5JDQA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 100 mm na+ and 10mm sr2+
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
Knots found
sequence length
301
structure length
296
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIENNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
molecule keywords Uncharacterized membrane protein MJ0091
total genus 127
structure length 296
sequence length 301
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdqA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdqA02
5HXRA 5HXHA 5JDMA 5JDQA 3V5SA 5HXEA 5HYAA 5HWXA 5JDHA 5JDFA 5HWYA 3V5UA 5JDLA 5JDNA 5HXSA 5JDGA 5HXCA
chains in the Genus database with same CATH superfamily
2BVLA 4CI3B 3P50A 1HX8A 4GK0E 3IBPA 3ZMVB 1VCTA 2NW7A 2AXDS 3N5LA 2ODUA 3LBXA 4EAHA 3UQ4A 4E7SA 3LK3B 2UU9T 5AQIB 3FZLB 2CCQA 2WSSV 4H9RC 4U31A 3VHLA 2CWOA 5AQQB 3WI3A 2DL1A 5HXEA 4CN6A 2WBLA 2L7NA 5JR9C 2MTCA 5HEGA 2VQFT 3P8CD 1T72A 4JLEA 3VJZA 3RC8A 4TWHA 4UELA 5F3JA 5FL0A 2I59A 3QC9A 4IDOA 3RQUA 4OFZA 3TKLB 3UUBA 4A56A 4ERRA 3KV6A 5L4EA 2L8KA 3L39A 3FYQA 3AEFA 2V7JA 3ZMTB 2BKPA 1JNRA 2VVSA 3VR9A 3RGLA 3RQWA 1N33T 2VWAA 3OVUA 3WSCA 3TLUA 4ISSA 5AQFB 2W00A 3TLTA 1E2AA 4EYYR 2XSAA 4CXXA 1MNDA 3N9QA 2OLTA 2W66A 3J9X1 5HAXA 2LSJA 3TLWA 5L3FB 4LFCT 1IJ6A 3AECA 4ADZA 1MMAA 5LHHB 1FMWA 4X5TA 4LMJA 2E9XC 2IC6A 1U5PA 4IE4A 3Q5WA 2X67A 1OWAA 1E1HB 5AQOB 5FY1A 4YSZA 2H7OA 3F57A 1XMQT 5LP6E 3KVAA 4K0KT 4AI6A 2BG9B 4QH4A 4X1YE 1KFYA 1MIWA 2X0CA 3ZMSB 3BQLA 2LHRA 4DR3T 4NXMT 3VKGA 2FJAA 2L3LA 5BR8T 4L5GA 4PFPA 3B57A 2NR4A 3UU4A 2YU2A 3ZKRA 3AE6A 3K3QC 4B3TT 1WYCA 3BQKA 2BS3A 3HKBE 4HFVA 4ECGA 5HXHA 2V5DA 3AEAA 2BG9E 5H6RB 2E9XB 2XM2A 2I0MA 2X9WA 1WRDA 2CE7A 4HFDA 3RLFF 2VASA 3RYIE 2NWBA 4C90A 4EZHA 4HWFA 4ZS3A 3KINB 3HR0A 2KWHA 2Y8DA 2W2UA 3N9NA 2BBJA 5J1GA 4ZI3C 4PJLA 1J1JA 3PU3A 4HFBA 2N9DA 3L3PA 4JI5T 3UFEA 4BAYB 3RF1A 3RPUA 5LGUB 1SE7A 3UUNA 2WMOA 3PF0A 2R6GF 2XQ5A 3BK9A 1HNXT 5JDHA 5JDFA 4JV5T 5LXTE 1M7KA 5AQPB 2CHOA 2D2SA 2WP9A 4QXBB 5AQGB 5LHIB 5ABHA 2LM9A 4H9OC 2LSGA 2Y48B 1BR0A 4ISTA 2CWYA 3N2OA 3OBVE 1WLXA 5CA1E 5AQNB 4WW0A 3ANWB 3PUGA 2KXPB 4P09A 5FNVE 3EDUA 3ZYMA 5JH7E 4MFRA 5AQKB 4LF7T 1WR0A 2JPFA 3PDYA 2V6YB 2BKNA 2KMFA 2V7IA 5HXCA 4EV6A 3AA1B 5M4YA 1V9DA 2H88A 4IE5A 1XMOT 2J4GA 4I55E 4TNWA 3UTKA 3NKZA 5HWYA 2ZM0A 3N9LA 1HG2A 4YLHA 1AJ3A 2SPCA 1HG5A 5AQJB 2LJLA 4ILAA 4EYUA 4H9PC 5LJMA 4DV2T 5LHGB 2E5VA 1NAFA 1S94A 4PNIA 3WAKA 2V26A 3I0OA 3PUYF 2LT3A 1SUMB 4HFCA 1SHZC 5AFUL 5LG4A 3I1AA 4YTMA 5HEUA 4AISA 5C3JA 4EXTA 2JRKA 2WQYA 4U2ZA 1HR0T 4HGAA 4AKIA 3RIAA 4IIJE 3A8YC 3DP7A 3DJBA 4IDNA 4PJMA 3U78A 1WCRA 3ZT7A 1Z8UA 2XAQB 3CX7B 4QWNB 2B1EA 3UUMA 4O2BE 2LEHA 4A5XA 5CA0E 2A9UA 4PK4A 1VRBA 3C51A 3HKEE 3ZLIA 2D5UA 2YK0A 3MKDA 4UV8B 5JVDE 1YD8G 4L9IA 2RPAA 2J62A 3EDVA 3PU8A 3PV0F 4AKRB 3KV4A 2WCAA 2DLRA 2KINB 3JAEA 4X66T 4GOUA 1HS7A 1GQEA 3EHZA 3CWZB 4X20E 2IHR1 4H9QC 2WAUA 2X68A 1Y64B 3AEDA 3P4WA 4TX5A 5HEHA 4OHFA 5DQWA 1WFDA 1ZP0A 2FBWA 2C5IT 2W67A 3CX8B 3PUQA 3AE4A 3B5MA 1J5WA 4LF8T 3ZPOA 3N9PA 4TV9E 1S35A 1T8BA 2IUBA 2XASB 4AQYT 2ACZA 2FUPA 4DBRA 4QX7B 1HCIA 4HN9A 4U7IA 4UF0B 2CXDA 4DV0T 3IA3A 3KV5A 3AE9A 4ZHQE 3LFMA 2X9HA 5ABGA 2XQ4A 4YY3T 3MJXA 3EI0A 1W09A 3N9OA 3HI2A 1WR6A 3JCFA 3OKQA 1QUUA 3G06A 3C64A 4HWHA 3AEBA 1OXZA 3ONXA 3PUXF 2BG9A 5JDMA 2XQ3A 4COFA 1SA0E 3AE7A 5L3EB 4MHCA 4AKHA 4DV5T 3ANWA 5DJQC 1UURA 2KSRA 5KX5E 2YEVC 3VR8A 1NWMX 5ABFB 4ZI2D 3PUAA 4LMKA 5ETWA 2DCFA 4ANJA 4PFOA 4EB6E 4ZEYA 2WMNA 2XAHB 2E5LT 4JI4T 3FB2A 5L3GB 5FL1A 1U4QA 3FBZA 5L4HA 2WU2A 1I6ZA 2PTFA 4J2CA 5FYMA 5TAOA 3LG7A 3M1CA 3D0TA 2Q9QC 4OK0A 4YSXA 4U3CA 2LOSA 3FXDB 3CK6A 3NBXX 3FZMB 4HEAA 5FY7A 4EOZB 4YTNA 4X64T 4A98A 2M67A 3LJCA 4JI6T 1YQ4A 4B3MT 2XY8B 2DI4A 3I0QA 4AIUA 4EEDA 1OEDE 2LRKA 4QXCB 1SJ8A 2XQAA 1IBLT 4IDZA 4C91A 2LKHA 4YHHT 3RHWA 2H3RA 2KNDA 2WDVA 5T1DA 4DV7T 3MK7C 5FXWA 4DIDB 2CBJA 1E7PA 2YN6A 2XQ8A 3FZFB 4KHPT 4HWIB 3SOLA 3T1HT 1W9RA 4UIGA 2XM1A 3UT5E 3O1IA 1LKXA 4UEMA 3P4RA 3SWHA 3UULA 5AQRB 2FJEA 3AAAB 4DUYT 3C98B 5HYAA 3CKDA 2GK9A 3QB5A 4QH5A 3KBUA 4XBFB 2MAWA 3I9WA 1D0ZA 2N2NA 3EVYA 3VRBA 2J1DG 2QYWA 3OJAA 5JTGA 2PFVA 2RP4A 4HWCA 1ZV4X 3NVOA 1MMDA 2CM0A 2MOZA 2LHNA 3ZC0A 2XHEB 4I4TE 2LKGA 3AE5A 3AXJA 2D9DA 4QHOA 1FJGT 2PBIA 2V7LA 3AE3A 2DWKA 1ZKEA 2A72A 4UF0A 4JI3T 4ZOLE 4AKGA 5KXJA 2UUBT 4GYRA 