5JDQA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 100 mm na+ and 10mm sr2+
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
Knots found
sequence length
301
structure length
296
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIENNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized membrane protein MJ0091
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 127
structure length 296
sequence length 301
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdqA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdqA02
3V5SA 5JDNA 5HXEA 5JDHA 5JDLA 5HXRA 5JDFA 5HXSA 5HXCA 5JDGA 5JDMA 5HWYA 5JDQA 5HYAA 3V5UA 5HWXA 5HXHA
chains in the Genus database with same CATH superfamily
2C0SA 4GYRA 4EEDA 2JJ9A 2YOEA 2D0TA 1XZYA 3LK42 2X9HA 1OEDE 4MBQA 4IIJE 3C50A 4O8SA 2HN1A 4EYUA 2XQ4A 1HS7A 3RQWA 3PTRB 2L3LA 3Q5XA 5LYJE 5JR9A 5FXVA 4KHZF 1SHZC 3RX6A 4EZ4A 1UX4A 2VKJA 3JCFA 2K5BB 5T1DA 2IW5B 1B7TA 2AXDS 5LCYA 5JDQA 1NAFA 3HKCE 4H9OC 4UF0A 2XJ7A 3V5SA 3EUHA 3SRZA 4DR7T 2M6IA 3IEEA 2X9XA 5AQIB 5ADXL 4IDOA 3HA4A 4IE7A 3ZCJA 4A98A 4LMLA 3G06A 3C4WA 5HCJA 5LHGB 4ISSA 3MK7C 5JTGA 2FUPA 2KBBA 2WSSV 2VKDA 3SWHA 1MNDA 3ZMZB 2WMOA 4HWCA 2JPFA 4UELA 2WMNA 4H63V 2DI4A 3RIAA 2X66A 3AA1B 4NPPA 4B6XA 2D5UA 3ETUA 1FMVA 1ZKEA 3KV9A 3ZYMA 3ZSTA 5BR8T 4LFBT 5AQTB 4DR2T 2UXXB 5AQSB 4L9IA 3F2EA 3B5MA 5AQFB 2WM9A 4IE0A 2WU5A 4QX7B 5AQGB 1HX8A 5AQNB 2BS3A 2CWOA 4DR3T 4ILUA 4DV1T 1MIWA 2CXFA 5JR9B 1OEDA 2Q9QA 5EK3A 2C5JA 3RHWA 3NBXX 4IDPA 3BQKA 3UUNA 3EI0A 4EIWA 4YXDA 3NZPA 2XSAA 3CQGB 4AQGA 4UF0B 3WURA 3RQUA 3GA8A 4ZI3D 4TV9E 5L3FB 5LGTB 1MMAA 4YTPA 4CXWA 3N9QA 4P09A 5KXJA 2NW9A 4U74A 4PFOA 3CKDA 2W61A 4YLHA 1BR4A 2WDQA 2JMHA 4F8HA 5ETWA 3GWHA 2EHOA 3AE3A 5KMGP 3BK9A 2E8IA 2XM1A 4F7GB 2JQHA 3S4UA 4AKHA 2IHR1 3N9NA 4LF6T 3ZN1B 5J1GA 4X65T 3MACA 1N34T 4PJMA 2H89A 3PU8A 1HCIA 1HTJF 1ZOYA 1UCUA 4AKLA 2X0LB 2V7JA 2XAGB 5F5WA 1WR6A 5CA1E 4MALA 2YDRA 1U4QA 3PDYA 3P7IA 1OEDB 2CHNA 2H7OA 3O1HA 5LMNT 5LMUT 4DV6T 2NW8A 2Q9QB 4TUYE 3JADA 1LKXA 1W0BA 3FZLB 4H9PC 3TLWA 3NVOA 4DIDB 1DU2A 5FXWA 1XMQT 1VRBA 3ZT6A 4XBFB 4ZI2C 3N2OA 5HAXA 4YJ3E 5DQWA 4JI0T 4EB6E 3WAKA 2XQ6A 4M1PA 5F8PA 5HXSA 3QK6A 4J2CA 2NTYA 3RYHE 1G73A 4DO0A 3AE6A 1HX1B 2DHRA 2W63A 1HNWT 2ZM8A 2CE7A 2W4XA 3T1HT 5JQGE 4U33A 1KF6A 2WU2A 5JDHA 2EHOB 2JMKA 4O4IE 5BMVE 2H3RA 2YINA 5FMNA 4WBOA 2RPAA 3PUQA 4YHHT 3LFMA 3AE1A 3O4XE 4U2YA 1YXRA 3VRAA 5LGNB 2LKGA 4COFA 4IE5A 3ESLA 5JDNA 5HXEA 4IT4A 1IJ5A 4UVAB 3MZKB 1D1CA 2BDEA 4P1NA 5AQOB 3PF0A 3UU3A 4WW0A 2WB5A 3PHF1 2CBJA 1NWMX 2KXPB 2J1DG 2V5CA 5AQVB 2L8KA 2M6BA 2VKOA 4PJNA 2L10A 3AEAA 2JQ9A 3GMIA 2VQFT 5LA6E 4TNWA 2MOZA 3P4PA 5J2TE 2JQQA 4CI3B 3NWIA 5HWYA 3KVBA 2A2FX 1J1JA 2NR4A 3CK6A 3EAMA 1XMOT 4HWDA 4DVDA 2LM2A 4O4HE 1QLBA 3GN5A 1N32T 5LNKA 3CQCB 1NENA 1D0YA 3T8OA 3OBVE 4DV2T 4LFCT 1HF8A 3L09A 4HFEA 2X51A 3RKGA 4BGOA 3TKLB 3LSVA 2D2SA 4E7ZA 3HKBE 2CA5A 2E5VA 3EDUA 4KX6A 4WYVA 1D1AA 1M7KA 2DWKA 4A5XA 2IC6A 4B3MT 5HEUA 3I9YA 4LF9T 5J0ZA 4HFIA 3PU3A 3RRWA 1US7B 2W67A 2IDOB 5DABA 2C5IT 5HXHA 3ZKRA 3VJZA 3PUYF 4ZI3C 3QB5K 2WBLA 4X5TA 1LRZA 1XDPA 5L3GB 5LGUB 3LDQB 3ONLC 5A1LA 4YSXA 3N2GE 4KBMB 2I6HA 1VCSA 3CX6B 3GN5B 3O1JA 3AAAB 3AE2A 3PUAA 1T72A 1WLXA 3KFWX 5IYZE 4AQFC 4CQIA 3N9OA 2A72A 1MIVA 2KLQA 3E22E 2XAQB 4AI6A 3Q5EA 4GIWA 3LK3B 1BR0A 3P4RA 2Y48B 4KI0F 4Z90A 2DCFA 4F6RC 2A9UA 2V8SV 2BG9C 2XPKA 5EK4A 3RYFE 2QA7A 3FXEB 3PE0A 5M4YA 3OTOT 4HWIB 3AE9A 3RIFA 4EAHA 4GKKT 4OYJA 3VKHA 4CN1A 3K3OA 1MNEA 2MBGA 4O4JE 2XQYA 4TWHA 4U7IA 3AEGA 5JREA 2M67A 2VURA 4EEBA 1YKHB 3UUXB 2X0HA 3AXJA 3AEEA 1MMDA 2X0YA 2CM0A 1JNRA 4IDZA 4AISA 4JI6T 3P50A 2YEVC 2E9XC 2XASB 3RRCA 4ZXLA 3CVRA 5AQRB 2UXDT 3OYZA 3OYXA 1SJ7A 3PJAA 3IBPA 3LK2B 2LEHA 1VCTA 3FHNA 3R6NA 3FXDB 5JRCA 3AEFA 1W09A 3KV5A 3N5LA 3QC9A 3F57A 2CMRA 2DLRA 3M65A 1UX5A 2NP9A 1T8BA 3R84B 3ZMVB 3DP7A 5FY0A 4ADZA 3ZPOA 5FXZA 3X1DA 3SS1A 4H63H 2VL8A 1IBKT 3AA6B 3SOLA 5LJNA 4DUYT 1HNXT 4ERRA 5IHYA 4YJ2E 4U7YA 1X79A 4EXTA 4EV6A 5DJQC 4UVCB 2ACZA 4LF4T 2L9QA 2XM2A 4N78D 3MKDA 4ZS3A 1YQ3A 4I55E 4HFCA 4YTNA 3AXJB 3VKGA 4U31A 1SE7A 1G8XA 2H88A 4IE6A 1IZNB 1QUUA 3M1CA 3PUGA 4HWFA 2MTQA 2ZLYA 2KT9A 3QB5A 4BJNA 2V7LA 2LM9A 5L47A 3UQ7A 1ZV4X 2V1DB 2VASA 3L8RA 2WWUA 4JYAT 4PK4A 5AQLB 2DL1A 4LMKA 1LVKA 1SA0E 4V1Av 4DV5T 2XTLA 2WWVA 3DTOA 4ISTA 5JRCB 5AQKB 1IAPA 4AXPA 3HKEE 