5JDHA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 10 mm na+ and 10mm ca2+
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
Knots found
sequence length
301
structure length
297
Chain Sequence
b'MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized membrane protein MJ0091
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 123
structure length 297
sequence length 301
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdhA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdhA02
5HXRA 3V5UA 5JDMA 5HYAA 5HXEA 5JDFA 3V5SA 5JDLA 5JDGA 5JDQA 5HXCA 5JDNA 5HWYA 5HXHA 5HWXA 5HXSA 5JDHA
chains in the Genus database with same CATH superfamily
5AFUL 2XAGB 3SRZA 5JR9A 1GQEA 2LSKA 2BDEA 2NW7A 4BA9A 3RX6A 4DMWA 1WCRA 1IAPA 1ZHCA 3ZPOA 2W61A 5AQMB 4QX8B 4FJOA 1AJ3A 3UFEA 2IAKA 5M4YA 4AKIA 2XAQB 1X79A 4IGUA 2XQ7A 5HXCA 3RRCA 2XSAA 4ZI7E 4HN9A 4IE0A 2LSGA 3LBXB 3PUVF 3JADA 3PJAA 4IE6A 4LMKA 2HHHT 3ZC0A 2LQUA 1Z0PA 4HE8A 4AQGA 3PF0A 5AQPB 2K9AA 4EEBA 4I43B 2YU2A 2QVAA 2Q9QC 4HFVA 5LGUB 2KSRA 2IMLA 5JTGA 2V5DA 2A9UA 2WP9A 3ZMSB 4JYAT 2C5KT 5L47A 3P4PA 1UCUA 3N9QA 4AXPA 4WBOA 5HEJA 4OFZA 4AQFA 3PE0A 3KV5A 4PJLA 4DV0T 4UVCB 2CWOA 1DU2A 3LFMA 4HWIB 1XWMA 3LBXA 4L9IA 3P4SA 4UF0B 1EZ3A 1R8IA 2BS4A 2V8SV 4UV9B 1BR4A 2Q9QD 3OTOT 3GMIA 2XY8B 3J9X1 5CGMA 4NPPA 1IBKT 4BJMA 4B3MT 2PG8A 2NP9A 4HFCA 2Y8DA 4ZZBA 4PFOA 4DR3T 4GKKT 3AE3A 4LF5T 3HKEE 4H9NC 4QH5A 3AAEB 5FP3A 3CQCB 2YU1A 3B57A 2WWVA 3AE8A 3P8CD 4FI5A 2ODUA 3MA9A 3CX7B 5ABEA 3AE6A 4U2ZA 4U7YA 3RIFA 3AAAB 3VHLA 3KVBA 4EYYR 4QXCB 4QH1A 3VJZA 4EZ4A 4WYVA 3WI3A 2M67A 5JREA 5AQRB 5JDFA 5FY1A 4QH4A 3I1AA 4OX9T 5L3GB 3N9LA 3K3OA 3T1HT 3E0ZA 3N2KE 2FJEA 4UF0A 3RIUC 2ZM2A 3FBLA 4DV7T 1Y64B 3HKCE 3NVOA 3L8RA 5HCMA 3RC3A 1FIOA 3CKDA 3UUNA 4AISA 4O4JE 2G0UA 1B7TA 2WY2A 4TNWA 2DWGA 2W66A 4EAHA 3AA7B 1J5WA 3OKQA 4DR6T 5IUXA 2IHR1 4PJJA 3U78A 3HR0A 4GK5E 2AE9A 3AE5A 4EEDA 3O9XA 1N33T 3MZKB 1UGOA 4KHZF 2W63A 3E08A 3FBZA 3R84B 4H63V 2X0CA 2D0TA 3PUGA 1VRBA 3ZJ1A 1IZNB 1O3XA 3N9OA 3ZT6A 3ZMUB 2ACXA 4AI6A 1YD8G 4DBRA 2FBWA 4YLHA 1FJGT 1BR0A 4H9RC 3EUHA 3VRBA 4TWDA 2VKJA 4JV5T 2VL0A 5CA0E 4KI0F 5LNKA 4B3TT 3PUWF 4IT4A 3AA6B 2XHEB 4F6RC 2K5BB 5HXRA 2M6BA 3E22E 1T98A 3FZLB 3FXDB 5BR8T 5C8YE 3I0OA 4ZI2C 3PJAJ 4IDPA 3J7Yq 1VOMA 5LGTB 2VASA 3NRYA 3CIRA 2MBGA 2E5LT 2CLYC 1J5ET 2KBBA 1SE7A 3HKBE 2MPKA 2GK9A 3C98B 3M65A 3IA3A 4NUUA 2XQ5A 3N9MA 4IDOA 1HNWT 1MIWA 3LK3B 4P0BA 1W0BA 4HFIA 4QHOA 2W62A 1KNPA 2RP4A 4DIDB 5LG3A 1NENA 5LG4A 2YK0A 2KNDA 2VVNA 1YW0A 1J1JA 2OV9A 2F4VT 3C4WA 1E7PA 3PUAA 1L0VA 4YJ3E 3TLWA 1ZKEA 1KFYA 2BKNA 3KBUA 2UUAT 2CA5A 3K3QC 5FY7A 2CHNA 2WZIA 4OHFA 4DV1T 3ONJA 2P9BA 5LHIB 3KDSE 5JR9C 4X64T 1M7KA 3UUXB 1HNXT 4DUZT 3VKGA 5DJQC 5KDMC 2WMNA 4IDZA 4B6XA 1U5PA 2C5IT 2LOSA 3ZJ2A 2IIUA 4LFAT 4ZI3D 4ONRA 2VK9A 3S4UA 3F2EA 3ZT5A 1G73A 3PUQA 4HWCA 4YY3T 1XMOT 2NTYA 4IL9A 4TX5A 5AQUB 4TUYE 4CQIA 5HYAA 3ZYKA 3FHNA 4ZOLE 3T8OA 1MMNA 2I6HA 5HWXA 4I55E 3QOFA 3GWHA 3IF8B 3FYQA 3O1HA 1XNRT 3B5MA 3UUBA 2UXCT 4EYUA 2D2SA 3VR9A 2V6XA 5AQJB 4AQFC 3AVSA 4H9PC 4JI7T 2LHRA 2PFVA 3PUYF 3PUSA 4EXTA 4AQYT 2XQYA 2C5JA 2OLTA 4JUYA 2H88A 4X62T 5JRCB 3P7IA 2IDOB 2LM9A 1HCIA 2XUEA 2ZLYA 3Q5EA 4YTMA 2RPAA 2XQ3A 5AQHB 2D5UA 1D0YA 5E0OA 2K24A 5L3EB 4PK5A 3PU8A 3R6NA 2EHOD 4GIWA 2BVMA 5LBMA 3I9YA 4B3ST 3AA0B 4MLKA 4PK6A 2LSYA 4IE4A 3UU3A 4HFBA 3DYJA 4IDQA 2KT9A 3ZC1A 2V7KA 2MTQA 3CPZA 5L3FB 4CZZB 4AKGA 5L4HA 3JCFA 4ECGA 5AQIB 3X1DA 5JRCA 2V26A 3LSVA 3KVAA 2N9DA 2DNXA 4AKRB 2LOPA 2LSJA 5JDQA 2CE7A 3MXZA 3UUMA 4A5XA 1LVFA 1KF6A 1WLXA 5HAXA 3UU4A 5L2LA 4DV4T 1HR0T 5CA1E 3KV9A 4KX6A 4NUVA 3PURA 1HTJF 4YFSA 2XAHB 3FZMB 3QC9A 2VWAA 3NBXX 4DNDA 5HEGA 2E9XB 2N2NA 5AQQB 4B3RT 3EAMA 1T72A 4IE5A 4GYSA 3LK2B 2XAJB 3U3IA 2J62A 2ZM6T 5LJMA 2L7NA 3AXJB 3UQ7A 2I0MA 1YKHB 1VCSA 2L10A 2CRBA 2X9HA 3P50A 4JI5T 1HF8A 4DV6T 5H6RB 1X9BA 3A8YC 3PDYA 1T8BA 3H3AA 1T7SA 1WYCA 3D0TA 4X5TA 3O4XE 1W0AA 4JI1T 1MMGA 1D0ZA 2CXFA 4OYKA 4KMCA 3DJBA 1XDOA 5LA6E 1OXZA 3RF1A 3K1SA 3H3MA 3O1JA 1HFAA 2JMKA 2WQYA 3F57A 4CXYA 2UXBT 2WWUA 1D1CA 2BG9E 4GOUA 2E9XA 2X0YA 5JDMA 5HXEA 3CWZB 4CI2B 4CI3B 3RYHE 3AE1A 2WDVA 2JQQA 2QGSA 3AECA 4KUMB 5HEOA 3UTKA 4IHJE 4ADZA 2JMHA 4KP3C 3TLVA 2Z6EA 2H3RA 3VRAA 1U4QA 2V7IA 2ZM8A 5EK4A 3PHF1 3UU5A 3ZCJA 4JBWF 1BR2A 3EDUA 3ETVA 2W4XA 3AE2A 4AIUA 1XNQT 2YINA 3L39A 4DR7T 