5JDQA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 100 mm na+ and 10mm sr2+
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
Knots found
sequence length
301
structure length
296
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIENNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
molecule keywords Uncharacterized membrane protein MJ0091
total genus 127
structure length 296
sequence length 301
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdqA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdqA02
5JDHA 5HXHA 3V5SA 5HYAA 5JDGA 5HXSA 5HXEA 5JDLA 5HXRA 5JDFA 5JDNA 5JDMA 3V5UA 5HWXA 5HWYA 5HXCA 5JDQA
chains in the Genus database with same CATH superfamily
2MBGA 2ZM8A 1OEDE 2LSIA 2L7NA 1J1JA 2XSAA 5EZYE 3M3ZB 1HNWT 1MMAA 4JI7T 2CLYC 2H3RA 2VKOA 3AAAB 3JC6C 2SPCA 3OVUA 3HA4A 4WBOA 4EAHA 3Q9DA 2X0CA 3B13A 4CI3B 5BR8T 4TWHA 4DIDB 2Q9QC 2B1EA 3N9LA 2JQKA 4H63H 5CA0E 1U5PA 2E2AA 1BR2A 1LVFA 2CPTA 2WCAA 4TV8E 2WMOA 5H6RB 2XY8B 1T8BA 3RX6A 2C5IT 2UUBT 2OV9A 4I0UA 4TWDA 2IAKA 2XQ9A 4I55E 5JVDE 3T1YT 4HFHA 2WQYA 4IHJE 4Z91A 3UULA 1XNRT 3VU7H 3FBZA 1HX8A 3QC9A 2XHEB 2W61A 3T8OA 2VVSA 3P4SA 4LF4T 4OX9T 3AY5A 4E7SA 5HXSA 4O8SA 1UGOA 3HR0A 3LBXB 1LKXA 2DHRA 2XAHB 4PFPA 3GA8A 2W63A 4LF8T 4HFEA 2XQYA 3WI3A 1N33T 2XQAA 1US7B 1HFAA 1IJ6A 3CX7B 3EDVA 3EI0A 3NBXX 3UQ4A 2UXCT 5TAOA 3UTKA 4IDOA 2XQ4A 4MBQA 4QXHB 5AQJB 1OEDB 1HTJF 2DLRA 3K3OA 3NRXA 3L39A 3S4UA 5CA1E 5IWAT 3JADA 3OYZA 2VKHA 3MZKB 4BJMA 4DR5T 5EK3A 1XNQT 3C50A 4DR7T 4PJLA 3CK6A 1YXRA 2FBWA 4H9SE 4ILCA 4NIQA 3PUVF 2L8KA 5LXTE 5DABA 4DR2T 2KVPA 4KHZF 2L3LA 4U7YA 4X1YE 3WSCA 4X62T 1D0YA 4IIJE 2VWAA 2WU5A 2Q9QD 2NTXA 4H9NC 3KINB 2YU2A 3RIAA 2JJ9A 2FUPA 4HTEA 3RRWA 1YKEB 2K24A 4UXNB 3T1HT 2LOSA 5LMUT 3RQUA 4PFOA 4K0KT 4TNWA 4DV1T 3GWHA 1OEDA 2WP9A 3CPZA 3FBLA 4G63A 4EEDA 5J2TE 2EHOB 2KBBA 1KNRA 1LVKA 2P9BA 2V6YA 3ETVA 5EK2A 5JQGE 4CXYA 3H3MA 4U2ZA 2V7JA 3ZCJA 2IW5B 2UXXB 3CQGB 2W67A 3MA9A 5ADXL 3PF0A 4GKJT 2FJBA 2XAJB 5LGNB 2WU2A 1NWMX 1UCUA 1MMGA 3AAIA 3C4ZA 4OK0A 3PURA 3QUJA 4K0UA 5HWXA 2N2NA 3CIRA 2X67A 3CVRA 4GIWA 4GKKT 3EHZA 4U72A 4JI2T 3EABA 5LYJE 5HXEA 2ZM6T 3I9WA 4B3TT 3O4XE 1QLBA 2V7MA 2H88A 5JR9C 5L4EA 3AA7B 2VL8A 2EHOD 3AEEA 1O3XA 3LFMA 3IBPA 3Q5XA 4WNKA 2H7OA 5FVLA 4PK6A 1XMQT 2V7KA 2X9HA 1J5WA 2LKHA 5FNVE 4DVDA 4XBFB 3ESLA 4WW0A 3ZSTA 3LK3B 4TUYE 3PV0F 4IDNA 1YQ4A 4L0RA 5F5WA 4EXTA 2WB5A 4A56A 2BKOA 1OWAA 3VKHA 2XTLA 4P0AA 2JPFA 2LJLA 5FP3A 3RQWA 4ONRA 4EYUA 2YU1A 4NUVA 3AA1B 3RIFA 4BAYB 2E8IA 4EEBA 3DP7A 4ECGA 4X5TA 5DJQC 5FVKA 1M62A 4DUYT 3U3IA 4HWDA 2A9UA 1D1CA 4NUUA 4AQYT 2LHNA 2ZM2A 1XDOA 2DI4A 4ZZBA 2ZLYA 3ETUA 5HEGA 1YD8G 4IE7A 2VK9A 4DMVA 1YW0A 3SS1A 3ZC0A 1N32T 3GN5A 2RP4A 5CFBA 4DV0T 2X0LB 2BS4A 1SUMB 2WAUA 2X68A 2ZM0A 1YQ3A 3P7IA 1HX1B 3AVSA 2HPJA 4U33A 5FKYA 2MPKA 5HCJA 5C2TA 4WZXA 4NPPA 5FXWA 3MK7C 4YHHT 3QK6A 2D5UA 2ZMAA 5GONE 1BR1A 4I4TE 5AQIB 4O2AE 2E9XC 2HN2A 4FI5A 3N9QA 3RKGA 5JR9B 2BG9E 2OLTA 2PFVA 4ZI3C 4U3CA 4Q25A 4EB6E 4NXMT 4DBQA 3EAMA 4O4JE 3NWIA 4KUMB 3VHLA 3RYFE 4LMLA 5FXZA 2QYWA 3PJAA 5AQRB 5A1LA 5M4YA 4YY3T 2WMNA 3AE2A 4IE5A 4MHCA 1D0ZA 3OBVE 3RF1A 4HE8A 4AKRB 5F3JA 1XMOT 3VR8A 2XQ5A 3E08A 3RC8A 2EHOA 2XAFB 4JI0T 1QUUA 5AQHB 3KV9A 2V7LA 4XAXB 5CJ5A 2J1DG 4P09A 2X9YA 3L09A 2K3WA 5CB4E 4YTMA 2D0TA 3KVBA 3R6NA 4CXXA 5T1DA 2WBLA 2MTQA 2WS3A 5AQSB 4ERRA 2EHOC 2CXDA 1N36T 5DQWA 2A3DA 3EVYA 1HF8A 4H9PC 1IAPA 4TN7B 5JDMA 4JI4T 3UT5E 1HS7A 3CMLA 5L47A 3NVOA 4HFCA 3KV4A 2VQET 3AE1A 2V1DB 2CA5A 3PE0A 4X20E 4UF0A 1Y64B 5LP6E 3GN5B 3P50A 4LF9T 3PUYF 4CQIA 4AXPA 2IMLA 5JDGA 5KMGP 2X9XA 3ZT7A 3PTRB 5JH7E 1MIVA 3VRBA 4W8PA 2CMRA 1XDPA 3AEDA 2K48A 2XQ3A 4DV4T 5C8YE 4LFCT 4IDPA 4A98A 3HKEE 1WR6A 2LSGA 1MIYA 4UVAB 4H63V 3QOFA 3P4WA 5HEJA 1NEKA 3PJAJ 3RGLA 3FB2A 2CHNA 5ETWA 3TLWA 4AISA 4LFBT 2E9XA 2YDSA 4QHOA 3ZN0B 1HCIA 4M1PA 4COFA 4BJNA 3N9PA 5FY1A 5KXJA 2MAWA 3AE8A 3FZLB 2I6HA 1W9RA 2W62A 5HXCA 1HNXT 3ZT6A 1NAFA 3IF8B 4U74A 4QH1A 4PJJA 3FZHB 2C5JA 2QVAA 2Z6EA 3PUSA 5AQVB 4DBRA 3WAJA 4HWIB 3TLTA 2IDOB 1WRDA 2KZ7B 5L3DB 1SE7A 3RYHE 3C4XA 3AE9A 4H9RC 3I0QA 5FL1A 2WZIA 2X66A 3V5UA 5L3EB 4DNDA 4YJ3E 4JLEA 3AE5A 3LK2B 2J62A 2Q9QB 1CHUA 3H37A 4DR1T 2XQ8A 3EDUA 1IBMT 1DU2A 3DYJA 2YDRA 2RPAA 3QNUA 4AKLA 4TWFA 3ZMVB 4YXDA 4IL4A 3MKDA 4DUZT 3AVRA 2E5LT 2VASA 3ZEFB 2FJEA 5FY0A 4PJNA 2KMFA 2MYSA 