2CLYB 3HI2A 2K24A 1ZEEA 3UQ4A 4HWHA 2CEAA 4PK5A 3UULA 1KEYA 3JC6C 1V9DA 2NTXA 2BVLA 2BKPA 3W15B 1LVFA 3Q2MA 3ONXA 3AVSA 2ACXA 4QH5A 4BA9A 3H3AA 4EYYR 1Y64B 1S94A 4LF5T 2XQ8A 1I6ZA 5FKYA 2KWHA 3OVUA 5LG4A 1FMWA 2K48A 1WYCA 4HFHA 4LF8T 1FEWA 4X66T 1KNRA 2IUBA 2DWGA 1T98A 2WQYA 4ANJA 3FZKB 3KV4A 1NEKA 2X9YA 5FP3A 2XAFB 4LMJA 5CJ5A 4DR1T 3U78A 4HGAA 2WDVA 5FZTA 2XQ5A 2Y6XA 4DBRA 2QRXA 4CN4A 2ZM6T 2VK9A 2ES0A 4UR9A 4I43B 4EGWA 5C8YE 2B76A 3VR9A 1D0ZA 2XZEA 2NWBA 2WZIA 1W9RA 3FYQA 4X20E 5KX5E 2CCQA 2Q9QD 3NKZA 4ILBA 2WDRA 3AEDA 4PJJA 4A97A 2UXNB 1HG2A 3RC3A 2OA5A 2VVNA 5CFBA 1IBLT 2LOPA 4ZZBA 4YHJA 3Q5DA 3RPUA 3FZFB 3RGLA 2RA1A 4ZEYA 4GOUA 1IBMT 5HEGA 4I4TE 5LHHB 5L3CB 2LKHA 2EHOD 3PUXF 1W0AA 4JV5T 2XQAA 2AE9A 4JI2T 1IJ6A 4O2AE 2NW7A 2R6GF 2Z6EA 4AIUA 4HFVA 3HL6A 1WCRA 3UUMA 3VHLA 3EDVA 3P4QA 4HTEA 2CXDA 3H37A 4QH4A 5EZYE 3TLVA 2LLYA 4ZZCA 2CBIA 2LSIA 4X1KE 3IHRA 1H7CA 2X68A 3C4ZA 4JEUB 2JIWA 5FY7A 3AA0B 3EVYA 3ZEFB 2RP4A 4CI2B 2HPJA 3UU8A 2CPTA 2XQ9A 5J2UE 4HKAA 4CN6A 1MMNA 2PTFA 2KSRA 4DBQA 3Q5WA 3ZT5A 3HR0A 5LOVE 2N9DA 2FJBA 4AKGA 2QYWA 1XNRT 3ZSSA 3CX7B 2VB6A 3KINB 4TNVA 1J5ET 2BBJA 5F3JA 5HXCA 1WFDA 2X0CA 4FI5A 3ZYLA 3C64A 4HFDA 3EHZA 2LQUA 4NXNT 2W00A 3L39A 3TLTA 5L2LA 3ANWA 1WYBA 5LHIB 2CXLA 2BKOA 5AQHB 3SFEA 4TWDA 3AECA 3UFEA 5FNVE 4JI4T 4IL4A 2FJDA 4NIQA 3PUZF 5AQQB 2MPKA 3AE8A 4XZCA 5KDMC 4MHCA 2NOXA 5TAOA 2LRKA 4TV8E 3PV0F 2MAWA 2FBWA 4O2BE 3C51A 5L3DB 1FIOA 1E7PA 3RKOA 4OK0A 2LT3A 2WAUA 3O1IA 2YK0A 5FL0A 3N2KE 2VQET 2XHEB 4K0UA 3A8YC 5FXXA 1YD8G 1SJ8A 4MLKA 2V7MA 2IMLA 3B13A 3RYCE 3KDSE 1KK7A 2UU9T 4NUVA 2PFVA 2C5KT 3WI3A 4ECGA 3RLFF 4OFZA 5FY1A 1XDOA 3QUJA 2E5LT 2PG8A 3UUBA 4ZOLE 3K8PC 3P4SA 4ZI7E 4H9RC 4OYKA 3RC8A 3KVAA 5CGMA 2BZBA 2PBIA 2I59A 5HEHA 4KMCA 5LB7B 4LFAT 4PW8A 1UK5A 4ZI2D 3BQLA 3PUWF 4IDQA 4UV9B 2CWYA 4I0UA 3CQXC 5FYMA 4IHJE 2YDQA 3ANWB 4JI5T 3CIRA 2LSGA 2ZM0A 1VOMA 4HN9A 2W0GA 3KBTA 4H9SE 3DYJA 3UU4A 5H6RB 1EZ3A 2V5DA 5HEJA 4QXCB 5LXTE 1I94T 2LSJA 1OEDC 2KZ7B 2V7IA 3AVRA 4JI7T 2WS3A 1YW0A 3UT5E 2WCAA 4PK6A 5L3BB 4YFSA 4PJLA 4KHPT 2Y8DA 2W62A 5C3JA 3NRYA 5JH7E 2K9AA 4G2AA 1T7SA 4L5GA 1M62A 5HEOA 4Z8XA 4GK0E 3TLSA 2SPCA 3QOFA 2XSBA 1AJ3A 2LE8A 3VRBA 3ZJ2A 4BAYB 3K1SA 1J5WA 2EHOC 4IDNA 2XQ7A 3ZJ1A 4A56A 2V26A 5LG3A 2MYSA 4UV8B 4ZHQE 2YU1A 4AQFA 4JLEA 1CUNA 4KP3C 2LHRA 4NXMT 4H9QC 1X9BA 3A7MA 5GONE 4YSZA 3ZN0B 4Z91A 2LOSA 1OWAA 4DMVA 2H7VC 4OHFA 3AE4A 3B57A 2BG9A 5IUXA 4TZ4C 2N1GA 2PJQA 4TX5A 4ZS2A 3BQIA 3ZYKA 5JVDE 3FZHB 5L4EA 2W66A 4JI8T 3PUSA 3PURA 2KNDA 3N9PA 4ILAA 5HCMA 5C2TA 4W8PA 4MFRA 4DR5T 1BR2A 2YKSA 3IF8B 3RIUC 3RI5A 5JDLA 2X67A 1MMGA 3VR8A 4YT0A 2E9XA 4XAXB 3C4XA 3AT7A 4DUZT 4UXNB 3AE5A 1YQ4A 1D0XA 3J7Yq 3IA3A 1HR0T 4WNKA 5ABEA 1E1HB 2HN2A 2XQ3A 3ZMTB 3UU5A 2BVMA 1N33T 1SUMB 4IGUA 4O4LE 4U3CA 1E2AA 3JAEA 2ODUA 2KMFA 3LBXA 2KVPA 3NRXA 2BS2A 3A5XA 2V6XA 4GKJT 1QSDA 5LBQB 2BG9B 4ILCA 4UIGA 2LHNA 3CMLA 5LP6E 4PAGA 2ODVA 2QGSA 4U2ZA 3RH3A 3N9LA 5L4HA 3AAIA 5CA0E 1ZHCA 2VVSA 4X62T 3CPZA 2V6YA 4JEHB 3RYIE 2KINB 2MTCA 5AQMB 1L0VA 2LSKA 2OLTA 3MA9A 4DNDA 2KWIB 4ONRA 2J47A 4P0BA 3I1AA 3ZMSB 4WBNE 2UUBT 3P8CD 3AAEB 5L3EB 4DV4T 1HG5A 4C90A 3C98B 3KBUA 3MJXA 3AY5A 2E9XB 2VWAA 3UFGA 5HXRA 5LBMA 3AA7B 2F4VT 3K3QC 4UVBB 4PNIA 3ZC1A 4C91A 2HHHT 4U72A 3M3ZB 2CRBA 3MXZA 4QX8B 2E9XD 5LJMA 2XAHB 3N9MA 2J4GA 2XUEA 5JDFA 4DV0T 2L7NA 3RIUA 2E2AA 3LBXB 5JDMA 5EK2A 4L0RA 4CZZB 3WAJA 1CHUA 4EOZB 4E7SA 4YTMA 1GQEA 4DV3T 5ABFA 2HH7A 4HEAA 4YSYA 4DV7T 4IL9A 3WSCA 3VU7H 2J62A 3ZC0A 4IREA 2V6YB 4DR6T 3E0ZA 2LRLA 3ZMUB 2X9WA 3LG7A 4QWNB 1HNZT 2KGXA 3V5UA 5AFUL 3JAFA 2IAKA 4G63A 1U5PA 3ABVA 4OX9T 3FBZA 3AE7A 3PJAJ 1KNZA 1N36T 1BR1A 3FBLA 2YN6A 4EZHA 5ABGA 5FVKA 5HYAA 2P9BA 4B3TT 2CHOA 4JI1T 2UXBT 3U3IA 3QNUA 2JQKA 2N2NA 5FVLA 3AB3B 2I0MA 1WRDA 3ETVA 2QVAA 5AQPB 1KFYA 3I0OA 1MIYA 2BS4A 1UGOA 4GK5E 3NZQA 2BBHA 3P4WA 4AKIA 5H6QB 4CXXA 4JBWF 4AKRB 4JI3T 4UEMA 4ASKA 1YKEB 2FJEA 3PUVF 2GK9A 4GYSA 3LJCA 3ONJA 2IC9A 3TLUA 2G0UA 3EABA 3UU6A 1Z8UA 5ABFB 4JUYA 4H9NC 1UURA 4QH1A 3K3NA 4QXHB 1XWMA 1JNZA 2W2UA 5ABHA 4LF7T 4X1IE 3O9XA 3OPCA 3ZLIA 1D1BA 1HFAA 5HWXA 3JC6D 2A3DA 3SFDA 2WP9A 2WZHA 3I9WA 1UUSA 2V7KA 2YDSA 4FJOA 3FZMB 1XNQT 4QKNA 4NUUA 5JR9C 3UTKA 3D0TA 3E08A 3T1YT 2FJAA 5AQJB 2UXCT 3OJAA 5E0OA 3H3MA 4K0KT 2ZM2A 4WZXA 5FL1A 4X1YE 3CX8B 2HPLA 2CLYC 2K3WA 3RF1A 4IE4A 5CB4E 4X64T 5IWAT 2DNXA 2D0UA 2ZMAA 1S35A 1O3XA 3L3PA 2XAJB 5DQVA 4QXBB 4DR4T 5JDGA 3ZCIA 1OXZA 2LSYA 4B3RT 4AQYT 2YU2A 2OV9A 4BJMA 2JRKA 4TWFA 3F31A 4QHOA 1ZP0A 4Q25A 3J9X1 2VL0A 4I50E 1Z0PA 3ZT7A 3HKDE 2UUAT 3FB2A 4TN7B 4YY3T 3OKQA 2XY8B 4CI1B 2WY2A 2VKHA 2UUCT 2BG9E 1KNPA 1Y01A 2B1EA 1R8IA 4CXYA 3AEBA 2LJLA 3KV6A 4KUMB 4HE8A 4B3ST 1FJGT 4DMWA 4P0AA 5AQUB 2D9DA 3CWZB 3DJBA 1WR0A 3I0QA 4PFPA 2Q9QC 2IIUA 3Q9DA 4HFBA 2BKNA