1US7B 3RC3A 1T7SA 5JREA 4BGOA 4ZXLA 4TV8E 4LF4T 3ETUA 1FEWA 4DV1T 3T1YT 3QNUA 1N34T 4LF9T 4OYKA 5LMNT 4X1KE 4O2AE 2MPKA 1HTJF 4WZXA 2M6IA 3AXJB 3L09A 3FHNA 2W61A 1MMNA 3ONJA 4EZ4A 5ADXL 1ZEEA 5J2TE 4UVAB 4IL9A 2Y6XA 2V6XA 2EHOC 2K9AA 2V1DB 4I43B 2FJBA 2CBIA 3JADA 3N2GE 1R8IA 3GWHA 4IDPA 2C5KT 2G0UA 2VL8A 3F2EA 3HA4A 3LSVA 4GK5E 5JQGE 1KNPA 3U3IA 3PJAJ 2UXBT 3GA8A 3AY5A 3Q2MA 2YDQA 3AEEA 5EK3A 1CHUA 2ZM8A 2WZHA 2HN2A 4GYSA 3UFGA 3UU3A 3N9MA 3ZCJA 3B13A 4H63V 3Q5EA 4FJOA 5AQVB 5IHYA 5BMVE 3MACA 2LRLA 2QA7A 1LVFA 2XQ9A 3CQGB 3MA9A 4JEHB 5LB7B 1UK5A 3RH3A 2CMRA 4AQGA 2XQ6A 1IJ5A 3M3ZB 3AT7A 3RYFE 1HF8A 1KEYA 2Q9QA 4BJMA 1BR2A 2N1GA 4CI1B 3AAIA 4XZCA 3EAMA 2CRBA 2X0HA 2JQ9A 3AA7B 4ILUA 4WNKA 3ESLA 3UU6A 3C4WA 3NRYA 4EIWA 1ZOYA 1W0AA 1UGOA 2V7KA 1BR1A 3AE8A 4YT0A 3PUWF 2UXXB 5L3BB 3AB3B 2XAGB 1D1CA 3C4XA 3K1SA 2ZM2A 4O4JE 5L3DB 2WDQA 5FZTA 2E9XA 3AE2A 1CUNA 2Q9QD 3PUSA 3AAEB 2VURA 4JI1T 1WYBA 2CEAA 2FJDA 4CN4A 2DWGA 2JMHA 3RRCA 4PAGA 2V8SV 3ZT5A 4IE7A 2YDSA 5ABFA 3AVSA 2L9QA 4M1PA 3RIUC 2QGSA 4HFIA 3P4QA 3RKGA 3HL6A 4HKAA 2LSIA 3RIUA 3SRZA 4W8PA 2WB5A 3CMLA 3AVRA 5IWAT 2QVAA 1NENA 1Y01A 3A7MA 2WWVA 3X1DA 4WYVA 5LBQB 5LOVE 2VKHA 1JNZA 4AXPA 2OA5A 3FBLA 3K3NA 3L8RA 2ZM6T 1SJ7A 4I50E 4U74A 4G2AA 2BDEA 5CB4E 4TWFA 4CXWA 4WBNE 3CIRA 4HE8A 5FXZA 1N32T 3LK2B 3O1JA 4HWDA 3OYZA 4DV4T 2JIWA 2X0LB 4YTPA 2E8IA 4LMLA 4JI7T 1YKHB 4UVBB 2NTXA 3WURA 2NOXA 5HEJA 2NP9A 2C0SA 2WZIA 2VQET 2V6YA 2VL0A 3IHRA 3ZMUB 2F4VT 3RYCE 3E0ZA 4NPPA 1I94T 5EK4A 3C50A 3JAFA 3ONLC 4HFEA 5J0ZA 3LDQB 1KF6A 3KFWX 3SFDA 3P4PA 4LF6T 2I6HA 1VOMA 3CVRA 3I9YA 5JRCB 5GONE 2IAKA 2BVMA 3RRWA 2K24A 2W0GA 4HTEA 5AQLB 2X9YA 4UR9A 3TLSA 4ZI2C 3IF8B 3OPCA 1XWMA 2W62A 1UX4A 3OYXA 4JBWF 3TLVA 4TUYE 4ZZBA 3ZJ2A 2EHOB 5AQHB 5FP3A 1XNRT 2A2FX 2WY2A 3J7Yq 4EGWA 1HNWT 2HN1A 4DBQA 4DUZT 1XDOA 3ZYLA 5AQTB 3ZJ1A 4DMVA 2UUAT 2EHOD 4JI0T 4YXDA 1EZ3A 2IC9A 2WU5A 4B3ST 3CPZA 2XTLA 3AA6B 2JQHA 1D0YA 4ONRA 4F8HA 4ILBA 3ZYKA 3ZT6A 2W4XA 4PJNA 3FZKB 3RYHE 4CI2B 4P0AA 5A1LA 2AE9A 4LFBT 4O4LE 2JQQA 4QX8B 2YDRA 4CN1A 3N2KE 5FY0A 1UCUA 2K48A 4KX6A 3ZN0B 4MBQA 2DNXA 2W63A 3E08A 3P4SA 1YXRA 3AEGA 1HX1B 1O3XA 4MLKA 4UV9B 4DNDA 3ZN1B 3KBTA 3ABVA 1IBMT 3T8OA 3DYJA 4QXHB 1J5ET 3PUVF 5E0OA 3ZC1A 4IDQA 3KV9A 4KUMB 2IDOB 1YW0A 4MALA 2L10A 1HFAA 2K3WA 5LG3A 5LJNA 4KMCA 4P0BA 3NZQA 1DU2A 3IEEA 2ZLYA 4TNVA 5HWXA 4JI8T 3V5UA 2KWIB 4Z90A 2LOPA 2VKJA 2CPTA 2VKDA 2CHNA 2IW5B 1D0XA 4F6RC 3BQIA 1IBKT 2LQUA 3PURA 2H89A 4I0UA 5DQVA 4ASKA 5JDQA 2IMLA 1W0BA 2XPKA 3LBXB 4AQFC 4YFSA 1H7CA 3H37A 1LRZA 2KZ7B 3K3OA 2YOEA 2K5BB 1XDPA 4NUUA 1FMVA 2XQYA 3ZSTA 1HNZT 1OEDC 2P9BA 2XAJB 4BJNA 5KMGP 1B7TA 2XJ7A 3ETVA 2KBBA 3CX6B 4CXYA 3LK42 3PJAA 1IAPA 2JJ9A 1UX5A 1Z0PA 4A97A 5HXRA 2MTQA 5LGNB 2LSKA 2E9XD 2JQKA 3JC6C 4KHZF 3K8PC 3ZEFB 3RIFA 4H9NC 2YINA 3O9XA 1BR4A 4B3RT 3F31A 4F7GB 2NTYA 2ZMAA 2E2AA 5JR9B 4DV3T 1X9BA 2UXDT 2ODVA 5IUXA 2PG8A 4DR2T 4QKNA 4TN7B 3E22E 1KNRA 5C2TA 2UXNB 5EZYE 2CLYC 2X9XA 2XZEA 4GIWA 1MMGA 4DO0A 3CQXC 5JDGA 4DV6T 2X66A 1LVKA 2VK9A 4Z91A 3P7IA 5FVLA 4NXNT 3MZKB 2BBHA 1NEKA 5FXXA 3UUXB 3QK6A 1G8XA 5J2UE 1X79A 2MYSA 4GKJT 2CA5A 4TWDA 3UU5A 4BA9A 3AE1A 1UUSA 5L3CB 3UQ7A 4DR1T 2LSYA 4O4HE 5CJ5A 2WS3A 4LF5T 1OEDA 4U72A 3H3MA 4IHJE 4X62T 5L47A 3Q5XA 4U2YA 2KLQA 1MIYA 2BZBA 4H9SE 5FXVA 5AQMB 2NW9A 4UXNB 4E7ZA 1ZHCA 4DR4T 1YKEB 3VKHA 2C5JA 5LA6E 2BKOA 2LM2A 4IE6A 4KBMB 5L2LA 4ZI7E 2UXCT 2PJQA 2J47A 5HCMA 3FXEB 3SFEA 3NWIA 4N78D 5EK2A 4DR5T 3R84B 4CQIA 2UUCT 3RX6A 3NRXA 2X0YA 4UVCB 4XAXB 3S4UA 2M6BA 3AA0B 3FZHB 3EABA 1G73A 1OEDB 3GN5A 3KDSE 5KDMC 4X65T 5LMUT 3RKOA 5HCJA 5LBMA 3JC6D 5LGTB 3WAJA 3MXZA 3O4XE 4YJ3E 4YSYA 5LNKA 4CZZB 4QH1A 4YHJA 4DVDA 2BG9C 3KVBA 2D0UA 4U33A 4IREA 4IT4A 5CGMA 4B6XA 2DHRA 5JR9A 4ZZCA 3ZMZB 5AQSB 2RA1A 1QSDA 5LYJE 2WM9A 4DMWA 3SS1A 5HXSA 2WWUA 4O4IE 2LE8A 4AQFA 3A5XA 5DABA 5JRCA 3ZSSA 2YU1A 2X51A 3QB5K 4O8SA 2ACXA 3NZPA 2YKSA 3O1HA 5FMNA 3V5SA 4LFAT 2Q9QB 2VVNA 4ZS2A 5LCYA 4OX9T 4PK5A 4U7YA 5F8PA 4YJ2E 4IL4A 3ZCIA 3PE0A 2ES0A 4H63H 4IGUA 4L0RA 3VU7H 2CXFA 3HKDE 4PK6A 2XSBA 5HEOA 1T98A 3H3AA 3QUJA 4DR6T 1MIVA 2WDRA 4JEUB 2HH7A 5FVKA 1IZNB 4G63A 3RI5A 1KK7A 3VRAA 2HHHT 4JYAT 2EHOA 3Q5DA 5H6QB 4JUYA 2Z6EA 2VB6A 4HFHA 4WBOA 2XQ7A 5IYZE 3DTOA 5FKYA 4V1Av 2H7VC 2D0TA 2XAFB 4TZ4C 3OTOT 1VCSA 3GMIA 4OYJA 4JI2T 3W15B 1MNEA 3QOFA 4AKLA 1YQ3A 2IIUA 5CFBA 5JDLA 4PW8A 2V7MA 3PUZF 4FI5A 3M65A 2KT9A 2LLYA 4KI0F 3UU8A 2B76A 3GN5B 1XNQT 1M62A 1L0VA 4GKKT 4ZI3D 5JDNA 5F5WA 5ABEA 2CLYB 3EUHA 1D1BA 4K0UA 2KGXA 2KVPA 5C8YE 2BS2A 3PTRB 2NW8A 1N36T 4EEBA 3C4ZA 2MBGA 1D1AA 2A3DA 2V5CA 1XZYA 2HPLA 1FIOA 2VKOA 3HKCE 4NIQA 2BS4A 4NUVA 4P1NA 2XUEA 4DR7T 2OV9A 2QRXA 1KNZA 3Q9DA 2CXLA 4Z8XA 4ILCA 4IE0A 4X1IE 3CQCB 4PJJA 3PHF1 1QLBA 2JMKA 4Q25A 5AQUB 3R6NA 2HPJA 4KP3C