3N9MA 4ZEYA 4JEUB 5LBMA 2BBHA 4EOZB 3K1SA 4ANJA 3ANWA 5J0ZA 2WY2A 4JI6T 3VR9A 2XQ6A 2V6YB 3ABVA 4KP3C 2ES0A 3N5LA 2LHRA 3KBTA 2YK0A 2XPKA 4O4LE 2CRBA 4PAGA 5J1GA 4LF7T 1I6ZA 2WM9A 2Y8DA 3UFGA 3J7Yq 2WZHA 3O1JA 2CE7A 4N78D 3AE4A 4U31A 4IDZA 3TLSA 3CKDA 4ASKA 3LDQB 1KF6A 2LRLA 4ZI7E 4CI1B 1B7TA 2YINA 4ZZCA 4AKIA 4JEHB 3JC6D 4ILUA 5AQGB 5AQUB 3UUBA 3JCFA 1MNDA 3E22E 4X1IE 4AQFA 4QX8B 2CXLA 3RH3A 3V5SA 3F31A 4I50E 3ZYMA 2VKDA 2XM2A 1KNZA 2ODUA 4ZS3A 4MLKA 4DO0A 3O1IA 2IUBA 3PUQA 4DV5T 1ZP0A 2W4XA 2DWKA 2YEVC 3KDSE 1E2AA 2E9XD 2OA5A 2X9WA 4HFIA 4HGAA 4KBMB 2L10A 4DV3T 4CI2B 3KVAA 4ZI2C 3RPUA 3AECA 3UFEA 3RHWA 3UUMA 1HNZT 4O4HE 1T98A 3PUGA 5LHIB 2CXFA 3BQIA 3WAKA 4IDQA 2LOPA 3RYCE 4JUYA 4OYJA 3ZJ2A 4HN9A 4QXBB 3ZYKA 5CGMA 1U4QA 4IL9A 4AQFC 5KDMC 2LSYA 1UURA 2XAQB 5LBQB 5JRCB 4AKHA 1S94A 3E0ZA 2QGSA 2XM1A 5AQPB 3Q2MA 4O4IE 2UXBT 3IA3A 3P4QA 2MOZA 5IYZE 5LHGB 1FJGT 2WDQA 3SOLA 4IE4A 2DCFA 1D1AA 4I43B 2ACXA 1XZYA 4X64T 4ISSA 1ZEEA 5JDHA 2NW7A 2LLYA 3OTOT 3EUHA 3AAEB 3C51A 4CN4A 3FYQA 2K5BB 1L0VA 3AXJA 4GOUA 3UU3A 4PK4A 3AEGA 1E7PA 4DV6T 2H89A 3FZKB 3SFEA 3ZN1B 3UU5A 2CBIA 4F8HA 1V9DA 5LJMA 3ZSSA 4YSZA 1J5ET 1G8XA 4HWHA 1W09A 2K9AA 3K8PC 4U2YA 2W2UA 2BBJA 3QB5A 3P4PA 2M6BA 4IT4A 4UIGA 2BS3A 1FIOA 5HWYA 3B57A 3CWZB 4Z8XA 2JQQA 4P0BA 3L8RA 5JTGA 2RA1A 3UU6A 3CX6B 3B5MA 3UU8A 2B76A 2XUEA 3AE6A 1UX4A 3MACA 4P1NA 5HEOA 1KEYA 3NZPA 4YFSA 4LF5T 1KK7A 5L3GB 1ZOYA 2HH7A 4ILBA 1SJ8A 1QSDA 2NP9A 4GK5E 1UK5A 1Z8UA 4TZ4C 5L4HA 4JI5T 3UU4A 2FJAA 4DV2T 4B3RT 1WYBA 2BS2A 3AE3A 3BK9A 4QH4A 1G73A 1CUNA 2VVNA 1Z0PA 3C64A 3ONXA 4YJ2E 4UVCB 2E9XB 1MMDA 2BG9A 3LK42 1ZHCA 2R6GF 5HAXA 5JDLA 2FJDA 3AA0B 1GQEA 2GK9A 4XZCA 4E7ZA 4TNVA 3ZJ1A 2WSSV 3N9OA 1KNPA 3I9YA 4UEMA 4CN6A 3F57A 2QRXA 3FHNA 3H3AA 1FMVA 2BG9C 1EZ3A 4LMKA 1I94T 2LM9A 5FXXA 5LJNA 2JQHA 4EV6A 2CCQA 3RKOA 2BDEA 4YHJA 1SJ7A 3KV5A 4C90A 4LFAT 3VJZA 5HEHA 2F4VT 2IC6A 3BQLA 4X66T 3DJBA 3CQCB 2JMKA 1UX5A 2AE9A 3K3QC 3PUXF 3LG7A 5AQFB 3QB5K 2D2SA 5AQQB 3RLFF 2PJQA 3X1DA 5L3FB 4J2CA 4EZHA 3AE7A 3DTOA 3N2OA 5AQTB 1UUSA 3FXEB 5LG3A 3OPCA 3RC3A 3LSVA 5ABFA 4WBNE 1WFDA 3TLUA 2HPLA 3ONLC 1X79A 4AIUA 2M67A 3FXDB 1N34T 1KFYA 5AQKB 2JQ9A 3RIUC 3ZLIA 1WYCA 1AJ3A 1WCRA 2LQUA 5JREA 2G0UA 2VB6A 2LT3A 3AEBA 3ANWB 3IEEA 4H9OC 5FYMA 4CXWA 1D0XA 3IHRA 4YSXA 3O9XA 4B3MT 4MALA 3TLVA 2YOEA 4GYSA 3ZMTB 4BGOA 4LF6T 5C3JA 1OXZA 1JNRA 2LSJA 3CX8B 2D0UA 3HKDE 3Q5DA 4KX6A 4QXCB 1YKHB 2KWHA 3M1CA 2I0MA 2LM2A 2C0SA 2XASB 2CM0A 5FXVA 5LOVE 3VRAA 3UUNA 3JAFA 4UELA 1IBKT 2UXDT 2V7IA 3A8YC 3J9X1 4HFBA 4EGWA 4B6XA 4YTPA 2LE8A 2CEAA 3OKQA 2KLQA 2DL1A 2W0GA 3AB3B 3BQKA 3SRZA 4EIWA 3P8CD 5IUXA 1D1BA 4AKGA 1WR0A 2XZEA 2ACZA 2V26A 5JDNA 3AA6B 4OFZA 4HWFA 2HHHT 4YSYA 5L3BB 1VCTA 4PK5A 2VURA 4H9QC 4IE0A 1WLXA 4UR9A 2X0YA 4ZS2A 5HCMA 4YTNA 5LA6E 5HXHA 1Y01A 4V1Av 2DNXA 1HG5A 4UF0B 2W66A 2JRKA 2NOXA 2KGXA 5LHHB 5JRCA 2VQFT 4HFDA 1ZKEA 4UVBB 4DV7T 3Q5WA 4PJMA 1W0BA 5ABGA 5H6QB 2KWIB 3K3NA 2KT9A 3JAEA 4ZOLE 3AEAA 4BA9A 3TKLB 4B3ST 1VOMA 3I0OA 3A7MA 3CQXC 3ZPOA 4JYAT 1IJ5A 3OYXA 4DR6T 3D0TA 2N1GA 3PUAA 2NW9A 4YT0A 1IBLT 1FEWA 1LRZA 2L9QA 4DMWA 5E0OA 1H7CA 3HI2A 5FMNA 2I59A 2BG9B 1IZNB 3PDYA 4Z90A 2XQ7A 4YLHA 2BZBA 2Y48B 3ONJA 2KSRA 4ILAA 4LMJA 5JDFA 3ZC1A 5F8PA 5ABFB 5FZTA 5DQVA 1E1HB 3MXZA 5FY7A 3UUXB 3ZMSB 5L3CB 4GYRA 2NWBA 1MMNA 2Q9QA 5AFUL 4JI8T 4UV9B 3AXJB 2C5KT 4TV9E 1OEDC 5AQOB 1SHZC 3HL6A 3RI5A 2VKJA 5ABEA 4JI1T 1X9BA 1MNEA 2V5CA 1MIWA 3RIUA 1M7KA 2ODVA 2CHOA 2V8SV 2NW8A 3AEFA 4IE6A 4OYKA 3F2EA 3RRCA 3ZCIA 3ZKRA 4QWNB 5LG4A 2V5DA 2WDVA 2V6XA 5JDQA 3AT7A 3WURA 3W15B 4HFVA 2KNDA 4JV5T 2UXNB 5HYAA 2CWYA 2IC9A 3RYIE 5LGUB 3Q5EA 2AXDS 3C98B 3KBUA 1SA0E 2LRKA 2QA7A 3N9NA 3P4RA 1NENA 3GMIA 3PU3A 2NR4A 3PUZF 4OHFA 3UQ7A 5LMNT 2W00A 3G06A 5LCYA 3ZYLA 1R8IA 2PG8A 4DR3T 1W0AA 1BR4A 2A72A 3NRYA 4L5GA 2H7VC 2WWVA 4AQGA 4CZZB 2LSKA 4A5XA 3KFWX 3HKCE 1JNZA 1FMWA 1S35A 3N2GE 4ZI3D 1HR0T 4KMCA 5L2LA 5EK4A 4NXNT 2CLYB 4KI0F 4ZHQE 2JMHA 5BMVE 4ZI2D 4A97A 3HKBE 4O2BE 3SWHA 2BVLA 2KXPB 2IHR1 2N9DA 3ZMUB 4FJOA 3N2KE 4MFRA 4GK0E 2DWGA 3C4WA 4IGUA 5AQNB 2XJ7A 5HEUA 2UUAT 2HN1A 4QKNA 4HKAA 5AQMB 3R84B 4CN1A 4EZ4A 5HXRA 4EYYR 4ZXLA 3L3PA 3FZFB 2JIWA 3PU8A 2M6IA 4ADZA 5J2UE 4WYVA 1T7SA 2BKNA 5JR9A 2MTCA 5ABHA 2WWUA 2LEHA 3MJXA 4TX5A 1BR0A 3PHF1 5LNKA 2VL0A 2UU9T 2KINB 2YDQA 4JBWF 3KV6A 2NTYA 3FZMB 4HEAA 3SFDA 3I1AA 3M65A 5LB7B 2CBJA 2Y6XA 4IREA 2CWOA 3OJAA 4HWCA 5FL0A 3VKGA 4QX7B 2J47A 4DR4T 1VRBA 3ZMZB 2A2FX 4PNIA 3LBXA 4QH5A 2XSBA 2WDRA 1VCSA 2YKSA 4G2AA 4ISTA 1T72A 2PBIA 2UUCT 4L9IA 2X0HA 1XWMA 5AQLB 4JI3T 4X1KE 2LKGA 3LJCA 2E5VA 2BVMA 3A5XA 4PW8A 4C91A 4F6RC 5KX5E 4U7IA 3NKZA 2XAGB 1ZV4X 2YN6A 3O1HA 4AI6A 4X65T 3PUWF 2BKPA 2D9DA 1HG2A 2X51A 5IHYA 3U78A 3NZQA 4KHPT 2PTFA 2J4GA 4F7GB 2IIUA 4UV8B 5LGTB 3ZT5A
