5JDHA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 10 mm na+ and 10mm ca2+
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
Knots found
sequence length
301
structure length
297
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized membrane protein MJ0091
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 123
structure length 297
sequence length 301
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdhA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdhA02
5JDMA 5HXCA 5JDHA 3V5UA 5HWXA 5JDQA 5JDLA 5HWYA 3V5SA 5HYAA 5JDGA 5HXRA 5JDNA 5HXSA 5HXEA 5HXHA 5JDFA
chains in the Genus database with same CATH superfamily
4H9QC 4UV9B 2E5VA 2HPJA 4CN6A 3EHZA 3AAAB 3A5XA 5AQQB 5CJ5A 1YKEB 2K9AA 3SRZA 4W8PA 4HFHA 2XPKA 3ZC0A 4EEDA 3ETUA 3I0OA 4KP3C 3K8PC 5DQVA 1J1JA 2I0MA 4YFSA 5ABEA 5AQMB 3L39A 2LSJA 2K3WA 5FVKA 1XDPA 2BG9A 2EHOB 5JDMA 1IJ6A 1ZOYA 4TV9E 4HWHA 2BKOA 2H7VC 3I0QA 5L47A 2UXNB 2PTFA 5EZYE 2X67A 3AE7A 3UUMA 3Q5XA 2YDSA 2IAKA 5IYZE 3AY5A 2ZMAA 2V6YA 4TWHA 2XAHB 3VU7H 2L9QA 5AQUB 2E2AA 3E22E 2XQAA 4PJNA 4IE7A 3P4PA 2KINB 4DVDA 1G8XA 5ABFB 2IDOB 3GWHA 4QHOA 2CXFA 4NPPA 3CQGB 1VCSA 3CX7B 3PUWF 1YXRA 3R84B 4UELA 3I9YA 4HFDA 3B57A 5L3GB 1X9BA 4IT4A 1WRDA 4PJJA 4GKJT 2WU2A 2A3DA 2NW7A 1VRBA 3AB3B 2OLTA 5CFBA 1G73A 5BR8T 3PU3A 2XQ9A 4U72A 5EK2A 4JYAT 2WQYA 3ANWA 3N9QA 1L0VA 2KMFA 2PJQA 5HEUA 1UX4A 4HWIB 4I50E 3FYQA 2LOSA 3QUJA 3TLUA 3E0ZA 4ZI3C 3TLTA 2KWIB 3KDSE 3BQIA 4X66T 3EABA 2UU9T 2E9XB 4CQIA 4GK0E 1XNRT 5HEJA 5FNVE 3OTOT 2YEVC 5TAOA 4IDQA 1T7SA 4DV2T 1SHZC 2FJEA 3OYXA 3P50A 4MHCA 1MMGA 3M65A 4EGWA 4L0RA 4JI3T 4DV5T 1HFAA 2W66A 4LF4T 2YKSA 4EB6E 2JMHA 3CX8B 3Q5EA 5ETWA 3P4QA 2LJLA 4PNIA 5IUXA 4ILUA 2VURA 5CB4E 2Q9QB 3G06A 3KV4A 5LMNT 5CA1E 3QK6A 3O9XA 2M6IA 3PU8A 4G63A 1MIWA 2QRXA 3ZN0B 1N33T 4JBWF 3P4SA 4M1PA 3N5LA 1YW0A 3PDYA 3C50A 4JEHB 2R6GF 4I43B 1S35A 2LHNA 3PUSA 1YD8G 3I9WA 4F7GB 3M1CA 5FYMA 3VKHA 2X0HA 5C8YE 3KVAA 2WAUA 3AE2A 5LCYA 1ZV4X 5ABGA 2XUEA 1MNDA 2CHOA 4QH4A 4CN1A 3MK7C 1MNEA 3B13A 4LF9T 3RYFE 5H6RB 5J1GA 1NAFA 3N2KE 4DO0A 1XWMA 1SA0E 2WZIA 2VL0A 4JI4T 3CQXC 3SOLA 3ZCIA 4DMVA 2W62A 2XY8B 5AQPB 4ASKA 2LE8A 4JV5T 2JIWA 5AQOB 1I6ZA 3DTOA 2X9XA 2CM0A 4IE0A 1M62A 1IAPA 2A2FX 4WBOA 4YJ2E 4HWFA 4K0KT 1WYCA 3X1DA 2JPFA 1M7KA 5FXXA 4QH1A 3SWHA 5HXSA 5HXCA 3OYZA 1D1CA 4OK0A 3UUNA 2BKPA 4LMLA 