5JDQA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 100 mm na+ and 10mm sr2+
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
Knots found
sequence length
301
structure length
296
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIENNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Uncharacterized membrane protein MJ0091
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
total genus 127
structure length 296
sequence length 301
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdqA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdqA02
5JDQA 5HXCA 5JDGA 5HXSA 5JDHA 5HYAA 5JDNA 5JDMA 3V5SA 5HXHA 5JDLA 5HWYA 5HWXA 5HXRA 5HXEA 5JDFA 3V5UA
chains in the Genus database with same CATH superfamily
3Q2MA 2V8SV 1XZYA 2XQYA 3N9MA 1QSDA 1T7SA 3O1HA 4UEMA 4B3TT 4JI7T 2WZHA 3HKDE 4DR7T 2QVAA 4OK0A 3PDYA 4CN6A 3NVOA 4QXHB 2E9XD 2XAGB 5JH7E 4ILBA 5LYJE 4JYAT 5HXEA 4JI4T 3PU8A 2UXBT 3L09A 1HX1B 5HEOA 3U3IA 2EHOA 1MNEA 2OA5A 3EUHA 2H7VC 2XPKA 2LSIA 2IUBA 3A5XA 5GONE 1L0VA 3ZC1A 1N34T 2Y6XA 5LHGB 2J1DG 1U4QA 2X0HA 3UU6A 5FXZA 4NXMT 4BJNA 4GYRA 3W15B 4EGWA 5HEHA 4H9PC 2NW9A 4O4HE 5AQPB 3CQCB 2PFVA 2A9UA 5JR9A 2X9YA 2JRKA 4UR9A 3ZYKA 4DV5T 5AQVB 3PUXF 4TWDA 2VKOA 3Q9DA 2X68A 3ZKRA 2IHR1 3ETVA 3ABVA 5FNVE 3RKOA 5FY1A 4A56A 1J5WA 2BKNA 1E7PA 4AIUA 3UT5E 3NWIA 5AQKB 4DR6T 3ANWB 1FJGT 2HPLA 1JNZA 2X0CA 3K8PC 3RF1A 4KHPT 4UF0A 2UUAT 4WYVA 2H3RA 3UU8A 1HS7A 3O1JA 4KHZF 4JV5T 2I6HA 4TV9E 5DJQC 5FKYA 3HA4A 4UVAB 3F57A 3K3NA 4I50E 4IHJE 3JC6C 3MZKB 2XHEB 5LA6E 4HWFA 3UQ4A 4CXWA 1ZV4X 3PUZF 3ZEFB 4LFBT 2C0SA 4IL4A 3CQGB 3AEDA 4UIGA 4IGUA 1HNWT 3ZJ2A 4TWFA 2VB6A 2XQ3A 3SWHA 2IC6A 2VKHA 3N5LA 5ADXL 2CCQA 5LOVE 2ODVA 1SA0E 3UTKA 5FP3A 2MOZA 4EIWA 4JBWF 1DU2A 3LJCA 3NRYA 4PFPA 5L3DB 2CXFA 3C98B 4HFCA 1UCUA 4JI5T 2AXDS 3P4SA 2X0YA 5AFUL 2MPKA 3PJAJ 4O4LE 5C2TA 3LBXA 1WYCA 2VQET 3QOFA 4AKLA 5HXHA 1N32T 2HPJA 4YHHT 3RPUA 3L39A 4F7GB 5IUXA 3ZMUB 3IA3A 3OYZA 2CXDA 5EK3A 4YTNA 1M62A 3ONXA 3KBTA 2QA7A 3ETUA 5ABGA 4PFOA 1N36T 1MMDA 4GKKT 2WSSV 3B13A 4C91A 4H9SE 5AQSB 3Q5DA 2FJDA 1VRBA 4PJLA 4EXTA 2UU9T 2K24A 1X9BA 1I6ZA 4X5TA 5AQJB 2DNXA 4IE5A 2CPTA 3CX8B 4ZHQE 3KINB 1XMOT 1LVFA 3TLSA 2C5KT 1Y64B 3DTOA 3UU3A 2FUPA 3UUNA 5J0ZA 1XDOA 5L3CB 3Q5WA 3LK2B 4JI3T 3OJAA 2DL1A 3DJBA 2LQUA 4E7SA 2ZMAA 4NUUA 3AE5A 3EABA 4NPPA 4HWHA 5JDNA 3M3ZB 3KV5A 2W2UA 4OFZA 5AQMB 3AA1B 1OEDE 2XQ6A 1WR6A 4WW0A 5IHYA 3FZFB 2BVLA 2D9DA 2K3WA 3AE1A 2V6YA 1X79A 4DV2T 3E0ZA 2KWHA 4BAYB 2DI4A 3TLWA 3VJZA 4NXNT 3VKHA 3ZN0B 2E2AA 3I9YA 3KDSE 5CGMA 1SHZC 3UUBA 4H9RC 3GN5B 5HEGA 2B76A 3O4XE 3EDVA 5ABHA 4X62T 4EYYR 4AXPA 4IREA 4BJMA 2JQHA 1S94A 3TLUA 3UQ7A 3JCFA 5CJ5A 3ZMTB 1UGOA 5FZTA 3CX7B 5J1GA 3CK6A 2L9QA 1D1CA 4P0BA 5JTGA 3AA0B 2D0TA 1MMGA 2LSKA 1IBLT 1I94T 2M67A 3E08A 4DUYT 3KBUA 3I1AA 5FVKA 5HCJA 3ZSSA 1O3XA 2LHRA 3HKEE 2PBIA 4JEUB 3N2OA 4ZS2A 3KV9A 5KXJA 3FBLA 3Q5XA 3AAEB 2K48A 3FYQA 5LBQB 2WS3A 2IAKA 2Y8DA 1OEDA 4YT0A 3FXDB 2DHRA 4TWHA 3AE3A 1YKEB 2ODUA 2WDQA 2VVNA 2LHNA 5JDQA 3UUMA 3RH3A 2RA1A 2YDSA 2XQ7A 2FBWA 2W67A 4MHCA 1YQ4A 2VURA 4MBQA 2Z6EA 5AQLB 1Z8UA 3AEGA 5IWAT 4U2YA 5AQRB 4AKIA 5KDMC 3IF8B 3P4WA 3KVBA 3MK7C 4H9QC 3OVUA 3VRAA 4ADZA 4EEBA 1UX5A 2LSJA 4E7ZA 4CQIA 1XDPA 3PE0A 3KVAA 4I43B 4B3ST 2VKDA 3JAEA 5FXWA 5EZYE 5KX5E 5LXTE 5AQUB 2W62A 4MLKA 2EHOB 2KSRA 4DIDB 4YJ2E 1MNDA 3EVYA 3HKCE 2WY2A 2VQFT 5AQHB 5C8YE 2I0MA 4XZCA 3RC3A 2ZM6T 5BMVE 1HX8A 2L7NA 4F6RC 4L5GA 3RIUA 3UUXB 2B1EA 4HFBA 3N2KE 3ZT6A 1KNRA 4QXBB 4Z8XA 2XZEA 4A98A 2YKSA 5ABEA 4HFHA 2L8KA 3ZCJA 2A2FX 4EV6A 4LFAT 2YOEA 5JR9B 1YD8G 2KZ7B 1KNZA 4OYJA 1WCRA 5HAXA 1XMQT 5T1DA 3AE9A 4DR5T 3VR8A 4LF5T 2Y48B 1ZHCA 3C4XA 3B57A 2IIUA 3RLFF 1SJ7A 3NZPA 5HCMA 4JI8T 2NTYA 1ZOYA 4JI6T 3RX6A 3O1IA 2LLYA 2CBIA 4U74A 4X20E 4KUMB 2CBJA 1LVKA 4ZI3D 3H37A 4ILCA 2W00A 3JADA 4DO0A 3ZT7A 3UULA 2CLYC 2Q9QA 4O4JE 4P0AA 4PK5A 5FY0A 3RYHE 3IEEA 4UF0B 4PK6A 2XSBA 4QH1A 2PJQA 5CA0E 2E5LT 2FJAA 1W09A 4HFIA 2JQQA 4HWDA 4DMVA 5DQVA 3SRZA 5ABFA 5LHIB 2XM2A 2E8IA 2M6BA 3FB2A 3PUSA 1HCIA 4EYUA 3LK3B 3LFMA 3FXEB 3ESLA 3WSCA 3OYXA 4EZ4A 2WU2A 2G0UA 4HTEA 3RQWA 2VK9A 3M65A 2HN2A 1OWAA 3P4PA 1D0ZA 2C5JA 3UFGA 4DNDA 2FJEA 3RYIE 4CI2B 1D1BA 4DR3T 4HEAA 1T98A 2UUBT 3WI3A 1H7CA 2W66A 5L2LA 2WMNA 3AEBA 3P4QA 3AE8A 4GIWA 3ZMVB 1KK7A 4DBRA 5FVLA 1MIYA 4X1KE 3QB5K 3ZT5A 2ZM0A 3PJAA 5JREA 3LBXB 