3RRW A;  2HPL A;  2DWK A;  3JAD A;  3K1S A;  4AKG A;  4LMK A;  3AAE B;  4DR5 T;  4B3T T;  4DR7 T;  3BQK A;  4PK4 A;  5FNV E;  4PW8 A;  2BG9 E;  3PUG A;  5FP3 A;  2JQQ A;  2Q9Q A;  4UXN B;  5EK3 A;  4KP3 C;  4LFB T;  4B3S T;  2LSJ A;  3JC6 D;  2CMR A;  5JTG A;  3FZM B;  2V5C A;  3K3O A;  2NW9 A;  2VB6 A;  3T1Y T;  3AA6 B;  4E7Z A;  4QKN A;  2WMN A;  5LGU B;  4HGA A;  4K0K T;  3FZF B;  4C91 A;  2G0U A;  3PV0 F;  3W15 B;  2D2S A;  2ZM0 A;  2PG8 A;  2V26 A;  5LJN A;  3AVR A;  1BR0 A;  1XWM A;  5IHY A;  4B3R T;  2CWO A;  2LT3 A;  4U74 A;  3R84 B;  1MMA A;  3C50 A;  3M1C A;  4J2C A;  3AED A;  4CI1 B;  2CEA A;  1AJ3 A;  2LHR A;  2WDQ A;  2CHN A;  4UF0 A;  3ZLI A;  1CHU A;  1XNR T;  2WS3 A;  3QB5 A;  5AQG B;  4QXC B;  2XQY A;  3PUS A;  4U7Y A;  3CML A;  4DR2 T;  3AE6 A;  2RA1 A;  5CA1 E;  5LBM A;  3V5S A;  3RQW A;  4NUU A;  5FXW A;  1LRZ A;  5GON E;  4NIQ A;  4M1P A;  3BK9 A;  2FJA A;  2X67 A;  2XZE A;  4EXT A;  4ISS A;  3Q5W A;  2X0C A;  3I9W A;  4HN9 A;  4MAL A;  5AQQ B;  2BKP A;  2YU2 A;  3OJA A;  4MHC A;  3NWI A;  1VCT A;  5ABE A;  3RIF A;  2E9X A;  5JRE A;  2SPC A;  3RGL A;  3S4U A;  4HWI B;  2MYS A;  2A72 A;  3LBX A;  2CCQ A;  3RKG A;  4UVB B;  3NBX X;  4LFC T;  1MIV A;  3UUB A;  2DHR A;  2MOZ A;  3ZEF B;  2WB5 A;  3RYC E;  1J5E T;  2I6H A;  5HEU A;  4H9S E;  4ILU A;  1W9R A;  2QYW A;  4I55 E;  2C5J A;  3MZK B;  4IT4 A;  4KUM B;  4EZH A;  2ODV A;  1IZN B;  4AI6 A;  4DID B;  3CX6 B;  4DO0 A;  3C64 A;  4CXX A;  5ETW A;  4LFA T;  3VKG A;  3C98 B;  2CBI A;  3LG7 A;  4AQF C;  4HEA A;  2WY2 A;  4HWD A;  1M7K A;  2X9W A;  3N9P A;  3SFE A;  2BBH A;  3JAF A;  2VKH A;  2ODU A;  1UGO A;  4IDQ A;  3PUQ A;  2XSB A;  2YIN A;  3H3M A;  5DAB A; 
#chains in the Genus database with same CATH homology
 2CA5 A;  2KWH A;  3ESL A;  3Q2M A;  4E7S A;  2V7J A;  3RYF E;  4DVD A;  2NTX A;  5DQV A;  2LM9 A;  4YHJ A;  4P0A A;  2CLY B;  3MKD A;  3ZC1 A;  1YD8 G;  2JPF A;  3AT7 A;  5LGT B;  3PE0 A;  4L9I A;  1B7T A;  5JDL A;  3R6N A;  3ZN1 B;  2E9X D;  4I43 B;  3UUN A;  3CVR A;  2BVM A;  4TZ4 C;  3A5X A;  3N9Q A;  5JVD E;  5F8P A;  2HH7 A;  4UVA B;  3FB2 A;  4N78 D;  3ANW B;  3HR0 A;  2VKD A;  4ZS3 A;  4XBF B;  4H9Q C;  1FEW A;  2L3L A;  3WAK A;  4JLE A;  5EK2 A;  2PJQ A;  2QA7 A;  2XAS B;  3C4Z A;  4H9O C;  2N9D A;  2BVL A;  5CA0 E;  5LHG B;  