2CRBA 5CA0E 3KBUA 2YDQA 4B3MT 3K3OA 5LGTB 2X51A 3KV5A 4PW8A 2J62A 4FJOA 3ETVA 4XBFB 4DV1T 1SE7A 2VKDA 4X62T 5AFUL 3QB5A 3CQCB 2GK9A 4LF5T 3SS1A 4IDNA 4DV7T 4A5XA 2EHOD 2X0YA 3M3ZB 5FMNA 1KF6A 1SUMB 5IHYA 4EOZB 1QUUA 3SFEA 4EZHA 2J47A 2WY2A 4AKRB 4KHZF 4O4IE 4O4HE 2IIUA 2YINA 3WSCA 2VVSA 2C5KT 2C5IT 2CA5A 4X1KE 3RQUA 4LFCT 3K3NA 3CMLA 3TLSA 3NKZA 1ZEEA 4Z8XA 4TWDA 3ZSSA 2JQQA 4KHPT 4IDZA 4PK4A 4ZXLA 4IHJE 2BVLA 4CZZB 3PUYF 2NW8A 3EVYA 3DJBA 2LOPA 2V7LA 3Q5DA 2XZEA 3NRXA 2WZHA 3LSVA 4JUYA 2LLYA 4ISTA 2X9HA 4QWNB 5LNKA 5HXRA 4FI5A 5EK4A 2LM9A 4O8SA 1OEDE 3CVRA 2D2SA 2W67A 3ZPOA 1D0ZA 2XAJB 3C4WA 2KZ7B 2MAWA 3NZQA 2ODVA 3WURA 3LBXB 2WCAA 3OJAA 1MMDA 1SJ8A 5HYAA 4NXMT 3AVRA 4UEMA 2YDRA 2FJDA 4BJNA 2LSGA 2CHNA 3BQLA 3HL6A 3AE8A 2RA1A 4HFBA 4A98A 1HX1B 4UIGA 4QXHB 2Q9QD 5LBMA 2QYWA 4EXTA 1XMQT 4O2AE 4TWFA 2E9XC 3JAFA 1JNZA 5EK3A 3DP7A 2HN1A 3UUBA 5L4EA 3UQ4A 4ILAA 4PFOA 2KSRA 1KFYA 3RYIE 4HN9A 2WDRA 2H88A 5L3FB 1NENA 2IW5B 3RHWA 3LK42 2BG9E 2HN2A 4PFPA 2CWOA 2K5BB 2VKJA 3OVUA 3VHLA 3LJCA 4GYRA 2LSYA 4ZZCA 3MZKB 5L4HA 2V6XA 1HG5A 2MYSA 2HH7A 4UV8B 5ABFA 4ZS3A 2LKGA 4O2BE 4JI1T 2DWKA 2LHRA 5LJNA 3KFWX 1O3XA 2ES0A 2W00A 4IL9A 3CIRA 4HWDA 1IJ5A 1WFDA 5LHHB 1UX5A 4LFAT 5HEHA 5FL0A 1D1AA 4ILBA 4PJLA 3RRWA 1FJGT 2ODUA 2LKHA 2WBLA 5L3CB 3PUXF 4HEAA 3ZMVB 2X9YA 4AI6A 4KI0F 4AKLA 4ZHQE 3QOFA 4QXBB 3A7MA 4DBQA 3P4WA 4DR4T 2E9XA 3BK9A 4DV4T 3P7IA 3AE9A 5J2UE 5DABA 3JAEA 5A1LA 1LVFA 4UF0B 4GKKT 4OYKA 2WSSV 2VK9A 4DR2T 4O4JE 2DLRA 1OEDB 3AAIA 4IDPA 2X66A 2KGXA 2Q9QA 3AEBA 4DR5T 4PAGA 4ISSA 4I4TE 1XMOT 2XAFB 5F5WA 5FY1A 1U4QA 4ZI2D 4EIWA 2UXDT 2I59A 1N32T 1V9DA 3LG7A 5LYJE 2VVNA 2XSAA 3AEAA 4YTMA 4HTEA 4YTPA 1FIOA 3RC3A 4L5GA 2BS3A 4NIQA 3AEDA 2IHR1 5T1DA 3HKBE 4KBMB 1HNZT 2VB6A 5JH7E 1GQEA 1D1BA 2VQFT 3RIFA 1FMVA 4TV8E 2XJ7A 2D0TA 3GN5A 5JVDE 2Y8DA 4WW0A 5JR9B 4AKGA 3RH3A 2MOZA 4ILCA 5ADXL 3WI3A 5E0OA 2XQ8A 4DMWA 4YSZA 1VOMA 5ABHA 2XAQB 2BBJA 2A9UA 4Z91A 5KMGP 2RP4A 2XQ3A 4F6RC 3ZLIA 4EAHA 2CXLA 2KNDA 3N9NA 5JRCB 3AEGA 4JI7T 5FXVA 1ZP0A 4HE8A 2V6YB 2WB5A 3W15B 2LSIA 3KVBA 5F3JA 4HFEA 3DYJA 2N9DA 1Z8UA 2XQ7A 3UQ7A 2XQ6A 4U33A 3CPZA 2WP9A 2BZBA 5AQVB 1D0XA 4DV6T 4COFA 3N9OA 1Z0PA 1WR6A 3ZT6A 2NWBA 3AA1B 1XNQT 2QVAA 3PUZF 4CXXA 4TN7B 3ZEFB 3ANWB 4MLKA 1T98A 4DR1T 3FZHB 1HS7A 2ZM2A 1AJ3A 3P4RA 1QSDA 3VKGA 5FP3A 3C51A 2WS3A 3PJAJ 2J4GA 5LGUB 