chains in the Genus database with same CATH topology
2ZM8A 2LSIA 5EZYE 1MMAA 2CLYC 2H3RA 2VKOA 3AAAB 3JC6C 2SPCA 4WBOA 3HA4A 4EAHA 3Q9DA 3B13A 4CI3B 5CA0E 2Q9QC 2B1EA 3N9LA 4H63H 1U5PA 2MBGA 1BR2A 1LVFA 5H6RB 4TV8E 2WMOA 3RX6A 2C5IT 2IAKA 4I55E 5JVDE 4IHJE 3UULA 3VU7H 3FBZA 1HX8A 3QC9A 2XHEB 2W61A 3T8OA 4E7SA 5HXSA 4O8SA 3HR0A 3LBXB 1LKXA 2DHRA 2XAHB 4PFPA 3GA8A 2W63A 3WI3A 2XQYA 3EDVA 1US7B 1HFAA 1IJ6A 3CX7B 3NBXX 5TAOA 3UTKA 4MBQA 4QXHB 1HTJF 2DLRA 3K3OA 3NRXA 3S4UA 5CA1E 3OYZA 2VKHA 3MZKB 4BJMA 5EK3A 3C50A 4PJLA 4H9SE 2L8KA 5LXTE 5DABA 4X1YE 2L3LA 3WSCA 1D0YA 4IIJE 2VWAA 2Q9QD 2NTXA 4H9NC 3KINB 2YU2A 2JJ9A 4HTEA 3RRWA 1YKEB 2K24A 4UXNB 2LOSA 4PFOA 3GWHA 3CPZA 3FBLA 4G63A 2EHOB 1LVKA 2P9BA 5EK2A 3ETVA 5JQGE 4CXYA 2V7JA 3ZCJA 2IW5B 2UXXB 3CQGB 5ADXL 3PF0A 2XAJB 5LGNB 1NWMX 1UCUA 1MMGA 3AAIA 3C4ZA 4OK0A 3PURA 3QUJA 4K0UA 5HWXA 2N2NA 2X67A 3CVRA 4GIWA 4U72A 5LYJE 5HXEA 3I9WA 3O4XE 2V7MA 5JR9C 3AA7B 2VL8A 2EHOD 1O3XA 3LFMA 3IBPA 3Q5XA 4WNKA 2H7OA 4PK6A 2V7KA 2X9HA 4XBFB 5FNVE 4DVDA 3ESLA 4WW0A 3LK3B 4TUYE 4L0RA 4EXTA 4A56A 3VKHA 1OWAA 2XTLA 4P0AA 2JPFA 2LJLA 5FP3A 4EYUA 2YU1A 4NUVA 3AA1B 4BAYB 2E8IA 3DP7A 4ECGA 5DJQC 3U3IA 1D1CA 4NUUA 2LHNA 2ZM2A 2DI4A 2ZLYA 3ETUA 3ZC0A 1YD8G 4IE7A 2VK9A 4DMVA 1YW0A 3SS1A 3GN5A 2RP4A 2X0LB 2WAUA 2X68A 2ZM0A 3P7IA 3AVSA 2HPJA 5FXWA 3MK7C 3QK6A 2D5UA 2ZMAA 5GONE 1BR1A 4I4TE 4O2AE 2E9XC 4FI5A 3N9QA 5JR9B 2PFVA 4ZI3C 4EB6E 4DBQA 4O4JE 4KUMB 3VHLA 3RYFE 5FXZA 5A1LA 5M4YA 2WMNA 4IE5A 5F3JA 4MHCA 1D0ZA 3OBVE 4HE8A 4AKRB 3E08A 3RC8A 2EHOA 2XAFB 1QUUA 3KV9A 2V7LA 4XAXB 2J1DG 4P09A 2X9YA 3L09A 5CB4E 2D0TA 3KVBA 3R6NA 4CXXA 5T1DA 2WBLA 2MTQA 4ERRA 2EHOC 2CXDA 5DQWA 2A3DA 3EVYA 1HF8A 4H9PC 1IAPA 4TN7B 5JDMA 1HS7A 3UT5E 3CMLA 3KV4A 2CA5A 2V1DB 3PE0A 4X20E 4UF0A 1Y64B 5LP6E 3GN5B 4CQIA 5JDGA 4AXPA 5KMGP 2X9XA 5JH7E 3PTRB 1MIVA 2CMRA 2K48A 5C8YE 3HKEE 1WR6A 1MIYA 2LSGA 4UVAB 4H63V 3FB2A 5ETWA 2E9XA 4QHOA 3ZN0B 1HCIA 4M1PA 4BJNA 3N9PA 5FY1A 4BGOA 2W62A 5HXCA 1NAFA 3IF8B 4U74A 4PJJA 2C5JA 2Z6EA 3WAJA 3PUSA 4DBRA 1WRDA 2KZ7B 5L3DB 3RYHE 3C4XA 4H9RC 3I0QA 5L3EB 2X66A 3V5UA 4DNDA 4YJ3E 4JLEA 3LK2B 2Q9QB 3H37A 3EDUA 4AKLA 3ZMVB 3MKDA 3AVRA 2VASA 3ZEFB 5FY0A 4PJNA 2KMFA 2MYSA 3N9MA 4JEUB 5LBMA 4EOZB 4ANJA 3ANWA 4KP3C 2ES0A 3N5LA 2LHRA 3KBTA 2YK0A 4O4LE 4PAGA 5J1GA 2WM9A 2Y8DA 3J7Yq 3O1JA 2CE7A 4N78D 4IDZA 4CI1B 3CKDA 4ASKA 4ZI7E 4AKIA 1B7TA 2YINA 4JEHB 3JC6D 4ILUA 1MNDA 3E22E 4X1IE 4AQFA 4QX8B 2CXLA 3RH3A 3V5SA 3F31A 4I50E 3ZYMA 2VKDA 1KNZA 2ODUA 4ZS3A 4MLKA 4DO0A 3O1IA 3PUQA 2DWKA 2YEVC 3KDSE 2E9XD 2OA5A 2X9WA 4HGAA 4KBMB 4CI2B 3KVAA 4ZI2C 3RPUA 3UFEA 3UUMA 4O4HE 1T98A 3PUGA 5LHIB 2CXFA 3BQIA 3WAKA 2LOPA 3RYCE 4JUYA 4OYJA 3ZJ2A 4HN9A 4QXBB 3ZYKA 5KDMC 1U4QA 4AQFC 5J2TE 5JRCB 2LSYA 2XAQB 5LBQB 4AKHA 1S94A 3E0ZA 2QGSA 3Q2MA 4O4IE 2MOZA 5IYZE 5LHGB 3SOLA 4IE4A 2DCFA 1D1AA 4I43B 2ACXA 4ISSA 1ZEEA 5JDHA 2NW7A 3EUHA 3AAEB 3C51A 2K5BB 4GOUA 4PK4A 3ZN1B 1V9DA 5LJMA 1G8XA 2K9AA 3K8PC 4UIGA 4ONRA 1FIOA 5HWYA 3B57A 3CWZB 4Z8XA 2JQQA 4P0BA 2RA1A 3CX6B 2XUEA 3MACA 1UX4A 3NZPA 4YFSA 1KK7A 5L3GB 2HH7A 1QSDA 2NP9A 4GK5E 4TZ4C 1WYBA 3BK9A 1CUNA 1G73A 3ONXA 1Z0PA 3C64A 4YJ2E 4UVCB 2E9XB 1MMDA 3LK42 5HAXA 1ZHCA 5JDLA 3AA0B 2GK9A 4XZCA 4E7ZA 3ZJ1A 2WSSV 3N9OA 3I9YA 4UEMA 3F57A 3FHNA 3H3AA 1FMVA 1EZ3A 2LM9A 5FXXA 5LJNA 2CCQA 3RKOA 2BDEA 4YHJA 3KV5A 4C90A 3VJZA 2IC6A 3BQLA 3DJBA 3CQCB 2JMKA 1UX5A 3K3QC 5L3FB 3LG7A 2D2SA 2PJQA 4J2CA 4EZHA 3DTOA 3N2OA 3FXEB 3RC3A 4WBNE 2HPLA 1X79A 2M67A 3FXDB 1AJ3A 3ZLIA 1WYCA 2LQUA 5JREA 2G0UA 2VB6A 2LT3A 3IEEA 3ANWB 4H9OC 5FYMA 4CXWA 1D0XA 3IHRA 3O9XA 4MALA 3ZMTB 4GYSA 1OXZA 3HKDE 2LSJA 3CX8B 2D0UA 4QXCB 1YKHB 2KWHA 2XASB 2C0SA 5FXVA 2CM0A 5LOVE 3UUNA 4UELA 2V7IA 3J9X1 4B6XA 2LE8A 2CEAA 3OKQA 2KLQA 2W0GA 3AB3B 3BQKA 3SRZA 4EIWA 3P8CD 1D1BA 4AKGA 2V26A 5JDNA 3AA6B 4OFZA 5L3BB 4PK5A 4ZS2A 4IE0A 4H9QC 5HXHA 1WLXA 5LA6E 4V1Av 2DNXA 1HG5A 4UF0B 2JRKA 2NOXA 