chains in the Genus database with same CATH topology
2BVLA 4CI3B 1HX8A 4GK0E 3IBPA 3ZMVB 2NW7A 3N5LA 2ODUA 3LBXA 4EAHA 4E7SA 3LK3B 2CCQA 2WSSV 4H9RC 3VHLA 2CWOA 3WI3A 5HXEA 2WBLA 2MTCA 3P8CD 4JLEA 3VJZA 3RC8A 4UELA 5F3JA 4ERRA 2I59A 3QC9A 3TKLB 4OFZA 4A56A 3KV6A 2L8KA 2V7JA 3ZMTB 2VWAA 3WSCA 4ISSA 2W00A 4EYYR 4CXXA 1MNDA 3N9QA 3J9X1 5HAXA 2LSJA 5L3FB 1IJ6A 4ADZA 1MMAA 5LHHB 1FMWA 2E9XC 2IC6A 1U5PA 4IE4A 3Q5WA 2X67A 1OWAA 1E1HB 5FY1A 2H7OA 3F57A 4AI6A 5LP6E 3KVAA 4X1YE 1MIWA 3ZMSB 3BQLA 2LHRA 3VKGA 2L3LA 4L5GA 4PFPA 3B57A 2YU2A 3K3QC 1WYCA 3BQKA 3HKBE 4HFVA 5HXHA 5H6RB 2E9XB 2X9WA 1WRDA 2CE7A 3RYIE 4EZHA 2VASA 2NWBA 4C90A 4ZS3A 3KINB 3HR0A 2KWHA 2Y8DA 3N9NA 5J1GA 4ZI3C 4PJLA 3PU3A 2N9DA 3L3PA 3UFEA 4BAYB 5LGUB 3RPUA 3UUNA 2WMOA 3PF0A 3BK9A 5JDHA 5JDFA 5LXTE 2D2SA 4QXBB 5LHIB 1BR0A 2LM9A 4H9OC 2LSGA 2Y48B 4ISTA 2CWYA 3N2OA 3OBVE 1WLXA 5CA1E 4WW0A 3ANWB 3PUGA 2KXPB 4P09A 5FNVE 3EDUA 3ZYMA 5JH7E 4MFRA 2JPFA 3PDYA 5HXCA 2KMFA 2V7IA 5M4YA 3AA1B 1V9DA 4IE5A 4I55E 3UTKA 5HWYA 2ZM0A 3N9LA 1HG2A 4YLHA 1AJ3A 2SPCA 1HG5A 2LJLA 4EYUA 4H9PC 5LJMA 5LHGB 1NAFA 1S94A 4PNIA 3WAKA 2V26A 3I0OA 2LT3A 5AFUL 1SHZC 5LG4A 3I1AA 4EXTA 2JRKA 4AKIA 4HGAA 4F6RC 4IIJE 3DP7A 3U78A 3DJBA 4PJMA 3CX7B 2XAQB 4QWNB 2B1EA 3UUMA 4O2BE 2LEHA 5CA0E 4PK4A 1VRBA 3C51A 3HKEE 3ZLIA 2D5UA 2YK0A 3MKDA 4UV8B 5JVDE 1YD8G 4L9IA 3EDVA 3PU8A 4AKRB 3KV4A 2DLRA 2KINB 4GOUA 1HS7A 3CWZB 4X20E 4H9QC 4TX5A 2WAUA 2X68A 1Y64B 5L3EB 4OHFA 5DQWA 3PUQA 4H63H 5LGTB 2C5IT 3CX8B 3ZPOA 3N9PA 4TV9E 1S35A 2XASB 4DBRA 4QX7B 1HCIA 4HN9A 4UF0B 2CXDA 4ZHQE 3KV5A 3LFMA 2X9HA 3MJXA 3N9OA 3HI2A 1WR6A 3OKQA 1QUUA 3C64A 1OXZA 3ONXA 5JDMA 4AKHA 1SA0E 4MHCA 3ANWA 5DJQC 5KX5E 2YEVC 1NWMX 4ZI2D 3PUAA 5ETWA 4EB6E 2DCFA 4ANJA 4PFOA 2WMNA 2XAHB 3FB2A 5L3GB 1U4QA 3FBZA 4J2CA 5FYMA 5TAOA 3LG7A 3M1CA 3D0TA 2Q9QC 4OK0A 2LOSA 3FXDB 5FY7A 3NBXX 4HEAA 4EOZB 2M67A 3LJCA 2DI4A 3I0QA 4QXCB 4IDZA 4C91A 2H3RA 2KNDA 5T1DA 3MK7C 5FXWA 3SOLA 4UIGA 3UT5E 3O1IA 1LKXA 4UEMA 3SWHA 3UULA 3AAAB 3C98B 5HYAA 3CKDA 2GK9A 4XBFB 3KBUA 3I9WA 1D0ZA 2N2NA 3EVYA 2J1DG 3OJAA 2PFVA 2RP4A 1ZV4X 1MMDA 2CM0A 2MOZA 2LHNA 3ZC0A 2XHEB 4I4TE 4QHOA 2PBIA 2V7LA 2DWKA 1ZKEA 2A72A 4UF0A 4ZOLE 4AKGA 4GYRA 1US7B 3RC3A 4BGOA 5JREA 4TV8E 3ETUA 1FEWA 4OYKA 4X1KE 4O2AE 1HTJF 3L09A 3FHNA 2W61A 1MMNA 5J2TE 4EZ4A 5ADXL 1ZEEA 4UVAB 2Y6XA 2EHOC 2K9AA 2V1DB 4I43B 3N2GE 3GWHA 3HA4A 2C5KT 2G0UA 2VL8A 3F2EA 4GK5E 5JQGE 3U3IA 3GA8A 3Q2MA 5EK3A 4DNDA 2ZM8A 4GYSA 3ZCJA 3N9MA 5BMVE 3B13A 4H63V 4FJOA 5IHYA 3MACA 3RH3A 2QA7A 1LVFA 3CQGB 3MA9A 4JEHB 5JDGA 2CMRA 4AQGA 3AT7A 1IJ5A 3RYFE 1HF8A 2Q9QA 4BJMA 1BR2A 2N1GA 4CI1B 3AAIA 4XZCA 3AA7B 4ILUA 4WNKA 3ESLA 3C4WA 3NRYA 4EIWA 2V7KA 5L3BB 1BR1A 2UXXB 3AB3B 2XAGB 1D1CA 3C4XA 2ZM2A 4O4JE 5L3DB 2E9XA 3PUSA 1CUNA 2Q9QD 3AAEB 1WYBA 2CEAA 2DWGA 2JMHA 3RRCA 4PAGA 4IE7A 3AVSA 2L9QA 4M1PA 2QGSA 3HL6A 4HKAA 2LSIA 3SRZA 3CMLA 3AVRA 5LBQB 5LOVE 2VKHA 4AXPA 2OA5A 3FBLA 3K3NA 4I50E 4U74A 4G2AA 2BDEA 5CB4E 4CXWA 4WBNE 4ONRA 5FXZA 4HE8A 3LK2B 3O1JA 3OYZA 2X0LB 2E8IA 1YKHB 4UVBB 2NTXA 3WURA 2NOXA 2NP9A 2C0SA 3ZMUB 3IHRA 3RYCE 3E0ZA 5EK4A 3C50A 3KFWX 1VOMA 3CVRA 3I9YA 5JRCB 5GONE 2IAKA 2BVMA 3RRWA 2K24A 2W0GA 4HTEA 2X9YA 4ZI2C 3IF8B 2W62A 3OYXA 1UX4A 4TUYE 3ZJ2A 2EHOB 5FP3A 2A2FX 3J7Yq 4DBQA 3ZYLA 3ZJ1A 4DMVA 2EHOD 1EZ3A 2IC9A 3CPZA 2XTLA 3AA6B 1D0YA 3ZYKA 4PJNA 3RYHE 4CI2B 4P0AA 5A1LA 4O4LE 2JQQA 4QX8B 3N2KE 5FY0A 1UCUA 2K48A 3ZN0B 4MBQA 2DNXA 2W63A 3E08A 1O3XA 4MLKA 4UV9B 3ZN1B 3KBTA 3T8OA 4QXHB 5E0OA 3ZC1A 3KV9A 4KUMB 1YW0A 4MALA 1HFAA 5LJNA 4KMCA 4P0BA 3NZQA 3IEEA 2ZLYA 5HWXA 3V5UA 2KWIB 2IW5B 2LOPA 2VKJA 2VKDA 1D0XA 2LQUA 3BQIA 3PURA 5DQVA 4ASKA 5JDQA 3LBXB 4AQFC 4YFSA 1H7CA 3H37A 1LRZA 2KZ7B 3K3OA 4NUUA 2K5BB 1FMVA 2XQYA 2P9BA 2XAJB 4BJNA 5KMGP 1B7TA 3ETVA 3CX6B 4CXYA 3LK42 1IAPA 2JJ9A 1UX5A 1Z0PA 5HXRA 2MTQA 5LGNB 2LSKA 2E9XD 3JC6C 3K8PC 3ZEFB 4H9NC 2YINA 3O9XA 1BR4A 3F31A 2NTYA 2ZMAA 5JR9B 