2V5DA 3PUQA 3F2EA 4AQGA 3AE4A 3ESLA 1XDOA 4B6XA 1KNRA 3UU8A 3TLWA 2V8SV 3NWIA 5IWAT 4JEUB 3AT7A 5FVLA 2C0SA 4U7YA 4U74A 3TLVA 5AQHB 2K48A 5JDFA 2BS4A 2SPCA 1KNPA 4DR3T 1HG2A 4ANJA 2WWVA 3T8OA 2VKOA 1W9RA 1VCTA 3UU5A 4CXWA 2CBJA 2CXDA 2DNXA 3NVOA 2ZM0A 2WMOA 3ZMTB 2MPKA 4DR7T 5LA6E 5JDHA 2JRKA 3HR0A 1UK5A 5FXZA 2V26A 1UCUA 5JTGA 3P8CD 3LBXA 1UURA 3B5MA 3OKQA 3OPCA 1E7PA 4HWCA 3Q2MA 4H9NC 3T1HT 3ZCJA 3VR9A 3RRCA 5HEOA 2ACZA 4IREA 2Y6XA 4JI8T 3IA3A 4B3RT 2L10A 5AQGB 3ZYKA 4PK5A 4ADZA 4O4LE 1W0AA 3IEEA 1DU2A 2M67A 3QNUA 4HKAA 5HCJA 2KLQA 4UR9A 3FZMB 2EHOC 3ZT5A 2BDEA 3MJXA 4DR6T 3FB2A 2JQKA 3LK2B 3PF0A 5HWXA 4IE6A 3VRBA 2YN6A 4BJMA 2MTQA 3JCFA 4E7SA 3PJAA 5HEGA 3WAKA 2LM2A 3ZJ2A 3O4XE 3MKDA 3AE3A 3K3QC 4HFVA 2LQUA 2B76A 5LMUT 4U3CA 2XAGB 4HFCA 4CI1B 3HKEE 2V7MA 3O1HA 5JDLA 3FXEB 3ZC1A 4Q25A 3VR8A 4ZI7E 5FKYA 3JC6D 1HF8A 3AXJB 4YLHA 1HR0T 4H63V 1CUNA 2OA5A 2V1DB 4YHJA 3UFGA 3N9PA 5AQSB 2RPAA 2CLYB 2XHEB 1OWAA 3AAEB 3RX6A 4H63H 3FBZA 1HX8A 3UU3A 3AECA 3N9MA 2IMLA 2X0LB 3VRAA 2J1DG 2XM1A 1MIYA 2KBBA 4H9SE 4UVAB 2UXBT 2CPTA 3FHNA 4HFIA 1UGOA 4X5TA 2WWUA 2EHOA 4IE5A 2YOEA 4PK6A 4HGAA 4WYVA 4H9PC 3UFEA 4YXDA 4X1IE 2Q9QC 3EUHA 3N9LA 4DBRA 3AA0B 4YY3T 3N2GE 2LEHA 4JLEA 5JQGE 3RKGA 2OV9A 1B7TA 4C91A 2G0UA 3RIUA 5AQLB 2XASB 4XZCA 3UU6A 5J2TE 4B3TT 5F8PA 1NWMX 4H9OC 3EI0A 2QGSA 1X79A 4CI2B 2VKHA 3C64A 3ZN1B 4NUVA 1QLBA 3E08A 2VASA 3D0TA 3AEEA 4BGOA 1HTJF 2NR4A 3JADA 2V7KA 2CEAA 2JJ9A 2QA7A 1YQ3A 5J0ZA 3I1AA 5BMVE 5LP6E 3ZSTA 5JDNA 4L9IA 4JI6T 2F4VT 4CXYA 2BKNA 3GA8A 2XTLA 4EYYR 2L8KA 3PUGA 3R6NA 4WBNE 3ONJA 3K1SA 5JR9A 2Z6EA 4TNVA 3AE5A 4MFRA 2HHHT 2H7OA 3L3PA 2ACXA 4ZOLE 4OHFA 3ZKRA 2UUAT 2P9BA 5H6QB 2L3LA 5L3BB 2MTCA 4QX8B 4AXPA 3FZLB 4DNDA 5LJMA 1J5ET 2UUCT 1ZKEA 4I55E 3EDVA 1J5WA 1BR0A 2VQET 1H7CA 2UXXB 2KWHA 2H3RA 5LGNB 2W63A 5HCMA 3RYHE 4IGUA 5JRCA 3RF1A 3LDQB 3VJZA 4DV0T 3ONLC 2CE7A 1KNZA 5KX5E 1IZNB 4C90A 4OFZA 3MACA 3MA9A 2ZM8A 3WAJA 2IUBA 4ZI3D 1S94A 4AISA 4ZZBA 2B1EA 2K24A 4YT0A 1YQ4A 2NOXA 1LVKA 5AQJB 3RQWA 2FUPA 2DL1A 3HA4A 4QH5A 4ZEYA 3Q5WA 5AQFB 5AQRB 5LB7B 3QB5K 4ZI2C 2LRLA 4YSXA 3FZKB 4GOUA 1E1HB 3IBPA 5CGMA 4PJMA 4LF6T 3ZYLA 2D9DA 4OYJA 2BVMA 1UUSA 3PV0F 3A8YC 1FMWA 5L3EB 2V5CA 5FL1A 5L2LA 1MMAA 2BG9B 4N78D 1CHUA 5DJQC 4AQFC 1IBLT 4QKNA 2XQ5A 1EZ3A 4EV6A 3C98B 4H9RC 1W09A 4NXNT 4P1NA 1E2AA 2D5UA 4JI2T 2H89A 3O1IA 