2E8IA 2UXNB 3GN5B 1JNZA 2XJ7A 5AQLB 4H9OC 3MK7C 4DUYT 2Q9QB 2E5VA 4PJNA 4TV8E 4U72A 2KGXA 3DP7A 4GK0E 1S94A 3FZKB 2LJLA 4I4TE 3L09A 5C2TA 3JAFA 2W2UA 3UULA 3OJAA 3TLTA 1KK7A 5FKYA 2NTXA 4HEAA 2IW5B 4NXNT 2X9XA 2SPCA 5LMUT 3NKZA 2BG9B 3NWIA 2LSIA 3VU7H 4JI8T 1OEDE 3ZCIA 2ACZA 3IEEA 4YTNA 4BJNA 2FUPA 3AE9A 3N5LA 4ILCA 4HWFA 4KHPT 2UXXB 2W0GA 3C4XA 3RC8A 3GN5A 5J1GA 3CX6B 5J2TE 2Y48B 1IBMT 5FVLA 5FXXA 2JJ9A 3ONLC 3AE4A 3RQUA 1ZV4X 1S35A 4LMLA 4H63H 1LVKA 1I6ZA 2A72A 1XDPA 2BG9A 4X20E 5DABA 3ZMVB 1SA0E 2R6GF 2MYSA 1NWMX 1HX1B 2BS2A 4ZHQE 3W15B 4AKHA 2BVLA 3ZSTA 3JC6C 2ODVA 4EZHA 1WFDA 5ETWA 1OEDB 2HN2A 4YTPA 3RGLA 4IL4A 4LFBT 2NR4A 4CN1A 3N9PA 2IC6A 2YN6A 4XBFB 4O2BE 3FZFB 5IHYA 1NEKA 4LMJA 1XMQT 2X68A 4ZEYA 4C91A 4DV3T 5L3BB 4EB6E 2XASB 4LF4T 3HKDE 3KV6A 2BS3A 1FMWA 3WSCA 1JNRA 3ZSSA 4ZI2D 4LF6T 2YKSA 5HXHA 1MIVA 3CQXC 5HEHA 3L3PA 1IBLT 2VKHA 2QRXA 4HFEA 5LMNT 1NAFA 4X66T 2N1GA 2LRKA 3WAKA 1UX5A 1MNEA 4HWDA 2NW9A 4YSXA 4ASKA 2KXPB 4XZCA 5KXJA 1OEDA 5CJ5A 2CCQA 3RKOA 4ISSA 2VQFT 4LF7T 2LM2A 3KFWX 5LP6E 3HL6A 2PBIA 3K8PC 1LRZA 5FMNA 2YEVC 4P1NA 2VL8A 5AQFB 5JDHA 2HH7A 3RHWA 3HA4A 3TKLB 5HEUA 2YDSA 3OPCA 5LBQB 3H37A 5F5WA 5AQNB 3EI0A 1FMVA 2AXDS 2HPLA 2XQ4A 4PFPA 1SHZC 3ANWB 3AAIA 1KNRA 5JVDE 4JI2T 5AQTB 2FJBA 2YDRA 3PU3A 4U7IA 4TN7B 2JRKA 3CVRA 1E1HB 4PK4A 1G8XA 4Z90A 5ABFB 4X1IE 2K3WA 2DCFA 2WBLA 4PAGA 4XAXB 4U31A 3PUZF 2KINB 5A1LA 4L0RA 4UXNB 3RH3A 5IYZE 3P4WA 4PNIA 5HXSA 2J1DG 5KX5E 2W67A 4EIWA 2V6YB 2JQKA 3ZEFB 3PUXF 2H89A 3LJCA 5FYMA 4G2AA 4QX7B 4YSZA 3MACA 1UK5A 4TWFA 4CXWA 3ANWA 4UIGA 3I0QA 2NW8A 5C3JA 1OWAA 1YKEB 3AEDA 5JR9B 4WBNE 5EZYE 3KINB 3PTRB 3PV0F 2WAUA 4COFA 5T1DA 2KMFA 5ABFA 2E9XC 3M3ZB 2HPJA 5GONE 4BGOA 1YQ3A 2Y6XA 1H7CA 2L3LA 5AQVB 1WR0A 3WAJA 2V7MA 4YSYA 4WZXA 3AEEA 2JIWA 3C51A 3M1CA 4HKAA 2V6YA 4N78D 2OA5A 5LOVE 3RPUA 5LCYA 3ONXA 4I50E 2RA1A 2KWIB 3C64A 5IWAT 2D9DA 2WDRA 2MAWA 1W9RA 2QA7A 2BZBA 3ZT7A 4E7ZA 2VKDA 3VKHA 3V5SA 4GYRA 1CHUA 1YXRA 2E9XD 1QSDA 3RI5A 5AQSB 2LLYA 2XQAA 3NZQA 4CI1B 4O8SA 4IIJE 5HWYA 2EHOB 4ZXLA 2J4GA 2X67A 4JEUB 4J2CA 4EV6A 2FJDA 4OK0A 3AEBA 3OYXA 3CQGB 2VB6A 2CEAA 2X0HA 2WMOA 4CXXA 3MKDA 4Z91A 4U33A 3WURA 3OVUA 2FJAA 5J2UE 2MOZA 3N2GE 3IHRA 3SS1A 5CFBA 3KBTA 4A98A 3AT7A 2WZHA 2QYWA 4W8PA 2PTFA 1Y01A 2X9YA 4UR9A 2XM1A 4IREA 2YOEA 3BQLA 2X9WA 1UURA 3ZYLA 2V7LA 4X65T 3CX8B 2WSSV 4HGAA 4QWNB 5FXVA 1ZP0A 3AB3B 2CHOA 2A3DA 4MBQA 3UU6A 3QUJA 2EHOA 4X1YE 4K0UA 2BG9C 4P09A 3SFEA 4DR4T 4MFRA 2CMRA 4O2AE 3K3NA 5BMVE 4JI0T 1XZYA 5JQGE 3VR8A 3TLUA 2KVPA 3AVRA 5LHGB 2ZM0A 2UXDT 3Q5DA 5L3CB 2CWYA 4LF9T 2YDQA 3AA1B 2LKHA 5FNVE 3NRXA 3AXJA 5JH7E 4A56A 2HN1A 4YHHT 5LB7B 1WYBA 1ZEEA 1WR6A 5AQGB 2UU9T 4UEMA 4LF8T 1HG2A 2WU5A 3AE7A 2K48A 4DV2T 1LKXA 3P4RA 4HWHA 2DHRA 4M1PA 1US7B 3FXEB 4A97A 5FXWA 4ERRA 2VKOA 2KZ7B 4ILUA 2XAFB 1N36T 1OEDC 2C0SA 3SOLA 4DO0A 2V7JA 2JQ9A 3ESLA 3ZMZB 1UX4A 3F31A 5ADXL 2H7VC 2NOXA 4HFDA 4DR2T 1MMDA 4DR1T 3CMLA 5LHHB 1E2AA 3BK9A 4JLEA 2CPTA 4MALA 3ZYMA 4P0AA 3RRWA 2JPFA 1HNZT 4ANJA 4TV9E 4UVAB 3AY5A 4QXHB 4TNVA 5FY0A 4I0UA 1D1AA 4DV5T 3Q2MA 1D1BA 2V1DB 2XQ8A 5EK3A 3UU8A 2V5CA 2XPKA 2WU2A 2Q9QA 5AQKB 3I9WA 2WDQA 3C50A 3JAEA 3Q9DA 5KMGP 3C4ZA 4PW8A 5LGNB 5FXZA 5FL0A 2CXDA 2UUBT 1MIYA 1M62A 2BBHA 3LG7A 2BKOA 3ABVA 2L9QA 3AEGA 3NZPA 3RLFF 3BQIA 2J47A 5FVKA 4F7GB 2NWBA 2CBIA 4ILBA 5LXTE 2WS3A 2W00A 2E2AA 3O1IA 4UV8B 2LKGA 2IUBA 1KNZA 4ZS2A 4MHCA 2DLRA 4YJ2E 3CK6A 1MMAA 4V1Av 2LHNA 4IE7A 5F3JA 4JI3T 3V5UA 1KEYA 2D0UA 5FZTA 3N9NA 4EGWA 4H9QC 5F8PA 2LE8A 1ZOYA 4Z8XA 5LYJE 1V9DA 2LT3A 1SJ8A 4UVBB 2WB5A 3EVYA 2LEHA 2PJQA 1QLBA 4DMVA 2M6IA 4AKLA 4HTEA 4O4IE 4H9SE 1MNDA 3JC6D 2VVSA 3IBPA 2MTCA 3ZMTB 3KV4A 2ES0A 5ABHA 3ZN0B 5L3DB 3RIUA 3EHZA 1QUUA 5AQOB 2XZEA 3ZLIA 1HX8A 4ZI3C 1HS7A 2CM0A 3A7MA 5DQWA 4F8HA 3B13A 1SJ7A 5DQVA 4DBQA 3AEFA 3QB5K 3LK42 3GA8A 4CN4A 2VURA 1YQ4A 2WCAA 3SFDA 2X51A 4BAYB 3UFGA 4K0KT 5TAOA 3UT5E 2BKPA 3RIAA 5LJNA 3FZHB 3QB5A 4UELA 4WNKA 2CLYB 3RYFE 2KWHA 1N34T 3TLSA 4EOZB 3N2OA 2B76A 2VQET 4LFCT 4E7SA 3A5XA 4KBMB 1N32T 4O4LE 3Q5XA 4GKJT 4U74A 4TZ4C 5H6QB 5JDNA 2JQHA 4L5GA 4YXDA 2KLQA 3DTOA 4Q25A 4ZS3A 1IJ5A 2A2FX 4PJMA 3AEAA 2XSBA 5JDGA 3QK6A 5J0ZA 1HG5A 4ISTA 3RKGA 2X66A 3BQKA 1IJ6A 4QXBB 4WW0A 4JEHB 2DI4A 3ETUA 2CBJA 3G06A 5JDLA 5HCJA 3UQ4A 5CB4E 1D0XA 3OYZA 2UUCT 4HFHA 3SWHA 4NXMT 2XTLA 5L4EA 2B1EA 4ILAA 5ABGA 1VCTA 3ZKRA 4C90A 4YT0A 1Z8UA 4JI4T 2EHOC 2XM2A 2XQ6A 4X1KE 2IC9A 1FEWA 4DVDA 2WM9A 4JI6T 3RYCE 1I94T 3RYIE 3Q5WA 3RQWA 4U3CA 2H7OA 3EDVA 3EABA 5EK2A 4DR5T 2X0LB 2DWKA 3T1YT 5FL1A 4YHJA 4O4HE 2BBJA 3QNUA 3MJXA 3OBVE 4NIQA 3FB2A 3ZN1B 4U2YA 2CXLA 1BR1A 2ZMAA 3P4QA 1SUMB 2DL1A 4TWHA 4QKNA 3HI2A 3LDQB 4OYJA 2I59A 1UUSA 4IDNA 4ZZCA 1W09A 1WRDA 4G63A 2L8KA 4CN6A 2XQ9A 1CUNA 2LRLA