5HXS A;  2EHO D;  1KK7 A;  2OA5 A;  3QK6 A;  4GIW A;  4UF0 B;  3RYI E;  3AAA B;  3B57 A;  3CQX C;  4PK5 A;  5H6R B;  4ZI3 C;  3ZMV B;  1MMN A;  2J1D G;  5JDN A;  1WRD A;  2X9H A;  3IEE A;  4AXP A;  1HX8 A;  3AA0 B;  3KV5 A;  2YEV C;  2V7K A;  4ADZ A;  5LJM A;  4WBO A;  4AKR B;  4V1A v;  2YU1 A;  5DJQ C;  4B6X A;  4UV8 B;  3PTR B;  2XAF B;  5LG4 A;  4L5G A;  2W62 A;  3TKL B;  1UCU A;  3ETU A;  3PDY A;  4DND A;  4HTE A;  4TV9 E;  3M65 A;  4GK0 E;  4BJM A;  4AKH A;  2WAU A;  2XAH B;  2V7M A;  2CM0 A;  4GYS A;  3E08 A;  3F57 A;  1HF8 A;  3JC6 C;  5LXT E;  4H9R C;  5CB4 E;  4EB6 E;  2HPJ A;  3EDU A;  4YLH A;  4ZI2 C;  2NW8 A;  4IE6 A;  5KMG P;  3ZC0 A;  3RRC A;  1NAF A;  5AFU L;  3HKD E;  4U72 A;  3CQG B;  4O4L E;  5JDM A;  4PAG A;  2X51 A;  1D1B A;  2LOP A;  3I9Y A;  1UX4 A;  4EIW A;  2YK0 A;  4YJ2 E;  3NRY A;  1FMV A;  2E8I A;  2ZM2 A;  4YFS A;  4HFV A;  2UXN B;  4UV9 B;  3ZN0 B;  4PJJ A;  5J2T E;  2H3R A;  3PUR A;  3KIN B;  4WNK A;  2JRK A;  4PK6 A;  5HWY A;  3CKD A;  4BGO A;  4X20 E;  3SRZ A;  1EZ3 A;  5LA6 E;  3BQL A;  4I4T E;  2DLR A;  4IE5 A;  4ZOL E;  1ZV4 X;  1Z0P A;  2VAS A;  4H63 H;  3ZMU B;  3N2G E;  1WYB A;  1WYC A;  2E9X B;  2H7V C;  1YKE B;  3KVA A;  3KDS E;  4GK5 E;  2LHN A;  1MIY A;  1MMD A;  3DJB A;  4O4J E;  3F31 A;  5EK4 A;  2LSK A;  5LCY A;  4TN7 B;  2A2F X;  3LBX B;  2LSY A;  4X1K E;  3NZQ A;  4O8S A;  4PNI A;  5HAX A;  2JMK A;  3N9L A;  4G2A A;  4IST A;  2D5U A;  2VKO A;  2VL8 A;  4H9N C;  2QGS A;  4K0U A;  4OYJ A;  4ZI7 E;  4NUV A;  4O2B E;  5LHI B;  4FJO A;  1O3X A;  3ZYK A;  5DQW A;  3O9X A;  2XUE A;  5KDM C;  2LEH A;  4KMC A;  2MBG A;  5L3D B;  2GK9 A;  3F2E A;  4PJL A;  5HXR A;  2EHO B;  3U3I A;  3EUH A;  2XAG B;  3C4W A;  2JMH A;  2N2N A;  3MXZ A;  3GN5 A;  1MIW A;  5FMN A;  4O4I E;  5F3J A;  3EDV A;  2B1E A;  3UT5 E;  3ZCI A;  1HS7 A;  1BR1 A;  1NWM X;  5FYM A;  3HKE E;  4IDZ A;  4A56 A;  3ZMS B;  3AA7 B;  4ECG A;  2ZM8 A;  3P7I A;  4CI2 B;  4QX8 B;  4TUY E;  3GA8 A;  3N9N A;  3T8O A;  3OBV E;  3WUR A;  2C5I T;  2Y48 B;  3OYX A;  5JDG A;  2IW5 B;  2E9X C;  4PJM A;  5LBQ B;  2BZB A;  5FY7 A;  5JDF A;  3RC3 A;  3U78 A;  1D0Y A;  2ZMA A;  4O2A E;  4AQF A;  3O1H A;  4O4H E;  4EOZ B;  2DCF A;  3E0Z A;  1U4Q A;  4IE4 A;  3KV6 A;  3LK2 B;  1ZHC A;  2Q9Q C;  1HCI A;  4BA9 A;  2LQU A;  3RYH