chains in the Genus database with same CATH topology
2C0SA 1BR2A 4GYRA 3EDUA 2OA5A 3IF8B 2LOPA 1D1AA 4YHJA 3RPUA 2JJ9A 5JDLA 2D0TA 2DWKA 2X67A 1MMGA 2IC6A 2RA1A 2E9XA 3LK42 4XAXB 3C4XA 3AT7A 2X9HA 4GOUA 3I9YA 4UXNB 4MBQA 4I4TE 5LHHB 1D0XA 4IIJE 3J7Yq 3C50A 4O8SA 3PU3A 5L3CB 3RRWA 4EYUA 4WNKA 1E1HB 1US7B 1HS7A 3PTRB 5DABA 2L3LA 3Q5XA 2C5IT 2EHOD 5LYJE 3ZMTB 5JR9A 5HXHA 5FXVA 2BVMA 1SHZC 3VJZA 3RX6A 4IGUA 4O4LE 4EZ4A 4ZI3C 1UX4A 2VKJA 2ODUA 2K5BB 5T1DA 1IJ6A 2KMFA 3LBXA 4O2AE 2NW7A 2WBLA 3NRXA 2IW5B 1LRZA 3A5XA 2Z6EA 1B7TA 5LCYA 5L3GB 5JDQA 1NAFA 3HKCE 4H9OC 5LGUB 4UF0A 5A1LA 1QSDA 3N2GE 3EUHA 4KBMB 5LBQB 3V5SA 3CX6B 3SRZA 4HFVA 3IEEA 2X9XA 5ADXL 3GN5B 3HL6A 3O1JA 4UIGA 3AAAB 3HA4A 4IE7A 2LHNA 3CMLA 3PUAA 3ZCJA 5LP6E 4PAGA 2ODVA 1WLXA 2QGSA 3KFWX 3UUMA 3RH3A 3VHLA 3C4WA 3N9LA 3EDVA 3AAIA 5LHGB 4HTEA 2CXDA 3H37A 5EZYE 5IYZE 4AQFC 4ISSA 4CQIA 3MK7C 3N9OA 5CA0E 2LSIA 4X1KE 1ZHCA 2A72A 3CPZA 3IHRA 1MIVA 2WSSV 2VKDA 2KLQA 3E22E 1H7CA 1MNDA 2X68A 2XAQB 3C4ZA 2WMOA 4JEHB 3SWHA 3ZMZB 2JPFA 3RYIE 4AI6A 4JEUB 4UELA 4GIWA 2KINB 2MTCA 5FY7A 2LSKA 3LK3B 3MA9A 4DNDA 1BR0A 2KWIB 2Y48B 4ONRA 4P0BA 3AA0B 2WMNA 2DCFA 3EVYA 3I1AA 4H63V 4F6RC 2DI4A 3ZEFB 2X66A 3ZMSB 4WBNE 2RP4A 3AA1B 3P8CD 4CI2B 4B6XA 2D5UA 3AAEB 2HPJA 3ETUA 5L3EB 5EK4A 3RYFE 2QA7A 3FXEB 1FMVA 1ZKEA 3KV9A 3PE0A 1HG5A 3ZYMA 5M4YA 2UXXB 4C90A 5J2UE 4L9IA 4EAHA 3C98B 4HKAA 3KBUA 3MJXA 1MMNA 2E9XB 3F2EA 4OYJA 2VWAA 3VKHA 4DBQA 3Q5WA 3K3OA 3HR0A 5LOVE 5HXRA 2N9DA 1MNEA 2WM9A 4IE0A 2MBGA 4QX7B 1HG2A 4O4JE 4AKGA 2XQYA 1HX8A 5LBMA 3AA7B 3K3QC 4UVBB 4PNIA 3ZC1A 4C91A 3CX7B 2VB6A 5JREA 2CWOA 3KINB 4ILUA 2M67A 4U72A 5F3JA 1MIWA 5HXCA 1YKHB 2CXFA 3MXZA 3UUXB 4QX8B 5JR9B 2E9XD 5LJMA 4FI5A 2XAHB 2Q9QA 3N9MA 3ZYLA 3C64A 1MMDA 5EK3A 2C5JA 2XUEA 3NBXX 3UUNA 3BQKA 2LQUA 5JDFA 2CM0A 2W00A 4IDZA 5L2LA 3ANWA 1WYBA 3LBXB 5LHIB 2YEVC 5JDMA 4EIWA 2E9XC 5EK2A 3NZPA 2CXLA 3CQGB 4L0RA 2XASB 4CZZB 4AQGA 4UF0B 3RRCA 3UFEA 3WAJA 3WURA 5FNVE 3CVRA 4EOZB 4E7SA 3GA8A 4ZI3D 4TV9E 5L3FB 3OYZA 3OYXA 5LGTB 3IBPA 3LK2B 4XZCA 1MMAA 5KDMC 4MHCA 4CXWA 2LEHA 3N9QA 2NOXA 5TAOA 2HH7A 4HEAA 4P09A 4TV8E 3FHNA 4O2BE 3WSCA 3C51A 2NW9A 3VU7H 1FIOA 5L3DB 3R6NA 4U74A 3FXDB 4PFOA 3RKOA 4OK0A 2LT3A 3ZC0A 2WAUA 5JRCA 3O1IA 2YK0A 3CKDA 2W61A 4YLHA 3KV5A 3E0ZA 3N5LA 3QC9A 3ZMUB 1BR4A 3N2KE 3F57A 2CMRA 2DLRA 2JMHA 5ETWA 2XHEB 3GWHA 4K0UA 2EHOA 3M65A 2X9WA 5KMGP 3LG7A 4QWNB 3BK9A 5FXXA 1UX5A 2E8IA 2NP9A 1YD8G 4MLKA 3V5UA 5AFUL 2V7MA 3R84B 3B13A 3RYCE 2IAKA 3ZMVB 4G63A 3KDSE 3S4UA 1U5PA 4AKHA 1KK7A 3DP7A 3N9NA 4NUVA 5FY0A 2PFVA 3ZN1B 4ADZA 2C5KT 3WI3A 5J1GA 3ZPOA 3MACA 5FXZA 3FBZA 4ECGA 4OFZA 4H63H 2VL8A 4PJMA 3SS1A 1KNZA 3PU8A 3AA6B 1BR1A 1HCIA 5FY1A 3SOLA 1HTJF 5LJNA 3FBLA 3QUJA 1UCUA 4AKLA 2PG8A 4EZHA 2X0LB 4ZOLE 3K8PC 5HYAA 4ERRA 5IHYA 2V7JA 4YJ2E 1X79A 2P9BA 4ZI7E 4EXTA 5DJQC 2XAGB 4H9RC 4UVCB 2L9QA 4N78D 4OYKA 1WR6A 5CA1E 3U3IA 3MKDA 3RC8A 4ZS3A 4MALA 3KVAA 3PDYA 1U4QA 2BZBA 2N2NA 2PBIA 4I55E 3P7IA 2I59A 3AB3B 4KMCA 1WRDA 3ETVA 2H7OA 4PW8A 3O1HA 3VKGA 4ZI2D 2NW8A 2Q9QB 3BQLA 4TUYE 1G8XA 3I0OA 4UV9B 1LKXA 1MIYA 4IE6A 1IZNB 2CWYA 1QUUA 3M1CA 4GK5E 3PUGA 3CQXC 4H9PC 5FYMA 2MTQA 2ZLYA 3NZQA 4IHJE 2KT9A 3ANWB 5FXWA 4BJNA 4AKIA 2V7LA 5H6QB 2LM9A 4CXXA 1VRBA 4AKRB 4XBFB 4ZI2C 4UEMA 3N2OA 4ASKA 2LSGA 1ZV4X 1YKEB 2ZM0A 5HAXA 2V1DB 1VOMA 4YJ3E 2GK9A 5DQWA 4HN9A 2W0GA 2VASA 3KBTA 4GYSA 4H9SE 3WAKA 4EB6E 4M1PA 3LJCA 2WWUA 5F8PA 2IC9A 2G0UA 5H6RB 4PK4A 1EZ3A 4JUYA 1LVKA 4H9NC 1SA0E 4QXCB 5LXTE 4V1Av 5HXSA 3QK6A 2LSJA 2XTLA 3K3NA 4J2CA 3DTOA 2KZ7B 2NTYA 4ISTA 1G73A 3RYHE 4DO0A 4QXHB 2DHRA 5JRCB 2V7IA 1IAPA 2W63A 3AVRA 4AXPA 3HKEE 2ZM8A 1YW0A 3UT5E 2CE7A 4X1IE 3O9XA 2CLYB 3HI2A 3ZLIA 4PK6A 5L3BB 4YFSA 2K24A 5JQGE 1D1BA 1HFAA 5HWXA 4PJLA 5JDHA 3JC6D 2EHOB 2A3DA 2Y8DA 2W62A 2JMKA 3NRYA 4O4IE 5JH7E 2K9AA 5BMVE 4G2AA 3I9WA 2H3RA 1ZEEA 2YINA 5FMNA 4WBOA 3PUQA 2V7KA 3LFMA 4L5GA 2CEAA 3O4XE 4FJOA 