chains in the Genus database with same CATH topology
5AFUL 1SA0E 2XAGB 3SRZA 1WYBA 4ONRA 2MYSA 5JR9A 2LSKA 2BDEA 2NW7A 1NWMX 2VK9A 3S4UA 1ZEEA 3F2EA 4BA9A 1WR6A 3RX6A 4ZHQE 3W15B 1G73A 4DMWA 3PUQA 4AKHA 2BVLA 1IAPA 4UEMA 1ZHCA 3JC6C 2ODVA 3ZPOA 2W61A 5ETWA 4EZHA 1HG2A 4QX8B 4FJOA 2NTYA 4TX5A 1AJ3A 2K48A 3UFEA 2IAKA 4TUYE 1LKXA 4CQIA 5M4YA 5HYAA 3ZYKA 4AKIA 2XAQB 3N9PA 3FHNA 2IC6A 4ZOLE 1X79A 4IGUA 2DHRA 4O2BE 4XBFB 3T8OA 1MMNA 5HXCA 4M1PA 3RRCA 1US7B 5IHYA 5HWXA 4ZI7E 3FXEB 2X68A 4HN9A 4IE0A 2LSGA 3LBXB 4I55E 3GWHA 4C91A 3IF8B 5FXWA 4ERRA 2VKOA 5L3BB 4IE6A 4EB6E 2XASB 2KZ7B 3ZC0A 3O1HA 3HKDE 4ILUA 2XAFB 2LQUA 4EYUA 2C0SA 3KV6A 1Z0PA 2D2SA 3SOLA 4HE8A 2V7JA 1FMWA 4DO0A 3WSCA 4AQFC 3ESLA 3ZMZB 4AQGA 1UX4A 3AVSA 4H9PC 3F31A 4ZI2D 2H7VC 2NOXA 5ADXL 2LHRA 2PFVA 3PF0A 5HXHA 1MIVA 3CQXC 1MMDA 2K9AA 3PUSA 4EXTA 3L3PA 2XQYA 2VKHA 2YU2A 3CMLA 2C5JA 4I43B 2Q9QC 4JUYA 4HFVA 1NAFA 5LHHB 5LGUB 2N1GA 3BK9A 3WAKA 4JLEA 1UX5A 5JRCB 1MNEA 4MALA 2NW9A 3P7IA 3ZYMA 3ZMSB 4P0AA 4ASKA 2LM9A 1HCIA 2C5KT 2KXPB 2JPFA 2XUEA 4XZCA 3RRWA 2ZLYA 4ANJA 4TV9E 4UVAB 4QXHB 5FY0A 1UCUA 1D1AA 3N9QA 3Q2MA 1D1BA 4AXPA 2CCQA 4WBOA 2V1DB 5EK3A 4OFZA 4AQFA 3RKOA 3PE0A 2D5UA 4ISSA 1D0YA 3KFWX 5E0OA 3KV5A 5LP6E 2K24A 3HL6A 2PBIA 4PJLA 2Q9QA 4UVCB 3K8PC 2CWOA 1LRZA 3I9WA 5FMNA 2YEVC 3LFMA 4PK5A 5L3EB 2VL8A 3PU8A 5JDHA 2HH7A 3R6NA 2EHOD 4GIWA 2BVMA 3C50A 5LBMA 3I9YA 3LBXA 3Q9DA 4L9IA 4UF0B 3AA0B 3HA4A 4MLKA 1EZ3A 4PK6A 2LSYA 3TKLB 4IE4A 5KMGP 3C4ZA 4PW8A 5LGNB 5FXZA 2CXDA 4UV9B 5LBQB 1BR4A 3H37A 2Q9QD 1MIYA 3GMIA 3J9X1 1FMVA 3LG7A 2KT9A 2HPLA 3ZC1A 2L9QA 2V7KA 2MTQA 3CPZA 5L3FB 4BJMA 4CZZB 4AKGA 2PG8A 3NZPA 4PFPA 2NP9A 1SHZC 4ECGA 2Y8DA 3ANWB 3BQIA 4PFOA 3AAIA 2NWBA 5JVDE 5LXTE 5JRCA 2V26A 3HKEE 4H9NC 3PU3A 3AAEB 5FP3A 2W00A 3KVAA 3CQCB 2N9DA 2DNXA 2JRKA 4TN7B 2YU1A 3B57A 3O1IA 4UV8B 3CVRA 1KNZA 4AKRB 4ZS2A 1E1HB 2LOPA 4MHCA 2DLRA 2LSJA 3P8CD 5JDQA 4YJ2E 4FI5A 2CE7A 2ODUA 3CX7B 3MA9A 4PK4A 1G8XA 4X1IE 3MXZA 3UUMA 2DCFA 2WBLA 1LVFA 4PAGA 4XAXB 1MMAA 3AAAB 4V1Av 3VHLA 3KVBA 4EYYR 2KINB 2LHNA 4QXCB 4IE7A 3VJZA 4EZ4A 5A1LA 5F3JA 1WLXA 5HAXA 3WI3A 4L0RA 2M67A 5JREA 4UXNB 3RH3A 2D0UA 3V5UA 5IYZE 5JDFA 5L2LA 5FY1A 3N9NA 3I1AA 5CA1E 3KV9A 3N9LA 5L3GB 4PNIA 5HXSA 4NUVA 2J1DG 3K3OA 3PURA 5KX5E 3E0ZA 3N2KE 4H9QC 5F8PA 4UF0A 1HTJF 2LE8A 2ZM2A 3FBLA 1Y64B 4YFSA 4EIWA 2XAHB 4Z8XA 5LYJE 1V9DA 2LT3A 3HKCE 4UVBB 3RC3A 1FIOA 3EVYA 3CKDA 2LEHA 3ZEFB 2PJQA 3UUNA 3QC9A 2VWAA 3NBXX 4DMVA 4DNDA 4O4JE 3LJCA 4AKLA 2E9XB 5FYMA 2N2NA 4G2AA 2G0UA 1B7TA 4QX7B 4HTEA 3MACA 4IE5A 2DWGA 4GYSA 4EAHA 3AA7B 4O4IE 3LK2B 4H9SE 1MNDA 2XAJB 3OKQA 4CXWA 3U3IA 3JC6D 4PJJA 3U78A 3IBPA 3ANWA 3HR0A 4GK5E 5LJMA 4UIGA 3O9XA 2MTCA 3MZKB 3I0QA 3ZMTB 3KV4A 1YKHB 2NW8A 1OWAA 2X9HA 1YKEB 2ES0A 2W63A 3E08A 3ZN0B 1HF8A 5JR9B 5L3DB 3FBZA 5H6RB 3R84B 4H63V 4WBNE 1QUUA 3PDYA 3KINB 3PTRB 5EZYE 2D0TA 2WAUA 3PUGA 3H3AA 3ZLIA 1HX8A 1VRBA 4ZI3C 5T1DA 1WYCA 1HS7A 3D0TA 2KMFA 3ZJ1A 1IZNB 2E9XC 3O4XE 2HPJA 5GONE 4BGOA 1O3XA 3N9OA 2CM0A 3ZMUB 2ACXA 1MMGA 1D0ZA 2CXFA 2Y6XA 5DQWA 1H7CA 4AI6A 1YD8G 2L3LA 4OYKA 4DBRA 4KMCA 3B13A 4YLHA 1BR0A 4H9RC 3EUHA 5DQVA 3WAJA 2V7MA 4DBQA 2VKJA 3LK42 3DJBA 5LA6E 3GA8A 1OXZA 5CA0E 3C51A 5LNKA 2X51A 4BAYB 3M1CA 5TAOA 3O1JA 4HKAA 3UT5E 5LJNA 1HFAA 3AA6B 4N78D 2XHEB 4F6RC 2JMKA 4UELA 4WNKA 2K5BB 3F57A 2CLYB 2OA5A 2KWHA 5HXRA 3RYFE 4CXYA 2WWUA 1D1CA 5LOVE 3RPUA 4EOZB 3N2OA 4GOUA 2E9XA 5LCYA 3ONXA 5JDMA 4I50E 3CWZB 5HXEA 4E7SA 3E22E 4CI2B 2RA1A 2KWIB 1T98A 3A5XA 3C64A 4KBMB 3Q5XA 4O4LE 3RYHE 4CI3B 4U74A 2QA7A 4TZ4C 3FXDB 2JQQA 5H6QB 2QGSA 5JDNA 5C8YE 4L5GA 3I0OA 2BZBA 4KUMB 2KLQA 4E7ZA 2VKDA 3DTOA 3V5SA 4ZI2C 3VKHA 4ZS3A 3J7Yq 1IJ5A 4GYRA 1VOMA 3UTKA 5LGTB 2VASA 4IHJE 2E9XD 4ADZA 2A2FX 2JMHA 4KP3C 1QSDA 3NRYA 4PJMA 2MBGA 2Z6EA 5JDGA 2H3RA 1U4QA 2V7IA 2ZM8A 3NZQA 3QK6A 5EK4A 4CI1B 2CLYC 3PHF1 4O8SA 3ZCJA 1HG5A 1BR2A 3EDUA 3ETVA 4ISTA 3HKBE 4IIJE 5HWYA 2GK9A 2X66A 3BQKA 2EHOB 1IJ6A 