2ZM6T 4KUMB 2WM9A 3NRYA 3F57A 3H3MA 2WU5A 2CBIA 2PG8A 3Q9DA 4A97A 1KK7A 3EDUA 1WR0A 4IL4A 4TUYE 4DV3T 1NEKA 2XQ4A 4QXCB 3V5UA 4OX9T 4BA9A 2JQ9A 4CN4A 4X20E 5FXWA 2UUBT 3J9X1 2WMNA 3KBTA 4A56A 5LBQB 3CWZB 3CX6B 3RI5A 2C5JA 2NTXA 3AA7B 1W0BA 2D0UA 2CLYC 1US7B 3RIAA 4YHHT 3GN5B 1HNWT 5C2TA 5LHGB 3PUVF 3U3IA 5LXTE 5AQKB 5JDQA 4DIDB 4ERRA 1IBMT 1D0YA 2IC9A 4BAYB 1R8IA 5DQWA 3FXDB 4GIWA 5GONE 2NTYA 4UVCB 4U7IA 4LF7T 2W4XA 4IE4A 1YKHB 1N34T 3NBXX 3MXZA 3SFDA 4UXNB 3UULA 4AQFA 2W61A 2KVPA 3S4UA 5AQNB 5KDMC 1MMNA 4TZ4C 3L8RA 3F31A 5HWYA 2FJAA 1LRZA 3T1YT 5JDGA 2DCFA 3CK6A 2N2NA 4LFBT 4B3ST 1BR1A 2A72A 3UU4A 5HXEA 4CI3B 4EZ4A 1N36T 4MALA 1T8BA 3RPUA 2E5LT 4WNKA 4AQYT 1SJ7A 3UT5E 3PHF1 3N2OA 2MBGA 4GK5E 4LMJA 3ZT7A 3OBVE 2XM2A 4YJ3E 3AXJA 4IIJE 2PBIA 4X65T 3U78A 5C3JA 3CKDA 3O1JA 2YK0A 3H3AA 4V1Av 3EAMA 4XAXB 3AVSA 1WYBA 5LOVE 2YU2A 3C4XA 3ABVA 3ZMSB 3AEFA 1BR2A 4IDOA 2FJBA 4ECGA 2ZLYA 2UXCT 2YU1A 2W0GA 3RKOA 4DUYT 5FZTA 3GMIA 3UUXB 5L3DB 2NP9A 3PTRB 3RYCE 4JI0T 4K0UA 3PURA 2CCQA 2VL8A 4LMKA 5HXHA 1OEDC 3IHRA 5M4YA 2DHRA 3QC9A 2V7JA 3KINB 3RIUC 3FBLA 4MBQA 4X64T 2WDQA 3IF8B 3C4ZA 2LT3A 4KMCA 1Y64B 2L7NA 4ZS2A 1KEYA 2E8IA 1XZYA 4AKHA 4I0UA 2Y48B 4U31A 5JREA 2W2UA 2KT9A 3PE0A 1WCRA 3ZYMA 5KXJA 2NW9A 2LRKA 2BBHA 4F8HA 4P0BA 4UVBB 4AIUA 2LSKA 2E9XD 2CWYA 4J2CA 2N1GA 2VWAA 2DWGA 3ZMUB 1T72A 3J7Yq 4AKIA 1OXZA 4DUZT 4JI5T 4KX6A 4E7ZA 3HI2A 2XSBA 4YTNA 3AE6A 2JMKA 4Z90A 5LG4A 4EYUA 3ONXA 5JR9C 4NUUA 2WDVA 3TKLB 2M6BA 1Y01A 1IBKT 3AE1A 3JC6C 3FZFB 1WLXA 4ONRA 2BS2A 3BQKA 1MIVA 2FBWA 4P0AA 2PFVA 2JQHA 3H37A 3KV6A 3AA6B 5HAXA 2AXDS 2BG9C 3KV9A 4QX7B 4WZXA 4EEBA 3V5SA 1FEWA 1HCIA 2AE9A 2V7IA 2IC6A 1BR4A 5AQIB 4P09A 4U2YA 4UF0A 2I6HA 2X9WA 4U2ZA 4GYSA 1LKXA 4G2AA 1OEDA 3LFMA 3RGLA 4YSYA 3ZMZB 3NZPA 2DI4A 2X0CA 2CMRA 2KXPB 4TX5A 2X68A 3UTKA 1ZHCA 5FY7A 5LHIB 4X1YE 3HKCE 3ZJ1A 3LK3B 3PUAA 3RLFF 1I94T 3HKDE 3RC8A 5FY0A 1U5PA 2HPLA 1JNRA 2XQYA 4LF8T 1HNXT 3L09A 5LG3A 4TNWA 5AQTB
chains in the Genus database with same CATH topology