4PK5A 3UULA 3JC6C 1V9DA 4QKNA 4NUUA 5JR9C 4Z8XA 2NTXA 3UTKA 3D0TA 2BVLA 4GK0E 5LGNB 3W15B 3E08A 1LVFA 3Q2MA 3ONXA 2SPCA 4IE5A 3ESLA 3AVSA 5JDNA 5HXEA 2ACXA 1IJ5A 4UVAB 3MZKB 1D1CA 2BDEA 4BA9A 3OJAA 5E0OA 3H3AA 3PF0A 2ZM2A 4WW0A 1AJ3A 4X1YE 3CX8B 2LE8A 2HPLA 4EYYR 1Y64B 2CLYC 1S94A 3PHF1 3ZJ2A 4BAYB 4IE4A 5CB4E 1NWMX 2EHOC 2KWHA 2DNXA 2D0UA 5LG4A 3ZJ1A 4A56A 1FMWA 2ZMAA 1S35A 2V26A 1O3XA 2K48A 1WYCA 2J1DG 2KXPB 2MYSA 3L3PA 2XAJB 2L8KA 4UV8B 4ZHQE 5DQVA 2YU1A 2VKOA 4PJNA 4QXBB 5JDGA 1FEWA 3ZCIA 1OXZA 2LSYA 2DWGA 1T98A 4AQFA 4JLEA 4ANJA 1CUNA 3GMIA 4KP3C 2LHRA 3KV4A 5LA6E 4H9QC 2MOZA 2YU2A 2X9YA 5FP3A 4BJMA 5J2TE 2JRKA 2JQQA 3F31A 5GONE 4CI3B 4QHOA 5HWYA 3ZN0B 2XAFB 3KVBA 2A2FX 3J9X1 4I50E 1Z0PA 2LOSA 1OWAA 3U78A 3HKDE 4HGAA 4DMVA 2H7VC 4OHFA 4DVDA 2Y6XA 3B57A 3FB2A 4TN7B 4DBRA 3OKQA 2VK9A 4O4HE 3GN5A 2ES0A 4CI1B 4I43B 2VKHA 5LNKA 3CQCB 1D0YA 4TZ4C 2N1GA 2PJQA 4TX5A 5C8YE 2B1EA 3T8OA 3OBVE 4CXYA 4ZS2A 2LJLA 1D0ZA 2NWBA 3KV6A 4KUMB 4HE8A 3BQIA 3ZYKA 5JVDE 1HF8A 3L09A 4X20E 5KX5E 2CCQA 2X51A 2Q9QD 4DMWA 4BGOA 3PUSA 3TKLB 4P0AA 3PURA 3CWZB 3DJBA 2D2SA 3I0QA 4E7ZA 3HKBE 2KNDA 3N9PA 4PJJA 2CA5A 4PFPA 2Q9QC 3Q9DA 4MFRA 2UXNB 3RC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5S A;  5JDN A;  5HXE A;  5JDH A;  5JDL A;  5HXR A;  5JDF A;  5HXS A;  5HXC A;  5JDG A;  5JDM A;  5HWY A;  5JDQ A;  5HYA A;  3V5U A;  5HWX A;  5HXH A; 
#chains in the Genus database with same CATH topology
 2C0S A;  4GYR A;  4EED A;  2JJ9 A;  2YOE A;  2D0T A;  1XZY A;  3LK4 2;  2X9H A;  1OED E;  4MBQ A;  4IIJ E;  3C50 A;  4O8S A;  2HN1 A;  4EYU A;  2XQ4 A;  1HS7 A;  3RQW A;  3PTR B;  2L3L A;  3Q5X A;  5LYJ E;  5JR9 A;  5FXV A;  4KHZ F;  1SHZ C;  3RX6 A;  4EZ4 A;  1UX4 A;  2VKJ A;  3JCF A;  2K5B B;  5T1D A;  2IW5 B;  1B7T A;  2AXD S;  5LCY A;  5JDQ A;  1NAF A;  3HKC E;  4H9O C;  4UF0 A;  2XJ7 A;  3V5S A;  3EUH A;  3SRZ A;  4DR7 T;  2M6I A;  3IEE A;  2X9X A;  5AQI B;  5ADX L;  4IDO A;  3HA4 A;  4IE7 A;  3ZCJ A;  4A98 A;  4LML A;  3G06 A;  3C4W A;  5HCJ A;  5LHG B;  4ISS A;  3MK7 C;  5JTG A;  2FUP A;  2KBB A;  2WSS V;  2VKD A;  3SWH A;  1MND A;  3ZMZ B;  2WMO A;  4HWC A;  2JPF A;  4UEL A;  2WMN A;  4H63 V;  2DI4 A;  3RIA A;  2X66 A;  3AA1 B;  4NPP A;  4B6X A;  2D5U A;  3ETU A;  1FMV A;  1ZKE A;  3KV9 A;  3ZYM A;  3ZST A;  5BR8 T;  4LFB T;  5AQT B;  4DR2 T;  2UXX B;  5AQS B;  4L9I A;  3F2E A;  3B5M A;  5AQF B;  2WM9 A;  4IE0 A;  2WU5 A;  4QX7 B;  5AQG B;  1HX8 A;  5AQN B;  2BS3 A;  2CWO A;  4DR3 T;  4ILU A;  4DV1 T;  1MIW A;  2CXF A;  5JR9 B;  1OED A;  2Q9Q A;  5EK3 A;  2C5J A;  3RHW A;  3NBX X;  4IDP A;  3BQK A;  3UUN A;  3EI0 A;  4EIW A;  4YXD A;  3NZP A;  2XSA A;  3CQG B;  4AQG A;  4UF0 B;  3WUR A;  3RQU A;  3GA8 A;  4ZI3 D;  4TV9 E;  5L3F B;  5LGT B;  1MMA A;  4YTP A;  4CXW A;  3N9Q A;  4P09 A;  5KXJ A;  2NW9 A;  4U74 A;  4PFO A;  3CKD A;  2W61 A;  4YLH A;  1BR4 A;  2WDQ A;  2JMH A;  4F8H A;  5ETW A;  3GWH A;  2EHO A;  3AE3 A;  5KMG P;  3BK9 A;  2E8I A;  2XM1 A;  4F7G B;  2JQH A;  3S4U A;  4AKH A;  2IHR 1;  3N9N A;  4LF6 T;  3ZN1 B;  5J1G A;  4X65 T;  3MAC A;  1N34 T;  4PJM A;  2H89 A;  3PU8 A;  1HCI A;  1HTJ F;  1ZOY A;  1UCU A;  4AKL A;  2X0L B;  2V7J A;  2XAG B;  5F5W A;  1WR6 A;  5CA1 E;  4MAL A;  2YDR A;  1U4Q A;  3PDY A;  3P7I A;  1OED B;  2CHN A;  2H7O A;  3O1H A;  5LMN T;  5LMU T;  4DV6 T;  2NW8 A;  2Q9Q B;  4TUY E;  3JAD A;  1LKX A;  1W0B A;  3FZL B;  4H9P C;  3TLW A;  3NVO A;  4DID B;  1DU2 A;  5FXW A;  1XMQ T;  1VRB A;  3ZT6 A;  4XBF B;  4ZI2 C;  3N2O A;  5HAX A;  4YJ3 E;  5DQW A;  4JI0 T;  4EB6 E;  3WAK A;  2XQ6 A;  4M1P A;  5F8P A;  5HXS A;  3QK6 A;  4J2C A;  2NTY A;  3RYH E;  1G73 A;  4DO0 A;  3AE6 A;  1HX1 B;  2DHR A;  2W63 A;  1HNW T;  2ZM8 A;  2CE7 A;  2W4X A;  3T1H T;  5JQG E;  4U33 A;  1KF6 A;  2WU2 A;  5JDH A;  2EHO B;  2JMK A;  4O4I E;  5BMV E;  2H3R A;  2YIN A;  5FMN A;  4WBO A;  2RPA A;  3PUQ A;  4YHH T;  3LFM A;  3AE1 A;  3O4X E;  4U2Y A;  1YXR A;  3VRA A;  5LGN B;  2LKG A;  4COF A;  4IE5 A;  3ESL A;  5JDN A;  5HXE A;  4IT4 A;  1IJ5 A;  4UVA B;  3MZK B;  1D1C A;  2BDE A;  4P1N A;  5AQO B;  3PF0 A;  3UU3 A;  4WW0 A;  2WB5 A;  3PHF 1;  2CBJ A;  1NWM X;  2KXP B;  2J1D G;  2V5C A;  5AQV B;  2L8K A;  2M6B A;  2VKO A;  4PJN A;  2L10 A;  3AEA A;  2JQ9 A;  3GMI A;  2VQF T;  5LA6 E;  4TNW A;  