4QXBB 4WW0A 2YINA 2X67A 3C98B 2E8IA 4JEUB 4JEHB 4J2CA 2UXNB 3GN5B 4OK0A 2DI4A 3M65A 3ETUA 3OYXA 3CQGB 2VB6A 5JDLA 4H9OC 2CEAA 3MK7C 2WMOA 4CXXA 5CB4E 2Q9QB 3MKDA 4NUUA 1D0XA 3OYZA 4PJNA 4TV8E 4U72A 3SWHA 3N9MA 3DP7A 2XTLA 3WURA 1MIWA 3LK3B 2B1EA 4GK0E 1S94A 4P0BA 5J2UE 2MOZA 3N2GE 3IHRA 3SS1A 2LJLA 4I4TE 4C90A 3KBTA 3L09A 4QHOA 3AT7A 2EHOC 3UULA 3OJAA 2W62A 2RP4A 1KK7A 2NTXA 4HEAA 4X1KE 2IW5B 2X9XA 2IC9A 1FEWA 2SPCA 5LG4A 4DVDA 2X9YA 2KNDA 2YK0A 2WM9A 1YW0A 3RYCE 3C4WA 2LSIA 3RYIE 3Q5WA 3VU7H 3PUAA 3BQLA 4YJ3E 2H7OA 3EDVA 2X9WA 5EK2A 1ZKEA 2X0LB 3ZCIA 3ZYLA 2V7LA 3KBUA 2DWKA 3IEEA 2CA5A 3CX8B 4BJNA 2WSSV 3K3QC 5FY7A 4HGAA 4QWNB 3N5LA 5FXVA 4YHJA 4OHFA 3AB3B 2A3DA 4MBQA 3QUJA 2EHOA 2UXXB 4O4HE 4X1YE 2W0GA 3C4XA 4K0UA 3MJXA 3OBVE 2P9BA 3GN5A 3RC8A 5LHIB 3KDSE 5J1GA 3CX6B 4P09A 5J2TE 3FB2A 3ZN1B 5JR9C 4MFRA 2CXLA 1BR1A 2Y48B 2ZMAA 2CMRA 4O2AE 3K3NA 5BMVE 3UUXB 5FXXA 5JQGE 4QKNA 2JJ9A 3HI2A 4OYJA 3AVRA 2I59A 5LHGB 3VKGA 2ZM0A 1ZV4X 5DJQC 1S35A 5KDMC 1WRDA 4G63A 2L8KA 2WMNA 5L3CB 2CWYA 4IDZA 4B6XA 1U5PA 4H63H 3AA1B 1LVKA 5FNVE 2C5IT 2LOSA 3ZJ2A 1CUNA 3NRXA 2A72A 5JH7E 4A56A 4X20E 4ZI3D 5DABA 3ZMVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXR A;  3V5U A;  5JDM A;  5HYA A;  5HXE A;  5JDF A;  3V5S A;  5JDL A;  5JDG A;  5JDQ A;  5HXC A;  5JDN A;  5HWY A;  5HXH A;  5HWX A;  5HXS A;  5JDH A; 
#chains in the Genus database with same CATH topology
 5AFU L;  2XAG B;  3SRZ A;  5JR9 A;  1GQE A;  2LSK A;  2BDE A;  2NW7 A;  4BA9 A;  3RX6 A;  4DMW A;  1WCR A;  1IAP A;  1ZHC A;  3ZPO A;  2W61 A;  5AQM B;  4QX8 B;  4FJO A;  1AJ3 A;  3UFE A;  2IAK A;  5M4Y A;  4AKI A;  2XAQ B;  1X79 A;  4IGU A;  2XQ7 A;  5HXC A;  3RRC A;  2XSA A;  4ZI7 E;  4HN9 A;  4IE0 A;  2LSG A;  3LBX B;  3PUV F;  3JAD A;  3PJA A;  4IE6 A;  4LMK A;  2HHH T;  3ZC0 A;  2LQU A;  1Z0P A;  4HE8 A;  4AQG A;  3PF0 A;  5AQP B;  2K9A A;  4EEB A;  4I43 B;  2YU2 A;  2QVA A;  2Q9Q C;  4HFV A;  5LGU B;  2KSR A;  2IML A;  5JTG A;  2V5D A;  2A9U A;  2WP9 A;  3ZMS B;  4JYA T;  2C5K T;  5L47 A;  3P4P A;  1UCU A;  3N9Q A;  4AXP A;  4WBO A;  5HEJ A;  4OFZ A;  4AQF A;  3PE0 A;  3KV5 A;  4PJL A;  4DV0 T;  4UVC B;  2CWO A;  1DU2 A;  3LFM A;  4HWI B;  1XWM A;  3LBX A;  4L9I A;  3P4S A;  4UF0 B;  1EZ3 A;  1R8I A;  2BS4 A;  2V8S V;  4UV9 B;  1BR4 A;  2Q9Q D;  3OTO T;  3GMI A;  2XY8 B;  3J9X 1;  5CGM A;  4NPP A;  1IBK T;  4BJM A;  4B3M T;  2PG8 A;  2NP9 A;  4HFC A;  2Y8D A;  4ZZB A;  4PFO A;  4DR3 T;  4GKK T;  3AE3 A;  4LF5 T;  3HKE E;  4H9N C;  4QH5 A;  3AAE B;  5FP3 A;  3CQC B;  2YU1 A;  3B57 A;  2WWV A;  3AE8 A;  3P8C D;  4FI5 A;  2ODU A;  3MA9 A;  3CX7 B;  5ABE A;  3AE6 A;  4U2Z A;  4U7Y A;  3RIF A;  3AAA B;  3VHL A;  3KVB A;  4EYY R;  4QXC B;  4QH1 A;  3VJZ A;  4EZ4 A;  4WYV A;  3WI3 A;  2M67 A;  5JRE A;  5AQR B;  5JDF A;  5FY1 A;  4QH4 A;  3I1A A;  4OX9 T;  5L3G B;  3N9L A;  3K3O A;  3T1H T;  3E0Z A;  3N2K E;  2FJE A;  4UF0 A;  3RIU C;  2ZM2 A;  3FBL A;  4DV7 T;  1Y64 B;  3HKC E;  3NVO A;  3L8R A;  5HCM A;  3RC3 A;  1FIO A;  3CKD A;  3UUN A;  4AIS A;  4O4J E;  2G0U A;  1B7T A;  2WY2 A;  4TNW A;  2DWG A;  2W66 A;  4EAH A;  3AA7 B;  1J5W A;  3OKQ A;  4DR6 T;  5IUX A;  2IHR 1;  4PJJ A;  3U78 A;  3HR0 A;  4GK5 E;  2AE9 A;  3AE5 A;  4EED A;  3O9X A;  1N33 T;  3MZK B;  1UGO A;  4KHZ F;  2W63 A;  3E08 A;  3FBZ A;  3R84 B;  4H63 V;  2X0C A;  2D0T A;  3PUG A;  1VRB A;  3ZJ1 A;  1IZN B;  1O3X A;  3N9O A;  3ZT6 A;  3ZMU B;  2ACX A;  4AI6 A;  1YD8 G;  4DBR A;  2FBW A;  4YLH A;  1FJG T;  1BR0 A;  4H9R C;  3EUH A;  3VRB A;  4TWD A;  2VKJ A;  4JV5 T;  2VL0 A;  5CA0 E;  4KI0 F;  5LNK A;  4B3T T;  3PUW F;  4IT4 A;  3AA6 B;  2XHE B;  4F6R C;  2K5B B;  5HXR A;  2M6B A;  3E22 E;  1T98 A;  3FZL B;  3FXD B;  5BR8 T;  5C8Y E;  3I0O A;  4ZI2 C;  3PJA J;  4IDP A;  3J7Y q;  1VOM A;  5LGT B;  2VAS A;  3NRY A;  3CIR A;  2MBG A;  2E5L T;  2CLY C;  1J5E T;  2KBB A;  1SE7 A;  3HKB E;  2MPK A;  2GK9 A;  3C98 B;  3M65 A;  3IA3 A;  4NUU A;  2XQ5 A;  3N9M A;  4IDO A;  1HNW T;  1MIW A;  3LK3 B;  4P0B A;  1W0B A;  4HFI A;  4QHO A;  2W62 A;  1KNP A;  2RP4 A;  4DID B;  5LG3 A;  1NEN A;  5LG4 A;  2YK0 A;  2KND A;  2VVN A;  1YW0 A;  1J1J A;  2OV9 A;  2F4V T;  3C4W A;  1E7P A;  3PUA A;  1L0V A;  4YJ3 E;  3TLW A;  1ZKE A;  1KFY A;  2BKN A;  3KBU A;  2UUA T;  2CA5 A;  3K3Q