1D0ZA 4H9QC 4UV9B 2XAJB 2SPCA 1FMWA 5L3EB 3C4WA 2KZ7B 5L2LA 3NZQA 1MMAA 2ODVA 3WURA 2HPJA 1HG2A 4N78D 5DJQC 4ANJA 3LBXB 4AQFC 3OJAA 3T8OA 1MMDA 2VKOA 3A5XA 3AAAB 4QKNA 1YKEB 2K9AA 3SRZA 4CXWA 1EZ3A 3C98B 4H9RC 5HYAA 3ZC0A 2CXDA 2DNXA 3AVRA 3ETUA 4UEMA 2ZM0A 3I0OA 2WMOA 4KP3C 3K8PC 5DQVA 4BJNA 2LSGA 3ZMTB 3BQLA 5LA6E 5JDHA 2JRKA 2D5UA 3HL6A 2RA1A 3O1IA 3HR0A 4YFSA 4KUMB 2V26A 2WM9A 5FXZA 2LSJA 1UCUA 3NRYA 3F57A 2PG8A 4UIGA 2EHOB 3P8CD 5JDMA 3Q9DA 4QXHB 3LBXA 1KK7A 1IJ6A 4TV9E 2Q9QD 5LBMA 3EDUA 2H7VC 4EXTA 4O2AE 3I0QA 4TUYE 3OKQA 2E9XC 2UXNB 5EK3A 3DP7A 5EZYE 2X67A 3Q2MA 4QXCB 3UUMA 4H9NC 3V5UA 3Q5XA 2IAKA 5IYZE 3ZCJA 2ZMAA 4BA9A 4X20E 2XAHB 4PFOA 3RRCA 5FXWA 3VU7H 3J9X1 2WMNA 2L9QA 3KBTA 3E22E 4A56A 5LBQB 3CWZB 2Y6XA 3RYIE 4PJNA 4IE7A 3CX6B 2KINB 4DVDA 4HN9A 1G8XA 2C5JA 3GWHA 4QHOA 2CXFA 5L3FB 3CQGB 2IW5B 3CX7B 2NTXA 3ZYKA 4PK5A 3AA7B 3LK42 4ADZA 3R84B 4O4LE 4UELA 2D0UA 3I9YA 3IEEA 2M67A 2CLYC 1US7B 4HKAA 3B57A 4PFPA 5L3GB 2KLQA 2CWOA 2K5BB 1WRDA 4PJJA 2EHOC 2VKJA 3VHLA 2BDEA 2A3DA 3GN5B 3MJXA 2NW7A 3FB2A 1VRBA 3AB3B 3LJCA 4GYRA 2LSYA 5LHGB 3U3IA 1G73A 5LXTE 3MZKB 3LK2B 3PU3A 3PF0A 5HWXA 1HG5A 2MYSA 4IE6A 4U72A 5JDQA 2HH7A 4UV8B 4ERRA 5EK2A 1D0YA 2IC9A 4ZS3A 4BAYB 4BJMA 2MTQA 3ANWA 4O2BE 4E7SA 3N9QA 5DQWA 2KMFA 2PJQA 3WAKA 3FXDB 4GIWA 2DWKA 5GONE 2LHRA 1UX4A 5LJNA 2NTYA 3ZJ2A 3O4XE 4I50E 4UVCB 3KFWX 1O3XA 2ES0A 2LOSA 3K3QC 2W00A 3MKDA 3QUJA 4IE4A 4HFVA 3E0ZA 4ZI3C 2LQUA 1YKHB 1IJ5A 5LHHB 1UX5A 2KWIB 3NBXX 3KDSE 3BQIA 3MXZA 3UULA 4UXNB 4AQFA 2XAGB 4CI1B 2W61A 3S4UA 3HKEE 2V7MA 2E9XB 1D1AA 1MMNA 3O1HA 4TZ4C 5JDLA 5KDMC 3F31A 3FXEB 3ZC1A 4CQIA 4PJLA 4GK0E 3RRWA 5HWYA 5FNVE 2YEVC 2ODUA 5TAOA 2WBLA 4ZI7E 1SHZC 3OYXA 1LRZA 5JDGA 2DCFA 5L3CB 4MHCA 3JC6D 1MMGA 2N2NA 1HF8A 3M65A 4HEAA 4YLHA 1BR1A 3ZMVB 2X9YA 4AI6A 4L0RA 2A72A 4H63V 4AKLA 4ZHQE 5HXEA 4CI3B 1HFAA 4EZ4A 4MALA 1CUNA 3RPUA 2OA5A 4QXBB 4EB6E 2JMHA 2V1DB 4YHJA 3CX8B 4WNKA 3UT5E 3PHF1 5ETWA 4DBQA 2LJLA 3N9PA 4PNIA 4ILUA 2E9XA 3BK9A 3N2OA 2CLYB 5CB4E 2XHEB 2Q9QB 2MBGA 1OWAA 3KV4A 4GK5E 3AAEB 3RX6A 4H63H 3FBZA 3P7IA 1HX8A 3OBVE 5CA1E 5J2UE 3QK6A 3N9MA 4YJ3E 5DABA 3O9XA 3PU8A 4G63A 4IIJE 1MIWA 2X0LB 3ZN0B 5A1LA 1LVFA 2PBIA 4UF0B 3U78A 4OYKA 2WSSV 4M1PA 2J1DG 2VK9A 3CKDA 1MIYA 4H9SE 4UVAB 3O1JA 3FHNA 2YK0A 3N5LA 1YW0A 3H3AA 4V1Av 3PDYA 4O4JE 3C50A 3AVSA 1WYBA 4JEHB 4XAXB 2DLRA 4I43B 5LOVE 1S35A 2LHNA 3AAIA 3PUSA 1YD8G 2X66A 2YU2A 3I9WA 3C4XA 3M1CA 5FYMA 2Q9QA 3VKHA 4PAGA 4ISSA 4I4TE 2WWUA 2EHOA 3ZMSB 5C8YE 4IE5A 4PK6A 2XAFB 3KVAA 2WAUA 4HGAA 1BR2A 4H9PC 5FY1A 1U4QA 5LCYA 1ZV4X 4ZI2D 4EIWA 4ECGA 3UFEA 2XUEA 2I59A 2ZLYA 2YU1A 4X1IE 1MNDA 1V9DA 2Q9QC 2W0GA 3LG7A 5LYJE 3RKOA 3EUHA 3MK7C 3N9LA 