5LHHB 5JRCA 1ZKEA 4UVBB 3Q5WA 4PJMA 5H6QB 2KWIB 3K3NA 2KT9A 4ZOLE 4BA9A 3TKLB 1VOMA 3I0OA 3CQXC 3ZPOA 1IJ5A 3OYXA 3D0TA 2N1GA 3PUAA 2NW9A 1FEWA 1LRZA 2L9QA 4DMWA 5E0OA 1H7CA 3HI2A 5FMNA 2I59A 1IZNB 3PDYA 4YLHA 2BZBA 2Y48B 5JDFA 3ZC1A 5F8PA 5DQVA 1E1HB 3MXZA 5FY7A 3UUXB 3ZMSB 5L3CB 4GYRA 2NWBA 1MMNA 2Q9QA 5AFUL 4UV9B 4TV9E 2C5KT 1SHZC 3HL6A 2VKJA 1MNEA 1MIWA 2ODVA 2NW8A 3ZCIA 4IE6A 4OYKA 3F2EA 3RRCA 4QWNB 5LG4A 3AT7A 3WURA 3W15B 4HFVA 2KNDA 2UXNB 5HYAA 2CWYA 2IC9A 3RYIE 5LGUB 3C98B 3KBUA 1SA0E 3N9NA 2QA7A 3PU3A 3GMIA 4OHFA 2W00A 5LCYA 3ZYLA 2PG8A 2A72A 1BR4A 3NRYA 4L5GA 4AQGA 2H7VC 4CZZB 2LSKA 3KFWX 3HKCE 1FMWA 1S35A 3N2GE 4ZI3D 4KMCA 5L2LA 5EK4A 2CLYB 4ZHQE 2JMHA 5BMVE 4ZI2D 3HKBE 4O2BE 3SWHA 2BVLA 2KXPB 2N9DA 3ZMUB 4FJOA 3N2KE 4MFRA 4GK0E 2DWGA 3C4WA 4IGUA 4QKNA 4HKAA 3R84B 4EZ4A 5HXRA 4EYYR 3L3PA 3PU8A 4ADZA 5J2UE 3M1CA 5JR9A 2MTCA 2WWUA 2LEHA 3MJXA 4TX5A 1BR0A 3PHF1 5LNKA 2KINB 3KV6A 2NTYA 4HEAA 3I1AA 3M65A 2Y6XA 3VKGA 2CWOA 3OJAA 4QX7B 1VRBA 3ZMZB 2A2FX 4PNIA 3LBXA 4ISTA 4G2AA 2PBIA 4L9IA 4X1KE 3LJCA 4PW8A 2BVMA 3A5XA 4C91A 4F6RC 5KX5E 2XAGB 1ZV4X 3O1HA 4AI6A 1HG2A 2X51A 5IHYA 3U78A 3NZQA 3MA9A 4UV8B 5LGTB 5JDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDH A;  5HXH A;  3V5S A;  5HYA A;  5JDG A;  5HXS A;  5HXE A;  5JDL A;  5HXR A;  5JDF A;  5JDN A;  5JDM A;  3V5U A;  5HWX A;  5HWY A;  5HXC A;  5JDQ A; 
#chains in the Genus database with same CATH topology
 2MBG A;  2ZM8 A;  1OED E;  2LSI A;  2L7N A;  1J1J A;  2XSA A;  5EZY E;  3M3Z B;  1HNW T;  1MMA A;  4JI7 T;  2CLY C;  2H3R A;  2VKO A;  3AAA B;  3JC6 C;  2SPC A;  3OVU A;  3HA4 A;  4WBO A;  4EAH A;  3Q9D A;  2X0C A;  3B13 A;  4CI3 B;  5BR8 T;  4TWH A;  4DID B;  2Q9Q C;  2B1E A;  3N9L A;  2JQK A;  4H63 H;  5CA0 E;  1U5P A;  2E2A A;  1BR2 A;  1LVF A;  2CPT A;  2WCA A;  4TV8 E;  2WMO A;  5H6R B;  2XY8 B;  1T8B A;  3RX6 A;  2C5I T;  2UUB T;  2OV9 A;  4I0U A;  4TWD A;  2IAK A;  2XQ9 A;  4I55 E;  5JVD E;  3T1Y T;  4HFH A;  2WQY A;  4IHJ E;  4Z91 A;  3UUL A;  1XNR T;  3VU7 H;  3FBZ A;  1HX8 A;  3QC9 A;  2XHE B;  2W61 A;  3T8O A;  2VVS A;  3P4S A;  4LF4 T;  4OX9 T;  3AY5 A;  4E7S A;  5HXS A;  4O8S A;  1UGO A;  3HR0 A;  3LBX B;  1LKX A;  2DHR A;  2XAH B;  4PFP A;  3GA8 A;  2W63 A;  4LF8 T;  4HFE A;  2XQY A;  3WI3 A;  1N33 T;  2XQA A;  1US7 B;  1HFA A;  1IJ6 A;  3CX7 B;  3EDV A;  3EI0 A;  3NBX X;  3UQ4 A;  2UXC T;  5TAO A;  3UTK A;  4IDO A;  2XQ4 A;  4MBQ A;  4QXH B;  5AQJ B;  1OED B;  1HTJ F;  2DLR A;  3K3O A;  3NRX A;  3L39 A;  3S4U A;  5CA1 E;  5IWA T;  3JAD A;  3OYZ A;  2VKH A;  3MZK B;  4BJM A;  4DR5 T;  5EK3 A;  1XNQ T;  3C50 A;  4DR7 T;  4PJL A;  3CK6 A;  1YXR A;  2FBW A;  4H9S E;  4ILC A;  4NIQ A;  3PUV F;  2L8K A;  5LXT E;  5DAB A;  4DR2 T;  2KVP A;  4KHZ F;  2L3L A;  4U7Y A;  4X1Y E;  3WSC A;  4X62 T;  1D0Y A;  4IIJ E;  2VWA A;  2WU5 A;  2Q9Q D;  2NTX A;  4H9N C;  3KIN B;  2YU2 A;  3RIA A;  2JJ9 A;  2FUP A;  4HTE A;  3RRW A;  1YKE B;  2K24 A;  4UXN B;  3T1H T;  2LOS A;  5LMU T;  3RQU A;  4PFO A;  4K0K T;  4TNW A;  4DV1 T;  3GWH A;  1OED A;  2WP9 A;  3CPZ A;  3FBL A;  4G63 A;  4EED A;  5J2T E;  2EHO B;  2KBB A;  1KNR A;  1LVK A;  2P9B A;  2V6Y A;  3ETV A;  5EK2 A;  5JQG E;  4CXY A;  3H3M A;  4U2Z A;  2V7J A;  3ZCJ A;  2IW5 B;  2UXX B;  3CQG B;  2W67 A;  3MA9 A;  5ADX L;  3PF0 A;  4GKJ T;  2FJB A;  2XAJ B;  5LGN B;  2WU2 A;  1NWM X;  1UCU A;  1MMG A;  3AAI A;  3C4Z A;  4OK0 A;  3PUR A;  3QUJ A;  4K0U A;  5HWX A;  2N2N A;  3CIR A;  2X67 A;  3CVR A;  4GIW A;  4GKK T;  3EHZ A;  4U72 A;  4JI2 T;  3EAB A;  5LYJ E;  5HXE A;  2ZM6 T;  3I9W A;  4B3T T;  3O4X E;  1QLB A;  2V7M A;  2H88 A;  5JR9 C;  5L4E A;  3AA7 B;  2VL8 A;  2EHO D;  3AEE A;  1O3X A;  3LFM A;  3IBP A;  3Q5X A;  4WNK A;  2H7O A;  5FVL A;  4PK6 A;  1XMQ T;  2V7K A;  2X9H A;  1J5W A;  2LKH A;  5FNV E;  4DVD A;  4XBF B;  3ESL A;  4WW0 A;  3ZST A;  3LK3 B;  4TUY E;  3PV0 F;  4IDN A;  1YQ4 A;  4L0R A;  5F5W A;  4EXT A;  2WB5 A;  4A56 A;  2BKO A;  1OWA A;  3VKH A;  2XTL A;  4P0A A;  2JPF A;  2LJL A;  5FP3 A;  3RQW A;  4ONR A;  4EYU A;  2YU1 A;  4NUV A;  3AA1 B;  3RIF A;  4BAY B;  2E8I A;  4EEB A;  3DP7 A;  4ECG A;  4X5T A;  5DJQ C;  5FVK A;  1M62 A;  4DUY T;  3U3I A;  4HWD A;  2A9U A;  1D1C A;  4NUU A;  4AQY T;  2LHN A;  2ZM2 A;  1XDO A;  2DI4 A;  4ZZB A;  2ZLY A;  