E;  1VRB A;  5LYJ E;  4WW0 A;  3UUL A;  5KX5 E;  3HKB E;  2X9X A;  3VJZ A;  1CUN A;  4JEH B;  1V9D A;  2H7O A;  3E22 E;  3DTO A;  1IAP A;  3MA9 A;  2DI4 A;  3RPU A;  5M4Y A;  5JR9 A;  5LP6 E;  1H7C A;  5H6Q B;  5JRC B;  5EZY E;  2KWI B;  3RRW A;  2EHO C;  1HFA A;  4ZHQ E;  1HG2 A;  2DWK A;  2HPL A;  4C90 A;  1WR6 A;  3IBP A;  3LJC A;  4AQG A;  4AKI A;  4AKG A;  3ZJ1 A;  2BDE A;  2IC9 A;  4CXY A;  3O4X E;  1S35 A;  4QX7 B;  4EZ4 A;  3AAE B;  5LHH B;  1FIO A;  2N1G A;  1OXZ A;  3PHF 1;  2XHE B;  1MMG A;  3AAI A;  3BQK A;  4G63 A;  4IHJ E;  4PK4 A;  3K8P C;  3Q5X A;  3UTK A;  4PJN A;  2CLY C;  3UUM A;  1HG5 A;  5L3C B;  1T98 A;  4KBM B;  4UIG A;  3CX7 B;  1ZKE A;  2Y8D A;  3CQC B;  5FNV E;  4P0B A;  2Y6X A;  4PW8 A;  3RC8 A;  3LFM A;  3AVS A;  5J1G A;  3PUG A;  3Q9D A;  5FP3 A;  2XTL A;  2D0U A;  5FY0 A;  2JQQ A;  4OFZ A;  5T1D A;  2Q9Q A;  4UXN B;  5EK3 A;  2K48 A;  3J9X 1;  2XAQ B;  2VWA A;  5L2L A;  4HE8 A;  3N2O A;  4KP3 C;  2LSJ A;  2WMO A;  3ZYM A;  3ZMZ B;  2K5B B;  1Y64 B;  2C0S A;  3JC6 D;  3ZJ2 A;  4CZZ B;  2CMR A;  4H9P C;  5HWX A;  1OWA A;  2V7I A;  3BQI A;  3K3O A;  4ZI2 D;  3IF8 B;  3IHR A;  2NW9 A;  2VB6 A;  3AA6 B;  4E7Z A;  5JR9 B;  5HYA A;  1MNE A;  4TX5 A;  4OHF A;  4QKN A;  2WMN A;  3MAC A;  4GYR A;  5JQG E;  4UVC B;  5LGU B;  4QWN B;  4EAH A;  1QUU A;  2CXD A;  3DP7 A;  4OK0 A;  2VKJ A;  1QSD A;  2ES0 A;  2CWY A;  2WWU A;  3FBZ A;  4WBN E;  4HGA A;  4Z8X A;  4C91 A;  2G0U A;  2ZLY A;  3W15 B;  2DWG A;  2D2S A;  2ZM0 A;  5FXV A;  2PG8 A;  3FXD B;  4QXB B;  3NRX A;  2V26 A;  3KVB A;  5ADX L;  5LJN A;  1E1H B;  4PFP A;  3QC9 A;  3AVR A;  3LK3 B;  3N9O A;  4PFO A;  1HTJ F;  1BR0 A;  1LKX A;  3ETV A;  2IC6 A;  2A3D A;  4X1I E;  1D1C A;  1BR2 A;  3HI2 A;  4ASK A;  2WSS V;  3MK7 C;  1VOM A;  5IHY A;  3ANW A;  4MFR A;  4JUY A;  4TV8 E;  2WBL A;  3WAJ A;  4JEU B;  4MLK A;  5C8Y E;  3VKH A;  1X79 A;  2CWO A;  2LT3 A;  3PU8 A;  4U74 A;  3CX8 B;  3H3A A;  3R84 B;  4QHO A;  1MMA A;  3C50 A;  3C51 A;  4DBR A;  3M1C A;  4J2C A;  2PBI A;  3KFW X;  2L9Q A;  4CQI A;  4CI1 B;  2CEA A;  1SHZ C;  2JJ9 A;  1AJ3 A;  2C5K T;  2LHR A;  4OYK A;  3D0T A;  4UF0 A;  1YKH B;  3QUJ A;  2CXL A;  4I50 E;  3ZLI A;  4DBQ A;  4H63 V;  5L3B B;  4XAX B;  3SWH A;  2K9A A;  3L3P A;  3SS1 A;  4QXC B;  4ANJ A;  2XQY A;  2V1D B;  3PUS