4DBRA 3AA0B 1MNEA 3N2GE 2LEHA 4JLEA 3B13A 5JQGE 3GMIA 3UUXB 4HTEA 3RYFE 5H6RB 1B7TA 4C91A 5L3DB 1FIOA 2NP9A 3PTRB 5J1GA 3RYCE 3RC3A 4L5GA 2G0UA 1NAFA 3N2KE 4K0UA 4DO0A 3PURA 2CCQA 2XASB 4XZCA 5T1DA 2VL8A 3HKBE 4KBMB 5HXHA 1SA0E 5J2TE 2VB6A 5JH7E 5F8PA 1NWMX 3CQXC 1D1BA 3IHRA 4H9OC 3SOLA 2DHRA 3ZCIA 4DMVA 2W62A 2QGSA 2V7JA 3QC9A 5M4YA 1FMVA 3KINB 4TV8E 1X79A 3FBLA 4MBQA 2VKHA 3C64A 2LE8A 4ASKA 4CI2B 3ZN1B 3IF8B 2D0TA 2LT3A 3C4ZA 3GN5A 4NUVA 4KMCA 1Y64B 3E08A 5JVDE 2VASA 3DTOA 2Y8DA 4ZS2A 3D0TA 2X9XA 1HTJF 2E8IA 4BGOA 2CM0A 4WW0A 4AKHA 5JR9B 2Y48B 4IE0A 2V7KA 5JREA 1IAPA 2KT9A 4AKGA 3RH3A 2CEAA 3PE0A 2A2FX 2JJ9A 2MOZA 4WBOA 3ZYMA 4YJ2E 2QA7A 3I1AA 5BMVE 5ADXL 2NW9A 1WYCA 5LP6E 2JPFA 3WI3A 5E0OA 4P0BA 4DMWA 4UVBB 1VOMA 5FXXA 4L9IA 5JDNA 3SWHA 5HXSA 2XAQB 5HXCA 2LSKA 3OYZA 2E9XD 5KMGP 2RP4A 1D1CA 4CXYA 3GA8A 2CWYA 4OK0A 2XTLA 4F6RC 4EYYR 2L8KA 3UUNA 3ZLIA 5CA0E 4J2CA 3KBUA 3PUGA 3R6NA 4WBNE 2N1GA 2VWAA 4EAHA 5JR9A 2DWGA 3ZMUB 2Z6EA 3K3OA 3J7Yq 4MFRA 5LGTB 2CXLA 4AKIA 2X51A 3KV5A 4PW8A 2H7OA 3L3PA 2ACXA 2KNDA 1OXZA 4ZOLE 3N9NA 4OHFA 5JRCB 2P9BA 5FXVA 5H6QB 2L3LA 4HE8A 3HI2A 4FJOA 4E7ZA 5L3BB 3ETVA 5LG4A 2JMKA 2MTCA 4EYUA 3W15B 3ONXA 4XBFB 2LSIA 3KVBA 4NUUA 5JR9C 3TKLB 4QX8B 2VKDA 5F3JA 4AXPA 3JC6C 5AFUL 1WLXA 4DNDA 4ONRA 2N9DA 3BQKA 3CQCB 5LJMA 2GK9A 1MIVA 3SS1A 1ZKEA 4I55E 4P0AA 2PFVA 2EHOD 3CPZA 3EDVA 2BZBA 3H37A 1BR0A 5FMNA 1H7CA 3KV6A 2UXXB 3AA6B 1D0XA 5HAXA 2KWHA 5IHYA 4EOZB 2H3RA 5LGNB 2W63A 3RYHE 3KV9A 4IGUA 3N9OA 4QX7B 1QUUA 5JRCA 1Z0PA 4EZHA 3V5SA 1FEWA 1HCIA 2V7IA 3VJZA 2IC6A 1WR6A 1BR4A 2NWBA 3AA1B 2CE7A 4P09A 1KNZA 5KX5E 4AKRB 4O4IE 4UF0A 1IZNB 2X9WA 4C90A 4GYSA 4O4HE 4OFZA 3MACA 4CXXA 1LKXA 4G2AA 2YINA 4TN7B 3ZEFB 3ANWB 3MA9A 4MLKA 2ZM8A 3WSCA 3WAJA 1T98A 2C5KT 3LFMA 2C5IT 4ZI3D 1S94A 1HS7A 2CA5A 2ZM2A 1AJ3A 4X1KE 1QSDA 3VKGA 3ZMZB 3NZPA 2B1EA 2DI4A 2K24A 3K3NA 3CMLA 5FP3A 3C51A 2CMRA 2KXPB 2NOXA 1ZEEA 1LVKA 4Z8XA 4TX5A 2JQQA 4IDZA 4PK4A 2X68A 5LGUB 3UTKA 3HA4A 3Q5WA 4IHJE 2BVLA 1ZHCA 3PUQA 3F2EA 4CZZB 2NW8A 3EVYA 5FY7A 4AQGA 3DJBA 2LOPA 4ZI2C 3ESLA 5LHIB 2V7LA 4X1YE 3HKCE 4B6XA 3ZJ1A 3LK3B 3NRXA 3PUAA 4JUYA 4GOUA 4ISTA 2X9HA 4QWNB 3HKDE 5LNKA 5HXRA 1E1HB 3IBPA 4FI5A 4JEUB 3AT7A 5EK4A 2LM9A 3RC8A 5FY0A 4O8SA 4PJMA 1U5PA 2HPLA 3CVRA 2D2SA 2XQYA 3ZYLA 2C0SA 3L09A 4U74A 3ZPOA 4OYJA 2K48A 2BVMA 5JDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDM A;  5HXC A;  5JDH A;  3V5U A;  5HWX A;  5JDQ A;  5JDL A;  5HWY A;  3V5S A;  5HYA A;  5JDG A;  5HXR A;  5JDN A;  5HXS A;  5HXE A;  5HXH A;  5JDF A; 
