5HYAA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchangerncx_mj soaked with 150 mm na+ and nominal ca2+
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
Knots found
sequence length
304
structure length
297
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRMGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
molecule keywords sodium,calcium exchanger
total genus 132
structure length 297
sequence length 304
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hyaA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hyaA02
5HXCA 5HWXA 5HWYA 5HXRA 3V5UA 5JDLA 5JDHA 5JDNA 5JDQA 3V5SA 5JDFA 5HXSA 5HXEA 5JDGA 5JDMA 5HXHA 5HYAA
chains in the Genus database with same CATH superfamily
2J47A 4JI6T 4O8SA 4DMVA 2MTQA 1HF8A 4IGUA 2H7VC 3AAEB 3ONLC 3NRYA 2GK9A 2XQ5A 4LFBT 4ZI2C 2FJBA 3BQLA 2M6BA 4EAHA 2X68A 3NRXA 2V7MA 3RH3A 2ES0A 3N9LA 2LSGA 3CK6A 3UU5A 3N5LA 5L3CB 4PJLA 4ZEYA 3UQ4A 4JYAT 4EV6A 2NP9A 4HWCA 5F5WA 4LF4T 4WBNE 2F4VT 3Q5EA 3AY5A 2WY2A 1SHZC 1E1HB 1M7KA 1US7B 3P4PA 4IL9A 3M65A 4AQFC 2ACZA 2WU2A 1JNZA 4YLHA 4QXBB 2QYWA 5ABHA 4DR5T 2MTCA 2W4XA 1ZHCA 2YDQA 2V7IA 1Y01A 3F57A 5F8PA 2CXFA 4IE7A 3ZN0B 3K3QC 4QH1A 4JEHB 2V7JA 3IA3A 4GYRA 2XQ6A 5TAOA 3RIFA 1AJ3A 3AA7B 3DP7A 2CHNA 2CMRA 3RPUA 3NBXX 2BVLA 2BBJA 3KV5A 3LK2B 1V9DA 3K8PC 3O4XE 3Q5DA 2IIUA 2NW8A 4UIGA 3ZMSB 5LG4A 1KNPA 1J5ET 3M3ZB 1XDPA 1N33T 4AKHA 4WZXA 2BVMA 5CGMA 2DLRA 5AFUL 5LP6E 4CN1A 2OA5A 3PV0F 4HFEA 4HGAA 5JDHA 1MMDA 2X9YA 1OXZA 3E22E 3AA6B 5DJQC 3P4SA 5LA6E 1XMQT 1NAFA 4DNDA 1S94A 2XZEA 4PK5A 4HFIA 2JMHA 2C5IT 2LHRA 3ZLIA 2CXLA 2KNDA 2FJAA 3LK42 4KBMB 4O4JE 4TNWA 3UULA 5HXSA 2KINB 2OLTA 4IHJE 5AQKB 3AE9A 3TLSA 3ZC1A 4EGWA 2V5CA 5AQFB 4DV6T 2V6XA 4L0RA 1E7PA 2E9XB 3JCFA 3MK7C 4G63A 5FVKA 3SWHA 4EZ4A 3N9PA 3LFMA 5JDNA 4QWNB 4XAXB 4YT0A 2X0LB 5LGTB 2KLQA 4AXPA 5LG3A 4AKGA 2J1DG 2WMOA 1MNEA 2WQYA 4DVDA 5JREA 1IZNB 3UUBA 2CWYA 4ZI3C 4MBQA 2FBWA 3K1SA 4AI6A 1OEDB 4XZCA 1KF6A 3PUYF 4H9NC 2E9XA 1WYCA 1G8XA 2BS2A 4NIQA 4PNIA 3ZSSA 2MPKA 4LFCT 2H3RA 4AQYT 5BMVE 2IC9A 4I0UA 4IDZA 3DYJA 2XM1A 5EZYE 1YQ4A 4IT4A 3ZEFB 2Q9QA 4DV0T 2LE8A 1WCRA 5KX5E 1D0YA 3PJAJ 4DV5T 4BJNA 4L5GA 2XY8B 4TN7B 2H88A 3N2KE 5IYZE 3VRBA 4ONRA 4IE0A 2PJQA 3AAAB 3PUAA 3AEFA 2MBGA 2W0GA 4Q25A 4NUUA 3EHZA 2P9BA 3GN5B 4EIWA 3QK6A 4YSYA 3KV6A 1HG2A 4ZI2D 3KINB 2BBHA 3AVRA 3S4UA 2XASB 2J4GA 2VL0A 3AEBA 2JJ9A 2LSJA 1WLXA 2Q9QC 2WDQA 3K3NA 3ZYLA 2L7NA 3PDYA 5FKYA 3P7IA 3ZN1B 4DR3T 1IBKT 4LMJA 4DR1T 1ZKEA 4K0UA 3MXZA 3KFWX 4PFOA 2WB5A 3OKQA 3L3PA 1Y64B 2A72A 3OYZA 3LJCA 2K48A 5AQUB 4TZ4C 1ZEEA 5CFBA 2UU9T 2W67A 3PU3A 2N9DA 4LF6T 4PFPA 2C5KT 2XQ7A 1T7SA 4J2CA 4V1Av 2LM9A 4H9QC 2K3WA 5AQMB 2L8KA 4OHFA 4AIUA 5LXTE 2LQUA 2FJEA 5LGNB 1W09A 1BR4A 1NWMX 2WAUA 3JAFA 3P4WA 4HFDA 2BG9E 4YJ3E 5AQIB 4DIDB 4QH5A 4JI8T 4XBFB 4EEDA 3O9XA 1HS7A 3VHLA 3ETUA 3RF1A 3L09A 4EEBA 4ERRA 3HL6A 3IEEA 1GQEA 1UX4A 2D5UA 4QKNA 3CX8B 1UX5A 2KGXA 4E7SA 2XJ7A 4JI5T 2ZM6T 4F6RC 2VL8A 4OYKA 4P09A 4UVBB 3VKHA 4I50E 3ZYKA 4A56A 2NW9A 3VU7H 3QC9A 5AQTB 4TUYE 3ZCIA 2VK9A 2D0UA 3EVYA 3IBPA 5L3BB 3UQ7A 5DQVA 2LEHA 5HCMA 3SS1A 1SE7A 2AE9A 5LNKA 4HE8A 3WAJA 4LMKA 3FBZA 5FVLA 4W8PA 3A5XA 2D2SA 4ILBA 2KT9A 5JDLA 2KMFA 1QSDA 2KWIB 4HWFA 4MHCA 5HWXA 1YW0A 4LF7T 2BDEA 4KI0F 2NW7A 5L3FB 2X9XA 3AEDA 3L39A 4ZI3D 2XQ8A 5LGUB 1BR2A 2XQ3A 4O2AE 3RYIE 3HR0A 2VQFT 4COFA 2XAQB 1O3XA 3WAKA 1LVKA 3AEAA 2PFVA 2NTYA 1OEDA 2IDOB 2LJLA 1KNZA 1HCIA 2CRBA 2WP9A 4ISTA 2NTXA 3FZLB 3AE3A 1HNWT 2BKPA 3KBUA 1BR1A 2FUPA 2EHOA 3K3OA 1G73A 4JUYA 4L9IA 2I0MA 4TV9E 2ZM0A 4U74A 3V5UA 3WI3A 3ONJA 2W2UA 4QXHB 4TV8E 3ZMVB 2UXCT 5HEHA 3C64A 3B13A 4GYSA 4LF5T 4O2BE 3HI2A 4KMCA 5AQLB 4YHJA 2MOZA 4O4HE 5AQVB 2CLYB 2Y48B 5AQQB 2M67A 3AA1B 3RIAA 4CQIA 2IC6A 4JI0T 2VKJA 2CLYC 4CI3B 5F3JA 4ZOLE 2WM9A 2QRXA 2X66A 4LMLA 2Q9QD 4B3RT 5AQJB 2W62A 2Y8DA 1QUUA 1W9RA 4A5XA 3AXJB 3PUQA 3CWZB 3PUVF 5IHYA 2IAKA 4EB6E 5EK2A 2RPAA 4DR4T 4X5TA 1DU2A 1LRZA 3QNUA 3GA8A 2YN6A 3LDQB 3CQCB 2ODUA 2UXBT 3H3MA 4EYUA 1MIYA 5AQNB 4H9PC 2JMKA 3B5MA 3E0ZA 4BAYB 4TWDA 1XNRT 3AT7A 1M62A 2YEVC 4DR7T 2CA5A 3KV4A 3PJAA 3N2GE 5L4EA 2X0HA 3SRZA 2NR4A 2CBJA 5CA1E 3FZKB 3CKDA 1YXRA 5HCJA 2JQQA 4YHHT 3KVAA 4PAGA 2XM2A 1HNXT 3LBXB 3UFEA 5JQGE 4X1IE 3V5SA 2YKSA 2BKOA 2DNXA 3O1HA 1XDOA 4IDOA 4CI2B 3DJBA 2DHRA 5JRCB 2A9UA 2VVNA 1HTJF 2K5BB 3ABVA 2LT3A 3O1JA 3RYCE 