2ODVA 2PG8A 4QKNA 4TN7B 3E22E 2UXNB 5EZYE 2CLYC 2X9XA 4DO0A 4GIWA 1MMGA 3CQXC 2X66A 1LVKA 2VK9A 3P7IA 3MZKB 3UUXB 5FXXA 3QK6A 1G8XA 5J2UE 1X79A 2MYSA 2CA5A 5L3CB 4BA9A 2LSYA 4O4HE 4U72A 4IHJE 3Q5XA 5FXVA 2KLQA 1MIYA 2BZBA 4H9SE 2NW9A 4E7ZA 3VKHA 4UXNB 1ZHCA 1YKEB 2C5JA 5LA6E 5L2LA 4IE6A 4KBMB 4ZI7E 2PJQA 5EK2A 3FXEB 4N78D 3R84B 4CQIA 3RX6A 3NRXA 4UVCB 4XAXB 3S4UA 3AA0B 3GN5A 3KDSE 1G73A 5KDMC 3RKOA 5LBMA 3JC6D 3WAJA 3MXZA 3O4XE 4YJ3E 5LNKA 4CZZB 4YHJA 4DVDA 3KVBA 2D0UA 4B6XA 2DHRA 5JR9A 3ZMZB 2RA1A 1QSDA 5LYJE 2WM9A 4DMWA 3SS1A 5HXSA 2WWUA 4O4IE 2LE8A 4AQFA 3A5XA 5DABA 5JRCA 2YU1A 2X51A 4O8SA 2ACXA 3NZPA 3O1HA 5FMNA 3V5SA 2Q9QB 4ZS2A 5LCYA 4PK5A 4YJ2E 5F8PA 3ZCIA 3PE0A 2ES0A 3VU7H 4IGUA 4L0RA 2CXFA 3HKDE 4PK6A 1T98A 3H3AA 3QUJA 1MIVA 4JEUB 2HH7A 1IZNB 4G63A 1KK7A 2EHOA 5H6QB 4JUYA 2Z6EA 2VB6A 5IYZE 4WBOA 3DTOA 4V1Av 2H7VC 2D0TA 2XAFB 4TZ4C 4ECGA 3GMIA 4OYJA 4AKLA 3W15B 1MNEA 5JR9C 5JDLA 4PW8A 2V7MA 4FI5A 3M65A 2KT9A 3GN5B 4ZI3D 5JDNA 2CLYB 3EUHA 1D1BA 4K0UA 5C8YE 3PTRB 2NW8A 3C4ZA 2MBGA 1D1AA 2A3DA 4NUVA 2HPLA 2VKOA 1FIOA 3HKCE 2XUEA 1KNZA 3Q9DA 2CXLA 4Z8XA 4IE0A 4X1IE 3CQCB 4PJJA 3PHF1 2JMKA 3R6NA 2HPJA 4KP3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXR A;  5HXH A;  5JDM A;  5JDQ A;  3V5S A;  5HXE A;  5HYA A;  5HWX A;  5JDH A;  5JDF A;  5HWY A;  3V5U A;  5JDL A;  5JDN A;  5HXS A;  5JDG A;  5HXC A; 
#chains in the Genus database with same CATH topology
 2BVL A;  4CI3 B;  3P50 A;  1HX8 A;  4GK0 E;  3IBP A;  3ZMV B;  1VCT A;  2NW7 A;  2AXD S;  3N5L A;  2ODU A;  3LBX A;  4EAH A;  3UQ4 A;  4E7S A;  3LK3 B;  2UU9 T;  5AQI B;  3FZL B;  2CCQ A;  2WSS V;  4H9R C;  4U31 A;  3VHL A;  2CWO A;  5AQQ B;  3WI3 A;  2DL1 A;  5HXE A;  4CN6 A;  2WBL A;  2L7N A;  5JR9 C;  2MTC A;  5HEG A;  2VQF T;  3P8C D;  1T72 A;  4JLE A;  3VJZ A;  3RC8 A;  4TWH A;  4UEL A;  5F3J A;  5FL0 A;  2I59 A;  3QC9 A;  4IDO A;  3RQU A;  4OFZ A;  3TKL B;  3UUB A;  4A56 A;  4ERR A;  3KV6 A;  5L4E A;  2L8K A;  3L39 A;  3FYQ A;  3AEF A;  2V7J A;  3ZMT B;  2BKP A;  1JNR A;  2VVS A;  3VR9 A;  3RGL A;  3RQW A;  1N33 T;  2VWA A;  3OVU A;  3WSC A;  3TLU A;  4ISS A;  5AQF B;  2W00 A;  3TLT A;  1E2A A;  4EYY R;  2XSA A;  4CXX A;  1MND A;  3N9Q A;  2OLT A;  2W66 A;  3J9X 1;  5HAX A;  2LSJ A;  3TLW A;  5L3F B;  4LFC T;  1IJ6 A;  3AEC A;  4ADZ A;  1MMA A;  5LHH B;  1FMW A;  4X5T A;  4LMJ A;  2E9X C;  2IC6 A;  1U5P A;  4IE4 A;  3Q5W A;  2X67 A;  1OWA A;  1E1H B;  5AQO B;  5FY1 A;  4YSZ A;  2H7O A;  3F57 A;  1XMQ T;  5LP6 E;  3KVA A;  4K0K T;  4AI6 A;  2BG9 B;  4QH4 A;  4X1Y E;  1KFY A;  1MIW A;  2X0C A;  3ZMS B;  3BQL A;  2LHR A;  4DR3 T;  4NXM T;  3VKG A;  2FJA A;  2L3L A;  5BR8 T;  4L5G A;  4PFP A;  3B57 A;  2NR4 A;  3UU4 A;  2YU2 A;  3ZKR A;  3AE6 A;  3K3Q C;  4B3T T;  1WYC A;  3BQK A;  2BS3 A;  3HKB E;  4HFV A;  4ECG A;  5HXH A;  2V5D A;  3AEA A;  2BG9 E;  5H6R B;  2E9X B;  2XM2 A;  2I0M A;  2X9W A;  1WRD A;  2CE7 A;  4HFD A;  3RLF F;  2VAS A;  3RYI E;  2NWB A;  4C90 A;  4EZH A;  4HWF A;  4ZS3 A;  3KIN B;  3HR0 A;  2KWH A;  2Y8D A;  2W2U A;  3N9N A;  2BBJ A;  5J1G A;  4ZI3 C;  4PJL A;  1J1J A;  3PU3 A;  4HFB A;  2N9D A;  3L3P A;  4JI5 T;  3UFE A;  4BAY B;  3RF1 A;  3RPU A;  5LGU B;  1SE7 A;  3UUN A;  2WMO A;  3PF0 A;  2R6G F;  2XQ5 A;  3BK9 A;  1HNX T;  5JDH A;  5JDF A;  4JV5 T;  5LXT E;  1M7K A;  5AQP B;  2CHO A;  2D2S A;  2WP9 A;  4QXB B;  5AQG B;  5LHI B;  5ABH A;  2LM9 A;  4H9O C;  2LSG A;  2Y48 B;  1BR0 A;  4IST A;  2CWY A;  3N2O A;  3OBV E;  1WLX A;  5CA1 E;  5AQN B;  4WW0 A;  3ANW B;  3PUG A;  2KXP B;  4P09 A;  5FNV E;  3EDU A;  3ZYM A;  5JH7 E;  4MFR A;  5AQK B;  4LF7 T;  1WR0 A;  2JPF A;  3PDY A;  2V6Y B;  2BKN A;  2KMF A;  2V7I A;  5HXC A;  4EV6 A;  3AA1 B;  5M4Y A;  1V9D A;  2H88 A;  4IE5 A;  1XMO T;  2J4G A;  4I55 E;  4TNW A;  3UTK A;  3NKZ A;  5HWY A;  2ZM0 A;  3N9L A;  1HG2 A;  4YLH A;  1AJ3 A;  2SPC A;  1HG5 A;  5AQJ B;  2LJL A;  4ILA A;  4EYU A;  4H9P C;  5LJM A;  4DV2 T;  5LHG B;  2E5V A;  1NAF A;  1S94 A;  4PNI A;  3WAK A;  2V26 A;  3I0O A;  3PUY F;  2LT3 A;  1SUM B;  4HFC A;  1SHZ C;  5AFU L;  5LG4 A;  3I1A A;  4YTM A;  5HEU A;  4AIS A;  5C3J A;  4EXT A;  2JRK A;  2WQY A;  4U2Z A;  1HR0 T;  4HGA A;  4AKI A;  3RIA A;  4IIJ E;  3A8Y C;  3DP7 A;  3DJB A;  4IDN A;  4PJM A;  3U78 A;  1WCR A;  3ZT7 A;  