#chains in the Genus database with same CATH topology
 4H9Q C;  4UV9 B;  2E5V A;  2HPJ A;  4CN6 A;  3EHZ A;  3AAA B;  3A5X A;  5AQQ B;  5CJ5 A;  1YKE B;  2K9A A;  3SRZ A;  4W8P A;  4HFH A;  2XPK A;  3ZC0 A;  4EED A;  3ETU A;  3I0O A;  4KP3 C;  3K8P C;  5DQV A;  1J1J A;  2I0M A;  4YFS A;  5ABE A;  5AQM B;  3L39 A;  2LSJ A;  2K3W A;  5FVK A;  1XDP A;  2BG9 A;  2EHO B;  5JDM A;  1IJ6 A;  1ZOY A;  4TV9 E;  4HWH A;  2BKO A;  2H7V C;  3I0Q A;  5L47 A;  2UXN B;  2PTF A;  5EZY E;  2X67 A;  3AE7 A;  3UUM A;  3Q5X A;  2YDS A;  2IAK A;  5IYZ E;  3AY5 A;  2ZMA A;  2V6Y A;  4TWH A;  2XAH B;  3VU7 H;  2L9Q A;  5AQU B;  2E2A A;  3E22 E;  2XQA A;  4PJN A;  4IE7 A;  3P4P A;  2KIN B;  4DVD A;  1G8X A;  5ABF B;  2IDO B;  3GWH A;  4QHO A;  2CXF A;  4NPP A;  3CQG B;  1VCS A;  3CX7 B;  3PUW F;  1YXR A;  3R84 B;  4UEL A;  3I9Y A;  4HFD A;  3B57 A;  5L3G B;  1X9B A;  4IT4 A;  1WRD A;  4PJJ A;  4GKJ T;  2WU2 A;  2A3D A;  2NW7 A;  1VRB A;  3AB3 B;  2OLT A;  5CFB A;  1G73 A;  5BR8 T;  3PU3 A;  2XQ9 A;  4U72 A;  5EK2 A;  4JYA T;  2WQY A;  3ANW A;  3N9Q A;  1L0V A;  2KMF A;  2PJQ A;  5HEU A;  1UX4 A;  4HWI B;  4I50 E;  3FYQ A;  2LOS A;  3QUJ A;  3TLU A;  3E0Z A;  4ZI3 C;  3TLT A;  2KWI B;  3KDS E;  3BQI A;  4X66 T;  3EAB A;  2UU9 T;  2E9X B;  4CQI A;  4GK0 E;  1XNR T;  5HEJ A;  5FNV E;  3OTO T;  2YEV C;  5TAO A;  4IDQ A;  1T7S A;  4DV2 T;  1SHZ C;  2FJE A;  3OYX A;  3P50 A;  4MHC A;  1MMG A;  3M65 A;  4EGW A;  4L0R A;  4JI3 T;  4DV5 T;  1HFA A;  2W66 A;  4LF4 T;  2YKS A;  4EB6 E;  2JMH A;  3CX8 B;  3Q5E A;  5ETW A;  3P4Q A;  2LJL A;  4PNI A;  5IUX A;  4ILU A;  2VUR A;  5CB4 E;  2Q9Q B;  3G06 A;  3KV4 A;  5LMN T;  5CA1 E;  3QK6 A;  3O9X A;  2M6I A;  3PU8 A;  4G63 A;  1MIW A;  2QRX A;  3ZN0 B;  1N33 T;  4JBW F;  3P4S A;  4M1P A;  3N5L A;  1YW0 A;  3PDY A;  3C50 A;  4JEH B;  2R6G F;  4I43 B;  1S35 A;  2LHN A;  3PUS A;  1YD8 G;  3I9W A;  4F7G B;  3M1C A;  5FYM A;  3VKH A;  2X0H A;  5C8Y E;  3KVA A;  2WAU A;  3AE2 A;  5LCY A;  1ZV4 X;  5ABG A;  2XUE A;  1MND A;  2CHO A;  4QH4 A;  4CN1 A;  3MK7 C;  1MNE A;  3B13 A;  4LF9 T;  3RYF E;  5H6R B;  5J1G A;  1NAF A;  3N2K