1D0XA 3UFGA 3JADA 4YJ2E 4CXYA 1I6ZA 2JQ9A 3AB3B 2XAHB 3I9WA 3CQXC 1T8BA 4IREA 1WYBA 4KP3C 3N9OA 2WZIA 4OK0A 5JR9B 1D1CA 2KWHA 2LOSA 3I0OA 3RI5A 2CCQA 1MMNA 1CHUA 2D9DA 2XHEB 3KVBA 4DV2T 3CMLA 4B6XA 5HXHA 5L2LA 2V26A 1FIOA 4ILUA 3QUJA 3JC6D 3ZT5A 3Q2MA 2VKHA 1VCTA 3ONXA 1YQ3A 3AE2A 2H7OA 3FYQA 5DQWA 2LSKA 2V7KA 3FZMB 5CA0E 3RLFF 2HN2A 2BS3A 5EK3A 4HWIB 2KBBA 4AISA 5ABFA 1HG5A 4JBWF 2YK0A 3NZPA 1EZ3A 2CPTA 2X9HA 2N2NA 4AQFA 3P4RA 5FMNA 2VVSA 3QB5A 3VRAA 4AKLA 4EXTA 1OEDE 4CXXA 5AQPB 2E2AA 3MZKB 5HEUA 1E2AA 5JR9A 4ANJA 4P0BA 5HYAA 1IBMT 2L10A 3AAIA 4UEMA 3VR9A 3H3AA 3R6NA 1CUNA 2XQAA 2V7LA 3PTRB 3EAMA 2VURA 3Q5WA 1ZOYA 3P8CD 4H63V 4NUVA 5HEGA 2ACXA 3RKOA 2HPJA 3HKCE 2HN1A 5FYMA 2VKDA 2V8SV 4WW0A 2X9WA 3C50A 5HAXA 4ZZCA 2R6GF 3ZT7A 5C2TA 4U72A 2VKOA 2B1EA 2W66A 3SOLA 2E5VA 2JIWA 3M1CA 2BG9C 1L0VA 4YXDA 3OTOT 2YDRA 2X0YA 1WR6A 5JVDE 3TLVA 2CE7A 5JR9C 3ANWB 4WBOA 5LHIB 1HR0T 5AQSB 2WBLA 3AE1A 5ETWA 5FXXA 5LBQB 4GKJT 5BR8T 4B3ST 1S35A 5FY0A 5HXRA 1YKEB 3RIUA 2I59A 3ZMZB 3NZQA 4DBQA 3GN5A 1UURA 2G0UA 4AKIA 4U33A 5ADXL 3R84B 4QH4A 1T98A 5H6RB 5FNVE 2LSYA 2YINA 4WYVA 2IW5B 1WFDA 4A97A 4KX6A 3ZKRA 2IMLA 2C5JA 1D0ZA 2NOXA 2V5DA 2CHOA 4F8HA 2XAFB 1YKHB 4HKAA 4UVCB 4U2YA 5FL0A 3PF0A 1KNRA 3J9X1 4KHPT 2JRKA 4TX5A 3N2OA 5LBMA 1U4QA 2WZHA 3AE6A 3A7MA 3PUXF 3AECA 4QX8B 2D0TA 5L47A 1MMGA 4M1PA 2K9AA 3UTKA 3C4ZA 2QGSA 4MFRA 2XSBA 3A8YC 4UF0A 1NEKA 4JI2T 4FI5A 4HTEA 4PJJA 5HXCA 4TNVA 3TLUA 5LMUT 3MACA 2H89A 5DABA 4JI3T 2ODVA 5CB4E 3JC6C 4A98A 2HHHT 1NENA 2IUBA 5LYJE 2WU5A 3FXDB 4H9SE 2V6YA 2KSRA 3JAEA 4DV1T 5E0OA 5A1LA 4HWHA 2X67A 5FY1A 4DV3T 2ZLYA 5FXVA 3Q5XA 1FJGT 2YOEA 4YTNA 5HEOA 4YSXA 5IUXA 4JLEA 5FZTA 2CBIA 3PU8A 1HX1B 2BS4A 4IL4A 4U2ZA 1H7CA 2CXDA 2W63A 5J1GA 2FJDA 5JH7E 2LRLA 2A2FX 4I43B 2V6YB 2W61A 4ZS3A 4LF8T 3TKLB 3WSCA 3RGLA 2BKNA 3ZC0A 1UK5A 4ECGA 4MLKA 5L4HA 3AXJA 5LJNA 4X1KE 5L3GB 1XZYA 3J7Yq 4I55E 2XQ4A 2X51A 3AE7A 5IWAT 2SPCA 4DR6T 4Z8XA 2E8IA 2Z6EA 3NKZA 1SJ8A 3ANWA 4DV4T 3PUZF 4Z91A 1VCSA 4OYJA 2LHNA 4CZZB 2JQKA 4AKRB 4EZHA 3FB2A 4IIJE 3RRCA 3MKDA 3SFEA 2J62A 2E5LT 4X66T 2A3DA 3CVRA 4KUMB 3AA0B 3RYHE 4BA9A 4YSZA 5HEJA 2K24A 3FZFB 3N9NA 4KHZF 3ZMUB 4DO0A 5C8YE 3LBXA 4JI4T 1UUSA 2IHR1 5KDMC 4F7GB 2CEAA 4ILCA 2LSIA 3IF8B 3GMIA 3ZSTA 2DCFA 2UXDT 2LOPA 1QLBA 3N9MA 2UUAT 2OV9A 1XWMA 1IJ5A 2W00A 3ESLA 2PTFA 2UXNB 3ZT6A 4YFSA 5J0ZA 2MAWA 2VQET 5H6QB 3ZMTB 2UUCT 3NWIA 4U3CA 5L3DB 3TLTA 4TWHA 4YTMA 3AE8A 4IDPA 3ZJ1A 4U31A 4UELA 3FXEB 3T8OA 5FY7A 3VJZA 2VASA 2DWGA 1R8IA 4ASKA 1SJ7A 3PUWF 1WR0A 1X9BA 5EK4A 3C98B 2WWUA 3F31A 3LSVA 4HEAA 3EDVA 4PJNA 4C90A 2LRKA 4IDQA 2WCAA 4P1NA 2UXXB 3EABA 2ZM8A 3ETVA 5AQOB 4E7ZA 2RA1A 2UUBT 1XMOT 3H37A 3BQKA 3ZPOA 1T72A 1SA0E 4CI1B 2HH7A 5C3JA 4YY3T 3HKBE 1Z8UA 3B57A 3W15B 3QOFA 2N1GA 5JDMA 5T1DA 2DL1A 4GIWA 2LM2A 3OBVE 2BZBA 4CN4A 5FXWA 4PK6A 2XPKA 4JEUB 3UU4A 5ABEA 3I1AA 4X64T 4NXNT 1U5PA 3CPZA 5LCYA 3FHNA 1MIVA 3BK9A 4U7IA 4PW8A 4PJMA 1W0AA 3P50A 2XSAA 3Q9DA 2XUEA 4CXWA 3F2EA 1OWAA 2WSSV 4U7YA 4ZXLA 3D0TA 5KXJA 2QA7A 2YU1A 2XAJB 3I9YA 4HFCA 3U78A 1ZV4X 4DV7T 2QVAA 4ISSA 1HX8A 5AQRB 3RRWA 4IE4A 1KK7A 4DUZT 3X1DA 4C91A 2JQHA 3G06A 2WWVA 4X65T 3CX7B 4DUYT 3KDSE 5HWYA 4OX9T 3EUHA 2C0SA 1J5WA 3AEEA 1UCUA 5LOVE 3U3IA 4ADZA 2VWAA 3CQGB 5ABFB 2WMNA 4GKKT 4IDNA 1N34T 2XTLA 3PE0A 3VR8A 4JV5T 4MALA 3LG7A 5LHGB 2PG8A 3ZCJA 4HN9A 5FXZA 2DI4A 2L9QA 3PUGA 2M6IA 5LHHB 5FP3A 5JDFA 3HA4A 4UR9A 4JI7T 3RIUC 3CIRA 2PBIA 3RC8A 1FEWA 3AE4A 4UF0B 4CN6A 4DMWA 2ZMAA 4Z90A 3ZYMA 1HNZT 3ZJ2A 3OVUA 4NPPA 2ZM2A 4HWDA 3BQIA 2KZ7B 1WRDA 2RP4A 4PK4A 4AQGA 4QHOA 3T1YT 4X62T 3RQUA 4ZI7E 5LMNT 4B3TT 4IE6A 4HFHA 2KXPB 3OJAA 5GONE 3UUNA 5CJ5A 5LJMA 2E9XC 2EHOB 4K0KT 4FJOA 2X0CA 3LK3B 1D1BA 2EHOC 5LB7B 3C51A 4GK0E 4GK5E 4ILAA 1UGOA 3AE5A 3CX6B 3KBTA 1Z0PA 2V1DB 2VB6A 4QX7B 1VRBA 4X20E 1OEDC 4H9RC 1B7TA 4G2AA 4N78D 4DBRA 5KMGP 1N36T 1MNDA 2HPLA 3L8RA 3NVOA 3WURA 1ZP0A 5AQGB 2Y6XA 4UV9B 4DR2T 3UU3A 2L3LA 2AXDS 2EHOD 2XQ9A 4GOUA 3RQWA 1JNRA 3FZHB 3UUMA 4BGOA 3RHWA 1N32T 3GWHA 1KEYA 5ABGA 5AQHB 3RYFE 3UU6A 3P4QA 2KVPA 1J1JA 2YU2A 5JDQA 1MIWA 3HKEE 4QXCB 3RKGA 3N9QA 3UU8A 5JDGA 5JTGA 2B76A 2WS3A 4I4TE 4P0AA 5M4YA 5J2TE 5FL1A 3T1HT 3C4XA 4EOZB 3EI0A 1IAPA 3E08A 4H63H 4UVAB 3TLWA 3MA9A 3EDUA 2MYSA 3RC3A 1IJ6A 2E9XD 2I6HA 4B3MT 4LF9T 5L3EB 5JRCA 2BG9A 1HFAA 3DTOA 4X1YE 2WDVA 4ZS2A 1FMVA 2Q9QB 3HKDE 2LLYA 2XQYA 1SUMB 3I0QA 3MJXA 2WDRA 4HFBA 1VOMA 4UV8B 5J2UE 4JI1T 2LKHA 3UUXB 1W0BA 3OPCA 4IE5A 4EYYR 1IBLT 1BR0A 4OFZA 1YD8G 2DWKA 2LKGA 4O4LE 3SFDA 4ZHQE 1LVFA 4ZZBA 2XAGB 3UT5E 2BG9B 1MMAA 3PUSA 4O4IE 3VKGA 3AVSA 3O1IA 3RX6A 3FBLA 1I94T 4BJMA 4YTPA 4LFAT 3OYXA 1FMWA 3QB5K 4UXNB 5HXEA 2CWOA 1X79A 3IHRA 3KV9A 2YDSA 3AEGA 1KFYA 4H9OC 4WNKA 3PURA 3C4WA 1LKXA 1D1AA 3PHF1 2JPFA 1XNQT 4NXMT 2CM0A 4TWFA 2NWBA 4HFVA