2EHOD 5HXCA 4P09A 3ZYMA 4PK4A 2LEHA 1D0XA 3KV6A 5J2TE 2ACZA 3AA7B 2XY8B 4WBNE 4ILAA 4LMJA 4HFEA 2WB5A 2KLQA 4H63V 2XQ5A 3DYJA 2OLTA 3U78A 4PW8A 4ONRA 3VU7H 1HG2A 3SS1A 4QKNA 3KV4A 4N78D 4YSYA 2MTQA 2K9AA 2PTFA 4DR1T 2BG9E 2J62A 4NIQA 5EK4A 2CXLA 2V7JA 3QB5A 2W63A 4ZEYA 4AI6A 5LJNA 3QC9A 2RPAA 2CA5A 3PUVF 4OYKA 1CUNA 2E5VA 2BG9C 3AEEA 3G06A 4X65T 4V1Av 1R8IA 3PUAA 3LG7A 2CRBA 4KP3C 3RI5A 1UX4A 4K0UA 1T72A 3UFEA 3I9WA 2V7KA 2IC9A 5LG4A 5EK2A 5F3JA 5FMNA 3MJXA 4P1NA 3CX6B 3F31A 3ZYLA 2JMHA 1U5PA 3SOLA 2DLRA 1NWMX 2CE7A 4X64T 2V6YB 3N9LA 5FXXA 3VHLA 4ZZBA 4QH4A 5HWYA 2QYWA 3J7Yq 4YHJA 2DCFA 2QRXA 4YSXA 4UELA 5L3BB 4IDNA 4K0KT 4U7YA 1Y01A 4LF8T 2X9XA 4CI1B 2BS4A 4PNIA 3AXJA 2X51A 3M1CA 2NOXA 2KXPB 4CN1A 3LSVA 5LG3A 3AE4A 5FL0A 2BG9A 2CHOA 1HR0T 2JMKA 2KWIB 4BA9A 3PV0F 5AQGB 4KI0F 5FL1A 2NR4A 1NEKA 1UUSA 3ZJ1A 3V5SA 5AQFB 2X66A 3P7IA 3I0OA 5L4EA 3SFDA 1LRZA 2LRLA 1CHUA 3AVRA 3QUJA 3VR9A 4ZI2C 4U31A 2H7OA 2DWGA 2SPCA 2OV9A 2K5BB 3RRCA 1MMNA 3QNUA 1OEDC 3PF0A 2UXXB 5FXVA 2CWYA 2V7IA 3JC6D 4J2CA 4DV1T 2X9HA 5A1LA 1E2AA 3UU4A 2CHNA 3RHWA 2YK0A 3BQIA 2MTCA 2YDQA 1OEDB 3FZLB 3GWHA 4PAGA 3NRXA 2JQ9A 3H3AA 4CZZB 3AEFA 3A8YC 2BVMA 5AQNB 3AVSA 4TNVA 4QWNB 3GA8A 2E9XC 3V5UA 3RKGA 2JJ9A 5JRCA 3LDQB 2JQKA 4COFA 2HN1A 4UVBB 3OTOT 1HTJF 3CKDA 5F5WA 1IAPA 1B7TA 2L10A 4ANJA 5LJMA 2KNDA 1KNPA 5LGNB 2CMRA 4GYSA 4ZS3A 2L3LA 2ZLYA 4LMKA 1SE7A 1FIOA 4H63H 3TKLB 4AKGA 3MA9A 1US7B 4YXDA 4U72A 2WMOA 4OHFA 1VCSA 1NENA 3ZC0A 2XQ8A 4AQFA 3CIRA 5AQOB 4GK5E 4U7IA 3BQKA 5HXRA 1Z0PA 4U33A 4IE6A 4L9IA 3RIUC 3RYFE 3X1DA 5E0OA 1KFYA 2V5CA 3HR0A 3RYCE 5L3GB 5KMGP 3WAJA 4I0UA 1ZP0A 1YQ3A 1HNZT 4KBMB 3PHF1 4MFRA 2HH7A 1J5ET 5CA1E 3ZCIA 2E9XA 2VWAA 5HYAA 4LF4T 1XNQT 4HFVA 2XUEA 3AE6A 4LMLA 4IE0A 2KINB 4JI2T 1MMAA 2VL8A 4ERRA 4HKAA 1E1HB 3K3QC 1WR0A 3K3OA 4Z91A 4KX6A 2LM9A 2BS2A 2W61A 4IDZA 1ZEEA 4UV8B 2IW5B 2Q9QC 4C90A 2MAWA 1YW0A 4ZI7E 4HGAA 4YFSA 2D0UA 2R6GF 2Q9QB 2XQAA 3ZPOA 5FY7A 2XAFB 4UV9B 3JAFA 3I0QA 5JDGA 5TAOA 2LSYA 2KBBA 4GK0E 5ABFB 3EI0A 4AISA 3CVRA 3IHRA 2ACXA 2DWKA 4UXNB 1BR0A 1KEYA 3B5MA 3Q5EA 4LF6T 4JUYA 4YJ3E 2XASB 4ECGA 3BQLA 5HEUA 5L3FB 2WWUA 3C64A 3DP7A 5CB4E 4JEHB 3AT7A 3PTRB 4HN9A 3ZN1B 4YTPA 5ETWA 4X66T 4A97A 2WZIA 2CWOA 4ILUA 5CFBA 3CMLA 5H6RB 2FJBA 2VKJA 4QX8B 2QGSA 3MKDA 2W4XA 2V6XA 5LHHB 3RC8A 4X1YE 2VVSA 3ZMZB 3OKQA 4IDQA 2CLYB 4TNWA 2NW8A 1G73A 4FJOA 5BR8T 3RIAA 2YINA 4XBFB 5LBMA 2C5IT 2A72A 1M7KA 2WDVA 2V26A 5LGTB 4IIJE 5LCYA 4IE7A 1IJ5A 2VL0A 5JVDE 1IZNB 2N1GA 2KGXA 1YXRA 2BDEA 3RRWA 4CI3B 2WQYA 4DBQA 1IJ6A 4LFCT 1FEWA 3PUGA 1IBKT 2CEAA 4BGOA 4TN7B 3FZMB 4TUYE 1LKXA 1BR4A 5LGUB 2XQ9A 4JI1T 2VASA 3RIFA 2ZM2A 3RQUA 4MALA 3GMIA 2ES0A 4PJMA 2XJ7A 3C51A 1ZKEA 2ZM8A 2I59A 2YU1A 4EOZB 4I55E 2RP4A 3AY5A 3AE7A 4U3CA 3N2GE 4WZXA 2V5DA 4GOUA 3T8OA 4B6XA 2NWBA 3ONJA 4WBOA 2H88A 2CM0A 3AEAA 2XAHB 1IBMT 4A5XA 2Q9QD 4LF7T 3AA6B 5LNKA 2JIWA 3OBVE 4OX9T 2UXCT 3LK42 4DR4T 3E22E 3C4WA 3AB3B 3HKBE 2NW7A 3ZSTA 2WAUA 4B3RT 2YU2A 1N33T 3T1HT 4ISTA 1D0YA 3L8RA 3AECA 4TZ4C 2XAQB 2BS3A 3EDUA 3KFWX 4F8HA 3ANWA 5DABA 5IYZE 1WFDA 1VCTA 3CQXC 1WYBA 4H9OC 3PURA 4CXXA 2BBHA 3AXJB 2GK9A 4AQGA 3C50A 4EAHA 4DV7T 4O2AE 1OXZA 2BG9B 2UUCT 2KVPA 3FZKB 4O8SA 3H3MA 2WBLA 3TLTA 1QLBA 2J47A 2LJLA 2KT9A 5HEJA 5C3JA 3EAMA 4PJJA 1SUMB 2D5UA 5JDFA 1S35A 1GQEA 3IBPA 4DR2T 2YEVC 4QHOA 1AJ3A 1D1AA 1VOMA 4AKHA 4ZXLA 4AKRB 2YDRA 4YTMA 2UXDT 3EHZA 3A7MA 2MYSA 5F8PA 3QK6A 4QXCB 4HWIB 1NAFA 3P50A 3BK9A 5H6QB 1J1JA 5LB7B 2BKOA 2NTXA 3FZHB 1KF6A 5AQTB 4W8PA 5L47A 3L3PA 4CN4A 4EB6E 4O4IE 2LM2A 4HE8A 5JRCB 4I4TE 4Z90A 5JDHA 4YSZA 3CPZA 1JNRA 4GKJT 3NKZA 4DV6T 3OPCA 1G8XA 3O9XA 4IL9A 2UXNB 1XNRT 2N2NA 3D0TA 3N9OA 4AQFC 1QUUA 2BBJA 2V7LA 3PUYF 4XAXB 5JQGE 1SJ8A 1BR2A 4O2BE 4ZZCA 3NZQA 2WCAA 1HF8A 2HHHT 4HWCA 4QH5A 4KMCA 3AAIA 2P9BA 1V9DA 4EZHA 4IDOA 2LOPA 2WP9A 4Q25A 3MXZA 3NBXX 3HI2A 3WAKA 2WWVA 2M6IA 2WM9A 4DV4T 3HL6A 3VRBA 5HXSA 3FHNA 2A3DA 3N9PA 3S4UA 3AE2A 2LKHA 4DVDA 5AQIB 3P4RA 2E9XB 4PJNA 4FI5A 4L0RA 1HFAA 4YLHA 4IT4A 2XSAA 2KMFA 3CWZB 4ZOLE 2BKPA 4DV0T 4ZI3C 2XAJB 4JI0T 3TLVA 2XQ4A 4QX7B 2V1DB 2YN6A 4ISSA 1WRDA 4HFDA 3PUWF 3WURA 5J2UE 1EZ3A 1HNXT 4TX5A 3MACA 2LT3A 5DQWA 1T8BA 4TV8E 3N9NA 4DV3T 2WDRA 4UVCB 3N9QA 3AAAB 3GN5A 3P8CD 4H9NC 1WLXA 4WNKA 1BR1A 1HG5A 1MIVA 4IE4A 5JDMA 2D2SA 2LE8A 1FMVA 3K1SA 5M4YA 3ZMSB 2W0GA 3ONLC 4ASKA 1XWMA 5FYMA 3FBZA 4AQYT 4JLEA 2XTLA 4DMWA 1MIWA 2J4GA 5LP6E 4CXYA 3T1YT 3R6NA 3PU3A 2LKGA 3ZLIA 2X0LB 2AE9A 1UURA 2LOSA 4M1PA 5HWXA 4EEDA 5AQQB 3F2EA 1W9RA 3PUQA 4LF9T 1W0BA 5LMUT 2PG8A 1W0AA 4NUVA 5L3EB 1UK5A 2IMLA 4G63A 2EHOC 2H89A 3UU5A 2F4VT 5JDLA 2WU5A 2X67A 2X9WA 2JPFA 4X1IE 2NP9A 1FMWA 2BZBA 4G2AA 5LMNT 4U2ZA 3SFEA 4IDPA 2V7MA 3VKGA 4DUZT 4ZI2D 2LRKA 4YY3T 2MBGA 3RGLA 4B3MT 1YKHB 3J9X1 3C4ZA 3R84B 2IDOB 2XM1A 2N9DA 5L4HA 2LSGA 5JR9C