2MOZ A;  3P4P A;  5J2T E;  2JQQ A;  4CI3 B;  3NWI A;  5HWY A;  3KVB A;  2A2F X;  1J1J A;  2NR4 A;  3CK6 A;  3EAM A;  1XMO T;  4HWD A;  4DVD A;  2LM2 A;  4O4H E;  1QLB A;  3GN5 A;  1N32 T;  5LNK A;  3CQC B;  1NEN A;  1D0Y A;  3T8O A;  3OBV E;  4DV2 T;  4LFC T;  1HF8 A;  3L09 A;  4HFE A;  2X51 A;  3RKG A;  4BGO A;  3TKL B;  3LSV A;  2D2S A;  4E7Z A;  3HKB E;  2CA5 A;  2E5V A;  3EDU A;  4KX6 A;  4WYV A;  1D1A A;  1M7K A;  2DWK A;  4A5X A;  2IC6 A;  4B3M T;  5HEU A;  3I9Y A;  4LF9 T;  5J0Z A;  4HFI A;  3PU3 A;  3RRW A;  1US7 B;  2W67 A;  2IDO B;  5DAB A;  2C5I T;  5HXH A;  3ZKR A;  3VJZ A;  3PUY F;  4ZI3 C;  3QB5 K;  2WBL A;  4X5T A;  1LRZ A;  1XDP A;  5L3G B;  5LGU B;  3LDQ B;  3ONL C;  5A1L A;  4YSX A;  3N2G E;  4KBM B;  2I6H A;  1VCS A;  3CX6 B;  3GN5 B;  3O1J A;  3AAA B;  3AE2 A;  3PUA A;  1T72 A;  1WLX A;  3KFW X;  5IYZ E;  4AQF C;  4CQI A;  3N9O A;  2A72 A;  1MIV A;  2KLQ A;  3E22 E;  2XAQ B;  4AI6 A;  3Q5E A;  4GIW A;  3LK3 B;  1BR0 A;  3P4R A;  2Y48 B;  4KI0 F;  4Z90 A;  2DCF A;  4F6R C;  2A9U A;  2V8S V;  2BG9 C;  2XPK A;  5EK4 A;  3RYF E;  2QA7 A;  3FXE B;  3PE0 A;  5M4Y A;  3OTO T;  4HWI B;  3AE9 A;  3RIF A;  4EAH A;  4GKK T;  4OYJ A;  3VKH A;  4CN1 A;  3K3O A;  1MNE A;  2MBG A;  4O4J E;  2XQY A;  4TWH A;  4U7I A;  3AEG A;  5JRE A;  2M67 A;  2VUR A;  4EEB A;  1YKH B;  3UUX B;  2X0H A;  3AXJ A;  3AEE A;  1MMD A;  2X0Y A;  2CM0 A;  1JNR A;  4IDZ A;  4AIS A;  4JI6 T;  3P50 A;  2YEV C;  2E9X C;  2XAS B;  3RRC A;  4ZXL A;  3CVR A;  5AQR B;  2UXD T;  3OYZ A;  3OYX A;  1SJ7 A;  3PJA A;  3IBP A;  3LK2 B;  2LEH A;  1VCT A;  3FHN A;  3R6N A;  3FXD B;  5JRC A;  3AEF A;  1W09 A;  3KV5 A;  3N5L A;  3QC9 A;  3F57 A;  2CMR A;  2DLR A;  3M65 A;  1UX5 A;  2NP9 A;  1T8B A;  3R84 B;  3ZMV B;  3DP7 A;  5FY0 A;  4ADZ A;  3ZPO A;  5FXZ A;  3X1D A;  3SS1 A;  4H63 H;  2VL8 A;  1IBK T;  3AA6 B;  3SOL A;  5LJN A;  4DUY T;  1HNX T;  4ERR A;  5IHY A;  4YJ2 E;  4U7Y A;  1X79 A;  4EXT A;  4EV6 A;  5DJQ C;  4UVC B;  2ACZ A;  4LF4 T;  2L9Q A;  2XM2 A;  4N78 D;  3MKD A;  4ZS3 A;  1YQ3 A;  4I55 E;  4HFC A;  4YTN A;  3AXJ B;  3VKG A;  4U31 A;  1SE7 A;  1G8X A;  2H88 A;  4IE6 A;  1IZN B;  1QUU A;  3M1C A;  3PUG A;  4HWF A;  2MTQ A;  2ZLY A;  2KT9 A;  3QB5 A;  4BJN A;  2V7L A;  2LM9 A;  5L47 A;  3UQ7 A;  1ZV4 X;  2V1D B;  2VAS A;  3L8R A;  2WWU A;  4JYA T;  4PK4 A;  5AQL B;  2DL1 A;  4LMK A;  1LVK A;  1SA0 E;  4V1A v;  4DV5 T;  2XTL A;  2WWV A;  3DTO A;  4IST A;  5JRC B;  5AQK B;  1IAP A;  4AXP A;  3HKE E;  2CLY B;  3HI2 A;  2K24 A;  1ZEE A;  3UQ4 A;  4HWH A;  2CEA A;  4PK5 A;  3UUL A;  1KEY A;  3JC6 C;  1V9D A;  2NTX A;  2BVL A;  2BKP A;  3W15 B;  1LVF A;  3Q2M A;  3ONX A;  3AVS A;  2ACX A;  4QH5 A;  4BA9 A;  3H3A A;  4EYY R;  1Y64 B;  1S94 A;  4LF5 T;  2XQ8 A;  1I6Z A;  5FKY A;  2KWH A;  3OVU A;  5LG4 A;  1FMW A;  2K48 A;  1WYC A;  4HFH A;  4LF8 T;  1FEW A;  4X66 T;  1KNR A;  2IUB A;  2DWG A;  1T98 A;  2WQY A;  4ANJ A;  3FZK B;  3KV4 A;  1NEK A;  2X9Y A;  5FP3 A;  2XAF B;  4LMJ A;  5CJ5 A;  4DR1 T;  3U78 A;  4HGA A;  2WDV A;  5FZT A;  2XQ5 A;  2Y6X A;  4DBR A;  2QRX A;  4CN4 A;  2ZM6 T;  2VK9 A;  2ES0 A;  4UR9 A;  4I43 B;  4EGW A;  5C8Y E;  2B76 A;  3VR9 A;  1D0Z A;  2XZE A;  2NWB A;  2WZI A;  1W9R A;  3FYQ A;  4X20 E;  5KX5 E;  2CCQ A;  2Q9Q D;  3NKZ A;  4ILB A;  2WDR A;  3AED A;  4PJJ A;  4A97 A;  2UXN B;  1HG2 A;  3RC3 A;  2OA5 A;  2VVN A;  5CFB A;  1IBL T;  2LOP A;  4ZZB A;  4YHJ A;  3Q5D A;  3RPU A;  3FZF B;  3RGL A;  2RA1 A;  4ZEY A;  4GOU A;  1IBM T;  5HEG A;  4I4T E;  5LHH B;  5L3C B;  2LKH A;  2EHO D;  3PUX F;  1W0A A;  4JV5 T;  2XQA A;  2AE9 A;  4JI2 T;  1IJ6 A;  4O2A E;  2NW7 A;  2R6G F;  2Z6E A;  4AIU A;  4HFV A;  3HL6 A;  1WCR A;  3UUM A;  3VHL A;  3EDV A;  3P4Q A;  4HTE A;  2CXD A;  3H37 A;  4QH4 A;  5EZY E;  3TLV A;  2LLY A;  4ZZC A;  2CBI A;  2LSI A;  4X1K E;  3IHR A;  1H7C A;  2X68 A;  3C4Z A;  4JEU B;  2JIW A;  5FY7 A;  3AA0 B;  3EVY A;  3ZEF B;  2RP4 A;  4CI2 B;  2HPJ A;  3UU8 A;  2CPT A;  2XQ9 A;  5J2U E;  4HKA A;  4CN6 A;  1MMN A;  2PTF A;  2KSR A;  4DBQ A;  3Q5W A;  3ZT5 A;  3HR0 A;  5LOV E;  2N9D A;  2FJB A;  4AKG A;  2QYW A;  1XNR T;  3ZSS A;  3CX7 B;  2VB6 A;  3KIN B;  4TNV A;  1J5E T;  2BBJ A;  5F3J A;  5HXC A;  1WFD A;  2X0C A;  4FI5 A;  3ZYL A;  3C64 A;  4HFD A;  3EHZ A;  2LQU