C;  5FY7 A;  2CHN A;  2WZI A;  4OHF A;  4DV1 T;  3ONJ A;  2P9B A;  5LHI B;  3KDS E;  5JR9 C;  4X64 T;  1M7K A;  3UUX B;  1HNX T;  4DUZ T;  3VKG A;  5DJQ C;  5KDM C;  2WMN A;  4IDZ A;  4B6X A;  1U5P A;  2C5I T;  2LOS A;  3ZJ2 A;  2IIU A;  4LFA T;  4ZI3 D;  4ONR A;  2VK9 A;  3S4U A;  3F2E A;  3ZT5 A;  1G73 A;  3PUQ A;  4HWC A;  4YY3 T;  1XMO T;  2NTY A;  4IL9 A;  4TX5 A;  5AQU B;  4TUY E;  4CQI A;  5HYA A;  3ZYK A;  3FHN A;  4ZOL E;  3T8O A;  1MMN A;  2I6H A;  5HWX A;  4I55 E;  3QOF A;  3GWH A;  3IF8 B;  3FYQ A;  3O1H A;  1XNR T;  3B5M A;  3UUB A;  2UXC T;  4EYU A;  2D2S A;  3VR9 A;  2V6X A;  5AQJ B;  4AQF C;  3AVS A;  4H9P C;  4JI7 T;  2LHR A;  2PFV A;  3PUY F;  3PUS A;  4EXT A;  4AQY T;  2XQY A;  2C5J A;  2OLT A;  4JUY A;  2H88 A;  4X62 T;  5JRC B;  3P7I A;  2IDO B;  2LM9 A;  1HCI A;  2XUE A;  2ZLY A;  3Q5E A;  4YTM A;  2RPA A;  2XQ3 A;  5AQH B;  2D5U A;  1D0Y A;  5E0O A;  2K24 A;  5L3E B;  4PK5 A;  3PU8 A;  3R6N A;  2EHO D;  4GIW A;  2BVM A;  5LBM A;  3I9Y A;  4B3S T;  3AA0 B;  4MLK A;  4PK6 A;  2LSY A;  4IE4 A;  3UU3 A;  4HFB A;  3DYJ A;  4IDQ A;  2KT9 A;  3ZC1 A;  2V7K A;  2MTQ A;  3CPZ A;  5L3F B;  4CZZ B;  4AKG A;  5L4H A;  3JCF A;  4ECG A;  5AQI B;  3X1D A;  5JRC A;  2V26 A;  3LSV A;  3KVA A;  2N9D A;  2DNX A;  4AKR B;  2LOP A;  2LSJ A;  5JDQ A;  2CE7 A;  3MXZ A;  3UUM A;  4A5X A;  1LVF A;  1KF6 A;  1WLX A;  5HAX A;  3UU4 A;  5L2L A;  4DV4 T;  1HR0 T;  5CA1 E;  3KV9 A;  4KX6 A;  4NUV A;  3PUR A;  1HTJ F;  4YFS A;  2XAH B;  3FZM B;  3QC9 A;  2VWA A;  3NBX X;  4DND A;  5HEG A;  2E9X B;  2N2N A;  5AQQ B;  4B3R T;  3EAM A;  1T72 A;  4IE5 A;  4GYS A;  3LK2 B;  2XAJ B;  3U3I A;  2J62 A;  2ZM6 T;  5LJM A;  2L7N A;  3AXJ B;  3UQ7 A;  2I0M A;  1YKH B;  1VCS A;  2L10 A;  2CRB A;  2X9H A;  3P50 A;  4JI5 T;  1HF8 A;  4DV6 T;  5H6R B;  1X9B A;  3A8Y C;  3PDY A;  1T8B A;  3H3A A;  1T7S A;  1WYC A;  3D0T A;  4X5T A;  3O4X E;  1W0A A;  4JI1 T;  1MMG A;  1D0Z A;  2CXF A;  4OYK A;  4KMC A;  3DJB A;  1XDO A;  5LA6 E;  1OXZ A;  3RF1 A;  3K1S A;  3H3M A;  3O1J A;  1HFA A;  2JMK A;  2WQY A;  3F57 A;  4CXY A;  2UXB T;  2WWU A;  1D1C A;  2BG9 E;  4GOU A;  2E9X A;  2X0Y A;  5JDM A;  5HXE A;  3CWZ B;  4CI2 B;  4CI3 B;  3RYH E;  3AE1 A;  2WDV A;  2JQQ A;  2QGS A;  3AEC A;  4KUM B;  5HEO A;  3UTK A;  4IHJ E;  4ADZ A;  2JMH A;  4KP3 C;  3TLV A;  2Z6E A;  2H3R A;  3VRA A;  1U4Q A;  2V7I A;  2ZM8 A;  5EK4 A;  3PHF 1;  3UU5 A;  3ZCJ A;  4JBW F;  1BR2 A;  3EDU A;  3ETV A;  2W4X A;  3AE2 A;  4AIU A;  1XNQ T;  2YIN A;  3L39 A;  4DR7 T;  2E8I A;  2UXN B;  3GN5 B;  1JNZ A;  2XJ7 A;  5AQL B;  4H9O C;  3MK7 C;  4DUY T;  2Q9Q B;  2E5V A;  4PJN A;  4TV8 E;  4U72 A;  2KGX A;  3DP7 A;  4GK0 E;  1S94 A;  3FZK B;  2LJL A;  4I4T E;  3L09 A;  5C2T A;  3JAF A;  2W2U A;  3UUL A;  3OJA A;  3TLT A;  1KK7 A;  5FKY A;  2NTX A;  4HEA A;  2IW5 B;  4NXN T;  2X9X A;  2SPC A;  5LMU T;  3NKZ A;  2BG9 B;  3NWI A;  2LSI A;  3VU7 H;  4JI8 T;  1OED E;  3ZCI A;  2ACZ A;  3IEE A;  4YTN A;  4BJN A;  2FUP A;  3AE9 A;  3N5L A;  4ILC A;  4HWF A;  4KHP T;  2UXX B;  2W0G A;  3C4X A;  3RC8 A;  3GN5 A;  5J1G A;  3CX6 B;  5J2T E;  2Y48 B;  1IBM T;  5FVL A;  5FXX A;  2JJ9 A;  3ONL C;  3AE4 A;  3RQU A;  1ZV4 X;  1S35 A;  4LML A;  4H63 H;  1LVK A;  1I6Z A;  2A72 A;  1XDP A;  2BG9 A;  4X20 E;  5DAB A;  3ZMV B;  1SA0 E;  2R6G F;  2MYS A;  1NWM X;  1HX1 B;  2BS2 A;  4ZHQ E;  3W15 B;  4AKH A;  2BVL A;  3ZST A;  3JC6 C;  2ODV A;  4EZH A;  1WFD A;  5ETW A;  1OED B;  2HN2 A;  4YTP A;  3RGL A;  4IL4 A;  4LFB T;  2NR4 A;  4CN1 A;  3N9P A;  2IC6 A;  2YN6 A;  4XBF B;  4O2B E;  3FZF B;  5IHY A;  1NEK A;  4LMJ A;  1XMQ T;  2X68 A;  4ZEY A;  4C91 A;  4DV3 T;  5L3B B;  4EB6 E;  2XAS B;  4LF4 T;  3HKD E;  3KV6 A;  2BS3 A;  1FMW A;  3WSC A;  1JNR A;  3ZSS A;  4ZI2 D;  4LF6 T;  2YKS A;  5HXH A;  1MIV A;  3CQX C;  5HEH A;  3L3P A;  1IBL T;  2VKH A;  2QRX A;  4HFE A;  5LMN T;  1NAF A;  4X66 T;  2N1G A;  2LRK A;  3WAK A;  1UX5 A;  1MNE A;  4HWD A;  2NW9 A;  4YSX A;  4ASK A;  2KXP B;  4XZC A;  5KXJ A;  1OED A;  5CJ5 A;  2CCQ A;  3RKO A;  4ISS A;  2VQF T;  4LF7 T;  2LM2 A;  3KFW X;  5LP6 E;  3HL6 A;  2PBI A;  3K8P C;  1LRZ A;  5FMN A;  2YEV C;  4P1N A;  2VL8 A;  5AQF B;  5JDH A;  2HH7 A;  3RHW A;  3HA4 A;  3TKL B;  5HEU A;  2YDS A;  3OPC A;  5LBQ B;  3H37 A;  