3ETU A;  5HEG A;  1YD8 G;  4IE7 A;  2VK9 A;  4DMV A;  1YW0 A;  3SS1 A;  3ZC0 A;  1N32 T;  3GN5 A;  2RP4 A;  5CFB A;  4DV0 T;  2X0L B;  2BS4 A;  1SUM B;  2WAU A;  2X68 A;  2ZM0 A;  1YQ3 A;  3P7I A;  1HX1 B;  3AVS A;  2HPJ A;  4U33 A;  5FKY A;  2MPK A;  5HCJ A;  5C2T A;  4WZX A;  4NPP A;  5FXW A;  3MK7 C;  4YHH T;  3QK6 A;  2D5U A;  2ZMA A;  5GON E;  1BR1 A;  4I4T E;  5AQI B;  4O2A E;  2E9X C;  2HN2 A;  4FI5 A;  3N9Q A;  3RKG A;  5JR9 B;  2BG9 E;  2OLT A;  2PFV A;  4ZI3 C;  4U3C A;  4Q25 A;  4EB6 E;  4NXM T;  4DBQ A;  3EAM A;  4O4J E;  3NWI A;  4KUM B;  3VHL A;  3RYF E;  4LML A;  5FXZ A;  2QYW A;  3PJA A;  5AQR B;  5A1L A;  5M4Y A;  4YY3 T;  2WMN A;  3AE2 A;  4IE5 A;  4MHC A;  1D0Z A;  3OBV E;  3RF1 A;  4HE8 A;  4AKR B;  5F3J A;  1XMO T;  3VR8 A;  2XQ5 A;  3E08 A;  3RC8 A;  2EHO A;  2XAF B;  4JI0 T;  1QUU A;  5AQH B;  3KV9 A;  2V7L A;  4XAX B;  5CJ5 A;  2J1D G;  4P09 A;  2X9Y A;  3L09 A;  2K3W A;  5CB4 E;  4YTM A;  2D0T A;  3KVB A;  3R6N A;  4CXX A;  5T1D A;  2WBL A;  2MTQ A;  2WS3 A;  5AQS B;  4ERR A;  2EHO C;  2CXD A;  1N36 T;  5DQW A;  2A3D A;  3EVY A;  1HF8 A;  4H9P C;  1IAP A;  4TN7 B;  5JDM A;  4JI4 T;  3UT5 E;  1HS7 A;  3CML A;  5L47 A;  3NVO A;  4HFC A;  3KV4 A;  2VQE T;  3AE1 A;  2V1D B;  2CA5 A;  3PE0 A;  4X20 E;  4UF0 A;  1Y64 B;  5LP6 E;  3GN5 B;  3P50 A;  4LF9 T;  3PUY F;  4CQI A;  4AXP A;  2IML A;  5JDG A;  5KMG P;  2X9X A;  3ZT7 A;  3PTR B;  5JH7 E;  1MIV A;  3VRB A;  4W8P A;  2CMR A;  1XDP A;  3AED A;  2K48 A;  2XQ3 A;  4DV4 T;  5C8Y E;  4LFC T;  4IDP A;  4A98 A;  3HKE E;  1WR6 A;  2LSG A;  1MIY A;  4UVA B;  4H63 V;  3QOF A;  3P4W A;  5HEJ A;  1NEK A;  3PJA J;  3RGL A;  3FB2 A;  2CHN A;  5ETW A;  3TLW A;  4AIS A;  4LFB T;  2E9X A;  2YDS A;  4QHO A;  3ZN0 B;  1HCI A;  4M1P A;  4COF A;  4BJN A;  3N9P A;  5FY1 A;  5KXJ A;  2MAW A;  3AE8 A;  3FZL B;  2I6H A;  1W9R A;  2W62 A;  5HXC A;  1HNX T;  3ZT6 A;  1NAF A;  3IF8 B;  4U74 A;  4QH1 A;  4PJJ A;  3FZH B;  2C5J A;  2QVA A;  2Z6E A;  3PUS A;  5AQV B;  4DBR A;  3WAJ A;  4HWI B;  3TLT A;  2IDO B;  1WRD A;  2KZ7 B;  5L3D B;  1SE7 A;  3RYH E;  3C4X A;  3AE9 A;  4H9R C;  3I0Q A;  5FL1 A;  2WZI A;  2X66 A;  3V5U A;  5L3E B;  4DND A;  4YJ3 E;  4JLE A;  3AE5 A;  3LK2 B;  2J62 A;  2Q9Q B;  1CHU A;  3H37 A;  4DR1 T;  2XQ8 A;  3EDU A;  1IBM T;  1DU2 A;  3DYJ A;  2YDR A;  2RPA A;  3QNU A;  4AKL A;  4TWF A;  3ZMV B;  4YXD A;  4IL4 A;  3MKD A;  4DUZ T;  3AVR A;  2E5L T;  2VAS A;  3ZEF B;  2FJE A;  5FY0 A;  4PJN A;  2KMF A;  2MYS A;  3N9M A;  4ZEY A;  4JEU B;  5LBM A;  2BBH A;  4EOZ B;  3K1S A;  4ANJ A;  3ANW A;  5J0Z A;  2WY2 A;  4JI6 T;  3VR9 A;  2XQ6 A;  2V6Y B;  3ABV A;  4KP3 C;  2ES0 A;  3N5L A;  2LHR A;  3KBT A;  2YK0 A;  2XPK A;  4O4L E;  2CRB A;  4PAG A;  5J1G A;  4LF7 T;  1I6Z A;  2WM9 A;  2Y8D A;  3UFG A;  3J7Y q;  2WZH A;  3O1J A;  2CE7 A;  4N78 D;  3AE4 A;  4U31 A;  4IDZ A;  3TLS A;  3CKD A;  4ASK A;  3LDQ B;  1KF6 A;  2LRL A;  4ZI7 E;  4CI1 B;  1B7T A;  2YIN A;  4ZZC A;  4AKI A;  4JEH B;  3JC6 D;  4ILU A;  5AQG B;  5AQU B;  3UUB A;  3JCF A;  1MND A;  3E22 E;  4X1I E;  4AQF A;  4QX8 B;  2CXL A;  3RH3 A;  3V5S A;  3F31 A;  4I50 E;  3ZYM A;  2VKD A;  2XM2 A;  1KNZ A;  2ODU A;  4ZS3 A;  4MLK A;  4DO0 A;  3O1I A;  2IUB A;  3PUQ A;  4DV5 T;  1ZP0 A;  2W4X A;  2DWK A;  2YEV C;  3KDS E;  1E2A A;  2E9X D;  2OA5 A;  2X9W A;  4HFI A;  4HGA A;  4KBM B;  2L10 A;  4DV3 T;  4CI2 B;  3KVA A;  4ZI2 C;  3RPU A;  3AEC A;  3UFE A;  3RHW A;  3UUM A;  1HNZ T;  4O4H E;  1T98 A;  3PUG A;  5LHI B;  2CXF A;  3BQI A;  3WAK A;  4IDQ A;  2LOP A;  3RYC E;  4JUY A;  4OYJ A;  3ZJ2 A;  4HN9 A;  4QXB B;  3ZYK A;  5CGM A;  1U4Q A;  4IL9 A;  4AQF C;  5KDM C;  2LSY A;  1UUR A;  2XAQ B;  5LBQ B;  5JRC B;  4AKH A;  1S94 A;  3E0Z A;  2QGS A;  2XM1 A;  5AQP B;  3Q2M A;  4O4I E;  2UXB T;  3IA3 A;  3P4Q A;  2MOZ A;  5IYZ E;  5LHG B;  1FJG T;  2WDQ A;  3SOL A;  4IE4 A;  2DCF A;  1D1A A;  4I43 B;  2ACX A;  1XZY A;  4X64 T;  4ISS A;  1ZEE A;  5JDH A;  2NW7 A;  2LLY A;  3OTO T;  3EUH A;  3AAE B;  3C51 A;  4CN4 A;  3FYQ A;  2K5B B;  1L0V A;  3AXJ A;  4GOU A;  3UU3 A;  4PK4 A;  3AEG A;  1E7P A;  4DV6 T;  2H89 A;  3FZK B;  3SFE A;  3ZN1 B;  3UU5 A;  2CBI A;  4F8H A;  1V9D A;  5LJM A;  3ZSS A;  4YSZ A;  1J5E T;  1G8X A;  4HWH A;  1W09 A;  2K9A A;  3K8P C;  4U2Y A;  