A;  4NXN T;  2W00 A;  3L39 A;  3TLT A;  5L2L A;  3ANW A;  1WYB A;  5LHI B;  2CXL A;  2BKO A;  5AQH B;  3SFE A;  4TWD A;  3AEC A;  3UFE A;  5FNV E;  4JI4 T;  4IL4 A;  2FJD A;  4NIQ A;  3PUZ F;  5AQQ B;  2MPK A;  3AE8 A;  4XZC A;  5KDM C;  4MHC A;  2NOX A;  5TAO A;  2LRK A;  4TV8 E;  3PV0 F;  2MAW A;  2FBW A;  4O2B E;  3C51 A;  5L3D B;  1FIO A;  1E7P A;  3RKO A;  4OK0 A;  2LT3 A;  2WAU A;  3O1I A;  2YK0 A;  5FL0 A;  3N2K E;  2VQE T;  2XHE B;  4K0U A;  3A8Y C;  5FXX A;  1YD8 G;  1SJ8 A;  4MLK A;  2V7M A;  2IML A;  3B13 A;  3RYC E;  3KDS E;  1KK7 A;  2UU9 T;  4NUV A;  2PFV A;  2C5K T;  3WI3 A;  4ECG A;  3RLF F;  4OFZ A;  5FY1 A;  1XDO A;  3QUJ A;  2E5L T;  2PG8 A;  3UUB A;  4ZOL E;  3K8P C;  3P4S A;  4ZI7 E;  4H9R C;  4OYK A;  3RC8 A;  3KVA A;  5CGM A;  2BZB A;  2PBI A;  2I59 A;  5HEH A;  4KMC A;  5LB7 B;  4LFA T;  4PW8 A;  1UK5 A;  4ZI2 D;  3BQL A;  3PUW F;  4IDQ A;  4UV9 B;  2CWY A;  4I0U A;  3CQX C;  5FYM A;  4IHJ E;  2YDQ A;  3ANW B;  4JI5 T;  3CIR A;  2LSG A;  2ZM0 A;  1VOM A;  4HN9 A;  2W0G A;  3KBT A;  4H9S E;  3DYJ A;  3UU4 A;  5H6R B;  1EZ3 A;  2V5D A;  5HEJ A;  4QXC B;  5LXT E;  1I94 T;  2LSJ A;  1OED C;  2KZ7 B;  2V7I A;  3AVR A;  4JI7 T;  2WS3 A;  1YW0 A;  3UT5 E;  2WCA A;  4PK6 A;  5L3B B;  4YFS A;  4PJL A;  4KHP T;  2Y8D A;  2W62 A;  5C3J A;  3NRY A;  5JH7 E;  2K9A A;  4G2A A;  1T7S A;  4L5G A;  1M62 A;  5HEO A;  4Z8X A;  4GK0 E;  3TLS A;  2SPC A;  3QOF A;  2XSB A;  1AJ3 A;  2LE8 A;  3VRB A;  3ZJ2 A;  4BAY B;  3K1S A;  1J5W A;  2EHO C;  4IDN A;  2XQ7 A;  3ZJ1 A;  4A56 A;  2V26 A;  5LG3 A;  2MYS A;  4UV8 B;  4ZHQ E;  2YU1 A;  4AQF A;  4JLE A;  1CUN A;  4KP3 C;  2LHR A;  4NXM T;  4H9Q C;  1X9B A;  3A7M A;  5GON E;  4YSZ A;  3ZN0 B;  4Z91 A;  2LOS A;  1OWA A;  4DMV A;  2H7V C;  4OHF A;  3AE4 A;  3B57 A;  2BG9 A;  5IUX A;  4TZ4 C;  2N1G A;  2PJQ A;  4TX5 A;  4ZS2 A;  3BQI A;  3ZYK A;  5JVD E;  3FZH B;  5L4E A;  2W66 A;  4JI8 T;  3PUS A;  3PUR A;  2KND A;  3N9P A;  4ILA A;  5HCM A;  5C2T A;  4W8P A;  4MFR A;  4DR5 T;  1BR2 A;  2YKS A;  3IF8 B;  3RIU C;  3RI5 A;  5JDL A;  2X67 A;  1MMG A;  3VR8 A;  4YT0 A;  2E9X A;  4XAX B;  3C4X A;  3AT7 A;  4DUZ T;  4UXN B;  3AE5 A;  1YQ4 A;  1D0X A;  3J7Y q;  3IA3 A;  1HR0 T;  4WNK A;  5ABE A;  1E1H B;  2HN2 A;  2XQ3 A;  3ZMT B;  3UU5 A;  2BVM A;  1N33 T;  1SUM B;  4IGU A;  4O4L E;  4U3C A;  1E2A A;  3JAE A;  2ODU A;  2KMF A;  3LBX A;  2KVP A;  3NRX A;  2BS2 A;  3A5X A;  2V6X A;  4GKJ T;  1QSD A;  5LBQ B;  2BG9 B;  4ILC A;  4UIG A;  2LHN A;  3CML A;  5LP6 E;  4PAG A;  2ODV A;  2QGS A;  4U2Z A;  3RH3 A;  3N9L A;  5L4H A;  3AAI A;  5CA0 E;  1ZHC A;  2VVS A;  4X62 T;  3CPZ A;  2V6Y A;  4JEH B;  3RYI E;  2KIN B;  2MTC A;  5AQM B;  1L0V A;  2LSK A;  2OLT A;  3MA9 A;  4DND A;  2KWI B;  4ONR A;  2J47 A;  4P0B A;  3I1A A;  3ZMS B;  4WBN E;  2UUB T;  3P8C D;  3AAE B;  5L3E B;  4DV4 T;  1HG5 A;  4C90 A;  3C98 B;  3KBU A;  3MJX A;  3AY5 A;  2E9X B;  2VWA A;  3UFG A;  5HXR A;  5LBM A;  3AA7 B;  2F4V T;  3K3Q C;  4UVB B;  4PNI A;  3ZC1 A;  4C91 A;  2HHH T;  4U72 A;  3M3Z B;  2CRB A;  3MXZ A;  4QX8 B;  2E9X D;  5LJM A;  2XAH B;  3N9M A;  2J4G A;  2XUE A;  5JDF A;  4DV0 T;  2L7N A;  3RIU A;  2E2A A;  3LBX B;  5JDM A;  5EK2 A;  4L0R A;  4CZZ B;  3WAJ A;  1CHU A;  4EOZ B;  4E7S A;  4YTM A;  1GQE A;  4DV3 T;  5ABF A;  2HH7 A;  4HEA A;  4YSY A;  4DV7 T;  4IL9 A;  3WSC A;  3VU7 H;  2J62 A;  3ZC0 A;  4IRE A;  2V6Y B;  4DR6 T;  3E0Z A;  2LRL A;  3ZMU B;  2X9W A;  3LG7 A;  4QWN B;  1HNZ T;  2KGX A;  3V5U A;  5AFU L;  3JAF A;  2IAK A;  4G63 A;  1U5P A;  3ABV A;  4OX9 T;  3FBZ A;  3AE7 A;  3PJA J;  1KNZ A;  1N36 T;  1BR1 A;  3FBL A;  2YN6 A;  4EZH A;  5ABG A;  5FVK A;  5HYA A;  2P9B A;  4B3T T;  2CHO A;  4JI1 T;  2UXB T;  3U3I A;  3QNU A;  2JQK A;  2N2N A;  5FVL A;  3AB3 B;  2I0M A;  1WRD A;  3ETV A;  2QVA A;  5AQP B;  1KFY A;  3I0O A;  1MIY A;  2BS4 A;  1UGO A;  4GK5 E;  3NZQ A;  2BBH A;  3P4W A;  4AKI A;  5H6Q B;  4CXX A;  4JBW F;  4AKR B;  4JI3 T;  4UEM A;  4ASK A;  1YKE B;  2FJE A;  3PUV F;  2GK9 A;  4GYS A;  3LJC A;  3ONJ A;  2IC9 A;  3TLU A;  2G0U A;  3EAB A;  3UU6 A;  1Z8U A;  5ABF B;  4JUY A;  4H9N C;  1UUR A;  4QH1 A;  3K3N A;  4QXH B;  1XWM A;  1JNZ A;  2W2U A;  5ABH A;  4LF7 T;  4X1I E;  3O9X A;  3OPC A;  3ZLI A;  1D1B A;  1HFA A;  5HWX A;  3JC6 