1Z8U A;  2XAQ B;  3CX7 B;  4QWN B;  2B1E A;  3UUM A;  4O2B E;  2LEH A;  4A5X A;  5CA0 E;  2A9U A;  4PK4 A;  1VRB A;  3C51 A;  3HKE E;  3ZLI A;  2D5U A;  2YK0 A;  3MKD A;  4UV8 B;  5JVD E;  1YD8 G;  4L9I A;  2RPA A;  2J62 A;  3EDV A;  3PU8 A;  3PV0 F;  4AKR B;  3KV4 A;  2WCA A;  2DLR A;  2KIN B;  3JAE A;  4X66 T;  4GOU A;  1HS7 A;  1GQE A;  3EHZ A;  3CWZ B;  4X20 E;  2IHR 1;  4H9Q C;  2WAU A;  2X68 A;  1Y64 B;  3AED A;  3P4W A;  4TX5 A;  5HEH A;  4OHF A;  5DQW A;  1WFD A;  1ZP0 A;  2FBW A;  2C5I T;  2W67 A;  3CX8 B;  3PUQ A;  3AE4 A;  3B5M A;  1J5W A;  4LF8 T;  3ZPO A;  3N9P A;  4TV9 E;  1S35 A;  1T8B A;  2IUB A;  2XAS B;  4AQY T;  2ACZ A;  2FUP A;  4DBR A;  4QX7 B;  1HCI A;  4HN9 A;  4U7I A;  4UF0 B;  2CXD A;  4DV0 T;  3IA3 A;  3KV5 A;  3AE9 A;  4ZHQ E;  3LFM A;  2X9H A;  5ABG A;  2XQ4 A;  4YY3 T;  3MJX A;  3EI0 A;  1W09 A;  3N9O A;  3HI2 A;  1WR6 A;  3JCF A;  3OKQ A;  1QUU A;  3G06 A;  3C64 A;  4HWH A;  3AEB A;  1OXZ A;  3ONX A;  3PUX F;  2BG9 A;  5JDM A;  2XQ3 A;  4COF A;  1SA0 E;  3AE7 A;  5L3E B;  4MHC A;  4AKH A;  4DV5 T;  3ANW A;  5DJQ C;  1UUR A;  2KSR A;  5KX5 E;  2YEV C;  3VR8 A;  1NWM X;  5ABF B;  4ZI2 D;  3PUA A;  4LMK A;  5ETW A;  2DCF A;  4ANJ A;  4PFO A;  4EB6 E;  4ZEY A;  2WMN A;  2XAH B;  2E5L T;  4JI4 T;  3FB2 A;  5L3G B;  5FL1 A;  1U4Q A;  3FBZ A;  5L4H A;  2WU2 A;  1I6Z A;  2PTF A;  4J2C A;  5FYM A;  5TAO A;  3LG7 A;  3M1C A;  3D0T A;  2Q9Q C;  4OK0 A;  4YSX A;  4U3C A;  2LOS A;  3FXD B;  3CK6 A;  3NBX X;  3FZM B;  4HEA A;  5FY7 A;  4EOZ B;  4YTN A;  4X64 T;  4A98 A;  2M67 A;  3LJC A;  4JI6 T;  1YQ4 A;  4B3M T;  2XY8 B;  2DI4 A;  3I0Q A;  4AIU A;  4EED A;  1OED E;  2LRK A;  4QXC B;  1SJ8 A;  2XQA A;  1IBL T;  4IDZ A;  4C91 A;  2LKH A;  4YHH T;  3RHW A;  2H3R A;  2KND A;  2WDV A;  5T1D A;  4DV7 T;  3MK7 C;  5FXW A;  4DID B;  2CBJ A;  1E7P A;  2YN6 A;  2XQ8 A;  3FZF B;  4KHP T;  4HWI B;  3SOL A;  3T1H T;  1W9R A;  4UIG A;  2XM1 A;  3UT5 E;  3O1I A;  1LKX A;  4UEM A;  3P4R A;  3SWH A;  3UUL A;  5AQR B;  2FJE A;  3AAA B;  4DUY T;  3C98 B;  5HYA A;  3CKD A;  2GK9 A;  3QB5 A;  4QH5 A;  3KBU A;  4XBF B;  2MAW A;  3I9W A;  1D0Z A;  2N2N A;  3EVY A;  3VRB A;  2J1D G;  2QYW A;  3OJA A;  5JTG A;  2PFV A;  2RP4 A;  4HWC A;  1ZV4 X;  3NVO A;  1MMD A;  2CM0 A;  2MOZ A;  2LHN A;  3ZC0 A;  2XHE B;  4I4T E;  2LKG A;  3AE5 A;  3AXJ A;  2D9D A;  4QHO A;  1FJG T;  2PBI A;  2V7L A;  3AE3 A;  2DWK A;  1ZKE A;  2A72 A;  4UF0 A;  4JI3 T;  4ZOL E;  4AKG A;  5KXJ A;  2UUB T;  4GYR A;  1US7 B;  3RC3 A;  1T7S A;  5JRE A;  4BGO A;  4ZXL A;  4TV8 E;  4LF4 T;  3ETU A;  1FEW A;  4DV1 T;  3T1Y T;  3QNU A;  1N34 T;  4LF9 T;  4OYK A;  5LMN T;  4X1K E;  4O2A E;  2MPK A;  1HTJ F;  4WZX A;  2M6I A;  3AXJ B;  3L09 A;  3FHN A;  2W61 A;  1MMN A;  3ONJ A;  4EZ4 A;  5ADX L;  1ZEE A;  5J2T E;  4UVA B;  4IL9 A;  2Y6X A;  2V6X A;  2EHO C;  2K9A A;  2V1D B;  4I43 B;  2FJB A;  2CBI A;  3JAD A;  3N2G E;  1R8I A;  3GWH A;  4IDP A;  2C5K T;  2G0U A;  2VL8 A;  3F2E A;  3HA4 A;  3LSV A;  4GK5 E;  5JQG E;  1KNP A;  3U3I A;  3PJA J;  2UXB T;  3GA8 A;  3AY5 A;  3Q2M A;  2YDQ A;  3AEE A;  5EK3 A;  1CHU A;  2ZM8 A;  2WZH A;  2HN2 A;  4GYS A;  3UFG A;  3UU3 A;  3N9M A;  3ZCJ A;  3B13 A;  4H63 V;  3Q5E A;  4FJO A;  5AQV B;  5IHY A;  5BMV E;  3MAC A;  2LRL A;  2QA7 A;  1LVF A;  2XQ9 A;  3CQG B;  3MA9 A;  4JEH B;  5LB7 B;  1UK5 A;  3RH3 A;  2CMR A;  4AQG A;  2XQ6 A;  1IJ5 A;  3M3Z B;  3AT7 A;  3RYF E;  1HF8 A;  1KEY A;  2Q9Q A;  4BJM A;  1BR2 A;  2N1G A;  4CI1 B;  3AAI A;  4XZC A;  3EAM A;  2CRB A;  2X0H A;  2JQ9 A;  3AA7 B;  4ILU A;  4WNK A;  3ESL A;  3UU6 A;  3C4W A;  3NRY A;  4EIW A;  1ZOY A;  1W0A A;  1UGO A;  2V7K A;  1BR1 A;  3AE8 A;  4YT0 A;  3PUW F;  2UXX B;  5L3B B;  3AB3 B;  2XAG B;  1D1C A;  3C4X A;  3K1S A;  2ZM2 A;  4O4J E;  5L3D B;  2WDQ A;  5FZT A;  2E9X A;  3AE2 A;  1CUN A;  2Q9Q D;  3PUS A;  3AAE B;  2VUR A;  4JI1 T;  1WYB A;  2CEA A;  2FJD A;  4CN4 A;  2DWG A;  2JMH A;  3RRC A;  4PAG A;  2V8S V;  3ZT5 A;  4IE7 A;  2YDS A;  5ABF A;  3AVS A;  2L9Q A;  4M1P A;  3RIU C;  2QGS A;  4HFI A;  3P4Q A;  3RKG A;  3HL6 A;  4HKA A;  2LSI A;  3RIU A;  3SRZ A;  4W8P A;  2WB5 A;  3CML A;  3AVR A;  5IWA T;  2QVA A;  1NEN A;  1Y01 A;  3A7M A;  2WWV A;  3X1D A;  4WYV A;  5LBQ B;  5LOV E;  2VKH A;  1JNZ A;  4AXP A;  