chains in the Genus database with same CATH topology
3Q2MA 2M67A 3E08A 3KBUA 3I1AA 2XQYA 3N9MA 3VHLA 4GOUA 5HWYA 3T8OA 3J7Yq 1QSDA 4YHJA 2DCFA 2NWBA 3O1HA 1O3XA 2LHRA 4B6XA 4UEMA 3HKEE 4UELA 4WBOA 5L3BB 2PBIA 4JEUB 3N2OA 3HKDE 2CM0A 4ZS2A 3KV9A 3PDYA 4OK0A 2X9XA 2XAHB 4CI1B 4QXHB 3FBLA 4PNIA 3Q5XA 2E9XD 3AAEB 2K48A 2Q9QD 2XAGB 2X51A 5JH7E 3M1CA 3AA6B 2NOXA 5LBQB 2KXPB 5LNKA 5LYJE 2IAKA 2Y8DA 5HXEA 3OBVE 3FXDB 2DHRA 3LK42 3PU8A 1YKEB 2ODUA 3E22E 2JMKA 3C4WA 2KWIB 3AB3B 2LHNA 3L09A 4BA9A 5JDQA 3HKBE 3UUMA 3U3IA 3RH3A 2EHOA 2NW7A 2RA1A 1MNEA 2OA5A 3EUHA 2H7VC 3ZJ1A 2LSIA 2WAUA 2YU2A 3V5SA 3A5XA 4MHCA 5GONE 2X66A 3P7IA 3I0OA 4MBQA 1LRZA 2Z6EA 3ZC1A 4ISTA 1D0YA 2Y6XA 3AVRA 5LHGB 2J1DG 1U4QA 4TZ4C 2XAQB 3QUJA 5FXZA 4ZI2C 3EDUA 3KFWX 2H7OA 2DWGA 3ANWA 2SPCA 5DABA 2K5BB 3RRCA 4BJNA 1MMNA 5IYZE 4AKIA 5KDMC 4GYRA 3W15B 3IF8B 3PF0A 2UXXB 5FXVA 3KVBA 2CWYA 3CQXC 1WYBA 2V7IA 3MK7C 4H9OC 2NW9A 4H9PC 3PURA 3JC6D 4H9QC 4O4HE 4CXXA 4J2CA 3CQCB 2X9HA 5A1LA 2GK9A 4AQGA 3C50A 2PFVA 4EAHA 4ADZA 2YK0A 3BQIA 4O2AE 5JR9A 2MTCA 3GWHA 1OXZA 1UX5A 2LSJA 4PAGA 4E7ZA 2X9YA 2JRKA 3NRXA 3PE0A 4CQIA 3KVAA 4I43B 3ZYKA 3H3AA 4CZZB 4O8SA 2VKDA 5FXWA 2BVMA 3AVSA 5EZYE 5KX5E 2VKOA 4QWNB 5LXTE 3Q9DA 2W62A 2X68A 4MLKA 3GA8A 2EHOB 2WBLA 2E9XC 3V5UA 2LJLA 2KT9A 3ETVA 4YJ2E 1MNDA 3EVYA 3HKCE 5FNVE 2JJ9A 3RKOA 5FY1A 4A56A 5JRCA 5C8YE 4XZCA 3RC3A 4PJJA 5BMVE 1HX8A 4UVBB 1HTJF 3CKDA 4F6RC 4L5GA 3UT5E 2D5UA 1IAPA 1B7TA 3UUXB 5JDFA 1S35A 4ANJA 2B1EA 5LJMA 3N2KE 2KNDA 3ANWB 3IBPA 2YEVC 4QHOA 4QXBB 2CMRA 5LGNB 1AJ3A 1D1AA 2HPLA 4Z8XA 1VOMA 4GYSA 3K8PC 4ZS3A 4AKHA 2L3LA 2ZLYA 4AKRB 1FIOA 4H63H 4UF0A 2L8KA 3ZCJA 2MYSA 3TKLB 4AKGA 2A2FX 2H3RA 3MA9A 5F8PA 1US7B 3QK6A 4QXCB 1HS7A 5JR9B 3O1JA 1NAFA 1YD8G 2KZ7B 3BK9A 5H6QB 4U72A 1KNZA 2WMOA 4OHFA 4OYJA 4TV9E 3ZC0A 5HAXA 4AQFA 5DJQC 3HA4A 4UVAB 2NTXA 3F57A 4GK5E 5T1DA 3K3NA 4I50E 3BQKA 2Y48B 1Z0PA 1ZHCA 3C4XA 3JC6C 4IHJE 5HXRA 3B57A 4IE6A 3MZKB 4L9IA 2XHEB 5LA6E 3RYFE 3L3PA 3NZPA 4EB6E 4O4IE 4CXWA 2NTYA 1ZV4X 3ZEFB 4HE8A 5E0OA 5JRCB 4I4TE 3HR0A 3RYCE 2C0SA 5L3GB 3RX6A 5KMGP 3CQGB 3WAJA 3O1IA 5JDHA 4KBMB 4U74A 4UIGA 4IGUA 4X20E 4KUMB 3PHF1 3CPZA 3ZJ2A 4MFRA 2HH7A 1LVKA 2VB6A 3SWHA 4ZI3D 5CA1E 3H37A 3ZCIA 2W00A 3O9XA 1G8XA 2IC6A 2VKHA 3N5LA 4DO0A 5ADXL 2E9XA 3UULA 2CCQA 2CLYC 2Q9QA 2VWAA 4HFVA 5HYAA 4O4JE 2UXNB 2XUEA 5LOVE 4P0AA 2ODVA 4PK5A 2N2NA 5FY0A 1SA0E 3RYHE 4IE0A 3IEEA 3UTKA 3D0TA 3N9OA 4UF0B 5FP3A 2KINB 4PK6A 2MOZA 4AQFC 4EIWA 1QUUA 1MMAA 2V7LA 2PJQA 2VL8A 3LJCA 4XAXB 5CA0E 3NRYA 4PFPA 5L3DB 4ERRA 3C98B 2CXFA 5JQGE 2JQQA 1BR2A 1UCUA 4HKAA 1E1HB 3K3QC 4O2BE 4DMVA 5DQVA 3SRZA 3NZQA 3K3OA 5LHIB 1HF8A 2E8IA 2LM9A 5AFUL 3FB2A 3PUSA 4KMCA 1HCIA 3AAIA 2P9BA 1V9DA 4EYUA 4EZHA 2LOPA 3LK3B 3LFMA 4O4LE 3LBXA 3MXZA 3FXEB 1WYCA 3ESLA 3NBXX 3WSCA 2W61A 4AKLA 3OYXA 3HI2A 3WAKA 5HXHA 2WM9A 4EZ4A 3HL6A 4IDZA 1ZEEA 4UV8B 2HPJA 2IW5B 5HXSA 2Q9QC 4C90A 3FHNA 1YW0A 2A3DA 3N9PA 4ZI7E 2G0UA 3RPUA 4HTEA 3S4UA 2VK9A 3M65A 3ZMUB 4HGAA 4DVDA 3OYZA 4YFSA 2CXDA 2D0UA 5EK3A 1OWAA 3ONXA 2E9XB 3KBTA 2QA7A 1D0ZA 2C5JA 2Q9QB 3ETUA 4DNDA 3ZPOA 4PJNA 4FI5A 5FY7A 4PFOA 4L0RA 3RYIE 1MMDA 4CI2B 1HFAA 4YLHA 2XAFB 1D1BA 2WSSV 3B13A 2KMFA 3CWZB 4C91A 4HEAA 4H9SE 4UV9B 3I0QA 4ZOLE 1T98A 3WI3A 5JDGA 5TAOA 1H7CA 2LSYA 4ZI3C 1VRBA 4PJLA 5L2LA 2WMNA 4EXTA 4GK0E 4GIWA 2XAJB 2K24A 3ZMVB 1KK7A 4DBRA 4QX7B 2V1DB 3CVRA 4ISSA 1MIYA 4X1KE 3IHRA 1WRDA 2ZM0A 2DNXA 5JREA 4IE5A 3WURA 2ACXA 3LBXB 5J2UE 2EHOD 2DWKA 4UXNB 1EZ3A 1BR0A 4TX5A 3CX8B 3MACA 4ZHQE 2LT3A 4JUYA 4YJ3E 5HXCA 5DQWA 2XASB 3KINB 4P09A 4TV8E 3ZYMA 3N9NA 4PK4A 2LEHA 4ECGA 1D0XA 1LVFA 3BQLA 3KV6A 2C5KT 4UVCB 1Y64B 3DTOA 5J2TE 3AA7B 5L3FB 3N9QA 2WWUA 3AAAB 3C64A 3DP7A 5CB4E 3UUNA 3GN5A 3P8CD 4JEHB 4WBNE 3AT7A 4H9NC 3PTRB 4HN9A 3ZN1B 5ETWA 5L3CB 1WLXA 2KLQA 3Q5WA 4H63V 3LK2B 1BR1A 4WNKA 2CWOA 1HG5A 1MIVA 3OJAA 3DJBA 4IE4A 4ILUA 5JDMA 3CMLA 5H6RB 2D2SA 