5F5W A;  5AQN B;  3EI0 A;  1FMV A;  2AXD S;  2HPL A;  2XQ4 A;  4PFP A;  1SHZ C;  3ANW B;  3AAI A;  1KNR A;  5JVD E;  4JI2 T;  5AQT B;  2FJB A;  2YDR A;  3PU3 A;  4U7I A;  4TN7 B;  2JRK A;  3CVR A;  1E1H B;  4PK4 A;  1G8X A;  4Z90 A;  5ABF B;  4X1I E;  2K3W A;  2DCF A;  2WBL A;  4PAG A;  4XAX B;  4U31 A;  3PUZ F;  2KIN B;  5A1L A;  4L0R A;  4UXN B;  3RH3 A;  5IYZ E;  3P4W A;  4PNI A;  5HXS A;  2J1D G;  5KX5 E;  2W67 A;  4EIW A;  2V6Y B;  2JQK A;  3ZEF B;  3PUX F;  2H89 A;  3LJC A;  5FYM A;  4G2A A;  4QX7 B;  4YSZ A;  3MAC A;  1UK5 A;  4TWF A;  4CXW A;  3ANW A;  4UIG A;  3I0Q A;  2NW8 A;  5C3J A;  1OWA A;  1YKE B;  3AED A;  5JR9 B;  4WBN E;  5EZY E;  3KIN B;  3PTR B;  3PV0 F;  2WAU A;  4COF A;  5T1D A;  2KMF A;  5ABF A;  2E9X C;  3M3Z B;  2HPJ A;  5GON E;  4BGO A;  1YQ3 A;  2Y6X A;  1H7C A;  2L3L A;  5AQV B;  1WR0 A;  3WAJ A;  2V7M A;  4YSY A;  4WZX A;  3AEE A;  2JIW A;  3C51 A;  3M1C A;  4HKA A;  2V6Y A;  4N78 D;  2OA5 A;  5LOV E;  3RPU A;  5LCY A;  3ONX A;  4I50 E;  2RA1 A;  2KWI B;  3C64 A;  5IWA T;  2D9D A;  2WDR A;  2MAW A;  1W9R A;  2QA7 A;  2BZB A;  3ZT7 A;  4E7Z A;  2VKD A;  3VKH A;  3V5S A;  4GYR A;  1CHU A;  1YXR A;  2E9X D;  1QSD A;  3RI5 A;  5AQS B;  2LLY A;  2XQA A;  3NZQ A;  4CI1 B;  4O8S A;  4IIJ E;  5HWY A;  2EHO B;  4ZXL A;  2J4G A;  2X67 A;  4JEU B;  4J2C A;  4EV6 A;  2FJD A;  4OK0 A;  3AEB A;  3OYX A;  3CQG B;  2VB6 A;  2CEA A;  2X0H A;  2WMO A;  4CXX A;  3MKD A;  4Z91 A;  4U33 A;  3WUR A;  3OVU A;  2FJA A;  5J2U E;  2MOZ A;  3N2G E;  3IHR A;  3SS1 A;  5CFB A;  3KBT A;  4A98 A;  3AT7 A;  2WZH A;  2QYW A;  4W8P A;  2PTF A;  1Y01 A;  2X9Y A;  4UR9 A;  2XM1 A;  4IRE A;  2YOE A;  3BQL A;  2X9W A;  1UUR A;  3ZYL A;  2V7L A;  4X65 T;  3CX8 B;  2WSS V;  4HGA A;  4QWN B;  5FXV A;  1ZP0 A;  3AB3 B;  2CHO A;  2A3D A;  4MBQ A;  3UU6 A;  3QUJ A;  2EHO A;  4X1Y E;  4K0U A;  2BG9 C;  4P09 A;  3SFE A;  4DR4 T;  4MFR A;  2CMR A;  4O2A E;  3K3N A;  5BMV E;  4JI0 T;  1XZY A;  5JQG E;  3VR8 A;  3TLU A;  2KVP A;  3AVR A;  5LHG B;  2ZM0 A;  2UXD T;  3Q5D A;  5L3C B;  2CWY A;  4LF9 T;  2YDQ A;  3AA1 B;  2LKH A;  5FNV E;  3NRX A;  3AXJ A;  5JH7 E;  4A56 A;  2HN1 A;  4YHH T;  5LB7 B;  1WYB A;  1ZEE A;  1WR6 A;  5AQG B;  2UU9 T;  4UEM A;  4LF8 T;  1HG2 A;  2WU5 A;  3AE7 A;  2K48 A;  4DV2 T;  1LKX A;  3P4R A;  4HWH A;  2DHR A;  4M1P A;  1US7 B;  3FXE B;  4A97 A;  5FXW A;  4ERR A;  2VKO A;  2KZ7 B;  4ILU A;  2XAF B;  1N36 T;  1OED C;  2C0S A;  3SOL A;  4DO0 A;  2V7J A;  2JQ9 A;  3ESL A;  3ZMZ B;  1UX4 A;  3F31 A;  5ADX L;  2H7V C;  2NOX A;  4HFD A;  4DR2 T;  1MMD A;  4DR1 T;  3CML A;  5LHH B;  1E2A A;  3BK9 A;  4JLE A;  2CPT A;  4MAL A;  3ZYM A;  4P0A A;  3RRW A;  2JPF A;  1HNZ T;  4ANJ A;  4TV9 E;  4UVA B;  3AY5 A;  4QXH B;  4TNV A;  5FY0 A;  4I0U A;  1D1A A;  4DV5 T;  3Q2M A;  1D1B A;  2V1D B;  2XQ8 A;  5EK3 A;  3UU8 A;  2V5C A;  2XPK A;  2WU2 A;  2Q9Q A;  5AQK B;  3I9W A;  2WDQ A;  3C50 A;  3JAE A;  3Q9D A;  5KMG P;  3C4Z A;  4PW8 A;  5LGN B;  5FXZ A;  5FL0 A;  2CXD A;  2UUB T;  1MIY A;  1M62 A;  2BBH A;  3LG7 A;  2BKO A;  3ABV A;  2L9Q A;  3AEG A;  3NZP A;  3RLF F;  3BQI A;  2J47 A;  5FVK A;  4F7G B;  2NWB A;  2CBI A;  4ILB A;  5LXT E;  2WS3 A;  2W00 A;  2E2A A;  3O1I A;  4UV8 B;  2LKG A;  2IUB A;  1KNZ A;  4ZS2 A;  4MHC A;  2DLR A;  4YJ2 E;  3CK6 A;  1MMA A;  4V1A v;  2LHN A;  4IE7 A;  5F3J A;  4JI3 T;  3V5U A;  1KEY A;  2D0U A;  5FZT A;  3N9N A;  4EGW A;  4H9Q C;  5F8P A;  2LE8 A;  1ZOY A;  4Z8X A;  5LYJ E;  1V9D A;  2LT3 A;  1SJ8 A;  4UVB B;  2WB5 A;  3EVY A;  2LEH A;  2PJQ A;  1QLB A;  4DMV A;  2M6I A;  4AKL A;  4HTE A;  4O4I E;  4H9S E;  1MND A;  3JC6 D;  2VVS A;  3IBP A;  2MTC A;  3ZMT B;  3KV4 A;  2ES0 A;  5ABH A;  3ZN0 B;  5L3D B;  3RIU A;  3EHZ A;  1QUU A;  5AQO B;  2XZE A;  3ZLI A;  1HX8 A;  4ZI3 C;  1HS7 A;  2CM0 A;  3A7M A;  5DQW A;  4F8H A;  3B13 A;  1SJ7 A;  5DQV A;  4DBQ A;  3AEF A;  3QB5 K;  3LK4 2;  3GA8 A;  4CN4 A;  2VUR A;  1YQ4 A;  2WCA A;  3SFD A;  2X51 A;  4BAY B;  3UFG A;  4K0K T;  5TAO A;  3UT5 E;  2BKP A;  3RIA A;  5LJN A;  3FZH B;  3QB5 A;  4UEL A;  4WNK A;  2CLY B;  3RYF E;  2KWH A;  1N34 T;  3TLS A;  4EOZ B;  3N2O A;  2B76 A;  2VQE T;  4LFC T;  4E7S A;  3A5X A;  4KBM B;  1N32 T;  4O4L E;  3Q5X A;  4GKJ T;  4U74 A;  4TZ4 C;  5H6Q B;  5JDN A;  2JQH