2OA5 A;  3FBL A;  3K3N A;  3L8R A;  2ZM6 T;  1SJ7 A;  4I50 E;  4U74 A;  4G2A A;  2BDE A;  5CB4 E;  4TWF A;  4CXW A;  4WBN E;  3CIR A;  4HE8 A;  5FXZ A;  1N32 T;  3LK2 B;  3O1J A;  4HWD A;  3OYZ A;  4DV4 T;  2JIW A;  2X0L B;  4YTP A;  2E8I A;  4LML A;  4JI7 T;  1YKH B;  4UVB B;  2NTX A;  3WUR A;  2NOX A;  5HEJ A;  2NP9 A;  2C0S A;  2WZI A;  2VQE T;  2V6Y A;  2VL0 A;  3IHR A;  3ZMU B;  2F4V T;  3RYC E;  3E0Z A;  4NPP A;  1I94 T;  5EK4 A;  3C50 A;  3JAF A;  3ONL C;  4HFE A;  5J0Z A;  3LDQ B;  1KF6 A;  3KFW X;  3SFD A;  3P4P A;  4LF6 T;  2I6H A;  1VOM A;  3CVR A;  3I9Y A;  5JRC B;  5GON E;  2IAK A;  2BVM A;  3RRW A;  2K24 A;  2W0G A;  4HTE A;  5AQL B;  2X9Y A;  4UR9 A;  3TLS A;  4ZI2 C;  3IF8 B;  3OPC A;  1XWM A;  2W62 A;  1UX4 A;  3OYX A;  4JBW F;  3TLV A;  4TUY E;  4ZZB A;  3ZJ2 A;  2EHO B;  5AQH B;  5FP3 A;  1XNR T;  2A2F X;  2WY2 A;  3J7Y q;  4EGW A;  1HNW T;  2HN1 A;  4DBQ A;  4DUZ T;  1XDO A;  3ZYL A;  5AQT B;  3ZJ1 A;  4DMV A;  2UUA T;  2EHO D;  4JI0 T;  4YXD A;  1EZ3 A;  2IC9 A;  2WU5 A;  4B3S T;  3CPZ A;  2XTL A;  3AA6 B;  2JQH A;  1D0Y A;  4ONR A;  4F8H A;  4ILB A;  3ZYK A;  3ZT6 A;  2W4X A;  4PJN A;  3FZK B;  3RYH E;  4CI2 B;  4P0A A;  5A1L A;  2AE9 A;  4LFB T;  4O4L E;  2JQQ A;  4QX8 B;  2YDR A;  4CN1 A;  3N2K E;  5FY0 A;  1UCU A;  2K48 A;  4KX6 A;  3ZN0 B;  4MBQ A;  2DNX A;  2W63 A;  3E08 A;  3P4S A;  1YXR A;  3AEG A;  1HX1 B;  1O3X A;  4MLK A;  4UV9 B;  4DND A;  3ZN1 B;  3KBT A;  3ABV A;  1IBM T;  3T8O A;  3DYJ A;  4QXH B;  1J5E T;  3PUV F;  5E0O A;  3ZC1 A;  4IDQ A;  3KV9 A;  4KUM B;  2IDO B;  1YW0 A;  4MAL A;  2L10 A;  1HFA A;  2K3W A;  5LG3 A;  5LJN A;  4KMC A;  4P0B A;  3NZQ A;  1DU2 A;  3IEE A;  2ZLY A;  4TNV A;  5HWX A;  4JI8 T;  3V5U A;  2KWI B;  4Z90 A;  2LOP A;  2VKJ A;  2CPT A;  2VKD A;  2CHN A;  2IW5 B;  1D0X A;  4F6R C;  3BQI A;  1IBK T;  2LQU A;  3PUR A;  2H89 A;  4I0U A;  5DQV A;  4ASK A;  5JDQ A;  2IML A;  1W0B A;  2XPK A;  3LBX B;  4AQF C;  4YFS A;  1H7C A;  3H37 A;  1LRZ A;  2KZ7 B;  3K3O A;  2YOE A;  2K5B B;  1XDP A;  4NUU A;  1FMV A;  2XQY A;  3ZST A;  1HNZ T;  1OED C;  2P9B A;  2XAJ B;  4BJN A;  5KMG P;  1B7T A;  2XJ7 A;  3ETV A;  2KBB A;  3CX6 B;  4CXY A;  3LK4 2;  3PJA A;  1IAP A;  2JJ9 A;  1UX5 A;  1Z0P A;  4A97 A;  5HXR A;  2MTQ A;  5LGN B;  2LSK A;  2E9X D;  2JQK A;  3JC6 C;  4KHZ F;  3K8P C;  3ZEF B;  3RIF A;  4H9N C;  2YIN A;  3O9X A;  1BR4 A;  4B3R T;  3F31 A;  4F7G B;  2NTY A;  2ZMA A;  2E2A A;  5JR9 B;  4DV3 T;  1X9B A;  2UXD T;  2ODV A;  5IUX A;  2PG8 A;  4DR2 T;  4QKN A;  4TN7 B;  3E22 E;  1KNR A;  5C2T A;  2UXN B;  5EZY E;  2CLY C;  2X9X A;  2XZE A;  4GIW A;  1MMG A;  4DO0 A;  3CQX C;  5JDG A;  4DV6 T;  2X66 A;  1LVK A;  2VK9 A;  4Z91 A;  3P7I A;  5FVL A;  4NXN T;  3MZK B;  2BBH A;  1NEK A;  5FXX A;  3UUX B;  3QK6 A;  1G8X A;  5J2U E;  1X79 A;  2MYS A;  4GKJ T;  2CA5 A;  4TWD A;  3UU5 A;  4BA9 A;  3AE1 A;  1UUS A;  5L3C B;  3UQ7 A;  4DR1 T;  2LSY A;  4O4H E;  5CJ5 A;  2WS3 A;  4LF5 T;  1OED A;  4U72 A;  3H3M A;  4IHJ E;  4X62 T;  5L47 A;  3Q5X A;  4U2Y A;  2KLQ A;  1MIY A;  2BZB A;  4H9S E;  5FXV A;  5AQM B;  2NW9 A;  4UXN B;  4E7Z A;  1ZHC A;  4DR4 T;  1YKE B;  3VKH A;  2C5J A;  5LA6 E;  2BKO A;  2LM2 A;  4IE6 A;  4KBM B;  5L2L A;  4ZI7 E;  2UXC T;  2PJQ A;  2J47 A;  5HCM A;  3FXE B;  3SFE A;  3NWI A;  4N78 D;  5EK2 A;  4DR5 T;  3R84 B;  4CQI A;  2UUC T;  3RX6 A;  3NRX A;  2X0Y A;  4UVC B;  4XAX B;  3S4U A;  2M6B A;  3AA0 B;  3FZH B;  3EAB A;  1G73 A;  1OED B;  3GN5 A;  3KDS E;  5KDM C;  4X65 T;  5LMU T;  3RKO A;  5HCJ A;  5LBM A;  3JC6 D;  5LGT B;  3WAJ A;  3MXZ A;  3O4X E;  4YJ3 E;  4YSY A;  5LNK A;  4CZZ B;  4QH1 A;  4YHJ A;  4DVD A;  2BG9 C;  3KVB A;  2D0U A;  4U33 A;  4IRE A;  4IT4 A;  5CGM A;  4B6X A;  2DHR A;  5JR9 A;  4ZZC A;  3ZMZ B;  5AQS B;  2RA1 A;  1QSD A;  5LYJ E;  2WM9 A;  4DMW A;  3SS1 A;  5HXS A;  2WWU A;  4O4I E;  2LE8 A;  4AQF A;  3A5X A;  5DAB A;  5JRC A;  3ZSS A;  2YU1 A;  2X51 A;  3QB5 K;  4O8S A;  2ACX A;  3NZP A;  2YKS A;  3O1H A;  5FMN A;  3V5S A;  4LFA T;  2Q9Q B;  2VVN A;  4ZS2 A;  5LCY A;  4OX9 T;  4PK5 A;  4U7Y A;  5F8P A;  4YJ2 E;  4IL4 A;  3ZCI A;  3PE0 A;  2ES0 A;  4H63 H;  4IGU A;  4L0R A;  3VU7 H;  2CXF A;  3HKD E;  4PK6 A;  2XSB A;  5HEO A;  1T98 A;  3H3A A;  3QUJ A;  4DR6 T;  1MIV A;  2WDR A;  