4E7SA 3U78A 2LQUA 2ZMAA 4PW8A 2LE8A 4NUUA 4ONRA 1FMVA 3VU7H 2VKJA 4QX8B 1HG2A 2QGSA 3SS1A 3MKDA 4QKNA 5M4YA 3ZMSB 2W0GA 3KV4A 5LHHB 5JDNA 3RC8A 4N78D 2MTQA 3KV5A 4X1YE 2K9AA 4OFZA 4ASKA 5FYMA 3FBZA 3AA1B 4JLEA 2XTLA 3ZMZB 3OKQA 2CLYB 1WR6A 4DMWA 1MIWA 4WW0A 5EK4A 5LP6E 4CXYA 2CXLA 5IHYA 2NW8A 1G73A 4FJOA 3R6NA 2V7JA 3PU3A 2BVLA 2W63A 3ZLIA 2YINA 4AI6A 5LJNA 5LBMA 2X0LB 4XBFB 2C5IT 2A72A 2LOSA 1X79A 4M1PA 5HWXA 3QC9A 2V26A 3E0ZA 3F2EA 2KWHA 5LGTB 4IIJE 2DI4A 4BAYB 3VJZA 5LCYA 4IE7A 1IJ5A 2CA5A 3PUQA 3VKHA 5JVDE 3ZN0B 4OYKA 1CUNA 1IZNB 3I9YA 2PG8A 2N1GA 3KDSE 1SHZC 4V1Av 4H9RC 2BDEA 4NUVA 3RRWA 3GN5B 3PUAA 3LG7A 4CI3B 5L3EB 4KP3C 1UX4A 4K0UA 4DBQA 3UFEA 1IJ6A 3I9WA 4G63A 1FEWA 2EHOC 3PUGA 3O4XE 2V7KA 3EDVA 2CEAA 2IC9A 5LG4A 4EYYR 4BGOA 4AXPA 5JDLA 2X67A 2X9WA 4TN7B 2JPFA 1LKXA 4TUYE 4X1IE 4BJMA 5EK2A 5F3JA 1BR4A 2NP9A 5LGUB 5FMNA 3MJXA 2VASA 1FMWA 2BZBA 3CX6B 4G2AA 3F31A 3ZYLA 2JMHA 2ZM2A 1S94A 4MALA 2V7MA 3VKGA 1U5PA 3GMIA 4ZI2D 2ES0A 4PJMA 3SOLA 3ZMTB 2MBGA 3C51A 3CX7B 5J1GA 2DLRA 1NWMX 1ZKEA 2ZM8A 2I59A 2YU1A 1YKHB 3J9X1 2CE7A 4EOZB 3C4ZA 2L9QA 3R84B 1D1CA 4I55E 4P0BA 2RP4A 3AA0B 3N9LA 2N9DA 2D0TA 1MMGA 2LSKA 5FXXA 3N2GE 2LSGA 5JR9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDQ A;  5HXC A;  5JDG A;  5HXS A;  5JDH A;  5HYA A;  5JDN A;  5JDM A;  3V5S A;  5HXH A;  5JDL A;  5HWY A;  5HWX A;  5HXR A;  5HXE A;  5JDF A;  3V5U A; 
#chains in the Genus database with same CATH topology
 3Q2M A;  2V8S V;  1XZY A;  2XQY A;  3N9M A;  1QSD A;  1T7S A;  3O1H A;  4UEM A;  4B3T T;  4JI7 T;  2WZH A;  3HKD E;  4DR7 T;  2QVA A;  4OK0 A;  3PDY A;  4CN6 A;  3NVO A;  4QXH B;  2E9X D;  2XAG B;  5JH7 E;  4ILB A;  5LYJ E;  4JYA T;  5HXE A;  4JI4 T;  3PU8 A;  2UXB T;  3L09 A;  1HX1 B;  5HEO A;  3U3I A;  2EHO A;  1MNE A;  2OA5 A;  3EUH A;  2H7V C;  2XPK A;  2LSI A;  2IUB A;  3A5X A;  5GON E;  1L0V A;  3ZC1 A;  1N34 T;  2Y6X A;  5LHG B;  2J1D G;  1U4Q A;  2X0H A;  3UU6 A;  5FXZ A;  4NXM T;  4BJN A;  4GYR A;  3W15 B;  4EGW A;  5HEH A;  4H9P C;  2NW9 A;  4O4H E;  5AQP B;  3CQC B;  2PFV A;  2A9U A;  5JR9 A;  2X9Y A;  2JRK A;  4UR9 A;  3ZYK A;  4DV5 T;  5AQV B;  3PUX F;  4TWD A;  2VKO A;  3Q9D A;  2X68 A;  3ZKR A;  2IHR 1;  3ETV A;  3ABV A;  5FNV E;  3RKO A;  5FY1 A;  4A56 A;  1J5W A;  2BKN A;  1E7P A;  4AIU A;  3UT5 E;  3NWI A;  5AQK B;  4DR6 T;  3ANW B;  1FJG T;  2HPL A;  1JNZ A;  2X0C A;  3K8P C;  3RF1 A;  4KHP T;  4UF0 A;  2UUA T;  4WYV A;  2H3R A;  3UU8 A;  1HS7 A;  3O1J A;  4KHZ F;  4JV5 T;  2I6H A;  4TV9 E;  5DJQ C;  5FKY A;  3HA4 A;  4UVA B;  3F57 A;  3K3N A;  4I50 E;  4IHJ E;  3JC6 C;  3MZK B;  2XHE B;  5LA6 E;  4HWF A;  3UQ4 A;  4CXW A;  1ZV4 X;  3PUZ F;  3ZEF B;  4LFB T;  2C0S A;  4IL4 A;  3CQG B;  3AED A;  4UIG A;  4IGU A;  1HNW T;  3ZJ2 A;  4TWF A;  2VB6 A;  2XQ3 A;  3SWH A;  2IC6 A;  2VKH A;  3N5L A;  5ADX L;  2CCQ A;  5LOV E;  2ODV A;  1SA0 E;  3UTK A;  5FP3 A;  2MOZ A;  4EIW A;  4JBW F;  1DU2 A;  3LJC A;  3NRY A;  4PFP A;  5L3D B;  2CXF A;  3C98 B;  4HFC A;  1UCU A;  4JI5 T;  2AXD S;  3P4S A;  2X0Y A;  5AFU L;  2MPK A;  3PJA J;  4O4L E;  5C2T A;  3LBX A;  1WYC A;  2VQE T;  3QOF A;  4AKL A;  5HXH A;  1N32 T;  2HPJ A;  4YHH T;  3RPU A;  3L39 A;  4F7G B;  5IUX A;  3ZMU B;  3IA3 A;  3OYZ A;  2CXD A;  5EK3 A;  4YTN A;  1M62 A;  3ONX A;  3KBT A;  2QA7 A;  3ETU A;  5ABG A;  4PFO A;  1N36 T;  1MMD A;  4GKK T;  2WSS V;  3B13 A;  4C91 A;  4H9S E;  5AQS B;  3Q5D A;  2FJD A;  1VRB A;  4PJL A;  4EXT A;  2UU9 T;  2K24 A;  1X9B A;  1I6Z A;  4X5T A;  5AQJ B;  2DNX A;  4IE5 A;  2CPT A;  3CX8 B;  4ZHQ E;  3KIN B;  1XMO T;  1LVF A;  3TLS A;  2C5K T;  1Y64 B;  3DTO A;  3UU3 A;  2FUP A;  3UUN A;  5J0Z A;  1XDO A;  5L3C B;  3Q5W A;  3LK2 B;  4JI3 T;  3OJA A;  2DL1 A;  3DJB A;  2LQU A;  4E7S A;  2ZMA A;  4NUU A;  3AE5 A;  3EAB A;  4NPP A;  4HWH A;  5JDN A;  3M3Z B;  3KV5 A;  2W2U A;  4OFZ A;  5AQM B;  3AA1 B;  1OED E;  2XQ6 A;  1WR6 A;  4WW0 A;  5IHY A;  3FZF B;  2BVL A;  2D9D A;  2K3W A;  3AE1 A;  2V6Y A;  1X79 A;  4DV2 T;  3E0Z A;  2KWH A;  4BAY B;  2DI4 A;  3TLW A;  3VJZ A;  4NXN T;  3VKH A;  3ZN0 B;  2E2A A;  3I9Y A;  3KDS E;  5CGM A;  1SHZ C;  3UUB A;  4H9R C;  3GN5 B;  5HEG A;  2B76 A;  3O4X E;  3EDV A;  5ABH A;  4X62 T;  4EYY R;  4AXP A;  4IRE A;  4BJM A;  2JQH A;  1S94 A;  3TLU A;  3UQ7 A;  3JCF A;  