A;  4L5G A;  4YXD A;  2KLQ A;  3DTO A;  4Q25 A;  4ZS3 A;  1IJ5 A;  2A2F X;  4PJM A;  3AEA A;  2XSB A;  5JDG A;  3QK6 A;  5J0Z A;  1HG5 A;  4IST A;  3RKG A;  2X66 A;  3BQK A;  1IJ6 A;  4QXB B;  4WW0 A;  4JEH B;  2DI4 A;  3ETU A;  2CBJ A;  3G06 A;  5JDL A;  5HCJ A;  3UQ4 A;  5CB4 E;  1D0X A;  3OYZ A;  2UUC T;  4HFH A;  3SWH A;  4NXM T;  2XTL A;  5L4E A;  2B1E A;  4ILA A;  5ABG A;  1VCT A;  3ZKR A;  4C90 A;  4YT0 A;  1Z8U A;  4JI4 T;  2EHO C;  2XM2 A;  2XQ6 A;  4X1K E;  2IC9 A;  1FEW A;  4DVD A;  2WM9 A;  4JI6 T;  3RYC E;  1I94 T;  3RYI E;  3Q5W A;  3RQW A;  4U3C A;  2H7O A;  3EDV A;  3EAB A;  5EK2 A;  4DR5 T;  2X0L B;  2DWK A;  3T1Y T;  5FL1 A;  4YHJ A;  4O4H E;  2BBJ A;  3QNU A;  3MJX A;  3OBV E;  4NIQ A;  3FB2 A;  3ZN1 B;  4U2Y A;  2CXL A;  1BR1 A;  2ZMA A;  3P4Q A;  1SUM B;  2DL1 A;  4TWH A;  4QKN A;  3HI2 A;  3LDQ B;  4OYJ A;  2I59 A;  1UUS A;  4IDN A;  4ZZC A;  1W09 A;  1WRD A;  4G63 A;  2L8K A;  4CN6 A;  2XQ9 A;  1CUN A;  2LRL A; 
#chains in the Genus database with same CATH homology
 5AFU L;  1SA0 E;  2XAG B;  3SRZ A;  1WYB A;  4ONR A;  2MYS A;  5JR9 A;  2LSK A;  2BDE A;  2NW7 A;  1NWM X;  2VK9 A;  3S4U A;  1ZEE A;  3F2E A;  4BA9 A;  1WR6 A;  3RX6 A;  4ZHQ E;  3W15 B;  1G73 A;  4DMW A;  3PUQ A;  4AKH A;  2BVL A;  1IAP A;  4UEM A;  1ZHC A;  3JC6 C;  2ODV A;  3ZPO A;  2W61 A;  5ETW A;  4EZH A;  1HG2 A;  4QX8 B;  4FJO A;  2NTY A;  4TX5 A;  1AJ3 A;  2K48 A;  3UFE A;  2IAK A;  4TUY E;  1LKX A;  4CQI A;  5M4Y A;  5HYA A;  3ZYK A;  4AKI A;  2XAQ B;  3N9P A;  3FHN A;  2IC6 A;  4ZOL E;  1X79 A;  4IGU A;  2DHR A;  4O2B E;  4XBF B;  3T8O A;  1MMN A;  5HXC A;  4M1P A;  3RRC A;  1US7 B;  5IHY A;  5HWX A;  4ZI7 E;  3FXE B;  2X68 A;  4HN9 A;  4IE0 A;  2LSG A;  3LBX B;  4I55 E;  3GWH A;  4C91 A;  3IF8 B;  5FXW A;  4ERR A;  2VKO A;  5L3B B;  4IE6 A;  4EB6 E;  2XAS B;  2KZ7 B;  3ZC0 A;  3O1H A;  3HKD E;  4ILU A;  2XAF B;  2LQU A;  4EYU A;  2C0S A;  3KV6 A;  1Z0P A;  2D2S A;  3SOL A;  4HE8 A;  2V7J A;  1FMW A;  4DO0 A;  3WSC A;  4AQF C;  3ESL A;  3ZMZ B;  4AQG A;  1UX4 A;  3AVS A;  4H9P C;  3F31 A;  4ZI2 D;  2H7V C;  2NOX A;  5ADX L;  2LHR A;  2PFV A;  3PF0 A;  5HXH A;  1MIV A;  3CQX C;  1MMD A;  2K9A A;  3PUS A;  4EXT A;  3L3P A;  2XQY A;  2VKH A;  2YU2 A;  3CML A;  2C5J A;  4I43 B;  2Q9Q C;  4JUY A;  4HFV A;  1NAF A;  5LHH B;  5LGU B;  2N1G A;  3BK9 A;  3WAK A;  4JLE A;  1UX5 A;  5JRC B;  1MNE A;  4MAL A;  2NW9 A;  3P7I A;  3ZYM A;  3ZMS B;  4P0A A;  4ASK A;  2LM9 A;  1HCI A;  2C5K T;  2KXP B;  2JPF A;  2XUE A;  4XZC A;  3RRW A;  2ZLY A;  4ANJ A;  4TV9 E;  4UVA B;  4QXH B;  5FY0 A;  1UCU A;  1D1A A;  3N9Q A;  3Q2M A;  1D1B A;  4AXP A;  2CCQ A;  4WBO A;  2V1D B;  5EK3 A;  4OFZ A;  4AQF A;  3RKO A;  3PE0 A;  2D5U A;  4ISS A;  1D0Y A;  3KFW X;  5E0O A;  3KV5 A;  5LP6 E;  2K24 A;  3HL6 A;  2PBI A;  4PJL A;  2Q9Q A;  4UVC B;  3K8P C;  2CWO A;  1LRZ A;  3I9W A;  5FMN A;  2YEV C;  3LFM A;  4PK5 A;  5L3E B;  2VL8 A;  3PU8 A;  5JDH A;  2HH7 A;  3R6N A;  2EHO D;  4GIW A;  2BVM A;  3C50 A;  5LBM A;  3I9Y A;  3LBX A;  3Q9D A;  4L9I A;  4UF0 B;  3AA0 B;  3HA4 A;  4MLK A;  1EZ3 A;  4PK6 A;  2LSY A;  3TKL B;  4IE4 A;  5KMG P;  3C4Z A;  4PW8 A;  5LGN B;  5FXZ A;  2CXD A;  4UV9 B;  5LBQ B;  1BR4 A;  3H37 A;  2Q9Q D;  1MIY A;  3GMI A;  3J9X 1;  1FMV A;  3LG7 A;  2KT9 A;  2HPL A;  3ZC1 A;  2L9Q A;  2V7K A;  2MTQ A;  3CPZ A;  5L3F B;  4BJM A;  4CZZ B;  4AKG A;  2PG8 A;  3NZP A;  4PFP A;  2NP9 A;  1SHZ C;  4ECG A;  2Y8D A;  3ANW B;  3BQI A;  4PFO A;  3AAI A;  2NWB A;  5JVD E;  5LXT E;  5JRC A;  2V26 A;  3HKE E;  4H9N C;  3PU3 A;  3AAE B;  5FP3 A;  2W00 A;  3KVA A;  3CQC B;  2N9D A;  2DNX A;  2JRK A;  4TN7 B;  2YU1 A;  3B57 A;  3O1I A;  4UV8 B;  3CVR A;  1KNZ A;  4AKR B;  4ZS2 A;  1E1H B;  2LOP A;  4MHC A;  2DLR A;  2LSJ A;  3P8C D;  5JDQ A;  4YJ2 E;  4FI5 A;  2CE7 A;  2ODU A;  3CX7 B;  3MA9 A;  4PK4 A;  1G8X A;  4X1I E;  3MXZ A;  3UUM A;  2DCF A;  2WBL A;  1LVF A;  4PAG A;  4XAX B;  1MMA A;  3AAA B;  4V1A v;  3VHL A;  3KVB A;  4EYY R;  2KIN B;  2LHN A;  4QXC B;  4IE7 A;  3VJZ A;  4EZ4 A;  5A1L A;  5F3J A;  1WLX A;  5HAX A;  3WI3 A;  4L0R A;  2M67 A;  5JRE A;  4UXN B;  3RH3 A;  2D0U A;  3V5U A;  5IYZ E;  5JDF A;  5L2L A;  5FY1 A;  3N9N A;  3I1A A;  5CA1 E;  3KV9 A;  3N9L A;  5L3G B;  4PNI A;  5HXS A;  