4JEU B;  2HH7 A;  5FVK A;  1IZN B;  4G63 A;  3RI5 A;  1KK7 A;  3VRA A;  2HHH T;  4JYA T;  2EHO A;  3Q5D A;  5H6Q B;  4JUY A;  2Z6E A;  2VB6 A;  4HFH A;  4WBO A;  2XQ7 A;  5IYZ E;  3DTO A;  5FKY A;  4V1A v;  2H7V C;  2D0T A;  2XAF B;  4TZ4 C;  3OTO T;  1VCS A;  3GMI A;  4OYJ A;  4JI2 T;  3W15 B;  1MNE A;  3QOF A;  4AKL A;  1YQ3 A;  2IIU A;  5CFB A;  5JDL A;  4PW8 A;  2V7M A;  3PUZ F;  4FI5 A;  3M65 A;  2KT9 A;  2LLY A;  4KI0 F;  3UU8 A;  2B76 A;  3GN5 B;  1XNQ T;  1M62 A;  1L0V A;  4GKK T;  4ZI3 D;  5JDN A;  5F5W A;  5ABE A;  2CLY B;  3EUH A;  1D1B A;  4K0U A;  2KGX A;  2KVP A;  5C8Y E;  2BS2 A;  3PTR B;  2NW8 A;  1N36 T;  4EEB A;  3C4Z A;  2MBG A;  1D1A A;  2A3D A;  2V5C A;  1XZY A;  2HPL A;  1FIO A;  2VKO A;  3HKC E;  4NIQ A;  2BS4 A;  4NUV A;  4P1N A;  2XUE A;  4DR7 T;  2OV9 A;  2QRX A;  1KNZ A;  3Q9D A;  2CXL A;  4Z8X A;  4ILC A;  4IE0 A;  4X1I E;  3CQC B;  4PJJ A;  3PHF 1;  1QLB A;  2JMK A;  4Q25 A;  5AQU B;  3R6N A;  2HPJ A;  4KP3 C; 
#chains in the Genus database with same CATH homology
 2BVL A;  4CI3 B;  1HX8 A;  4GK0 E;  3IBP A;  3ZMV B;  2NW7 A;  3N5L A;  2ODU A;  3LBX A;  4EAH A;  4E7S A;  3LK3 B;  2CCQ A;  2WSS V;  4H9R C;  3VHL A;  2CWO A;  3WI3 A;  5HXE A;  2WBL A;  2MTC A;  3P8C D;  4JLE A;  3VJZ A;  3RC8 A;  4UEL A;  5F3J A;  4ERR A;  2I59 A;  3QC9 A;  3TKL B;  4OFZ A;  4A56 A;  3KV6 A;  2L8K A;  2V7J A;  3ZMT B;  2VWA A;  3WSC A;  4ISS A;  2W00 A;  4EYY R;  4CXX A;  1MND A;  3N9Q A;  3J9X 1;  5HAX A;  2LSJ A;  5L3F B;  1IJ6 A;  4ADZ A;  1MMA A;  5LHH B;  1FMW A;  2E9X C;  2IC6 A;  1U5P A;  4IE4 A;  3Q5W A;  2X67 A;  1OWA A;  1E1H B;  5FY1 A;  2H7O A;  3F57 A;  4AI6 A;  5LP6 E;  3KVA A;  4X1Y E;  1MIW A;  3ZMS B;  3BQL A;  2LHR A;  3VKG A;  2L3L A;  4L5G A;  4PFP A;  3B57 A;  2YU2 A;  3K3Q C;  1WYC A;  3BQK A;  3HKB E;  4HFV A;  5HXH A;  5H6R B;  2E9X B;  2X9W A;  1WRD A;  2CE7 A;  3RYI E;  4EZH A;  2VAS A;  2NWB A;  4C90 A;  4ZS3 A;  3KIN B;  3HR0 A;  2KWH A;  2Y8D A;  3N9N A;  5J1G A;  4ZI3 C;  4PJL A;  3PU3 A;  2N9D A;  3L3P A;  3UFE A;  4BAY B;  5LGU B;  3RPU A;  3UUN A;  2WMO A;  3PF0 A;  3BK9 A;  5JDH A;  5JDF A;  5LXT E;  2D2S A;  4QXB B;  5LHI B;  1BR0 A;  2LM9 A;  4H9O C;  2LSG A;  2Y48 B;  4IST A;  2CWY A;  3N2O A;  3OBV E;  1WLX A;  5CA1 E;  4WW0 A;  3ANW B;  3PUG A;  2KXP B;  4P09 A;  5FNV E;  3EDU A;  3ZYM A;  5JH7 E;  4MFR A;  2JPF A;  3PDY A;  5HXC A;  2KMF A;  2V7I A;  5M4Y A;  3AA1 B;  1V9D A;  4IE5 A;  4I55 E;  3UTK A;  5HWY A;  2ZM0 A;  3N9L A;  1HG2 A;  4YLH A;  1AJ3 A;  2SPC A;  1HG5 A;  2LJL A;  4EYU A;  4H9P C;  5LJM A;  5LHG B;  1NAF A;  1S94 A;  4PNI A;  3WAK A;  2V26 A;  3I0O A;  2LT3 A;  5AFU L;  1SHZ C;  5LG4 A;  3I1A A;  4EXT A;  2JRK A;  4AKI A;  4HGA A;  4F6R C;  4IIJ E;  3DP7 A;  3U78 A;  3DJB A;  4PJM A;  3CX7 B;  2XAQ B;  4QWN B;  2B1E A;  3UUM A;  4O2B E;  2LEH A;  5CA0 E;  4PK4 A;  1VRB A;  3C51 A;  3HKE E;  3ZLI A;  2D5U A;  2YK0 A;  3MKD A;  4UV8 B;  5JVD E;  1YD8 G;  4L9I A;  3EDV A;  3PU8 A;  4AKR B;  3KV4 A;  2DLR A;  2KIN B;  4GOU A;  1HS7 A;  3CWZ B;  4X20 E;  4H9Q C;  4TX5 A;  2WAU A;  2X68 A;  1Y64 B;  5L3E B;  4OHF A;  5DQW A;  3PUQ A;  4H63 H;  5LGT B;  2C5I T;  3CX8 B;  3ZPO A;  3N9P A;  4TV9 E;  1S35 A;  2XAS B;  4DBR A;  4QX7 B;  1HCI A;  4HN9 A;  4UF0 B;  2CXD A;  4ZHQ E;  3KV5 A;  3LFM A;  2X9H A;  3MJX A;  3N9O A;  3HI2 A;  1WR6 A;  3OKQ A;  1QUU A;  3C64 A;  1OXZ A;  3ONX A;  5JDM A;  4AKH A;  1SA0 E;  4MHC A;  3ANW A;  5DJQ C;  5KX5 E;  2YEV C;  1NWM X;  4ZI2 D;  3PUA A;  5ETW A;  4EB6 E;  2DCF A;  4ANJ A;  4PFO A;  2WMN A;  2XAH B;  3FB2 A;  5L3G B;  1U4Q A;  3FBZ A;  4J2C A;  5FYM A;  5TAO A;  3LG7 A;  3M1C A;  3D0T A;  2Q9Q C;  4OK0 A;  2LOS A;  3FXD B;  5FY7 A;  3NBX X;  4HEA A;  4EOZ B;  2M67 A;  3LJC A;  2DI4 A;  3I0Q A;  4QXC B;  4IDZ A;  4C91 A;  2H3R A;  2KND A;  5T1D A;  3MK7 C;  5FXW A;  3SOL A;  4UIG A;  3UT5 E;  3O1I A;  1LKX A;  4UEM A;  3SWH A;  3UUL A;  3AAA B;  3C98 B;  5HYA A;  3CKD A;  2GK9 A;  4XBF B;  3KBU A;  3I9W A;  1D0Z A;  2N2N A;  3EVY A;  2J1D G;  3OJA A;  2PFV A;  2RP4 A;  1ZV4 X;  1MMD A;  2CM0 A;  2MOZ A;  2LHN A;  3ZC0 A;  2XHE B;  4I4T E;  4QHO A;  2PBI A;  2V7L A;  2DWK A;  1ZKE A;  2A72 A;  4UF0 A;  4ZOL E;  4AKG A;  4GYR A;  1US7 B;  3RC3 A;  4BGO A;  5JRE A;  4TV8 