chains in the Genus database with same CATH topology
4O8SA 4DMVA 2MTQA 1HF8A 4IGUA 2H7VC 3AAEB 3NRYA 2GK9A 4ZI2C 3BQLA 4EAHA 2X68A 3NRXA 2V7MA 3RH3A 2ES0A 3N9LA 2LSGA 3N5LA 5L3CB 4PJLA 2NP9A 4WBNE 1SHZC 1E1HB 1US7B 4DBRA 4AQFC 4ZI7E 3M65A 4YLHA 2MTCA 4QXBB 3F57A 1ZHCA 2V7IA 5F8PA 2CXFA 4IE7A 3ZN0B 3K3QC 4JEHB 2V7JA 4GYRA 5TAOA 1AJ3A 3AA7B 3DP7A 2CMRA 3RPUA 3NBXX 2BVLA 3KV5A 3LK2B 3O4XE 1V9DA 3K8PC 4UIGA 3ZMSB 5LG4A 2NW8A 4AKHA 2BVMA 2DLRA 5AFUL 5LP6E 2OA5A 4HGAA 5JDHA 1MMDA 2X9YA 1OXZA 3E22E 3AA6B 5DJQC 5LA6E 1NAFA 4DNDA 1S94A 4PK5A 2JMHA 2C5IT 2LHRA 3ZLIA 2CXLA 2KNDA 4KBMB 3LK42 4O4JE 3UULA 5HXSA 2KINB 4IHJE 3ZC1A 4L0RA 2E9XB 4G63A 4EZ4A 3MK7C 3SWHA 5JDNA 5LGTB 3PHF1 3N9PA 3LFMA 4QWNB 4XAXB 2X0LB 2KLQA 4AXPA 4AKGA 2J1DG 2WMOA 1MNEA 4DVDA 5JREA 1IZNB 2CWYA 4ZI3C 4MBQA 4AI6A 4XZCA 4H9NC 2E9XA 1WYCA 1G8XA 4PNIA 2H3RA 5BMVE 2IC9A 4IDZA 5EZYE 3ZEFB 2Q9QA 2LE8A 5KX5E 1D0YA 4BJNA 4L5GA 4TN7B 3N2KE 5IYZE 4ONRA 4IE0A 2PJQA 3AAAB 3PUAA 2MBGA 2W0GA 4NUUA 2P9BA 3GN5B 4EIWA 3QK6A 3KV6A 1HG2A 4ZI2D 3KINB 3AVRA 3S4UA 2XASB 2JJ9A 2LSJA 1WLXA 2Q9QC 3K3NA 3ZYLA 3PDYA 3P7IA 3ZN1B 1ZKEA 4K0UA 3MXZA 3KFWX 4PFOA 3OKQA 3L3PA 1Y64B 2A72A 3OYZA 3LJCA 2K48A 4TZ4C 1ZEEA 3PU3A 2N9DA 4PFPA 2C5KT 4J2CA 4V1Av 2LM9A 4H9QC 5LXTE 2L8KA 4OHFA 5LGNB 1BR4A 1NWMX 2WAUA 4YJ3E 4XBFB 1HS7A 3O9XA 3VHLA 3ETUA 3L09A 4ERRA 3HL6A 3IEEA 2D5UA 1UX4A 4QKNA 3CX8B 1UX5A 4E7SA 4F6RC 2VL8A 4OYKA 4P09A 4UVBB 3VKHA 4I50E 3ZYKA 4A56A 2NW9A 3VU7H 3QC9A 4TUYE 3ZCIA 2VK9A 2D0UA 3EVYA 3IBPA 5L3BB 5DQVA 2LEHA 3SS1A 5LNKA 3WAJA 4HE8A 3FBZA 3A5XA 2D2SA 2KT9A 5JDLA 2KMFA 1QSDA 2KWIB 5HWXA 4MHCA 1YW0A 2BDEA 2NW7A 5L3FB 2X9XA 4ZI3D 5LGUB 1BR2A 4O2AE 3RYIE 3HR0A 2XAQB 1O3XA 3WAKA 1LVKA 2PFVA 2NTYA 2LJLA 1KNZA 1HCIA 4ISTA 2NTXA 3KBUA 1BR1A 3K3OA 2EHOA 4JUYA 1G73A 4L9IA 4TV9E 4U74A 3V5UA 2ZM0A 3WI3A 3ZMVB 4QXHB 4TV8E 3C64A 3B13A 4GYSA 4O2BE 3HI2A 4KMCA 4YHJA 2MOZA 4O4HE 3U3IA 2CLYB 2Y48B 4ADZA 2M67A 3AA1B 4CQIA 2IC6A 2VKJA 2CLYC 4CI3B 5F3JA 4ZOLE 2WM9A 2X66A 2Q9QD 2W62A 2Y8DA 1QUUA 3PUQA 3CWZB 5IHYA 4EB6E 2IAKA 5EK2A 1LRZA 3GA8A 3CQCB 2ODUA 4EYUA 1MIYA 4H9PC 2JMKA 3E0ZA 4BAYB 3AT7A 2YEVC 2CA5A 3KV4A 3N2GE 3SRZA 5CA1E 3CKDA 2JQQA 3KVAA 4PAGA 3LBXB 3UFEA 5JQGE 4X1IE 3V5SA 2DNXA 3O1HA 4CI2B 3DJBA 2DHRA 5JRCB 1HTJF 2K5BB 2LT3A 3O1JA 3RYCE 1D0XA 4YJ2E 4CXYA 3AB3B 3I9WA 2XAHB 4OK0A 3CQXC 4KP3C 5JR9B 1WYBA 5LHIB 3N9OA 1D1CA 2KWHA 2LOSA 3I0OA 2CCQA 1MMNA 3KVBA 2XHEB 3CMLA 4B6XA 5HXHA 5L2LA 2V26A 1FIOA 4ILUA 3QUJA 3JC6D 3Q2MA 2VKHA 3ONXA 2H7OA 5DQWA 2LSKA 2V7KA 5CA0E 5EK3A 1HG5A 2YK0A 3NZPA 1EZ3A 2X9HA 2N2NA 4AQFA 5FMNA 4EXTA 4AKLA 4CXXA 3MZKB 5JR9A 4ANJA 4P0BA 5HYAA 3AAIA 4UEMA 3H3AA 3R6NA 1CUNA 3PTRB 2V7LA 3Q5WA 4NUVA 4H63V 3P8CD 3RKOA 2ACXA 2HPJA 3HKCE 5FYMA 2VKDA 4WW0A 2X9WA 3C50A 5HAXA 4U72A 2VKOA 2B1EA 3SOLA 3M1CA 5JVDE 1WR6A 5JR9C 2CE7A 3ANWB 4WBOA 2WBLA 5ETWA 5FXXA 5LBQB 1S35A 5FY0A 5HXRA 1YKEB 3ZMZB 2I59A 3NZQA 4DBQA 3GN5A 2G0UA 4AKIA 5ADXL 3R84B 1T98A 5H6RB 5FNVE 2LSYA 2YINA 2IW5B 2C5JA 1D0ZA 2NOXA 2XAFB 1YKHB 4HKAA 4UVCB 3PF0A 3J9X1 2JRKA 4TX5A 3N2OA 5LBMA 1U4QA 4QX8B 2D0TA 1MMGA 4M1PA 2K9AA 3UTKA 3C4ZA 2QGSA 4MFRA 4UF0A 4FI5A 4HTEA 4PJJA 5HXCA 3MACA 5DABA 2ODVA 5CB4E 3JC6C 5LYJE 3FXDB 4H9SE 5E0OA 5A1LA 2X67A 5FY1A 2ZLYA 5FXVA 3Q5XA 4JLEA 3PU8A 5J1GA 5JH7E 1H7CA 2CXDA 2W63A 2A2FX 4I43B 2W61A 4ZS3A 3TKLB 3WSCA 4ECGA 3ZC0A 4MLKA 5LJNA 4X1KE 5L3GB 3J7Yq 4I55E 2X51A 2SPCA 4Z8XA 2E8IA 2Z6EA 3ANWA 4OYJA 2LHNA 4CZZB 4AKRB 4EZHA 3FB2A 4IIJE 3RRCA 3MKDA 2A3DA 3CVRA 4KUMB 3AA0B 3RYHE 4BA9A 2K24A 3N9NA 3ZMUB 4DO0A 5C8YE 3LBXA 5KDMC 2CEAA 2LSIA 3IF8B 3GMIA 2DCFA 2LOPA 3N9MA 1IJ5A 2W00A 3ESLA 2UXNB 4YFSA 5H6QB 3ZMTB 5L3DB 3ZJ1A 4UELA 3FXEB 3T8OA 5FY7A 3VJZA 2VASA 2DWGA 4ASKA 5EK4A 3C98B 2WWUA 3F31A 4HEAA 4PJNA 3EDVA 4C90A 2UXXB 4E7ZA 3ETVA 2ZM8A 2RA1A 3H37A 3BQKA 3ZPOA 4CI1B 1SA0E 2HH7A 3HKBE 3B57A 3W15B 2N1GA 5JDMA 5T1DA 4GIWA 3OBVE 2BZBA 5FXWA 