2W2U A;  2BBJ A;  3QB5 A;  3P4P A;  2M6B A;  4IT4 A;  4UIG A;  2BS3 A;  1FIO A;  5HWY A;  3B57 A;  3CWZ B;  4Z8X A;  2JQQ A;  4P0B A;  3L8R A;  5JTG A;  2RA1 A;  3UU6 A;  3CX6 B;  3B5M A;  3UU8 A;  2B76 A;  2XUE A;  3AE6 A;  1UX4 A;  3MAC A;  4P1N A;  5HEO A;  1KEY A;  3NZP A;  4YFS A;  4LF5 T;  1KK7 A;  5L3G B;  1ZOY A;  2HH7 A;  4ILB A;  1SJ8 A;  1QSD A;  2NP9 A;  4GK5 E;  1UK5 A;  1Z8U A;  4TZ4 C;  5L4H A;  4JI5 T;  3UU4 A;  2FJA A;  4DV2 T;  4B3R T;  1WYB A;  2BS2 A;  3AE3 A;  3BK9 A;  4QH4 A;  1G73 A;  1CUN A;  2VVN A;  1Z0P A;  3C64 A;  3ONX A;  4YJ2 E;  4UVC B;  2E9X B;  1MMD A;  2BG9 A;  3LK4 2;  1ZHC A;  2R6G F;  5HAX A;  5JDL A;  2FJD A;  3AA0 B;  1GQE A;  2GK9 A;  4XZC A;  4E7Z A;  4TNV A;  3ZJ1 A;  2WSS V;  3N9O A;  1KNP A;  3I9Y A;  4UEM A;  4CN6 A;  3F57 A;  2QRX A;  3FHN A;  3H3A A;  1FMV A;  2BG9 C;  1EZ3 A;  4LMK A;  1I94 T;  2LM9 A;  5FXX A;  5LJN A;  2JQH A;  4EV6 A;  2CCQ A;  3RKO A;  2BDE A;  4YHJ A;  1SJ7 A;  3KV5 A;  4C90 A;  4LFA T;  3VJZ A;  5HEH A;  2F4V T;  2IC6 A;  3BQL A;  4X66 T;  3DJB A;  3CQC B;  2JMK A;  1UX5 A;  2AE9 A;  3K3Q C;  3PUX F;  3LG7 A;  5AQF B;  3QB5 K;  2D2S A;  5AQQ B;  3RLF F;  2PJQ A;  3X1D A;  5L3F B;  4J2C A;  4EZH A;  3AE7 A;  3DTO A;  3N2O A;  5AQT B;  1UUS A;  3FXE B;  5LG3 A;  3OPC A;  3RC3 A;  3LSV A;  5ABF A;  4WBN E;  1WFD A;  3TLU A;  2HPL A;  3ONL C;  1X79 A;  4AIU A;  2M67 A;  3FXD B;  1N34 T;  1KFY A;  5AQK B;  2JQ9 A;  3RIU C;  3ZLI A;  1WYC A;  1AJ3 A;  1WCR A;  2LQU A;  5JRE A;  2G0U A;  2VB6 A;  2LT3 A;  3AEB A;  3ANW B;  3IEE A;  4H9O C;  5FYM A;  4CXW A;  1D0X A;  3IHR A;  4YSX A;  3O9X A;  4B3M T;  4MAL A;  3TLV A;  2YOE A;  4GYS A;  3ZMT B;  4BGO A;  4LF6 T;  5C3J A;  1OXZ A;  1JNR A;  2LSJ A;  3CX8 B;  2D0U A;  3HKD E;  3Q5D A;  4KX6 A;  4QXC B;  1YKH B;  2KWH A;  3M1C A;  2I0M A;  2LM2 A;  2C0S A;  2XAS B;  2CM0 A;  5FXV A;  5LOV E;  3VRA A;  3UUN A;  3JAF A;  4UEL A;  1IBK T;  2UXD T;  2V7I A;  3A8Y C;  3J9X 1;  4HFB A;  4EGW A;  4B6X A;  4YTP A;  2LE8 A;  2CEA A;  3OKQ A;  2KLQ A;  2DL1 A;  2W0G A;  3AB3 B;  3BQK A;  3SRZ A;  4EIW A;  3P8C D;  5IUX A;  1D1B A;  4AKG A;  1WR0 A;  2XZE A;  2ACZ A;  2V26 A;  5JDN A;  3AA6 B;  4OFZ A;  4HWF A;  2HHH T;  4YSY A;  5L3B B;  1VCT A;  4PK5 A;  2VUR A;  4H9Q C;  4IE0 A;  1WLX A;  4UR9 A;  2X0Y A;  4ZS2 A;  5HCM A;  4YTN A;  5LA6 E;  5HXH A;  1Y01 A;  4V1A v;  2DNX A;  1HG5 A;  4UF0 B;  2W66 A;  2JRK A;  2NOX A;  2KGX A;  5LHH B;  5JRC A;  2VQF T;  4HFD A;  1ZKE A;  4UVB B;  4DV7 T;  3Q5W A;  4PJM A;  1W0B A;  5ABG A;  5H6Q B;  2KWI B;  3K3N A;  2KT9 A;  3JAE A;  4ZOL E;  3AEA A;  4BA9 A;  3TKL B;  4B3S T;  1VOM A;  3I0O A;  3A7M A;  3CQX C;  3ZPO A;  4JYA T;  1IJ5 A;  3OYX A;  4DR6 T;  3D0T A;  2N1G A;  3PUA A;  2NW9 A;  4YT0 A;  1IBL T;  1FEW A;  1LRZ A;  2L9Q A;  4DMW A;  5E0O A;  1H7C A;  3HI2 A;  5FMN A;  2I59 A;  2BG9 B;  1IZN B;  3PDY A;  4Z90 A;  2XQ7 A;  4YLH A;  2BZB A;  2Y48 B;  3ONJ A;  2KSR A;  4ILA A;  4LMJ A;  5JDF A;  3ZC1 A;  5F8P A;  5ABF B;  5FZT A;  5DQV A;  1E1H B;  3MXZ A;  5FY7 A;  3UUX B;  3ZMS B;  5L3C B;  4GYR A;  2NWB A;  1MMN A;  2Q9Q A;  5AFU L;  4JI8 T;  4UV9 B;  3AXJ B;  2C5K T;  4TV9 E;  1OED C;  5AQO B;  1SHZ C;  3HL6 A;  3RI5 A;  2VKJ A;  5ABE A;  4JI1 T;  1X9B A;  1MNE A;  2V5C A;  1MIW A;  3RIU A;  1M7K A;  2ODV A;  2CHO A;  2V8S V;  2NW8 A;  3AEF A;  4IE6 A;  4OYK A;  3F2E A;  3RRC A;  3ZCI A;  3ZKR A;  4QWN B;  5LG4 A;  2V5D A;  2WDV A;  2V6X A;  5JDQ A;  3AT7 A;  3WUR A;  3W15 B;  4HFV A;  2KND A;  4JV5 T;  2UXN B;  5HYA A;  2CWY A;  2IC9 A;  3RYI E;  5LGU B;  3Q5E A;  2AXD S;  3C98 B;  3KBU A;  1SA0 E;  2LRK A;  2QA7 A;  3N9N A;  3P4R A;  1NEN A;  3GMI A;  3PU3 A;  2NR4 A;  3PUZ F;  4OHF A;  3UQ7 A;  5LMN T;  2W00 A;  3G06 A;  5LCY A;  3ZYL A;  1R8I A;  2PG8 A;  4DR3 T;  1W0A A;  1BR4 A;  2A72 A;  3NRY A;  4L5G A;  2H7V C;  2WWV A;  4AQG A;  4CZZ B;  2LSK A;  4A5X A;  3KFW X;  3HKC E;  1JNZ A;  1FMW A;  1S35 A;  3N2G E;  4ZI3 D;  1HR0 T;  4KMC A;  5L2L A;  5EK4 A;  4NXN T;  2CLY B;  4KI0 F;  4ZHQ E;  2JMH A;  5BMV E;  4ZI2 D;  4A97 A;  3HKB E;  4O2B E;  3SWH A;  2BVL A;  2KXP B;  2IHR 1;  2N9D A;  3ZMU B;  4FJO A;  3N2K E;  4MFR A;  4GK0 E;  2DWG A;  3C4W A;  4IGU A;  5AQN B;  2XJ7 A;  5HEU A;  2UUA T;  2HN1 A;  4QKN