D;  2A3D A;  3SFD A;  2WP9 A;  2WZH A;  3I9W A;  1UUS A;  2V7K A;  2YDS A;  4FJO A;  3FZM B;  1XNQ T;  4QKN A;  4NUU A;  5JR9 C;  3UTK A;  3D0T A;  3E08 A;  3T1Y T;  2FJA A;  5AQJ B;  2UXC T;  3OJA A;  5E0O A;  3H3M A;  4K0K T;  2ZM2 A;  4WZX A;  5FL1 A;  4X1Y E;  3CX8 B;  2HPL A;  2CLY C;  2K3W A;  3RF1 A;  4IE4 A;  5CB4 E;  4X64 T;  5IWA T;  2DNX A;  2D0U A;  2ZMA A;  1S35 A;  1O3X A;  3L3P A;  2XAJ B;  5DQV A;  4QXB B;  4DR4 T;  5JDG A;  3ZCI A;  1OXZ A;  2LSY A;  4B3R T;  4AQY T;  2YU2 A;  2OV9 A;  4BJM A;  2JRK A;  4TWF A;  3F31 A;  4QHO A;  1ZP0 A;  4Q25 A;  3J9X 1;  2VL0 A;  4I50 E;  1Z0P A;  3ZT7 A;  3HKD E;  2UUA T;  3FB2 A;  4TN7 B;  4YY3 T;  3OKQ A;  2XY8 B;  4CI1 B;  2WY2 A;  2VKH A;  2UUC T;  2BG9 E;  1KNP A;  1Y01 A;  2B1E A;  1R8I A;  4CXY A;  3AEB A;  2LJL A;  3KV6 A;  4KUM B;  4HE8 A;  4B3S T;  1FJG T;  4DMW A;  4P0A A;  5AQU B;  2D9D A;  3CWZ B;  3DJB A;  1WR0 A;  3I0Q A;  4PFP A;  2Q9Q C;  2IIU A;  3Q9D A;  4HFB A;  2BKN A; 
#chains in the Genus database with same CATH homology
 2C0S A;  1BR2 A;  4GYR A;  3EDU A;  2OA5 A;  3IF8 B;  2LOP A;  1D1A A;  4YHJ A;  3RPU A;  2JJ9 A;  5JDL A;  2D0T A;  2DWK A;  2X67 A;  1MMG A;  2IC6 A;  2RA1 A;  2E9X A;  3LK4 2;  4XAX B;  3C4X A;  3AT7 A;  2X9H A;  4GOU A;  3I9Y A;  4UXN B;  4MBQ A;  4I4T E;  5LHH B;  1D0X A;  4IIJ E;  3J7Y q;  3C50 A;  4O8S A;  3PU3 A;  5L3C B;  3RRW A;  4EYU A;  4WNK A;  1E1H B;  1US7 B;  1HS7 A;  3PTR B;  5DAB A;  2L3L A;  3Q5X A;  2C5I T;  2EHO D;  5LYJ E;  3ZMT B;  5JR9 A;  5HXH A;  5FXV A;  2BVM A;  1SHZ C;  3VJZ A;  3RX6 A;  4IGU A;  4O4L E;  4EZ4 A;  4ZI3 C;  1UX4 A;  2VKJ A;  2ODU A;  2K5B B;  5T1D A;  1IJ6 A;  2KMF A;  3LBX A;  4O2A E;  2NW7 A;  2WBL A;  3NRX A;  2IW5 B;  1LRZ A;  3A5X A;  2Z6E A;  1B7T A;  5LCY A;  5L3G B;  5JDQ A;  1NAF A;  3HKC E;  4H9O C;  5LGU B;  4UF0 A;  5A1L A;  1QSD A;  3N2G E;  3EUH A;  4KBM B;  5LBQ B;  3V5S A;  3CX6 B;  3SRZ A;  4HFV A;  3IEE A;  2X9X A;  5ADX L;  3GN5 B;  3HL6 A;  3O1J A;  4UIG A;  3AAA B;  3HA4 A;  4IE7 A;  2LHN A;  3CML A;  3PUA A;  3ZCJ A;  5LP6 E;  4PAG A;  2ODV A;  1WLX A;  2QGS A;  3KFW X;  3UUM A;  3RH3 A;  3VHL A;  3C4W A;  3N9L A;  3EDV A;  3AAI A;  5LHG B;  4HTE A;  2CXD A;  3H37 A;  5EZY E;  5IYZ E;  4AQF C;  4ISS A;  4CQI A;  3MK7 C;  3N9O A;  5CA0 E;  2LSI A;  4X1K E;  1ZHC A;  2A72 A;  3CPZ A;  3IHR A;  1MIV A;  2WSS V;  2VKD A;  2KLQ A;  3E22 E;  1H7C A;  1MND A;  2X68 A;  2XAQ B;  3C4Z A;  2WMO A;  4JEH B;  3SWH A;  3ZMZ B;  2JPF A;  3RYI E;  4AI6 A;  4JEU B;  4UEL A;  4GIW A;  2KIN B;  2MTC A;  5FY7 A;  2LSK A;  3LK3 B;  3MA9 A;  4DND A;  1BR0 A;  2KWI B;  2Y48 B;  4ONR A;  4P0B A;  3AA0 B;  2WMN A;  2DCF A;  3EVY A;  3I1A A;  4H63 V;  4F6R C;  2DI4 A;  3ZEF B;  2X66 A;  3ZMS B;  4WBN E;  2RP4 A;  3AA1 B;  3P8C D;  4CI2 B;  4B6X A;  2D5U A;  3AAE B;  2HPJ A;  3ETU A;  5L3E B;  5EK4 A;  3RYF E;  2QA7 A;  3FXE B;  1FMV A;  1ZKE A;  3KV9 A;  3PE0 A;  1HG5 A;  3ZYM A;  5M4Y A;  2UXX B;  4C90 A;  5J2U E;  4L9I A;  4EAH A;  3C98 B;  4HKA A;  3KBU A;  3MJX A;  1MMN A;  2E9X B;  3F2E A;  4OYJ A;  2VWA A;  3VKH A;  4DBQ A;  3Q5W A;  3K3O A;  3HR0 A;  5LOV E;  5HXR A;  2N9D A;  1MNE A;  2WM9 A;  4IE0 A;  2MBG A;  4QX7 B;  1HG2 A;  4O4J E;  4AKG A;  2XQY A;  1HX8 A;  5LBM A;  3AA7 B;  3K3Q C;  4UVB B;  4PNI A;  3ZC1 A;  4C91 A;  3CX7 B;  2VB6 A;  5JRE A;  2CWO A;  3KIN B;  4ILU A;  2M67 A;  4U72 A;  5F3J A;  1MIW A;  5HXC A;  1YKH B;  2CXF A;  3MXZ A;  3UUX B;  4QX8 B;  5JR9 B;  2E9X D;  5LJM A;  4FI5 A;  2XAH B;  2Q9Q A;  3N9M A;  3ZYL A;  3C64 A;  1MMD A;  5EK3 A;  2C5J A;  2XUE A;  3NBX X;  3UUN A;  3BQK A;  2LQU A;  5JDF A;  2CM0 A;  2W00 A;  4IDZ A;  5L2L A;  3ANW A;  1WYB A;  3LBX B;  5LHI B;  2YEV C;  5JDM A;  4EIW A;  2E9X C;  5EK2 A;  3NZP A;  2CXL A;  3CQG B;  4L0R A;  2XAS B;  4CZZ B;  4AQG A;  4UF0 B;  3RRC A;  3UFE A;  3WAJ A;  3WUR A;  5FNV E;  3CVR A;  4EOZ B;  4E7S A;  3GA8 A;  4ZI3 D;  4TV9 E;  5L3F B;  3OYZ A;  3OYX A;  5LGT B;  3IBP A;  3LK2 B;  4XZC A;  1MMA A;  5KDM C;  4MHC A;  4CXW A;  2LEH A;  3N9Q A;  2NOX A;  5TAO A;  2HH7 A;  4HEA A;  4P09 A;  4TV8 E;  3FHN A;  4O2B E;  3WSC A;  3C51 A;  2NW9 A;  3VU7 H;  1FIO A;  5L3D B;  3R6N A;  4U74 A;  3FXD B;  4PFO A;  3RKO A;  4OK0 A;  2LT3 A;  3ZC0 A;  2WAU A;  5JRC