4PK6A 4JEUB 3I1AA 1U5PA 3CPZA 5LCYA 3FHNA 1MIVA 3BK9A 4PW8A 4PJMA 3Q9DA 2XUEA 4CXWA 3F2EA 1OWAA 2WSSV 3D0TA 2QA7A 2YU1A 2XAJB 3I9YA 3U78A 1ZV4X 4ISSA 1HX8A 3RRWA 4IE4A 1KK7A 4C91A 3CX7B 3KDSE 5HWYA 3EUHA 2C0SA 5LOVE 1UCUA 2VWAA 3CQGB 2WMNA 2XTLA 3PE0A 4MALA 3LG7A 5LHGB 2PG8A 3ZCJA 4HN9A 5FXZA 2DI4A 2L9QA 3PUGA 5LHHB 5FP3A 5JDFA 3HA4A 3RC8A 2PBIA 1FEWA 4UF0B 4DMWA 2ZMAA 3ZYMA 3ZJ2A 2ZM2A 3BQIA 2KZ7B 1WRDA 2RP4A 4PK4A 4AQGA 4QHOA 4IE6A 5GONE 2KXPB 3OJAA 3UUNA 5LJMA 2LQUA 2E9XC 2EHOB 4FJOA 3LK3B 1D1BA 2EHOC 3C51A 4GK0E 4GK5E 3CX6B 4X20E 3KBTA 1Z0PA 2V1DB 2VB6A 4QX7B 1VRBA 5KMGP 4H9RC 4N78D 1B7TA 4G2AA 1MNDA 2HPLA 3WURA 2Y6XA 4UV9B 2L3LA 2EHOD 4GOUA 3UUMA 4BGOA 3GWHA 3RYFE 2YU2A 5JDQA 1MIWA 3HKEE 4QXCB 4P0AA 3N9QA 5JDGA 4I4TE 5M4YA 5J2TE 3C4XA 4EOZB 1IAPA 3E08A 4H63H 4UVAB 3MA9A 3EDUA 2MYSA 3RC3A 1IJ6A 2E9XD 5JRCA 5L3EB 1HFAA 3DTOA 4X1YE 4ZS2A 1FMVA 2Q9QB 3HKDE 2XQYA 3I0QA 3MJXA 4UV8B 5J2UE 1VOMA 3UUXB 4IE5A 4EYYR 1BR0A 4OFZA 1YD8G 2DWKA 4O4LE 4ZHQE 1LVFA 2XAGB 3UT5E 1MMAA 3PUSA 4O4IE 3VKGA 3AVSA 3O1IA 3RX6A 3FBLA 4BJMA 3OYXA 1FMWA 4UXNB 5HXEA 2CWOA 1X79A 3IHRA 3KV9A 4WNKA 4H9OC 3PURA 3C4WA 1LKXA 1D1AA 2JPFA 2CM0A 2NWBA 4HFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXC A;  5HWX A;  5HWY A;  5HXR A;  3V5U A;  5JDL A;  5JDH A;  5JDN A;  5JDQ A;  3V5S A;  5JDF A;  5HXS A;  5HXE A;  5JDG A;  5JDM A;  5HXH A;  5HYA A; 
#chains in the Genus database with same CATH topology
 2J47 A;  4JI6 T;  4O8S A;  4DMV A;  2MTQ A;  1HF8 A;  4IGU A;  2H7V C;  3AAE B;  3ONL C;  3NRY A;  2GK9 A;  2XQ5 A;  4LFB T;  4ZI2 C;  2FJB A;  3BQL A;  2M6B A;  4EAH A;  2X68 A;  3NRX A;  2V7M A;  3RH3 A;  2ES0 A;  3N9L A;  2LSG A;  3CK6 A;  3UU5 A;  3N5L A;  5L3C B;  4PJL A;  4ZEY A;  3UQ4 A;  4JYA T;  4EV6 A;  2NP9 A;  4HWC A;  5F5W A;  4LF4 T;  4WBN E;  2F4V T;  3Q5E A;  3AY5 A;  2WY2 A;  1SHZ C;  1E1H B;  1M7K A;  1US7 B;  3P4P A;  4IL9 A;  3M65 A;  4AQF C;  2ACZ A;  2WU2 A;  1JNZ A;  4YLH A;  4QXB B;  2QYW A;  5ABH A;  4DR5 T;  2MTC A;  2W4X A;  1ZHC A;  2YDQ A;  2V7I A;  1Y01 A;  3F57 A;  5F8P A;  2CXF A;  4IE7 A;  3ZN0 B;  3K3Q C;  4QH1 A;  4JEH B;  2V7J A;  3IA3 A;  4GYR A;  2XQ6 A;  5TAO A;  3RIF A;  1AJ3 A;  3AA7 B;  3DP7 A;  2CHN A;  2CMR A;  3RPU A;  3NBX X;  2BVL A;  2BBJ A;  3KV5 A;  3LK2 B;  1V9D A;  3K8P C;  3O4X E;  3Q5D A;  2IIU A;  2NW8 A;  4UIG A;  3ZMS B;  5LG4 A;  1KNP A;  1J5E T;  3M3Z B;  1XDP A;  1N33 T;  4AKH A;  4WZX A;  2BVM A;  5CGM A;  2DLR A;  5AFU L;  5LP6 E;  4CN1 A;  2OA5 A;  3PV0 F;  4HFE A;  4HGA A;  5JDH A;  1MMD A;  2X9Y A;  1OXZ A;  3E22 E;  3AA6 B;  5DJQ C;  3P4S A;  5LA6 E;  1XMQ T;  1NAF A;  4DND A;  1S94 A;  2XZE A;  4PK5 A;  4HFI A;  2JMH A;  2C5I T;  2LHR A;  3ZLI A;  2CXL A;  2KND A;  2FJA A;  3LK4 2;  4KBM B;  4O4J E;  4TNW A;  3UUL A;  5HXS A;  2KIN B;  2OLT A;  4IHJ E;  5AQK B;  3AE9 A;  3TLS A;  3ZC1 A;  4EGW A;  2V5C A;  5AQF B;  4DV6 T;  2V6X A;  4L0R A;  1E7P A;  2E9X B;  3JCF A;  3MK7 C;  4G63 A;  5FVK A;  3SWH A;  4EZ4 A;  3N9P A;  3LFM A;  5JDN A;  4QWN B;  4XAX B;  4YT0 A;  2X0L B;  5LGT B;  2KLQ A;  4AXP A;  5LG3 A;  4AKG A;  2J1D G;  2WMO A;  1MNE A;  2WQY A;  4DVD A;  5JRE A;  1IZN B;  3UUB A;  2CWY A;  4ZI3 C;  4MBQ A;  2FBW A;  3K1S A;  4AI6 A;  1OED B;  4XZC A;  1KF6 A;  3PUY F;  4H9N C;  2E9X A;  1WYC A;  1G8X A;  2BS2 A;  4NIQ A;  4PNI A;  3ZSS A;  2MPK A;  4LFC T;  2H3R A;  4AQY T;  5BMV E;  2IC9 A;  4I0U A;  4IDZ A;  3DYJ A;  2XM1 A;  5EZY E;  1YQ4 A;  4IT4 A;  3ZEF B;  2Q9Q A;  4DV0 T;  2LE8 A;  1WCR A;  5KX5 E;  1D0Y A;  3PJA J;  4DV5 T;  4BJN A;  4L5G A;  2XY8 B;  4TN7 B;  2H88 A;  3N2K E;  5IYZ E;  3VRB A;  4ONR A;  4IE0 A;  2PJQ A;  3AAA B;  3PUA A;  3AEF A;  2MBG A;  2W0G A;  4Q25 A;  4NUU A;  3EHZ A;  2P9B A;  3GN5 B;  4EIW A;  3QK6 A;  4YSY A;  3KV6 A;  1HG2 A;  4ZI2 D;  3KIN B;  2BBH A;  3AVR A;  3S4U A;  2XAS B;  2J4G A;  2VL0 A;  3AEB A;  2JJ9 A;  2LSJ A;  1WLX A;  2Q9Q C;  2WDQ A;  3K3N A;  3ZYL A;  2L7N A;  3PDY A;  5FKY A;  3P7I A;  3ZN1 B;  4DR3 T;  1IBK T;  4LMJ A;  4DR1 T;  1ZKE A;  4K0U A;  3MXZ A;  3KFW X;  4PFO A;  2WB5 A;  3OKQ A;  3L3P A;  1Y64 B;  2A72 A;  3OYZ A;  3LJC A;  2K48 A;  5AQU B;  4TZ4 C;  1ZEE A;  5CFB A;  2UU9 T;  2W67 A;  3PU3 A;  2N9D A;  4LF6 T;  4PFP A;  2C5K T;  2XQ7 A;  1T7S A;  4J2C A;  4V1A v;  