4NUV A;  2J1D G;  3K3O A;  3PUR A;  5KX5 E;  3E0Z A;  3N2K E;  4H9Q C;  5F8P A;  4UF0 A;  1HTJ F;  2LE8 A;  2ZM2 A;  3FBL A;  1Y64 B;  4YFS A;  4EIW A;  2XAH B;  4Z8X A;  5LYJ E;  1V9D A;  2LT3 A;  3HKC E;  4UVB B;  3RC3 A;  1FIO A;  3EVY A;  3CKD A;  2LEH A;  3ZEF B;  2PJQ A;  3UUN A;  3QC9 A;  2VWA A;  3NBX X;  4DMV A;  4DND A;  4O4J E;  3LJC A;  4AKL A;  2E9X B;  5FYM A;  2N2N A;  4G2A A;  2G0U A;  1B7T A;  4QX7 B;  4HTE A;  3MAC A;  4IE5 A;  2DWG A;  4GYS A;  4EAH A;  3AA7 B;  4O4I E;  3LK2 B;  4H9S E;  1MND A;  2XAJ B;  3OKQ A;  4CXW A;  3U3I A;  3JC6 D;  4PJJ A;  3U78 A;  3IBP A;  3ANW A;  3HR0 A;  4GK5 E;  5LJM A;  4UIG A;  3O9X A;  2MTC A;  3MZK B;  3I0Q A;  3ZMT B;  3KV4 A;  1YKH B;  2NW8 A;  1OWA A;  2X9H A;  1YKE B;  2ES0 A;  2W63 A;  3E08 A;  3ZN0 B;  1HF8 A;  5JR9 B;  5L3D B;  3FBZ A;  5H6R B;  3R84 B;  4H63 V;  4WBN E;  1QUU A;  3PDY A;  3KIN B;  3PTR B;  5EZY E;  2D0T A;  2WAU A;  3PUG A;  3H3A A;  3ZLI A;  1HX8 A;  1VRB A;  4ZI3 C;  5T1D A;  1WYC A;  1HS7 A;  3D0T A;  2KMF A;  3ZJ1 A;  1IZN B;  2E9X C;  3O4X E;  2HPJ A;  5GON E;  4BGO A;  1O3X A;  3N9O A;  2CM0 A;  3ZMU B;  2ACX A;  1MMG A;  1D0Z A;  2CXF A;  2Y6X A;  5DQW A;  1H7C A;  4AI6 A;  1YD8 G;  2L3L A;  4OYK A;  4DBR A;  4KMC A;  3B13 A;  4YLH A;  1BR0 A;  4H9R C;  3EUH A;  5DQV A;  3WAJ A;  2V7M A;  4DBQ A;  2VKJ A;  3LK4 2;  3DJB A;  5LA6 E;  3GA8 A;  1OXZ A;  5CA0 E;  3C51 A;  5LNK A;  2X51 A;  4BAY B;  3M1C A;  5TAO A;  3O1J A;  4HKA A;  3UT5 E;  5LJN A;  1HFA A;  3AA6 B;  4N78 D;  2XHE B;  4F6R C;  2JMK A;  4UEL A;  4WNK A;  2K5B B;  3F57 A;  2CLY B;  2OA5 A;  2KWH A;  5HXR A;  3RYF E;  4CXY A;  2WWU A;  1D1C A;  5LOV E;  3RPU A;  4EOZ B;  3N2O A;  4GOU A;  2E9X A;  5LCY A;  3ONX A;  5JDM A;  4I50 E;  3CWZ B;  5HXE A;  4E7S A;  3E22 E;  4CI2 B;  2RA1 A;  2KWI B;  1T98 A;  3A5X A;  3C64 A;  4KBM B;  3Q5X A;  4O4L E;  3RYH E;  4CI3 B;  4U74 A;  2QA7 A;  4TZ4 C;  3FXD B;  2JQQ A;  5H6Q B;  2QGS A;  5JDN A;  5C8Y E;  4L5G A;  3I0O A;  2BZB A;  4KUM B;  2KLQ A;  4E7Z A;  2VKD A;  3DTO A;  3V5S A;  4ZI2 C;  3VKH A;  4ZS3 A;  3J7Y q;  1IJ5 A;  4GYR A;  1VOM A;  3UTK A;  5LGT B;  2VAS A;  4IHJ E;  2E9X D;  4ADZ A;  2A2F X;  2JMH A;  4KP3 C;  1QSD A;  3NRY A;  4PJM A;  2MBG A;  2Z6E A;  5JDG A;  2H3R A;  1U4Q A;  2V7I A;  2ZM8 A;  3NZQ A;  3QK6 A;  5EK4 A;  4CI1 B;  2CLY C;  3PHF 1;  4O8S A;  3ZCJ A;  1HG5 A;  1BR2 A;  3EDU A;  3ETV A;  4IST A;  3HKB E;  4IIJ E;  5HWY A;  2GK9 A;  2X66 A;  3BQK A;  2EHO B;  1IJ6 A;  4QXB B;  4WW0 A;  2YIN A;  2X67 A;  3C98 B;  2E8I A;  4JEU B;  4JEH B;  4J2C A;  2UXN B;  3GN5 B;  4OK0 A;  2DI4 A;  3M65 A;  3ETU A;  3OYX A;  3CQG B;  2VB6 A;  5JDL A;  4H9O C;  2CEA A;  3MK7 C;  2WMO A;  4CXX A;  5CB4 E;  2Q9Q B;  3MKD A;  4NUU A;  1D0X A;  3OYZ A;  4PJN A;  4TV8 E;  4U72 A;  3SWH A;  3N9M A;  3DP7 A;  2XTL A;  3WUR A;  1MIW A;  3LK3 B;  2B1E A;  4GK0 E;  1S94 A;  4P0B A;  5J2U E;  2MOZ A;  3N2G E;  3IHR A;  3SS1 A;  2LJL A;  4I4T E;  4C90 A;  3KBT A;  3L09 A;  4QHO A;  3AT7 A;  2EHO C;  3UUL A;  3OJA A;  2W62 A;  2RP4 A;  1KK7 A;  2NTX A;  4HEA A;  4X1K E;  2IW5 B;  2X9X A;  2IC9 A;  1FEW A;  2SPC A;  5LG4 A;  4DVD A;  2X9Y A;  2KND A;  2YK0 A;  2WM9 A;  1YW0 A;  3RYC E;  3C4W A;  2LSI A;  3RYI E;  3Q5W A;  3VU7 H;  3PUA A;  3BQL A;  4YJ3 E;  2H7O A;  3EDV A;  2X9W A;  5EK2 A;  1ZKE A;  2X0L B;  3ZCI A;  3ZYL A;  2V7L A;  3KBU A;  2DWK A;  3IEE A;  2CA5 A;  3CX8 B;  4BJN A;  2WSS V;  3K3Q C;  5FY7 A;  4HGA A;  4QWN B;  3N5L A;  5FXV A;  4YHJ A;  4OHF A;  3AB3 B;  2A3D A;  4MBQ A;  3QUJ A;  2EHO A;  2UXX B;  4O4H E;  4X1Y E;  2W0G A;  3C4X A;  4K0U A;  3MJX A;  3OBV E;  2P9B A;  3GN5 A;  3RC8 A;  5LHI B;  3KDS E;  5J1G A;  3CX6 B;  4P09 A;  5J2T E;  3FB2 A;  3ZN1 B;  5JR9 C;  4MFR A;  2CXL A;  1BR1 A;  2Y48 B;  2ZMA A;  2CMR A;  4O2A E;  3K3N A;  5BMV E;  3UUX B;  5FXX A;  5JQG E;  4QKN A;  2JJ9 A;  3HI2 A;  4OYJ A;  3AVR A;  2I59 A;  5LHG B;  3VKG A;  2ZM0 A;  1ZV4 X;  5DJQ C;  1S35 A;  5KDM C;  1WRD A;  4G63 A;  2L8K A;  2WMN A;  5L3C B;  2CWY A;  4IDZ A;  4B6X A;  1U5P A;  4H63 H;  3AA1 B;  1LVK A;  5FNV E;  2C5I T;  2LOS A;  3ZJ2 A;  1CUN A;  3NRX A;  2A72 A;  5JH7 E;  4A56 A;  4X20 E;  4ZI3 D;  5DAB A;  3ZMV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...