5CJ5 A;  3ZMT B;  1UGO A;  5FZT A;  3CX7 B;  5J1G A;  3CK6 A;  2L9Q A;  1D1C A;  4P0B A;  5JTG A;  3AA0 B;  2D0T A;  1MMG A;  2LSK A;  1IBL T;  1I94 T;  2M67 A;  3E08 A;  4DUY T;  3KBU A;  3I1A A;  5FVK A;  5HCJ A;  3ZSS A;  1O3X A;  2LHR A;  3HKE E;  2PBI A;  4JEU B;  3N2O A;  4ZS2 A;  3KV9 A;  5KXJ A;  3FBL A;  3Q5X A;  3AAE B;  2K48 A;  3FYQ A;  5LBQ B;  2WS3 A;  2IAK A;  2Y8D A;  1OED A;  4YT0 A;  3FXD B;  2DHR A;  4TWH A;  3AE3 A;  1YKE B;  2ODU A;  2WDQ A;  2VVN A;  2LHN A;  5JDQ A;  3UUM A;  3RH3 A;  2RA1 A;  2YDS A;  2XQ7 A;  2FBW A;  2W67 A;  4MHC A;  1YQ4 A;  2VUR A;  4MBQ A;  2Z6E A;  5AQL B;  1Z8U A;  3AEG A;  5IWA T;  4U2Y A;  5AQR B;  4AKI A;  5KDM C;  3IF8 B;  3P4W A;  3KVB A;  3MK7 C;  4H9Q C;  3OVU A;  3VRA A;  4ADZ A;  4EEB A;  1UX5 A;  2LSJ A;  4E7Z A;  4CQI A;  1XDP A;  3PE0 A;  3KVA A;  4I43 B;  4B3S T;  2VKD A;  3JAE A;  5FXW A;  5EZY E;  5KX5 E;  5LXT E;  5AQU B;  2W62 A;  4MLK A;  2EHO B;  2KSR A;  4DID B;  4YJ2 E;  1MND A;  3EVY A;  3HKC E;  2WY2 A;  2VQF T;  5AQH B;  5C8Y E;  2I0M A;  4XZC A;  3RC3 A;  2ZM6 T;  5BMV E;  1HX8 A;  2L7N A;  4F6R C;  4L5G A;  3RIU A;  3UUX B;  2B1E A;  4HFB A;  3N2K E;  3ZT6 A;  1KNR A;  4QXB B;  4Z8X A;  2XZE A;  4A98 A;  2YKS A;  5ABE A;  4HFH A;  2L8K A;  3ZCJ A;  2A2F X;  4EV6 A;  4LFA T;  2YOE A;  5JR9 B;  1YD8 G;  2KZ7 B;  1KNZ A;  4OYJ A;  1WCR A;  5HAX A;  1XMQ T;  5T1D A;  3AE9 A;  4DR5 T;  3VR8 A;  4LF5 T;  2Y48 B;  1ZHC A;  3C4X A;  3B57 A;  2IIU A;  3RLF F;  1SJ7 A;  3NZP A;  5HCM A;  4JI8 T;  2NTY A;  1ZOY A;  4JI6 T;  3RX6 A;  3O1I A;  2LLY A;  2CBI A;  4U74 A;  4X20 E;  4KUM B;  2CBJ A;  1LVK A;  4ZI3 D;  3H37 A;  4ILC A;  2W00 A;  3JAD A;  4DO0 A;  3ZT7 A;  3UUL A;  2CLY C;  2Q9Q A;  4O4J E;  4P0A A;  4PK5 A;  5FY0 A;  3RYH E;  3IEE A;  4UF0 B;  4PK6 A;  2XSB A;  4QH1 A;  2PJQ A;  5CA0 E;  2E5L T;  2FJA A;  1W09 A;  4HFI A;  2JQQ A;  4HWD A;  4DMV A;  5DQV A;  3SRZ A;  5ABF A;  5LHI B;  2XM2 A;  2E8I A;  2M6B A;  3FB2 A;  3PUS A;  1HCI A;  4EYU A;  3LK3 B;  3LFM A;  3FXE B;  3ESL A;  3WSC A;  3OYX A;  4EZ4 A;  2WU2 A;  2G0U A;  4HTE A;  3RQW A;  2VK9 A;  3M65 A;  2HN2 A;  1OWA A;  3P4P A;  1D0Z A;  2C5J A;  3UFG A;  4DND A;  2FJE A;  3RYI E;  4CI2 B;  1D1B A;  4DR3 T;  4HEA A;  1T98 A;  2UUB T;  3WI3 A;  1H7C A;  2W66 A;  5L2L A;  2WMN A;  3AEB A;  3P4Q A;  3AE8 A;  4GIW A;  3ZMV B;  1KK7 A;  4DBR A;  5FVL A;  1MIY A;  4X1K E;  3QB5 K;  3ZT5 A;  2ZM0 A;  3PJA A;  5JRE A;  3LBX B;  2EHO D;  5HXC A;  4P09 A;  3ZYM A;  4PK4 A;  2LEH A;  1D0X A;  3KV6 A;  5J2T E;  2ACZ A;  3AA7 B;  2XY8 B;  4WBN E;  4ILA A;  4LMJ A;  4HFE A;  2WB5 A;  2KLQ A;  4H63 V;  2XQ5 A;  3DYJ A;  2OLT A;  3U78 A;  4PW8 A;  4ONR A;  3VU7 H;  1HG2 A;  3SS1 A;  4QKN A;  3KV4 A;  4N78 D;  4YSY A;  2MTQ A;  2K9A A;  2PTF A;  4DR1 T;  2BG9 E;  2J62 A;  4NIQ A;  5EK4 A;  2CXL A;  2V7J A;  3QB5 A;  2W63 A;  4ZEY A;  4AI6 A;  5LJN A;  3QC9 A;  2RPA A;  2CA5 A;  3PUV F;  4OYK A;  1CUN A;  2E5V A;  2BG9 C;  3AEE A;  3G06 A;  4X65 T;  4V1A v;  1R8I A;  3PUA A;  3LG7 A;  2CRB A;  4KP3 C;  3RI5 A;  1UX4 A;  4K0U A;  1T72 A;  3UFE A;  3I9W A;  2V7K A;  2IC9 A;  5LG4 A;  5EK2 A;  5F3J A;  5FMN A;  3MJX A;  4P1N A;  3CX6 B;  3F31 A;  3ZYL A;  2JMH A;  1U5P A;  3SOL A;  2DLR A;  1NWM X;  2CE7 A;  4X64 T;  2V6Y B;  3N9L A;  5FXX A;  3VHL A;  4ZZB A;  4QH4 A;  5HWY A;  2QYW A;  3J7Y q;  4YHJ A;  2DCF A;  2QRX A;  4YSX A;  4UEL A;  5L3B B;  4IDN A;  4K0K T;  4U7Y A;  1Y01 A;  4LF8 T;  2X9X A;  4CI1 B;  2BS4 A;  4PNI A;  3AXJ A;  2X51 A;  3M1C A;  2NOX A;  2KXP B;  4CN1 A;  3LSV A;  5LG3 A;  3AE4 A;  5FL0 A;  2BG9 A;  2CHO A;  1HR0 T;  2JMK A;  2KWI B;  4BA9 A;  3PV0 F;  5AQG B;  4KI0 F;  5FL1 A;  2NR4 A;  1NEK A;  1UUS A;  3ZJ1 A;  3V5S A;  5AQF B;  2X66 A;  3P7I A;  3I0O A;  5L4E A;  3SFD A;  1LRZ A;  2LRL A;  1CHU A;  3AVR A;  3QUJ A;  3VR9 A;  4ZI2 C;  4U31 A;  2H7O A;  2DWG A;  2SPC A;  2OV9 A;  2K5B B;  3RRC A;  1MMN A;  3QNU A;  1OED C;  3PF0 A;  2UXX B;  5FXV A;  2CWY A;  2V7I A;  3JC6 D;  4J2C A;  4DV1 T;  2X9H A;  5A1L A;  1E2A A;  3UU4 A;  2CHN A;  3RHW A;  2YK0 A;  3BQI A;  2MTC A;  2YDQ A;  1OED B;  3FZL B;  3GWH A;  4PAG A;  3NRX A;  2JQ9 A;  3H3A A;  4CZZ B;  3AEF A;  3A8Y C;  2BVM A;  5AQN B;  3AVS A;  4TNV A;  4QWN B;  3GA8 A;  2E9X C;  3V5U