A;  3O1I A;  2YK0 A;  3CKD A;  2W61 A;  4YLH A;  3KV5 A;  3E0Z A;  3N5L A;  3QC9 A;  3ZMU B;  1BR4 A;  3N2K E;  3F57 A;  2CMR A;  2DLR A;  2JMH A;  5ETW A;  2XHE B;  3GWH A;  4K0U A;  2EHO A;  3M65 A;  2X9W A;  5KMG P;  3LG7 A;  4QWN B;  3BK9 A;  5FXX A;  1UX5 A;  2E8I A;  2NP9 A;  1YD8 G;  4MLK A;  3V5U A;  5AFU L;  2V7M A;  3R84 B;  3B13 A;  3RYC E;  2IAK A;  3ZMV B;  4G63 A;  3KDS E;  3S4U A;  1U5P A;  4AKH A;  1KK7 A;  3DP7 A;  3N9N A;  4NUV A;  5FY0 A;  2PFV A;  3ZN1 B;  4ADZ A;  2C5K T;  3WI3 A;  5J1G A;  3ZPO A;  3MAC A;  5FXZ A;  3FBZ A;  4ECG A;  4OFZ A;  4H63 H;  2VL8 A;  4PJM A;  3SS1 A;  1KNZ A;  3PU8 A;  3AA6 B;  1BR1 A;  1HCI A;  5FY1 A;  3SOL A;  1HTJ F;  5LJN A;  3FBL A;  3QUJ A;  1UCU A;  4AKL A;  2PG8 A;  4EZH A;  2X0L B;  4ZOL E;  3K8P C;  5HYA A;  4ERR A;  5IHY A;  2V7J A;  4YJ2 E;  1X79 A;  2P9B A;  4ZI7 E;  4EXT A;  5DJQ C;  2XAG B;  4H9R C;  4UVC B;  2L9Q A;  4N78 D;  4OYK A;  1WR6 A;  5CA1 E;  3U3I A;  3MKD A;  3RC8 A;  4ZS3 A;  4MAL A;  3KVA A;  3PDY A;  1U4Q A;  2BZB A;  2N2N A;  2PBI A;  4I55 E;  3P7I A;  2I59 A;  3AB3 B;  4KMC A;  1WRD A;  3ETV A;  2H7O A;  4PW8 A;  3O1H A;  3VKG A;  4ZI2 D;  2NW8 A;  2Q9Q B;  3BQL A;  4TUY E;  1G8X A;  3I0O A;  4UV9 B;  1LKX A;  1MIY A;  4IE6 A;  1IZN B;  2CWY A;  1QUU A;  3M1C A;  4GK5 E;  3PUG A;  3CQX C;  4H9P C;  5FYM A;  2MTQ A;  2ZLY A;  3NZQ A;  4IHJ E;  2KT9 A;  3ANW B;  5FXW A;  4BJN A;  4AKI A;  2V7L A;  5H6Q B;  2LM9 A;  4CXX A;  1VRB A;  4AKR B;  4XBF B;  4ZI2 C;  4UEM A;  3N2O A;  4ASK A;  2LSG A;  1ZV4 X;  1YKE B;  2ZM0 A;  5HAX A;  2V1D B;  1VOM A;  4YJ3 E;  2GK9 A;  5DQW A;  4HN9 A;  2W0G A;  2VAS A;  3KBT A;  4GYS A;  4H9S E;  3WAK A;  4EB6 E;  4M1P A;  3LJC A;  2WWU A;  5F8P A;  2IC9 A;  2G0U A;  5H6R B;  4PK4 A;  1EZ3 A;  4JUY A;  1LVK A;  4H9N C;  1SA0 E;  4QXC B;  5LXT E;  4V1A v;  5HXS A;  3QK6 A;  2LSJ A;  2XTL A;  3K3N A;  4J2C A;  3DTO A;  2KZ7 B;  2NTY A;  4IST A;  1G73 A;  3RYH E;  4DO0 A;  4QXH B;  2DHR A;  5JRC B;  2V7I A;  1IAP A;  2W63 A;  3AVR A;  4AXP A;  3HKE E;  2ZM8 A;  1YW0 A;  3UT5 E;  2CE7 A;  4X1I E;  3O9X A;  2CLY B;  3HI2 A;  3ZLI A;  4PK6 A;  5L3B B;  4YFS A;  2K24 A;  5JQG E;  1D1B A;  1HFA A;  5HWX A;  4PJL A;  5JDH A;  3JC6 D;  2EHO B;  2A3D A;  2Y8D A;  2W62 A;  2JMK A;  3NRY A;  4O4I E;  5JH7 E;  2K9A A;  5BMV E;  4G2A A;  3I9W A;  2H3R A;  1ZEE A;  2YIN A;  5FMN A;  4WBO A;  3PUQ A;  2V7K A;  3LFM A;  4L5G A;  2CEA A;  3O4X E;  4FJO A;  4PK5 A;  3UUL A;  3JC6 C;  1V9D A;  4QKN A;  4NUU A;  5JR9 C;  4Z8X A;  2NTX A;  3UTK A;  3D0T A;  2BVL A;  4GK0 E;  5LGN B;  3W15 B;  3E08 A;  1LVF A;  3Q2M A;  3ONX A;  2SPC A;  4IE5 A;  3ESL A;  3AVS A;  5JDN A;  5HXE A;  2ACX A;  1IJ5 A;  4UVA B;  3MZK B;  1D1C A;  2BDE A;  4BA9 A;  3OJA A;  5E0O A;  3H3A A;  3PF0 A;  2ZM2 A;  4WW0 A;  1AJ3 A;  4X1Y E;  3CX8 B;  2LE8 A;  2HPL A;  4EYY R;  1Y64 B;  2CLY C;  1S94 A;  3PHF 1;  3ZJ2 A;  4BAY B;  4IE4 A;  5CB4 E;  1NWM X;  2EHO C;  2KWH A;  2DNX A;  2D0U A;  5LG4 A;  3ZJ1 A;  4A56 A;  1FMW A;  2ZMA A;  1S35 A;  2V26 A;  1O3X A;  2K48 A;  1WYC A;  2J1D G;  2KXP B;  2MYS A;  3L3P A;  2XAJ B;  2L8K A;  4UV8 B;  4ZHQ E;  5DQV A;  2YU1 A;  2VKO A;  4PJN A;  4QXB B;  5JDG A;  1FEW A;  3ZCI A;  1OXZ A;  2LSY A;  2DWG A;  1T98 A;  4AQF A;  4JLE A;  4ANJ A;  1CUN A;  3GMI A;  4KP3 C;  2LHR A;  3KV4 A;  5LA6 E;  4H9Q C;  2MOZ A;  2YU2 A;  2X9Y A;  5FP3 A;  4BJM A;  5J2T E;  2JRK A;  2JQQ A;  3F31 A;  5GON E;  4CI3 B;  4QHO A;  5HWY A;  3ZN0 B;  2XAF B;  3KVB A;  2A2F X;  3J9X 1;  4I50 E;  1Z0P A;  2LOS A;  1OWA A;  3U78 A;  3HKD E;  4HGA A;  4DMV A;  2H7V C;  4OHF A;  4DVD A;  2Y6X A;  3B57 A;  3FB2 A;  4TN7 B;  4DBR A;  3OKQ A;  2VK9 A;  4O4H E;  3GN5 A;  2ES0 A;  4CI1 B;  4I43 B;  2VKH A;  5LNK A;  3CQC B;  1D0Y A;  4TZ4 C;  2N1G A;  2PJQ A;  4TX5 A;  5C8Y E;  2B1E A;  3T8O A;  3OBV E;  4CXY A;  4ZS2 A;  2LJL A;  1D0Z A;  2NWB A;  3KV6 A;  4KUM B;  4HE8 A;  3BQI A;  3ZYK A;  5JVD E;  1HF8 A;  3L09 A;  4X20 E;  5KX5 E;  2CCQ A;  2X51 A;  2Q9Q D;  4DMW A;  4BGO A;  3PUS A;  3TKL B;  4P0A A;  3PUR A;  3CWZ B;  3DJB A;  2D2S A;  3I0Q A;  4E7Z A;  3HKB E;  2KND A;  3N9P A;  4PJJ A;  2CA5 A;  4PFP A;  2Q9Q C;  3Q9D A;  4MFR A;  2UXN B;  3RC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...