2LM9 A;  4H9Q C;  2K3W A;  5AQM B;  2L8K A;  4OHF A;  4AIU A;  5LXT E;  2LQU A;  2FJE A;  5LGN B;  1W09 A;  1BR4 A;  1NWM X;  2WAU A;  3JAF A;  3P4W A;  4HFD A;  2BG9 E;  4YJ3 E;  5AQI B;  4DID B;  4QH5 A;  4JI8 T;  4XBF B;  4EED A;  3O9X A;  1HS7 A;  3VHL A;  3ETU A;  3RF1 A;  3L09 A;  4EEB A;  4ERR A;  3HL6 A;  3IEE A;  1GQE A;  1UX4 A;  2D5U A;  4QKN A;  3CX8 B;  1UX5 A;  2KGX A;  4E7S A;  2XJ7 A;  4JI5 T;  2ZM6 T;  4F6R C;  2VL8 A;  4OYK A;  4P09 A;  4UVB B;  3VKH A;  4I50 E;  3ZYK A;  4A56 A;  2NW9 A;  3VU7 H;  3QC9 A;  5AQT B;  4TUY E;  3ZCI A;  2VK9 A;  2D0U A;  3EVY A;  3IBP A;  5L3B B;  3UQ7 A;  5DQV A;  2LEH A;  5HCM A;  3SS1 A;  1SE7 A;  2AE9 A;  5LNK A;  4HE8 A;  3WAJ A;  4LMK A;  3FBZ A;  5FVL A;  4W8P A;  3A5X A;  2D2S A;  4ILB A;  2KT9 A;  5JDL A;  2KMF A;  1QSD A;  2KWI B;  4HWF A;  4MHC A;  5HWX A;  1YW0 A;  4LF7 T;  2BDE A;  4KI0 F;  2NW7 A;  5L3F B;  2X9X A;  3AED A;  3L39 A;  4ZI3 D;  2XQ8 A;  5LGU B;  1BR2 A;  2XQ3 A;  4O2A E;  3RYI E;  3HR0 A;  2VQF T;  4COF A;  2XAQ B;  1O3X A;  3WAK A;  1LVK A;  3AEA A;  2PFV A;  2NTY A;  1OED A;  2IDO B;  2LJL A;  1KNZ A;  1HCI A;  2CRB A;  2WP9 A;  4IST A;  2NTX A;  3FZL B;  3AE3 A;  1HNW T;  2BKP A;  3KBU A;  1BR1 A;  2FUP A;  2EHO A;  3K3O A;  1G73 A;  4JUY A;  4L9I A;  2I0M A;  4TV9 E;  2ZM0 A;  4U74 A;  3V5U A;  3WI3 A;  3ONJ A;  2W2U A;  4QXH B;  4TV8 E;  3ZMV B;  2UXC T;  5HEH A;  3C64 A;  3B13 A;  4GYS A;  4LF5 T;  4O2B E;  3HI2 A;  4KMC A;  5AQL B;  4YHJ A;  2MOZ A;  4O4H E;  5AQV B;  2CLY B;  2Y48 B;  5AQQ B;  2M67 A;  3AA1 B;  3RIA A;  4CQI A;  2IC6 A;  4JI0 T;  2VKJ A;  2CLY C;  4CI3 B;  5F3J A;  4ZOL E;  2WM9 A;  2QRX A;  2X66 A;  4LML A;  2Q9Q D;  4B3R T;  5AQJ B;  2W62 A;  2Y8D A;  1QUU A;  1W9R A;  4A5X A;  3AXJ B;  3PUQ A;  3CWZ B;  3PUV F;  5IHY A;  2IAK A;  4EB6 E;  5EK2 A;  2RPA A;  4DR4 T;  4X5T A;  1DU2 A;  1LRZ A;  3QNU A;  3GA8 A;  2YN6 A;  3LDQ B;  3CQC B;  2ODU A;  2UXB T;  3H3M A;  4EYU A;  1MIY A;  5AQN B;  4H9P C;  2JMK A;  3B5M A;  3E0Z A;  4BAY B;  4TWD A;  1XNR T;  3AT7 A;  1M62 A;  2YEV C;  4DR7 T;  2CA5 A;  3KV4 A;  3PJA A;  3N2G E;  5L4E A;  2X0H A;  3SRZ A;  2NR4 A;  2CBJ A;  5CA1 E;  3FZK B;  3CKD A;  1YXR A;  5HCJ A;  2JQQ A;  4YHH T;  3KVA A;  4PAG A;  2XM2 A;  1HNX T;  3LBX B;  3UFE A;  5JQG E;  4X1I E;  3V5S A;  2YKS A;  2BKO A;  2DNX A;  3O1H A;  1XDO A;  4IDO A;  4CI2 B;  3DJB A;  2DHR A;  5JRC B;  2A9U A;  2VVN A;  1HTJ F;  2K5B B;  3ABV A;  2LT3 A;  3O1J A;  3RYC E;  1D0X A;  3UFG A;  3JAD A;  4YJ2 E;  4CXY A;  1I6Z A;  2JQ9 A;  3AB3 B;  2XAH B;  3I9W A;  3CQX C;  1T8B A;  4IRE A;  1WYB A;  4KP3 C;  3N9O A;  2WZI A;  4OK0 A;  5JR9 B;  1D1C A;  2KWH A;  2LOS A;  3I0O A;  3RI5 A;  2CCQ A;  1MMN A;  1CHU A;  2D9D A;  2XHE B;  3KVB A;  4DV2 T;  3CML A;  4B6X A;  5HXH A;  5L2L A;  2V26 A;  1FIO A;  4ILU A;  3QUJ A;  3JC6 D;  3ZT5 A;  3Q2M A;  2VKH A;  1VCT A;  3ONX A;  1YQ3 A;  3AE2 A;  2H7O A;  3FYQ A;  5DQW A;  2LSK A;  2V7K A;  3FZM B;  5CA0 E;  3RLF F;  2HN2 A;  2BS3 A;  5EK3 A;  4HWI B;  2KBB A;  4AIS A;  5ABF A;  1HG5 A;  4JBW F;  2YK0 A;  3NZP A;  1EZ3 A;  2CPT A;  2X9H A;  2N2N A;  4AQF A;  3P4R A;  5FMN A;  2VVS A;  3QB5 A;  3VRA A;  4AKL A;  4EXT A;  1OED E;  4CXX A;  5AQP B;  2E2A A;  3MZK B;  5HEU A;  1E2A A;  5JR9 A;  4ANJ A;  4P0B A;  5HYA A;  1IBM T;  2L10 A;  3AAI A;  4UEM A;  3VR9 A;  3H3A A;  3R6N A;  1CUN A;  2XQA A;  2V7L A;  3PTR B;  3EAM A;  2VUR A;  3Q5W A;  1ZOY A;  3P8C D;  4H63 V;  4NUV A;  5HEG A;  2ACX A;  3RKO A;  2HPJ A;  3HKC E;  2HN1 A;  5FYM A;  2VKD A;  2V8S V;  4WW0 A;  2X9W A;  3C50 A;  5HAX A;  4ZZC A;  2R6G F;  3ZT7 A;  5C2T A;  4U72 A;  2VKO A;  2B1E A;  2W66 A;  3SOL A;  2E5V A;  2JIW A;  3M1C A;  2BG9 C;  1L0V A;  4YXD A;  3OTO T;  2YDR A;  2X0Y A;  1WR6 A;  5JVD E;  3TLV A;  2CE7 A;  5JR9 C;  3ANW B;  4WBO A;  5LHI B;  1HR0 T;  5AQS B;  2WBL A;  3AE1 A;  5ETW A;  5FXX A;  5LBQ B;  4GKJ T;  5BR8 T;  4B3S T;  1S35 A;  5FY0 A;  5HXR A;  1YKE B;  3RIU A;  2I59 A;  3ZMZ B;  3NZQ A;  4DBQ A;  3GN5 A;  1UUR A;  2G0U A;  4AKI A;  4U33 A;  5ADX L;  3R84 B;  4QH4 A;  1T98 A;  5H6R B;  5FNV E;  2LSY A;  2YIN A;  4WYV A;  2IW5 B;  1WFD A;  4A97 A;  4KX6 A;  3ZKR A;  2IML A;  2C5J A;  1D0Z A;  2NOX A;  2V5D A;  2CHO A;  4F8H A;  2XAF B;  1YKH B;  4HKA A;  4UVC B;  4U2Y A;  5FL0 A;  3PF0 A;  1KNR A;  3J9X 1;  4KHP T;  2JRK A;  4TX5 A;  3N2O A;  5LBM A;  1U4Q A;  2WZH A;  3AE6 A;  3A7M A;  3PUX F;  3AEC A;  4QX8 B;  2D0T A;  5L47 A;  1MMG A;  4M1P A;  2K9A A;  3UTK A;  3C4Z A;  2QGS A;  4MFR A;  2XSB A;  3A8Y C;  4UF0 A;  1NEK A;  4JI2 T;  4FI5 A;  4HTE A;  4PJJ A;  5HXC A;  4TNV A;  3TLU A;  5LMU T;  3MAC A;  2H89 A;  5DAB A;  4JI3 T;  2ODV A;  5CB4 E;  3JC6 C;  4A98 A;  2HHH T;  1NEN A;  2IUB A;  5LYJ E;  2WU5 A;  3FXD B;  4H9S E;  2V6Y A;  2KSR A;  3JAE A;  4DV1 T;  5E0O A;  5A1L A;  4HWH A;  2X67 A;  5FY1 A;  4DV3 T;  2ZLY A;  5FXV A;  3Q5X A;  1FJG T;  2YOE A;  4YTN A;  5HEO A;  4YSX A;  5IUX A;  4JLE A;  5FZT A;  2CBI A;  3PU8 A;  1HX1 B;  2BS4 A;  4IL4 A;  4U2Z A;  1H7C A;  2CXD A;  2W63 A;  5J1G A;  2FJD A;  5JH7 E;  2LRL A;  2A2F X;  4I43 B;  2V6Y B;  2W61 A;  4ZS3 A;  4LF8 T;  3TKL B;  3WSC A;  3RGL A;  2BKN A;  3ZC0 A;  1UK5 A;  4ECG A;  4MLK A;  5L4H A;  3AXJ A;  5LJN A;  4X1K E;  5L3G B;  1XZY A;  3J7Y q;  4I55 E;  2XQ4 A;  2X51 A;  3AE7 A;  5IWA T;  2SPC A;  4DR6 T;  4Z8X A;  2E8I A;  2Z6E A;  3NKZ A;  1SJ8 A;  3ANW A;  4DV4 T;  3PUZ F;  4Z91 A;  1VCS A;  4OYJ A;  2LHN A;  4CZZ B;  2JQK A;  4AKR B;  4EZH A;  3FB2 A;  4IIJ E;  3RRC A;  3MKD A;  3SFE A;  2J62 A;  2E5L T;  4X66 T;  2A3D A;  3CVR A;  4KUM B;  3AA0 B;  3RYH E;  4BA9 A;  4YSZ A;  5HEJ A;  2K24 A;  3FZF B;  3N9N A;  4KHZ F;  3ZMU B;  4DO0 A;  5C8Y E;  3LBX A;  4JI4 T;  1UUS A;  2IHR 1;  5KDM C;  4F7G B;  2CEA A;  4ILC A;  2LSI A;  3IF8 B;  3GMI A;  3ZST A;  2DCF A;  2UXD T;  2LOP A;  1QLB A;  3N9M A;  2UUA T;  2OV9 A;  1XWM A;  1IJ5 A;  2W00 A;  3ESL A;  2PTF A;  2UXN B;  3ZT6 A;  4YFS A;  5J0Z A;  2MAW A;  2VQE T;  5H6Q B;  3ZMT B;  2UUC T;  3NWI A;  4U3C A;  5L3D B;  3TLT A;  4TWH A;  4YTM A;  3AE8 A;  4IDP A;  3ZJ1 A;  4U31 A;  4UEL A;  3FXE B;  3T8O A;  5FY7 A;  3VJZ A;  2VAS A;  2DWG A;  1R8I A;  4ASK A;  1SJ7 A;  3PUW F;  1WR0 A;  1X9B A;  5EK4 A;  3C98 B;  2WWU A;  3F31 A;  3LSV A;  4HEA A;  3EDV A;  4PJN A;  4C90 A;  2LRK A;  4IDQ A;  2WCA A;  4P1N A;  2UXX B;  3EAB A;  2ZM8 A;  3ETV A;  5AQO B;  4E7Z A;  2RA1 A;  2UUB T;  1XMO T;  3H37 A;  3BQK A;  3ZPO A;  1T72 A;  1SA0 E;  4CI1 B;  2HH7 A;  5C3J A;  4YY3 T;  3HKB E;  1Z8U A;  3B57 A;  3W15 B;  3QOF A;  2N1G A;  5JDM A;  5T1D A;  2DL1 A;  4GIW A;  2LM2 A;  3OBV E;  2BZB A;  4CN4 A;  5FXW A;  4PK6 A;  2XPK A;  4JEU B;  3UU4 A;  5ABE A;  3I1A A;  4X64 T;  4NXN T;  1U5P A;  3CPZ A;  5LCY A;  3FHN A;  1MIV A;  3BK9 A;  4U7I A;  4PW8 A;  4PJM A;  1W0A A;  3P50 A;  2XSA A;  3Q9D A;  2XUE A;  4CXW A;  3F2E A;  1OWA A;  2WSS V;  4U7Y A;  4ZXL A;  3D0T A;  5KXJ A;  2QA7 A;  2YU1 A;  2XAJ B;  3I9Y A;  4HFC A;  3U78 A;  1ZV4 X;  4DV7 T;  2QVA A;  4ISS A;  1HX8 A;  5AQR B;  3RRW A;  4IE4 A;  1KK7 A;  4DUZ T;  3X1D A;  4C91 A;  2JQH A;  3G06 A;  2WWV A;  4X65 T;  3CX7 B;  4DUY T;  3KDS E;  5HWY A;  4OX9 T;  3EUH A;  2C0S A;  1J5W A;  3AEE A;  1UCU A;  5LOV E;  3U3I A;  4ADZ A;  2VWA A;  3CQG B;  5ABF B;  2WMN A;  4GKK T;  4IDN A;  1N34 T;  2XTL A;  3PE0 A;  3VR8 A;  4JV5 T;  4MAL A;  3LG7 A;  5LHG B;  2PG8 A;  3ZCJ A;  4HN9 A;  5FXZ A;  2DI4 A;  2L9Q A;  3PUG A;  2M6I A;  5LHH B;  5FP3 A;  5JDF A;  3HA4 A;  4UR9 A;  4JI7 T;  3RIU C;  3CIR A;  2PBI A;  3RC8 A;  1FEW A;  3AE4 A;  4UF0 B;  4CN6 A;  4DMW A;  2ZMA A;  4Z90 A;  3ZYM A;  1HNZ T;  3ZJ2 A;  3OVU A;  4NPP A;  2ZM2 A;  4HWD A;  3BQI A;  2KZ7 B;  1WRD A;  2RP4 A;  4PK4 A;  4AQG A;  4QHO A;  3T1Y T;  4X62 T;  3RQU A;  4ZI7 E;  5LMN T;  4B3T T;  4IE6 A;  4HFH A;  2KXP B;  3OJA A;  5GON E;  3UUN A;  5CJ5 A;  5LJM A;  2E9X C;  2EHO B;  4K0K T;  4FJO A;  2X0C A;  3LK3 B;  1D1B A;  2EHO C;  5LB7 B;  3C51 A;  4GK0 E;  4GK5 E;  4ILA A;  1UGO A;  3AE5 A;  3CX6 B;  3KBT A;  1Z0P A;  2V1D B;  2VB6 A;  4QX7 B;  1VRB A;  4X20 E;  1OED C;  4H9R C;  1B7T A;  4G2A A;  4N78 D;  4DBR A;  5KMG P;  1N36 T;  1MND A;  2HPL A;  3L8R A;  3NVO A;  3WUR A;  1ZP0 A;  5AQG B;  2Y6X A;  4UV9 B;  4DR2 T;  3UU3 A;  2L3L A;  2AXD S;  2EHO D;  2XQ9 A;  4GOU A;  3RQW A;  1JNR A;  3FZH B;  3UUM A;  4BGO A;  3RHW A;  1N32 T;  3GWH A;  1KEY A;  5ABG A;  5AQH B;  3RYF E;  3UU6 A;  3P4Q A;  2KVP A;  1J1J A;  2YU2 A;  5JDQ A;  1MIW A;  3HKE E;  4QXC B;  3RKG A;  3N9Q A;  3UU8 A;  5JDG