A;  4QXH B;  2L8K A;  3LK4 2;  4L0R A;  5LGN B;  3CML A;  3PUA A;  4UEM A;  5HXC A;  3RX6 A;  2KLQ A;  3KBU A;  2RA1 A;  5CA1 E;  2PFV A;  5LBM A;  3VU7 H;  1MND A;  3V5S A;  1KNZ A;  5L3E B;  1G8X A;  4ZS2 A;  5JH7 E;  4NUU A;  5FXW A;  5A1L A;  3P8C D;  1LRZ A;  1G73 A;  4CI3 B;  5GON E;  4M1P A;  3MJX A;  2M67 A;  5BMV E;  3BK9 A;  5L3G B;  2X67 A;  5L3F B;  4EYY R;  3UFE A;  4EXT A;  2Q9Q D;  4ISS A;  3Q5W A;  5JDH A;  1IJ5 A;  3CWZ B;  2I59 A;  2W00 A;  3I9W A;  3I0Q A;  2K24 A;  4YJ3 E;  2LSG A;  3GN5 B;  4HN9 A;  4MAL A;  2XAJ B;  2WM9 A;  5LOV E;  1LVK A;  3ZMT B;  2YU2 A;  2UXX B;  3AB3 B;  3VHL A;  3V5U A;  1SA0 E;  2P9B A;  2X0L B;  3OJA A;  4MHC A;  5HXE A;  3N9M A;  4IGU A;  2V7L A;  2E9X A;  3B13 A;  3RKO A;  4ZI3 D;  3OKQ A;  5JRE A;  3O1I A;  3K3Q C;  2SPC A;  1U5P A;  4GOU A;  2KND A;  2IAK A;  2NTY A;  5IYZ E;  3S4U A;  5LNK A;  5J2U E;  3FXE B;  2LJL A;  2MYS A;  2A72 A;  3LBX A;  2NOX A;  4UEL A;  2CCQ A;  4UVB B;  3NBX X;  2W63 A;  3PF0 A;  4MBQ A;  2NP9 A;  3ZYL A;  3C4X A;  1S94 A;  1MIV A;  3RH3 A;  3J7Y q;  1BR4 A;  2DHR A;  1YW0 A;  2MOZ A;  4BAY B;  3ZEF B;  2EHO A;  2LOS A;  2KXP B;  2KMF A;  4EYU A;  5FXX A;  1IJ6 A;  2ACX A;  2X68 A;  4IE0 A;  3RYC E;  4H9S E;  2KZ7 B;  4ILU A;  1ZEE A;  3GMI A;  3KV4 A;  4I55 E;  5TAO A;  2X9Y A;  2DNX A;  2C5J A;  4P09 A;  4DMW A;  5E0O A;  3KBT A;  3MZK B;  4ERR A;  2LE8 A;  3K3N A;  2LSI A;  3PU3 A;  3NZP A;  3ZCJ A;  4KUM B;  4EZH A;  4CXW A;  5JDQ A;  2X66 A;  2ODV A;  4IIJ E;  1IZN B;  3N5L A;  3I0O A;  3O1J A;  2CE7 A;  2KIN B;  4AI6 A;  3HL6 A;  3ZPO A;  3OYZ A;  2MTQ A;  3CX6 B;  3GWH A;  4DO0 A;  3C64 A;  4CXX A;  4DMV A;  5ETW A;  3EVY A;  2NWB A;  4F6R C;  3VKG A;  5FY1 A;  3I1A A;  2NW7 A;  4IE7 A;  1D1A A;  3C98 B;  2VK9 A;  3LG7 A;  4AKL A;  4AQF C;  2MTC A;  4HEA A;  3WI3 A;  2Q9Q B;  1LVF A;  2D0T A;  3L09 A;  1UX5 A;  3HKC E;  2RP4 A;  3H37 A;  3KV9 A;  2CXF A;  3UUX B;  4XZC A;  4BJN A;  3N2K E;  3WSC A;  2X9W A;  3SOL A;  4X1Y E;  3N9P A;  1D0Z A;  1US7 B;  4FI5 A;  3CPZ A;  4ONR A;  5JRC A;  2VKH A;  3ONX A;  1FMW A;  2ODU A;  2W61 A;  3HA4 A;  5FXZ A;  5HXH A;  4HKA A;  3FBL A;  2W0G A;  1D0X A;  3AA1 B;  3PUQ A;  5JR9 C;  3FHN A;  2YIN A;  2Z6E A;  5DAB A;  2KT9 A;  1WLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...