A;  3RKG A;  2JJ9 A;  5JRC A;  3LDQ B;  2JQK A;  4COF A;  2HN1 A;  4UVB B;  3OTO T;  1HTJ F;  3CKD A;  5F5W A;  1IAP A;  1B7T A;  2L10 A;  4ANJ A;  5LJM A;  2KND A;  1KNP A;  5LGN B;  2CMR A;  4GYS A;  4ZS3 A;  2L3L A;  2ZLY A;  4LMK A;  1SE7 A;  1FIO A;  4H63 H;  3TKL B;  4AKG A;  3MA9 A;  1US7 B;  4YXD A;  4U72 A;  2WMO A;  4OHF A;  1VCS A;  1NEN A;  3ZC0 A;  2XQ8 A;  4AQF A;  3CIR A;  5AQO B;  4GK5 E;  4U7I A;  3BQK A;  5HXR A;  1Z0P A;  4U33 A;  4IE6 A;  4L9I A;  3RIU C;  3RYF E;  3X1D A;  5E0O A;  1KFY A;  2V5C A;  3HR0 A;  3RYC E;  5L3G B;  5KMG P;  3WAJ A;  4I0U A;  1ZP0 A;  1YQ3 A;  1HNZ T;  4KBM B;  3PHF 1;  4MFR A;  2HH7 A;  1J5E T;  5CA1 E;  3ZCI A;  2E9X A;  2VWA A;  5HYA A;  4LF4 T;  1XNQ T;  4HFV A;  2XUE A;  3AE6 A;  4LML A;  4IE0 A;  2KIN B;  4JI2 T;  1MMA A;  2VL8 A;  4ERR A;  4HKA A;  1E1H B;  3K3Q C;  1WR0 A;  3K3O A;  4Z91 A;  4KX6 A;  2LM9 A;  2BS2 A;  2W61 A;  4IDZ A;  1ZEE A;  4UV8 B;  2IW5 B;  2Q9Q C;  4C90 A;  2MAW A;  1YW0 A;  4ZI7 E;  4HGA A;  4YFS A;  2D0U A;  2R6G F;  2Q9Q B;  2XQA A;  3ZPO A;  5FY7 A;  2XAF B;  4UV9 B;  3JAF A;  3I0Q A;  5JDG A;  5TAO A;  2LSY A;  2KBB A;  4GK0 E;  5ABF B;  3EI0 A;  4AIS A;  3CVR A;  3IHR A;  2ACX A;  2DWK A;  4UXN B;  1BR0 A;  1KEY A;  3B5M A;  3Q5E A;  4LF6 T;  4JUY A;  4YJ3 E;  2XAS B;  4ECG A;  3BQL A;  5HEU A;  5L3F B;  2WWU A;  3C64 A;  3DP7 A;  5CB4 E;  4JEH B;  3AT7 A;  3PTR B;  4HN9 A;  3ZN1 B;  4YTP A;  5ETW A;  4X66 T;  4A97 A;  2WZI A;  2CWO A;  4ILU A;  5CFB A;  3CML A;  5H6R B;  2FJB A;  2VKJ A;  4QX8 B;  2QGS A;  3MKD A;  2W4X A;  2V6X A;  5LHH B;  3RC8 A;  4X1Y E;  2VVS A;  3ZMZ B;  3OKQ A;  4IDQ A;  2CLY B;  4TNW A;  2NW8 A;  1G73 A;  4FJO A;  5BR8 T;  3RIA A;  2YIN A;  4XBF B;  5LBM A;  2C5I T;  2A72 A;  1M7K A;  2WDV A;  2V26 A;  5LGT B;  4IIJ E;  5LCY A;  4IE7 A;  1IJ5 A;  2VL0 A;  5JVD E;  1IZN B;  2N1G A;  2KGX A;  1YXR A;  2BDE A;  3RRW A;  4CI3 B;  2WQY A;  4DBQ A;  1IJ6 A;  4LFC T;  1FEW A;  3PUG A;  1IBK T;  2CEA A;  4BGO A;  4TN7 B;  3FZM B;  4TUY E;  1LKX A;  1BR4 A;  5LGU B;  2XQ9 A;  4JI1 T;  2VAS A;  3RIF A;  2ZM2 A;  3RQU A;  4MAL A;  3GMI A;  2ES0 A;  4PJM A;  2XJ7 A;  3C51 A;  1ZKE A;  2ZM8 A;  2I59 A;  2YU1 A;  4EOZ B;  4I55 E;  2RP4 A;  3AY5 A;  3AE7 A;  4U3C A;  3N2G E;  4WZX A;  2V5D A;  4GOU A;  3T8O A;  4B6X A;  2NWB A;  3ONJ A;  4WBO A;  2H88 A;  2CM0 A;  3AEA A;  2XAH B;  1IBM T;  4A5X A;  2Q9Q D;  4LF7 T;  3AA6 B;  5LNK A;  2JIW A;  3OBV E;  4OX9 T;  2UXC T;  3LK4 2;  4DR4 T;  3E22 E;  3C4W A;  3AB3 B;  3HKB E;  2NW7 A;  3ZST A;  2WAU A;  4B3R T;  2YU2 A;  1N33 T;  3T1H T;  4IST A;  1D0Y A;  3L8R A;  3AEC A;  4TZ4 C;  2XAQ B;  2BS3 A;  3EDU A;  3KFW X;  4F8H A;  3ANW A;  5DAB A;  5IYZ E;  1WFD A;  1VCT A;  3CQX C;  1WYB A;  4H9O C;  3PUR A;  4CXX A;  2BBH A;  3AXJ B;  2GK9 A;  4AQG A;  3C50 A;  4EAH A;  4DV7 T;  4O2A E;  1OXZ A;  2BG9 B;  2UUC T;  2KVP A;  3FZK B;  4O8S A;  3H3M A;  2WBL A;  3TLT A;  1QLB A;  2J47 A;  2LJL A;  2KT9 A;  5HEJ A;  5C3J A;  3EAM A;  4PJJ A;  1SUM B;  2D5U A;  5JDF A;  1S35 A;  1GQE A;  3IBP A;  4DR2 T;  2YEV C;  4QHO A;  1AJ3 A;  1D1A A;  1VOM A;  4AKH A;  4ZXL A;  4AKR B;  2YDR A;  4YTM A;  2UXD T;  3EHZ A;  3A7M A;  2MYS A;  5F8P A;  3QK6 A;  4QXC B;  4HWI B;  1NAF A;  3P50 A;  3BK9 A;  5H6Q B;  1J1J A;  5LB7 B;  2BKO A;  2NTX A;  3FZH B;  1KF6 A;  5AQT B;  4W8P A;  5L47 A;  3L3P A;  4CN4 A;  4EB6 E;  4O4I E;  2LM2 A;  4HE8 A;  5JRC B;  4I4T E;  4Z90 A;  5JDH A;  4YSZ A;  3CPZ A;  1JNR A;  4GKJ T;  3NKZ A;  4DV6 T;  3OPC A;  1G8X A;  3O9X A;  4IL9 A;  2UXN B;  1XNR T;  2N2N A;  3D0T A;  3N9O A;  4AQF C;  1QUU A;  2BBJ A;  2V7L A;  3PUY F;  4XAX B;  5JQG E;  1SJ8 A;  1BR2 A;  4O2B E;  4ZZC A;  3NZQ A;  2WCA A;  1HF8 A;  2HHH T;  4HWC A;  4QH5 A;  4KMC A;  3AAI A;  2P9B A;  1V9D A;  4EZH A;  4IDO A;  2LOP A;  2WP9 A;  4Q25 A;  3MXZ A;  3NBX X;  3HI2 A;  3WAK A;  2WWV A;  2M6I A;  2WM9 A;  4DV4 T;  3HL6 A;  3VRB A;  5HXS A;  3FHN A;  2A3D A;  3N9P A;  3S4U A;  3AE2 A;  2LKH A;  4DVD A;  5AQI B;  3P4R A;  2E9X B;  4PJN A;  4FI5 A;  4L0R A;  1HFA A;  4YLH A;  4IT4 A;  2XSA A;  2KMF A;  3CWZ B;  4ZOL E;  2BKP A;  4DV0 T;  4ZI3 C;  2XAJ B;  4JI0 T;  3TLV A;  2XQ4 A;  4QX7 B;  2V1D B;  2YN6 A;  4ISS A;  1WRD A;  4HFD A;  3PUW F;  3WUR A;  5J2U E;  