A;  5JTG A;  2B76 A;  2WS3 A;  4I4T E;  4P0A A;  5M4Y A;  5J2T E;  5FL1 A;  3T1H T;  3C4X A;  4EOZ B;  3EI0 A;  1IAP A;  3E08 A;  4H63 H;  4UVA B;  3TLW A;  3MA9 A;  3EDU A;  2MYS A;  3RC3 A;  1IJ6 A;  2E9X D;  2I6H A;  4B3M T;  4LF9 T;  5L3E B;  5JRC A;  2BG9 A;  1HFA A;  3DTO A;  4X1Y E;  2WDV A;  4ZS2 A;  1FMV A;  2Q9Q B;  3HKD E;  2LLY A;  2XQY A;  1SUM B;  3I0Q A;  3MJX A;  2WDR A;  4HFB A;  1VOM A;  4UV8 B;  5J2U E;  4JI1 T;  2LKH A;  3UUX B;  1W0B A;  3OPC A;  4IE5 A;  4EYY R;  1IBL T;  1BR0 A;  4OFZ A;  1YD8 G;  2DWK A;  2LKG A;  4O4L E;  3SFD A;  4ZHQ E;  1LVF A;  4ZZB A;  2XAG B;  3UT5 E;  2BG9 B;  1MMA A;  3PUS A;  4O4I E;  3VKG A;  3AVS A;  3O1I A;  3RX6 A;  3FBL A;  1I94 T;  4BJM A;  4YTP A;  4LFA T;  3OYX A;  1FMW A;  3QB5 K;  4UXN B;  5HXE A;  2CWO A;  1X79 A;  3IHR A;  3KV9 A;  2YDS A;  3AEG A;  1KFY A;  4H9O C;  4WNK A;  3PUR A;  3C4W A;  1LKX A;  1D1A A;  3PHF 1;  2JPF A;  1XNQ T;  4NXM T;  2CM0 A;  4TWF A;  2NWB A;  4HFV A; 
#chains in the Genus database with same CATH homology
 4O8S A;  4DMV A;  2MTQ A;  1HF8 A;  4IGU A;  2H7V C;  3AAE B;  3NRY A;  2GK9 A;  4ZI2 C;  3BQL A;  4EAH A;  2X68 A;  3NRX A;  2V7M A;  3RH3 A;  2ES0 A;  3N9L A;  2LSG A;  3N5L A;  5L3C B;  4PJL A;  2NP9 A;  4WBN E;  1SHZ C;  1E1H B;  1US7 B;  4DBR A;  4AQF C;  4ZI7 E;  3M65 A;  4YLH A;  2MTC A;  4QXB B;  3F57 A;  1ZHC A;  2V7I A;  5F8P A;  2CXF A;  4IE7 A;  3ZN0 B;  3K3Q C;  4JEH B;  2V7J A;  4GYR A;  5TAO A;  1AJ3 A;  3AA7 B;  3DP7 A;  2CMR A;  3RPU A;  3NBX X;  2BVL A;  3KV5 A;  3LK2 B;  3O4X E;  1V9D A;  3K8P C;  4UIG A;  3ZMS B;  5LG4 A;  2NW8 A;  4AKH A;  2BVM A;  2DLR A;  5AFU L;  5LP6 E;  2OA5 A;  4HGA A;  5JDH A;  1MMD A;  2X9Y A;  1OXZ A;  3E22 E;  3AA6 B;  5DJQ C;  5LA6 E;  1NAF A;  4DND A;  1S94 A;  4PK5 A;  2JMH A;  2C5I T;  2LHR A;  3ZLI A;  2CXL A;  2KND A;  4KBM B;  3LK4 2;  4O4J E;  3UUL A;  5HXS A;  2KIN B;  4IHJ E;  3ZC1 A;  4L0R A;  2E9X B;  4G63 A;  4EZ4 A;  3MK7 C;  3SWH A;  5JDN A;  5LGT B;  3PHF 1;  3N9P A;  3LFM A;  4QWN B;  4XAX B;  2X0L B;  2KLQ A;  4AXP A;  4AKG A;  2J1D G;  2WMO A;  1MNE A;  4DVD A;  5JRE A;  1IZN B;  2CWY A;  4ZI3 C;  4MBQ A;  4AI6 A;  4XZC A;  4H9N C;  2E9X A;  1WYC A;  1G8X A;  4PNI A;  2H3R A;  5BMV E;  2IC9 A;  4IDZ A;  5EZY E;  3ZEF B;  2Q9Q A;  2LE8 A;  5KX5 E;  1D0Y A;  4BJN A;  4L5G A;  4TN7 B;  3N2K E;  5IYZ E;  4ONR A;  4IE0 A;  2PJQ A;  3AAA B;  3PUA A;  2MBG A;  2W0G A;  4NUU A;  2P9B A;  3GN5 B;  4EIW A;  3QK6 A;  3KV6 A;  1HG2 A;  4ZI2 D;  3KIN B;  3AVR A;  3S4U A;  2XAS B;  2JJ9 A;  2LSJ A;  1WLX A;  2Q9Q C;  3K3N A;  3ZYL A;  3PDY A;  3P7I A;  3ZN1 B;  1ZKE A;  4K0U A;  3MXZ A;  3KFW X;  4PFO A;  3OKQ A;  3L3P A;  1Y64 B;  2A72 A;  3OYZ A;  3LJC A;  2K48 A;  4TZ4 C;  1ZEE A;  3PU3 A;  2N9D A;  4PFP A;  2C5K T;  4J2C A;  4V1A v;  2LM9 A;  4H9Q C;  5LXT E;  2L8K A;  4OHF A;  5LGN B;  1BR4 A;  1NWM X;  2WAU A;  4YJ3 E;  4XBF B;  1HS7 A;  3O9X A;  3VHL A;  3ETU A;  3L09 A;  4ERR A;  3HL6 A;  3IEE A;  2D5U A;  1UX4 A;  4QKN A;  3CX8 B;  1UX5 A;  4E7S A;  4F6R C;  2VL8 A;  4OYK A;  4P09 A;  4UVB B;  3VKH A;  4I50 E;  3ZYK A;  4A56 A;  2NW9 A;  3VU7 H;  3QC9 A;  4TUY E;  3ZCI A;  2VK9 A;  2D0U A;  3EVY A;  3IBP A;  5L3B B;  5DQV A;  2LEH A;  3SS1 A;  5LNK A;  3WAJ A;  4HE8 A;  3FBZ A;  3A5X A;  2D2S A;  2KT9 A;  5JDL A;  2KMF A;  1QSD A;  2KWI B;  5HWX A;  4MHC A;  1YW0 A;  2BDE A;  2NW7 A;  5L3F B;  2X9X A;  4ZI3 D;  5LGU B;  1BR2 A;  4O2A E;  3RYI E;  3HR0 A;  2XAQ B;  1O3X A;  3WAK A;  1LVK A;  2PFV A;  2NTY A;  2LJL A;  1KNZ A;  1HCI A;  4IST A;  2NTX A;  3KBU A;  1BR1 A;  3K3O A;  2EHO A;  4JUY A;  1G73 A;  4L9I A;  4TV9 E;  4U74 A;  3V5U A;  2ZM0 A;  3WI3 A;  3ZMV B;  4QXH B;  4TV8 E;  3C64 A;  3B13 A;  4GYS A;  4O2B E;  3HI2 A;  4KMC A;  4YHJ A;  2MOZ A;  4O4H E;  3U3I A;  2CLY B;  2Y48 B;  4ADZ A;  2M67 A;  3AA1 B;  4CQI A;  2IC6 A;  2VKJ A;  2CLY C;  4CI3 B;  5F3J A;  4ZOL E;  2WM9 A;  2X66 A;  2Q9Q D;  2W62 A;  2Y8D A;  1QUU A;  3PUQ A;  3CWZ B;  5IHY A;  4EB6 E;  2IAK A;  5EK2 A;  1LRZ A;  3GA8 A;  3CQC B;  2ODU A;  4EYU A;  1MIY A;  4H9P C;  2JMK A;  3E0Z A;  4BAY B;  3AT7 A;  2YEV C;  2CA5 A;  3KV4 A;  3N2G E;  3SRZ A;  5CA1 E;  3CKD A;  2JQQ A;  3KVA A;  4PAG A;  3LBX B;  3UFE A;  5JQG E;  4X1I E;  3V5S A;  2DNX