E;  3ETU A;  1FEW A;  4OYK A;  4X1K E;  4O2A E;  1HTJ F;  3L09 A;  3FHN A;  2W61 A;  1MMN A;  5J2T E;  4EZ4 A;  5ADX L;  1ZEE A;  4UVA B;  2Y6X A;  2EHO C;  2K9A A;  2V1D B;  4I43 B;  3N2G E;  3GWH A;  3HA4 A;  2C5K T;  2G0U A;  2VL8 A;  3F2E A;  4GK5 E;  5JQG E;  3U3I A;  3GA8 A;  3Q2M A;  5EK3 A;  4DND A;  2ZM8 A;  4GYS A;  3ZCJ A;  3N9M A;  5BMV E;  3B13 A;  4H63 V;  4FJO A;  5IHY A;  3MAC A;  3RH3 A;  2QA7 A;  1LVF A;  3CQG B;  3MA9 A;  4JEH B;  5JDG A;  2CMR A;  4AQG A;  3AT7 A;  1IJ5 A;  3RYF E;  1HF8 A;  2Q9Q A;  4BJM A;  1BR2 A;  2N1G A;  4CI1 B;  3AAI A;  4XZC A;  3AA7 B;  4ILU A;  4WNK A;  3ESL A;  3C4W A;  3NRY A;  4EIW A;  2V7K A;  5L3B B;  1BR1 A;  2UXX B;  3AB3 B;  2XAG B;  1D1C A;  3C4X A;  2ZM2 A;  4O4J E;  5L3D B;  2E9X A;  3PUS A;  1CUN A;  2Q9Q D;  3AAE B;  1WYB A;  2CEA A;  2DWG A;  2JMH A;  3RRC A;  4PAG A;  4IE7 A;  3AVS A;  2L9Q A;  4M1P A;  2QGS A;  3HL6 A;  4HKA A;  2LSI A;  3SRZ A;  3CML A;  3AVR A;  5LBQ B;  5LOV E;  2VKH A;  4AXP A;  2OA5 A;  3FBL A;  3K3N A;  4I50 E;  4U74 A;  4G2A A;  2BDE A;  5CB4 E;  4CXW A;  4WBN E;  4ONR A;  5FXZ A;  4HE8 A;  3LK2 B;  3O1J A;  3OYZ A;  2X0L B;  2E8I A;  1YKH B;  4UVB B;  2NTX A;  3WUR A;  2NOX A;  2NP9 A;  2C0S A;  3ZMU B;  3IHR A;  3RYC E;  3E0Z A;  5EK4 A;  3C50 A;  3KFW X;  1VOM A;  3CVR A;  3I9Y A;  5JRC B;  5GON E;  2IAK A;  2BVM A;  3RRW A;  2K24 A;  2W0G A;  4HTE A;  2X9Y A;  4ZI2 C;  3IF8 B;  2W62 A;  3OYX A;  1UX4 A;  4TUY E;  3ZJ2 A;  2EHO B;  5FP3 A;  2A2F X;  3J7Y q;  4DBQ A;  3ZYL A;  3ZJ1 A;  4DMV A;  2EHO D;  1EZ3 A;  2IC9 A;  3CPZ A;  2XTL A;  3AA6 B;  1D0Y A;  3ZYK A;  4PJN A;  3RYH E;  4CI2 B;  4P0A A;  5A1L A;  4O4L E;  2JQQ A;  4QX8 B;  3N2K E;  5FY0 A;  1UCU A;  2K48 A;  3ZN0 B;  4MBQ A;  2DNX A;  2W63 A;  3E08 A;  1O3X A;  4MLK A;  4UV9 B;  3ZN1 B;  3KBT A;  3T8O A;  4QXH B;  5E0O A;  3ZC1 A;  3KV9 A;  4KUM B;  1YW0 A;  4MAL A;  1HFA A;  5LJN A;  4KMC A;  4P0B A;  3NZQ A;  3IEE A;  2ZLY A;  5HWX A;  3V5U A;  2KWI B;  2IW5 B;  2LOP A;  2VKJ A;  2VKD A;  1D0X A;  2LQU A;  3BQI A;  3PUR A;  5DQV A;  4ASK A;  5JDQ A;  3LBX B;  4AQF C;  4YFS A;  1H7C A;  3H37 A;  1LRZ A;  2KZ7 B;  3K3O A;  4NUU A;  2K5B B;  1FMV A;  2XQY A;  2P9B A;  2XAJ B;  4BJN A;  5KMG P;  1B7T A;  3ETV A;  3CX6 B;  4CXY A;  3LK4 2;  1IAP A;  2JJ9 A;  1UX5 A;  1Z0P A;  5HXR A;  2MTQ A;  5LGN B;  2LSK A;  2E9X D;  3JC6 C;  3K8P C;  3ZEF B;  4H9N C;  2YIN A;  3O9X A;  1BR4 A;  3F31 A;  2NTY A;  2ZMA A;  5JR9 B;  2ODV A;  2PG8 A;  4QKN A;  4TN7 B;  3E22 E;  2UXN B;  5EZY E;  2CLY C;  2X9X A;  4DO0 A;  4GIW A;  1MMG A;  3CQX C;  2X66 A;  1LVK A;  2VK9 A;  3P7I A;  3MZK B;  3UUX B;  5FXX A;  3QK6 A;  1G8X A;  5J2U E;  1X79 A;  2MYS A;  2CA5 A;  5L3C B;  4BA9 A;  2LSY A;  4O4H E;  4U72 A;  4IHJ E;  3Q5X A;  5FXV A;  2KLQ A;  1MIY A;  2BZB A;  4H9S E;  2NW9 A;  4E7Z A;  3VKH A;  4UXN B;  1ZHC A;  1YKE B;  2C5J A;  5LA6 E;  5L2L A;  4IE6 A;  4KBM B;  4ZI7 E;  2PJQ A;  5EK2 A;  3FXE B;  4N78 D;  3R84 B;  4CQI A;  3RX6 A;  3NRX A;  4UVC B;  4XAX B;  3S4U A;  3AA0 B;  3GN5 A;  3KDS E;  1G73 A;  5KDM C;  3RKO A;  5LBM A;  3JC6 D;  3WAJ A;  3MXZ A;  3O4X E;  4YJ3 E;  5LNK A;  4CZZ B;  4YHJ A;  4DVD A;  3KVB A;  2D0U A;  4B6X A;  2DHR A;  5JR9 A;  3ZMZ B;  2RA1 A;  1QSD A;  5LYJ E;  2WM9 A;  4DMW A;  3SS1 A;  5HXS A;  2WWU A;  4O4I E;  2LE8 A;  4AQF A;  3A5X A;  5DAB A;  5JRC A;  2YU1 A;  2X51 A;  4O8S A;  2ACX A;  3NZP A;  3O1H A;  5FMN A;  3V5S A;  2Q9Q B;  4ZS2 A;  5LCY A;  4PK5 A;  4YJ2 E;  5F8P A;  3ZCI A;  3PE0 A;  2ES0 A;  3VU7 H;  4IGU A;  4L0R A;  2CXF A;  3HKD E;  4PK6 A;  1T98 A;  3H3A A;  3QUJ A;  1MIV A;  4JEU B;  2HH7 A;  1IZN B;  4G63 A;  1KK7 A;  2EHO A;  5H6Q B;  4JUY A;  2Z6E A;  2VB6 A;  5IYZ E;  4WBO A;  3DTO A;  4V1A v;  2H7V C;  2D0T A;  2XAF B;  4TZ4 C;  4ECG A;  3GMI A;  4OYJ A;  4AKL A;  3W15 B;  1MNE A;  5JR9 C;  5JDL A;  4PW8 A;  2V7M A;  4FI5 A;  3M65 A;  2KT9 A;  3GN5 B;  4ZI3 D;  5JDN A;  2CLY B;  3EUH A;  1D1B A;  4K0U A;  5C8Y E;  3PTR B;  2NW8 A;  3C4Z A;  2MBG A;  1D1A A;  2A3D A;  4NUV A;  2HPL A;  2VKO A;  1FIO A;  3HKC E;  2XUE A;  1KNZ A;  3Q9D A;  2CXL A;  4Z8X A;  4IE0 A;  4X1I E;  3CQC B;  4PJJ A;  3PHF 1;  2JMK A;  3R6N A;  2HPJ A;  4KP3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...