1EZ3 A;  1HNX T;  4TX5 A;  3MAC A;  2LT3 A;  5DQW A;  1T8B A;  4TV8 E;  3N9N A;  4DV3 T;  2WDR A;  4UVC B;  3N9Q A;  3AAA B;  3GN5 A;  3P8C D;  4H9N C;  1WLX A;  4WNK A;  1BR1 A;  1HG5 A;  1MIV A;  4IE4 A;  5JDM A;  2D2S A;  2LE8 A;  1FMV A;  3K1S A;  5M4Y A;  3ZMS B;  2W0G A;  3ONL C;  4ASK A;  1XWM A;  5FYM A;  3FBZ A;  4AQY T;  4JLE A;  2XTL A;  4DMW A;  1MIW A;  2J4G A;  5LP6 E;  4CXY A;  3T1Y T;  3R6N A;  3PU3 A;  2LKG A;  3ZLI A;  2X0L B;  2AE9 A;  1UUR A;  2LOS A;  4M1P A;  5HWX A;  4EED A;  5AQQ B;  3F2E A;  1W9R A;  3PUQ A;  4LF9 T;  1W0B A;  5LMU T;  2PG8 A;  1W0A A;  4NUV A;  5L3E B;  1UK5 A;  2IML A;  4G63 A;  2EHO C;  2H89 A;  3UU5 A;  2F4V T;  5JDL A;  2WU5 A;  2X67 A;  2X9W A;  2JPF A;  4X1I E;  2NP9 A;  1FMW A;  2BZB A;  4G2A A;  5LMN T;  4U2Z A;  3SFE A;  4IDP A;  2V7M A;  3VKG A;  4DUZ T;  4ZI2 D;  2LRK A;  4YY3 T;  2MBG A;  3RGL A;  4B3M T;  1YKH B;  3J9X 1;  3C4Z A;  3R84 B;  2IDO B;  2XM1 A;  2N9D A;  5L4H A;  2LSG A;  5JR9 C; 
#chains in the Genus database with same CATH homology
 3Q2M A;  2M67 A;  3E08 A;  3KBU A;  3I1A A;  2XQY A;  3N9M A;  3VHL A;  4GOU A;  5HWY A;  3T8O A;  3J7Y q;  1QSD A;  4YHJ A;  2DCF A;  2NWB A;  3O1H A;  1O3X A;  2LHR A;  4B6X A;  4UEM A;  3HKE E;  4UEL A;  4WBO A;  5L3B B;  2PBI A;  4JEU B;  3N2O A;  3HKD E;  2CM0 A;  4ZS2 A;  3KV9 A;  3PDY A;  4OK0 A;  2X9X A;  2XAH B;  4CI1 B;  4QXH B;  3FBL A;  4PNI A;  3Q5X A;  2E9X D;  3AAE B;  2K48 A;  2Q9Q D;  2XAG B;  2X51 A;  5JH7 E;  3M1C A;  3AA6 B;  2NOX A;  5LBQ B;  2KXP B;  5LNK A;  5LYJ E;  2IAK A;  2Y8D A;  5HXE A;  3OBV E;  3FXD B;  2DHR A;  3LK4 2;  3PU8 A;  1YKE B;  2ODU A;  3E22 E;  2JMK A;  3C4W A;  2KWI B;  3AB3 B;  2LHN A;  3L09 A;  4BA9 A;  5JDQ A;  3HKB E;  3UUM A;  3U3I A;  3RH3 A;  2EHO A;  2NW7 A;  2RA1 A;  1MNE A;  2OA5 A;  3EUH A;  2H7V C;  3ZJ1 A;  2LSI A;  2WAU A;  2YU2 A;  3V5S A;  3A5X A;  4MHC A;  5GON E;  2X66 A;  3P7I A;  3I0O A;  4MBQ A;  1LRZ A;  2Z6E A;  3ZC1 A;  4IST A;  1D0Y A;  2Y6X A;  3AVR A;  5LHG B;  2J1D G;  1U4Q A;  4TZ4 C;  2XAQ B;  3QUJ A;  5FXZ A;  4ZI2 C;  3EDU A;  3KFW X;  2H7O A;  2DWG A;  3ANW A;  2SPC A;  5DAB A;  2K5B B;  3RRC A;  4BJN A;  1MMN A;  5IYZ E;  4AKI A;  5KDM C;  4GYR A;  3W15 B;  3IF8 B;  3PF0 A;  2UXX B;  5FXV A;  3KVB A;  2CWY A;  3CQX C;  1WYB A;  2V7I A;  3MK7 C;  4H9O C;  2NW9 A;  4H9P C;  3PUR A;  3JC6 D;  4H9Q C;  4O4H E;  4CXX A;  4J2C A;  3CQC B;  2X9H A;  5A1L A;  2GK9 A;  4AQG A;  3C50 A;  2PFV A;  4EAH A;  4ADZ A;  2YK0 A;  3BQI A;  4O2A E;  5JR9 A;  2MTC A;  3GWH A;  1OXZ A;  1UX5 A;  2LSJ A;  4PAG A;  4E7Z A;  2X9Y A;  2JRK A;  3NRX A;  3PE0 A;  4CQI A;  3KVA A;  4I43 B;  3ZYK A;  3H3A A;  4CZZ B;  4O8S A;  2VKD A;  5FXW A;  2BVM A;  3AVS A;  5EZY E;  5KX5 E;  2VKO A;  4QWN B;  5LXT E;  3Q9D A;  2W62 A;  2X68 A;  4MLK A;  3GA8 A;  2EHO B;  2WBL A;  2E9X C;  3V5U A;  2LJL A;  2KT9 A;  3ETV A;  4YJ2 E;  1MND A;  3EVY A;  3HKC E;  5FNV E;  2JJ9 A;  3RKO A;  5FY1 A;  4A56 A;  5JRC A;  5C8Y E;  4XZC A;  3RC3 A;  4PJJ A;  5BMV E;  1HX8 A;  4UVB B;  1HTJ F;  3CKD A;  4F6R C;  4L5G A;  3UT5 E;  2D5U A;  1IAP A;  1B7T A;  3UUX B;  5JDF A;  1S35 A;  4ANJ A;  2B1E A;  5LJM A;  3N2K E;  2KND A;  3ANW B;  3IBP A;  2YEV C;  4QHO A;  4QXB B;  2CMR A;  5LGN B;  1AJ3 A;  1D1A A;  2HPL A;  4Z8X A;  1VOM A;  4GYS A;  3K8P C;  4ZS3 A;  4AKH A;  2L3L A;  2ZLY A;  4AKR B;  1FIO A;  4H63 H;  4UF0 A;  2L8K A;  3ZCJ A;  2MYS A;  3TKL B;  4AKG A;  2A2F X;  2H3R A;  3MA9 A;  5F8P A;  1US7 B;  3QK6 A;  4QXC B;  1HS7 A;  5JR9 B;  3O1J A;  1NAF A;  1YD8 G;  2KZ7 B;  3BK9 A;  5H6Q B;  4U72 A;  1KNZ A;  2WMO A;  4OHF A;  4OYJ A;  4TV9 E;  3ZC0 A;  5HAX A;  4AQF A;  5DJQ C;  3HA4 A;  4UVA B;  2NTX A;  3F57 A;  4GK5 E;  5T1D A;  3K3N A;  4I50 E;  3BQK A;  2Y48 B;  1Z0P A;  1ZHC A;  3C4X A;  3JC6 C;  4IHJ E;  5HXR A;  3B57 A;  4IE6 A;  3MZK B;  4L9I A;  2XHE B;  5LA6 E;  3RYF E;  3L3P A;  3NZP A;  4EB6 E;  4O4I E;  4CXW A;  2NTY A;  1ZV4 X;  3ZEF B;  4HE8 A;  5E0O A;  5JRC B;  4I4T E;  3HR0 A;  3RYC E;  2C0S A;  5L3G B;  3RX6 A;  5KMG P;  3CQG B;  3WAJ A;  3O1I A;  5JDH A;  4KBM B;  4U74 A;  4UIG A;  4IGU A;  4X20 E;  4KUM B;  3PHF 1;  3CPZ A;  3ZJ2 A;  4MFR A;  2HH7 A;  1LVK A;  2VB6 A;  3SWH A;  4ZI3 D;  5CA1 E;  3H37 A;  3ZCI A;  2W00 A;  