A;  3O1H A;  4CI2 B;  3DJB A;  2DHR A;  5JRC B;  1HTJ F;  2K5B B;  2LT3 A;  3O1J A;  3RYC E;  1D0X A;  4YJ2 E;  4CXY A;  3AB3 B;  3I9W A;  2XAH B;  4OK0 A;  3CQX C;  4KP3 C;  5JR9 B;  1WYB A;  5LHI B;  3N9O A;  1D1C A;  2KWH A;  2LOS A;  3I0O A;  2CCQ A;  1MMN A;  3KVB A;  2XHE B;  3CML A;  4B6X A;  5HXH A;  5L2L A;  2V26 A;  1FIO A;  4ILU A;  3QUJ A;  3JC6 D;  3Q2M A;  2VKH A;  3ONX A;  2H7O A;  5DQW A;  2LSK A;  2V7K A;  5CA0 E;  5EK3 A;  1HG5 A;  2YK0 A;  3NZP A;  1EZ3 A;  2X9H A;  2N2N A;  4AQF A;  5FMN A;  4EXT A;  4AKL A;  4CXX A;  3MZK B;  5JR9 A;  4ANJ A;  4P0B A;  5HYA A;  3AAI A;  4UEM A;  3H3A A;  3R6N A;  1CUN A;  3PTR B;  2V7L A;  3Q5W A;  4NUV A;  4H63 V;  3P8C D;  3RKO A;  2ACX A;  2HPJ A;  3HKC E;  5FYM A;  2VKD A;  4WW0 A;  2X9W A;  3C50 A;  5HAX A;  4U72 A;  2VKO A;  2B1E A;  3SOL A;  3M1C A;  5JVD E;  1WR6 A;  5JR9 C;  2CE7 A;  3ANW B;  4WBO A;  2WBL A;  5ETW A;  5FXX A;  5LBQ B;  1S35 A;  5FY0 A;  5HXR A;  1YKE B;  3ZMZ B;  2I59 A;  3NZQ A;  4DBQ A;  3GN5 A;  2G0U A;  4AKI A;  5ADX L;  3R84 B;  1T98 A;  5H6R B;  5FNV E;  2LSY A;  2YIN A;  2IW5 B;  2C5J A;  1D0Z A;  2NOX A;  2XAF B;  1YKH B;  4HKA A;  4UVC B;  3PF0 A;  3J9X 1;  2JRK A;  4TX5 A;  3N2O A;  5LBM A;  1U4Q A;  4QX8 B;  2D0T A;  1MMG A;  4M1P A;  2K9A A;  3UTK A;  3C4Z A;  2QGS A;  4MFR A;  4UF0 A;  4FI5 A;  4HTE A;  4PJJ A;  5HXC A;  3MAC A;  5DAB A;  2ODV A;  5CB4 E;  3JC6 C;  5LYJ E;  3FXD B;  4H9S E;  5E0O A;  5A1L A;  2X67 A;  5FY1 A;  2ZLY A;  5FXV A;  3Q5X A;  4JLE A;  3PU8 A;  5J1G A;  5JH7 E;  1H7C A;  2CXD A;  2W63 A;  2A2F X;  4I43 B;  2W61 A;  4ZS3 A;  3TKL B;  3WSC A;  4ECG A;  3ZC0 A;  4MLK A;  5LJN A;  4X1K E;  5L3G B;  3J7Y q;  4I55 E;  2X51 A;  2SPC A;  4Z8X A;  2E8I A;  2Z6E A;  3ANW A;  4OYJ A;  2LHN A;  4CZZ B;  4AKR B;  4EZH A;  3FB2 A;  4IIJ E;  3RRC A;  3MKD A;  2A3D A;  3CVR A;  4KUM B;  3AA0 B;  3RYH E;  4BA9 A;  2K24 A;  3N9N A;  3ZMU B;  4DO0 A;  5C8Y E;  3LBX A;  5KDM C;  2CEA A;  2LSI A;  3IF8 B;  3GMI A;  2DCF A;  2LOP A;  3N9M A;  1IJ5 A;  2W00 A;  3ESL A;  2UXN B;  4YFS A;  5H6Q B;  3ZMT B;  5L3D B;  3ZJ1 A;  4UEL A;  3FXE B;  3T8O A;  5FY7 A;  3VJZ A;  2VAS A;  2DWG A;  4ASK A;  5EK4 A;  3C98 B;  2WWU A;  3F31 A;  4HEA A;  4PJN A;  3EDV A;  4C90 A;  2UXX B;  4E7Z A;  3ETV A;  2ZM8 A;  2RA1 A;  3H37 A;  3BQK A;  3ZPO A;  4CI1 B;  1SA0 E;  2HH7 A;  3HKB E;  3B57 A;  3W15 B;  2N1G A;  5JDM A;  5T1D A;  4GIW A;  3OBV E;  2BZB A;  5FXW A;  4PK6 A;  4JEU B;  3I1A A;  1U5P A;  3CPZ A;  5LCY A;  3FHN A;  1MIV A;  3BK9 A;  4PW8 A;  4PJM A;  3Q9D A;  2XUE A;  4CXW A;  3F2E A;  1OWA A;  2WSS V;  3D0T A;  2QA7 A;  2YU1 A;  2XAJ B;  3I9Y A;  3U78 A;  1ZV4 X;  4ISS A;  1HX8 A;  3RRW A;  4IE4 A;  1KK7 A;  4C91 A;  3CX7 B;  3KDS E;  5HWY A;  3EUH A;  2C0S A;  5LOV E;  1UCU A;  2VWA A;  3CQG B;  2WMN A;  2XTL A;  3PE0 A;  4MAL A;  3LG7 A;  5LHG B;  2PG8 A;  3ZCJ A;  4HN9 A;  5FXZ A;  2DI4 A;  2L9Q A;  3PUG A;  5LHH B;  5FP3 A;  5JDF A;  3HA4 A;  3RC8 A;  2PBI A;  1FEW A;  4UF0 B;  4DMW A;  2ZMA A;  3ZYM A;  3ZJ2 A;  2ZM2 A;  3BQI A;  2KZ7 B;  1WRD A;  2RP4 A;  4PK4 A;  4AQG A;  4QHO A;  4IE6 A;  5GON E;  2KXP B;  3OJA A;  3UUN A;  5LJM A;  2LQU A;  2E9X C;  2EHO B;  4FJO A;  3LK3 B;  1D1B A;  2EHO C;  3C51 A;  4GK0 E;  4GK5 E;  3CX6 B;  4X20 E;  3KBT A;  1Z0P A;  2V1D B;  2VB6 A;  4QX7 B;  1VRB A;  5KMG P;  4H9R C;  4N78 D;  1B7T A;  4G2A A;  1MND A;  2HPL A;  3WUR A;  2Y6X A;  4UV9 B;  2L3L A;  2EHO D;  4GOU A;  3UUM A;  4BGO A;  3GWH A;  3RYF E;  2YU2 A;  5JDQ A;  1MIW A;  3HKE E;  4QXC B;  4P0A A;  3N9Q A;  5JDG A;  4I4T E;  5M4Y A;  5J2T E;  3C4X A;  4EOZ B;  1IAP A;  3E08 A;  4H63 H;  4UVA B;  3MA9 A;  3EDU A;  2MYS A;  3RC3 A;  1IJ6 A;  2E9X D;  5JRC A;  5L3E B;  1HFA A;  3DTO A;  4X1Y E;  4ZS2 A;  1FMV A;  2Q9Q B;  3HKD E;  2XQY A;  3I0Q A;  3MJX A;  4UV8 B;  5J2U E;  1VOM A;  3UUX B;  4IE5 A;  4EYY R;  1BR0 A;  4OFZ A;  1YD8 G;  2DWK A;  4O4L E;  4ZHQ E;  1LVF A;  2XAG B;  3UT5 E;  1MMA A;  3PUS A;  4O4I E;  3VKG A;  3AVS A;  3O1I A;  3RX6 A;  3FBL A;  4BJM A;  3OYX A;  1FMW A;  4UXN B;  5HXE A;  2CWO A;  1X79 A;  3IHR A;  3KV9 A;  4WNK A;  4H9O C;  3PUR A;  3C4W A;  1LKX A;  1D1A A;  2JPF A;  2CM0 A;  2NWB A;  4HFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...