A;  4HKA A;  5AQM B;  3R84 B;  4CN1 A;  4EZ4 A;  5HXR A;  4EYY R;  4ZXL A;  3L3P A;  3FZF B;  2JIW A;  3PU8 A;  2M6I A;  4ADZ A;  5J2U E;  4WYV A;  1T7S A;  2BKN A;  5JR9 A;  2MTC A;  5ABH A;  2WWU A;  2LEH A;  3MJX A;  4TX5 A;  1BR0 A;  3PHF 1;  5LNK A;  2VL0 A;  2UU9 T;  2KIN B;  2YDQ A;  4JBW F;  3KV6 A;  2NTY A;  3FZM B;  4HEA A;  3SFD A;  3I1A A;  3M65 A;  5LB7 B;  2CBJ A;  2Y6X A;  4IRE A;  2CWO A;  3OJA A;  4HWC A;  5FL0 A;  3VKG A;  4QX7 B;  2J47 A;  4DR4 T;  1VRB A;  3ZMZ B;  2A2F X;  4PNI A;  3LBX A;  4QH5 A;  2XSB A;  2WDR A;  1VCS A;  2YKS A;  4G2A A;  4IST A;  1T72 A;  2PBI A;  2UUC T;  4L9I A;  2X0H A;  1XWM A;  5AQL B;  4JI3 T;  4X1K E;  2LKG A;  3LJC A;  2E5V A;  2BVM A;  3A5X A;  4PW8 A;  4C91 A;  4F6R C;  5KX5 E;  4U7I A;  3NKZ A;  2XAG B;  1ZV4 X;  2YN6 A;  3O1H A;  4AI6 A;  4X65 T;  3PUW F;  2BKP A;  2D9D A;  1HG2 A;  2X51 A;  5IHY A;  3U78 A;  3NZQ A;  4KHP T;  2PTF A;  2J4G A;  4F7G B;  2IIU A;  4UV8 B;  5LGT B;  3ZT5 A; 
#chains in the Genus database with same CATH homology
 2ZM8 A;  2LSI A;  5EZY E;  1MMA A;  2CLY C;  2H3R A;  2VKO A;  3AAA B;  3JC6 C;  2SPC A;  4WBO A;  3HA4 A;  4EAH A;  3Q9D A;  3B13 A;  4CI3 B;  5CA0 E;  2Q9Q C;  2B1E A;  3N9L A;  4H63 H;  1U5P A;  2MBG A;  1BR2 A;  1LVF A;  5H6R B;  4TV8 E;  2WMO A;  3RX6 A;  2C5I T;  2IAK A;  4I55 E;  5JVD E;  4IHJ E;  3UUL A;  3VU7 H;  3FBZ A;  1HX8 A;  3QC9 A;  2XHE B;  2W61 A;  3T8O A;  4E7S A;  5HXS A;  4O8S A;  3HR0 A;  3LBX B;  1LKX A;  2DHR A;  2XAH B;  4PFP A;  3GA8 A;  2W63 A;  3WI3 A;  2XQY A;  3EDV A;  1US7 B;  1HFA A;  1IJ6 A;  3CX7 B;  3NBX X;  5TAO A;  3UTK A;  4MBQ A;  4QXH B;  1HTJ F;  2DLR A;  3K3O A;  3NRX A;  3S4U A;  5CA1 E;  3OYZ A;  2VKH A;  3MZK B;  4BJM A;  5EK3 A;  3C50 A;  4PJL A;  4H9S E;  2L8K A;  5LXT E;  5DAB A;  4X1Y E;  2L3L A;  3WSC A;  1D0Y A;  4IIJ E;  2VWA A;  2Q9Q D;  2NTX A;  4H9N C;  3KIN B;  2YU2 A;  2JJ9 A;  4HTE A;  3RRW A;  1YKE B;  2K24 A;  4UXN B;  2LOS A;  4PFO A;  3GWH A;  3CPZ A;  3FBL A;  4G63 A;  2EHO B;  1LVK A;  2P9B A;  5EK2 A;  3ETV A;  5JQG E;  4CXY A;  2V7J A;  3ZCJ A;  2IW5 B;  2UXX B;  3CQG B;  5ADX L;  3PF0 A;  2XAJ B;  5LGN B;  1NWM X;  1UCU A;  1MMG A;  3AAI A;  3C4Z A;  4OK0 A;  3PUR A;  3QUJ A;  4K0U A;  5HWX A;  2N2N A;  2X67 A;  3CVR A;  4GIW A;  4U72 A;  5LYJ E;  5HXE A;  3I9W A;  3O4X E;  2V7M A;  5JR9 C;  3AA7 B;  2VL8 A;  2EHO D;  1O3X A;  3LFM A;  3IBP A;  3Q5X A;  4WNK A;  2H7O A;  4PK6 A;  2V7K A;  2X9H A;  4XBF B;  5FNV E;  4DVD A;  3ESL A;  4WW0 A;  3LK3 B;  4TUY E;  4L0R A;  4EXT A;  4A56 A;  3VKH A;  1OWA A;  2XTL A;  4P0A A;  2JPF A;  2LJL A;  5FP3 A;  4EYU A;  2YU1 A;  4NUV A;  3AA1 B;  4BAY B;  2E8I A;  3DP7 A;  4ECG A;  5DJQ C;  3U3I A;  1D1C A;  4NUU A;  2LHN A;  2ZM2 A;  2DI4 A;  2ZLY A;  3ETU A;  3ZC0 A;  1YD8 G;  4IE7 A;  2VK9 A;  4DMV A;  1YW0 A;  3SS1 A;  3GN5 A;  2RP4 A;  2X0L B;  2WAU A;  2X68 A;  2ZM0 A;  3P7I A;  3AVS A;  2HPJ A;  5FXW A;  3MK7 C;  3QK6 A;  2D5U A;  2ZMA A;  5GON E;  1BR1 A;  4I4T E;  4O2A E;  2E9X C;  4FI5 A;  3N9Q A;  5JR9 B;  2PFV A;  4ZI3 C;  4EB6 E;  4DBQ A;  4O4J E;  4KUM B;  3VHL A;  3RYF E;  5FXZ A;  5A1L A;  5M4Y A;  2WMN A;  4IE5 A;  5F3J A;  4MHC A;  1D0Z A;  3OBV E;  4HE8 A;  4AKR B;  3E08 A;  3RC8 A;  2EHO A;  2XAF B;  1QUU A;  3KV9 A;  2V7L A;  4XAX B;  2J1D G;  4P09 A;  2X9Y A;  3L09 A;  5CB4 E;  2D0T A;  3KVB A;  3R6N A;  4CXX A;  5T1D A;  2WBL A;  2MTQ A;  4ERR A;  2EHO C;  2CXD A;  5DQW A;  2A3D A;  3EVY A;  1HF8 A;  4H9P C;  1IAP A;  4TN7 B;  5JDM A;  1HS7 A;  3UT5 E;  3CML A;  3KV4 A;  2CA5 A;  2V1D B;  3PE0 A;  4X20 E;  4UF0 A;  1Y64 B;  5LP6 E;  3GN5 B;  4CQI A;  5JDG A;  4AXP A;  5KMG P;  2X9X A;  5JH7 E;  3PTR B;  1MIV A;  2CMR A;  2K48 A;  5C8Y E;  3HKE E;  1WR6 A;  1MIY A;  2LSG A;  4UVA B;  4H63 V;  3FB2 A;  5ETW A;  2E9X A;  4QHO A;  3ZN0 B;  1HCI A;  4M1P A;  4BJN A;  3N9P A;  5FY1 A;  4BGO A;  2W62 A;  5HXC A;  1NAF A;  3IF8 B;  4U74 A;  4PJJ A;  2C5J A;  2Z6E A;  3WAJ A;  3PUS A;  4DBR A;  1WRD A;  2KZ7 B;  5L3D B;  3RYH E;  3C4X A;  4H9R C;  3I0Q A;  5L3E B;  2X66 A;  3V5U A;  4DND A;  4YJ3 E;  4JLE A;  3LK2 B;  2Q9Q B;  3H37 A;  3EDU A;  4AKL A;  3ZMV B;  3MKD A;  3AVR A;  2VAS A;  3ZEF B;  5FY0 A;  4PJN A;  2KMF A;  2MYS A;  3N9M A;  4JEU B;  5LBM A;  4EOZ B;  4ANJ A;  3ANW A;  4KP3 C;  2ES0 A;  3N5L A;  2LHR A;  3KBT A;  2YK0 A;  4O4L E;  4PAG A;  5J1G A;  2WM9 A;  2Y8D A;  3J7Y q;  3O1J A;  2CE7 A;  4N78 D;  4IDZ A;  4CI1 B;  3CKD A;  4ASK A;  4ZI7 E;  4AKI A;  1B7T A;  2YIN A;  4JEH B;  3JC6 D;  4ILU A;  1MND A;  3E22 E;  4X1I E;  4AQF A;  4QX8 B;  2CXL A;  3RH3 A;  3V5S A;  3F31 A;  4I50 E;  3ZYM A;  2VKD A;  1KNZ A;  2ODU A;  4ZS3 A;  4MLK A;  4DO0 A;  3O1I A;  3PUQ A;  2DWK A;  2YEV C;  3KDS E;  2E9X D;  2OA5 A;  2X9W A;  4HGA A;  4KBM B;  4CI2 B;  3KVA A;  4ZI2 C;  3RPU A;  3UFE A;  3UUM A;  4O4H E;  1T98 A;  3PUG A;  5LHI B;  2CXF A;  3BQI A;  3WAK A;  2LOP A;  3RYC E;  4JUY A;  4OYJ A;  3ZJ2 A;  4HN9 A;  4QXB B;  3ZYK A;  5KDM C;  1U4Q A;  4AQF C;  5J2T E;  5JRC B;  2LSY A;  2XAQ B;  5LBQ B;  4AKH A;  1S94 A;  3E0Z A;  2QGS A;  3Q2M A;  4O4I E;  2MOZ A;  5IYZ E;  5LHG B;  3SOL A;  4IE4 A;  2DCF A;  1D1A A;  4I43 B;  2ACX A;  4ISS A;  1ZEE A;  5JDH A;  2NW7 A;  3EUH A;  3AAE B;  3C51 A;  2K5B B;  4GOU A;  4PK4 A;  3ZN1 B;  1V9D A;  5LJM A;  1G8X A;  2K9A A;  3K8P C;  4UIG A;  4ONR A;  1FIO A;  5HWY A;  3B57 A;  3CWZ B;  4Z8X A;  2JQQ A;  4P0B A;  2RA1 A;  3CX6 B;  2XUE A;  3MAC A;  1UX4 A;  3NZP A;  4YFS A;  1KK7 A;  5L3G B;  2HH7 A;  1QSD A;  2NP9 A;  4GK5 E;  4TZ4 C;  1WYB A;  3BK9 A;  1CUN A;  1G73 A;  3ONX A;  1Z0P A;  3C64 A;  4YJ2 E;  4UVC B;  2E9X B;  1MMD A;  3LK4 2;  5HAX A;  1ZHC A;  5JDL A;  3AA0 B;  2GK9 A;  4XZC A;  4E7Z A;  3ZJ1 A;  2WSS V;  3N9O A;  3I9Y A;  4UEM A;  3F57 A;  3FHN A;  3H3A A;  1FMV A;  1EZ3 A;  2LM9 A;  5FXX A;  5LJN A;  2CCQ A;  3RKO A;  2BDE A;  4YHJ A;  3KV5 A;  4C90 A;  3VJZ A;  2IC6 A;  3BQL A;  3DJB A;  3CQC B;  2JMK A;  1UX5 A;  3K3Q C;  5L3F B;  3LG7 A;  2D2S A;  2PJQ A;  4J2C A;  4EZH A;  3DTO A;  3N2O A;  3FXE B;  3RC3 A;  4WBN E;  2HPL A;  1X79 A;  2M67 A;  3FXD B;  1AJ3 A;  3ZLI A;  1WYC A;  2LQU A;  5JRE A;  2G0U A;  2VB6 A;  2LT3 A;  3IEE A;  3ANW B;  4H9O C;  5FYM A;  4CXW A;  1D0X A;  3IHR A;  3O9X A;  4MAL A;  3ZMT B;  4GYS A;  1OXZ A;  3HKD E;  2LSJ A;  3CX8 B;  2D0U A;  4QXC B;  1YKH B;  2KWH A;  2XAS B;  2C0S A;  5FXV A;  2CM0 A;  5LOV E;  3UUN A;  4UEL A;  2V7I A;  3J9X 1;  4B6X A;  2LE8 A;  2CEA A;  3OKQ A;  2KLQ A;  2W0G A;  3AB3 B;  3BQK A;  3SRZ A;  4EIW A;  3P8C D;  1D1B A;  4AKG A;  2V26 A;  5JDN A;  3AA6 B;  4OFZ A;  5L3B B;  4PK5 A;  4ZS2 A;  4IE0 A;  4H9Q C;  5HXH A;  1WLX A;  5LA6 E;  4V1A v;  2DNX A;  1HG5 A;  4UF0 B;  2JRK A;  2NOX A;  5LHH B;  5JRC A;  1ZKE A;  4UVB B;  3Q5W A;  4PJM A;  5H6Q B;  2KWI B;  3K3N A;  2KT9 A;  4ZOL E;  4BA9 A;  3TKL B;  1VOM A;  3I0O A;  3CQX C;  3ZPO A;  1IJ5 A;  3OYX A;  3D0T A;  2N1G A;  3PUA A;  2NW9 A;  1FEW A;  1LRZ A;  2L9Q A;  4DMW A;  5E0O A;  1H7C A;  3HI2 A;  5FMN A;  2I59 A;  1IZN B;  3PDY A;  4YLH A;  2BZB A;  2Y48 B;  5JDF A;  3ZC1 A;  5F8P A;  5DQV A;  1E1H B;  3MXZ A;  5FY7 A;  3UUX B;  3ZMS B;  5L3C B;  4GYR A;  2NWB A;  1MMN A;  2Q9Q A;  5AFU L;  4UV9 B;  4TV9 E;  2C5K T;  1SHZ C;  3HL6 A;  2VKJ A;  1MNE A;  1MIW A;  2ODV A;  2NW8 A;  3ZCI A;  4IE6 A;  4OYK A;  3F2E A;  3RRC A;  4QWN B;  5LG4 A;  3AT7 A;  3WUR A;  3W15 B;  4HFV A;  2KND A;  2UXN B;  5HYA A;  2CWY A;  2IC9 A;  3RYI E;  5LGU B;  3C98 B;  3KBU A;  1SA0 E;  3N9N A;  2QA7 A;  3PU3 A;  3GMI A;  4OHF A;  2W00 A;  5LCY A;  3ZYL A;  2PG8 A;  2A72 A;  1BR4 A;  3NRY A;  4L5G A;  4AQG A;  2H7V C;  4CZZ B;  2LSK A;  3KFW X;  3HKC E;  1FMW A;  1S35 A;  3N2G E;  4ZI3 D;  4KMC A;  5L2L A;  5EK4 A;  2CLY B;  4ZHQ E;  2JMH A;  5BMV E;  4ZI2 D;  3HKB E;  4O2B E;  3SWH A;  2BVL A;  2KXP B;  2N9D A;  3ZMU B;  4FJO A;  3N2K E;  4MFR A;  4GK0 E;  2DWG A;  3C4W A;  4IGU A;  4QKN A;  4HKA A;  3R84 B;  4EZ4 A;  5HXR A;  4EYY R;  3L3P A;  3PU8 A;  4ADZ A;  5J2U E;  3M1C A;  5JR9 A;  2MTC A;  2WWU A;  2LEH A;  3MJX A;  4TX5 A;  1BR0 A;  3PHF 1;  5LNK A;  2KIN B;  3KV6 A;  2NTY A;  4HEA A;  3I1A A;  3M65 A;  2Y6X A;  3VKG A;  2CWO A;  3OJA A;  4QX7 B;  1VRB A;  3ZMZ B;  2A2F X;  4PNI A;  3LBX A;  4IST A;  4G2A A;  2PBI A;  4L9I A;  4X1K E;  3LJC A;  4PW8 A;  2BVM A;  3A5X A;  4C91 A;  4F6R C;  5KX5 E;  2XAG B;  1ZV4 X;  3O1H A;  4AI6 A;  1HG2 A;  2X51 A;  5IHY A;  3U78 A;  3NZQ A;  3MA9 A;  4UV8 B;  5LGT B;  5JDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...