3O9X A;  1G8X A;  2IC6 A;  2VKH A;  3N5L A;  4DO0 A;  5ADX L;  2E9X A;  3UUL A;  2CCQ A;  2CLY C;  2Q9Q A;  2VWA A;  4HFV A;  5HYA A;  4O4J E;  2UXN B;  2XUE A;  5LOV E;  4P0A A;  2ODV A;  4PK5 A;  2N2N A;  5FY0 A;  1SA0 E;  3RYH E;  4IE0 A;  3IEE A;  3UTK A;  3D0T A;  3N9O A;  4UF0 B;  5FP3 A;  2KIN B;  4PK6 A;  2MOZ A;  4AQF C;  4EIW A;  1QUU A;  1MMA A;  2V7L A;  2PJQ A;  2VL8 A;  3LJC A;  4XAX B;  5CA0 E;  3NRY A;  4PFP A;  5L3D B;  4ERR A;  3C98 B;  2CXF A;  5JQG E;  2JQQ A;  1BR2 A;  1UCU A;  4HKA A;  1E1H B;  3K3Q C;  4O2B E;  4DMV A;  5DQV A;  3SRZ A;  3NZQ A;  3K3O A;  5LHI B;  1HF8 A;  2E8I A;  2LM9 A;  5AFU L;  3FB2 A;  3PUS A;  4KMC A;  1HCI A;  3AAI A;  2P9B A;  1V9D A;  4EYU A;  4EZH A;  2LOP A;  3LK3 B;  3LFM A;  4O4L E;  3LBX A;  3MXZ A;  3FXE B;  1WYC A;  3ESL A;  3NBX X;  3WSC A;  2W61 A;  4AKL A;  3OYX A;  3HI2 A;  3WAK A;  5HXH A;  2WM9 A;  4EZ4 A;  3HL6 A;  4IDZ A;  1ZEE A;  4UV8 B;  2HPJ A;  2IW5 B;  5HXS A;  2Q9Q C;  4C90 A;  3FHN A;  1YW0 A;  2A3D A;  3N9P A;  4ZI7 E;  2G0U A;  3RPU A;  4HTE A;  3S4U A;  2VK9 A;  3M65 A;  3ZMU B;  4HGA A;  4DVD A;  3OYZ A;  4YFS A;  2CXD A;  2D0U A;  5EK3 A;  1OWA A;  3ONX A;  2E9X B;  3KBT A;  2QA7 A;  1D0Z A;  2C5J A;  2Q9Q B;  3ETU A;  4DND A;  3ZPO A;  4PJN A;  4FI5 A;  5FY7 A;  4PFO A;  4L0R A;  3RYI E;  1MMD A;  4CI2 B;  1HFA A;  4YLH A;  2XAF B;  1D1B A;  2WSS V;  3B13 A;  2KMF A;  3CWZ B;  4C91 A;  4HEA A;  4H9S E;  4UV9 B;  3I0Q A;  4ZOL E;  1T98 A;  3WI3 A;  5JDG A;  5TAO A;  1H7C A;  2LSY A;  4ZI3 C;  1VRB A;  4PJL A;  5L2L A;  2WMN A;  4EXT A;  4GK0 E;  4GIW A;  2XAJ B;  2K24 A;  3ZMV B;  1KK7 A;  4DBR A;  4QX7 B;  2V1D B;  3CVR A;  4ISS A;  1MIY A;  4X1K E;  3IHR A;  1WRD A;  2ZM0 A;  2DNX A;  5JRE A;  4IE5 A;  3WUR A;  2ACX A;  3LBX B;  5J2U E;  2EHO D;  2DWK A;  4UXN B;  1EZ3 A;  1BR0 A;  4TX5 A;  3CX8 B;  3MAC A;  4ZHQ E;  2LT3 A;  4JUY A;  4YJ3 E;  5HXC A;  5DQW A;  2XAS B;  3KIN B;  4P09 A;  4TV8 E;  3ZYM A;  3N9N A;  4PK4 A;  2LEH A;  4ECG A;  1D0X A;  1LVF A;  3BQL A;  3KV6 A;  2C5K T;  4UVC B;  1Y64 B;  3DTO A;  5J2T E;  3AA7 B;  5L3F B;  3N9Q A;  2WWU A;  3AAA B;  3C64 A;  3DP7 A;  5CB4 E;  3UUN A;  3GN5 A;  3P8C D;  4JEH B;  4WBN E;  3AT7 A;  4H9N C;  3PTR B;  4HN9 A;  3ZN1 B;  5ETW A;  5L3C B;  1WLX A;  2KLQ A;  3Q5W A;  4H63 V;  3LK2 B;  1BR1 A;  4WNK A;  2CWO A;  1HG5 A;  1MIV A;  3OJA A;  3DJB A;  4IE4 A;  4ILU A;  5JDM A;  3CML A;  5H6R B;  2D2S A;  4E7S A;  3U78 A;  2LQU A;  2ZMA A;  4PW8 A;  2LE8 A;  4NUU A;  4ONR A;  1FMV A;  3VU7 H;  2VKJ A;  4QX8 B;  1HG2 A;  2QGS A;  3SS1 A;  3MKD A;  4QKN A;  5M4Y A;  3ZMS B;  2W0G A;  3KV4 A;  5LHH B;  5JDN A;  3RC8 A;  4N78 D;  2MTQ A;  3KV5 A;  4X1Y E;  2K9A A;  4OFZ A;  4ASK A;  5FYM A;  3FBZ A;  3AA1 B;  4JLE A;  2XTL A;  3ZMZ B;  3OKQ A;  2CLY B;  1WR6 A;  4DMW A;  1MIW A;  4WW0 A;  5EK4 A;  5LP6 E;  4CXY A;  2CXL A;  5IHY A;  2NW8 A;  1G73 A;  4FJO A;  3R6N A;  2V7J A;  3PU3 A;  2BVL A;  2W63 A;  3ZLI A;  2YIN A;  4AI6 A;  5LJN A;  5LBM A;  2X0L B;  4XBF B;  2C5I T;  2A72 A;  2LOS A;  1X79 A;  4M1P A;  5HWX A;  3QC9 A;  2V26 A;  3E0Z A;  3F2E A;  2KWH A;  5LGT B;  4IIJ E;  2DI4 A;  4BAY B;  3VJZ A;  5LCY A;  4IE7 A;  1IJ5 A;  2CA5 A;  3PUQ A;  3VKH A;  5JVD E;  3ZN0 B;  4OYK A;  1CUN A;  1IZN B;  3I9Y A;  2PG8 A;  2N1G A;  3KDS E;  1SHZ C;  4V1A v;  4H9R C;  2BDE A;  4NUV A;  3RRW A;  3GN5 B;  3PUA A;  3LG7 A;  4CI3 B;  5L3E B;  4KP3 C;  1UX4 A;  4K0U A;  4DBQ A;  3UFE A;  1IJ6 A;  3I9W A;  4G63 A;  1FEW A;  2EHO C;  3PUG A;  3O4X E;  2V7K A;  3EDV A;  2CEA A;  2IC9 A;  5LG4 A;  4EYY R;  4BGO A;  4AXP A;  5JDL A;  2X67 A;  2X9W A;  4TN7 B;  2JPF A;  1LKX A;  4TUY E;  4X1I E;  4BJM A;  5EK2 A;  5F3J A;  1BR4 A;  2NP9 A;  5LGU B;  5FMN A;  3MJX A;  2VAS A;  1FMW A;  2BZB A;  3CX6 B;  4G2A A;  3F31 A;  3ZYL A;  2JMH A;  2ZM2 A;  1S94 A;  4MAL A;  2V7M A;  3VKG A;  1U5P A;  3GMI A;  4ZI2 D;  2ES0 A;  4PJM A;  3SOL A;  3ZMT B;  2MBG A;  3C51 A;  3CX7 B;  5J1G A;  2DLR A;  1NWM X;  1ZKE A;  2ZM8 A;  2I59 A;  2YU1 A;  1YKH B;  3J9X 1;  2CE7 A;  4EOZ B;  3C4Z A;  2L9Q A;  3R84 B;  1D1C A;  4I55 E;  4P0B A;  2RP4 A;  3AA0 B;  3N9L A;  2N9D A;  2D0T A;  1MMG A;  2LSK A;  5FXX A;  3N2G E;  2LSG A;  5JR9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...