E;  4DO0 A;  1XWM A;  1SA0 E;  2WZI A;  2VL0 A;  4JI4 T;  3CQX C;  3SOL A;  3ZCI A;  4DMV A;  2W62 A;  2XY8 B;  5AQP B;  4ASK A;  2LE8 A;  4JV5 T;  2JIW A;  5AQO B;  1I6Z A;  3DTO A;  2X9X A;  2CM0 A;  4IE0 A;  1M62 A;  1IAP A;  2A2F X;  4WBO A;  4YJ2 E;  4HWF A;  4K0K T;  1WYC A;  3X1D A;  2JPF A;  1M7K A;  5FXX A;  4QH1 A;  3SWH A;  5HXS A;  5HXC A;  3OYZ A;  1D1C A;  4OK0 A;  3UUN A;  2BKP A;  4LML A;  2CRB A;  5CA0 E;  3KBU A;  2YDQ A;  4B3M T;  3K3O A;  5LGT B;  2X51 A;  3KV5 A;  4PW8 A;  2J62 A;  4FJO A;  3ETV A;  4XBF B;  4DV1 T;  1SE7 A;  2VKD A;  4X62 T;  5AFU L;  3QB5 A;  3CQC B;  2GK9 A;  4LF5 T;  3SS1 A;  4IDN A;  4DV7 T;  4A5X A;  2EHO D;  2X0Y A;  3M3Z B;  5FMN A;  1KF6 A;  1SUM B;  5IHY A;  4EOZ B;  1QUU A;  3SFE A;  4EZH A;  2J47 A;  2WY2 A;  4AKR B;  4KHZ F;  4O4I E;  4O4H E;  2IIU A;  2YIN A;  3WSC A;  2VVS A;  2C5K T;  2C5I T;  2CA5 A;  4X1K E;  3RQU A;  4LFC T;  3K3N A;  3CML A;  3TLS A;  3NKZ A;  1ZEE A;  4Z8X A;  4TWD A;  3ZSS A;  2JQQ A;  4KHP T;  4IDZ A;  4PK4 A;  4ZXL A;  4IHJ E;  2BVL A;  4CZZ B;  3PUY F;  2NW8 A;  3EVY A;  3DJB A;  2LOP A;  2V7L A;  3Q5D A;  2XZE A;  3NRX A;  2WZH A;  3LSV A;  4JUY A;  2LLY A;  4IST A;  2X9H A;  4QWN B;  5LNK A;  5HXR A;  4FI5 A;  5EK4 A;  2LM9 A;  4O8S A;  1OED E;  3CVR A;  2D2S A;  2W67 A;  3ZPO A;  1D0Z A;  2XAJ B;  3C4W A;  2KZ7 B;  2MAW A;  3NZQ A;  2ODV A;  3WUR A;  3LBX B;  2WCA A;  3OJA A;  1MMD A;  1SJ8 A;  5HYA A;  4NXM T;  3AVR A;  4UEM A;  2YDR A;  2FJD A;  4BJN A;  2LSG A;  2CHN A;  3BQL A;  3HL6 A;  3AE8 A;  2RA1 A;  4HFB A;  4A98 A;  1HX1 B;  4UIG A;  4QXH B;  2Q9Q D;  5LBM A;  2QYW A;  4EXT A;  1XMQ T;  4O2A E;  4TWF A;  2E9X C;  3JAF A;  1JNZ A;  5EK3 A;  3DP7 A;  2HN1 A;  3UUB A;  5L4E A;  3UQ4 A;  4ILA A;  4PFO A;  2KSR A;  1KFY A;  3RYI E;  4HN9 A;  2WDR A;  2H88 A;  5L3F B;  1NEN A;  2IW5 B;  3RHW A;  3LK4 2;  2BG9 E;  2HN2 A;  4PFP A;  2CWO A;  2K5B B;  2VKJ A;  3OVU A;  3VHL A;  3LJC A;  4GYR A;  2LSY A;  4ZZC A;  3MZK B;  5L4H A;  2V6X A;  1HG5 A;  2MYS A;  2HH7 A;  4UV8 B;  5ABF A;  4ZS3 A;  2LKG A;  4O2B E;  4JI1 T;  2DWK A;  2LHR A;  5LJN A;  3KFW X;  1O3X A;  2ES0 A;  2W00 A;  4IL9 A;  3CIR A;  4HWD A;  1IJ5 A;  1WFD A;  5LHH B;  1UX5 A;  4LFA T;  5HEH A;  5FL0 A;  1D1A A;  4ILB A;  4PJL A;  3RRW A;  1FJG T;  2ODU A;  2LKH A;  2WBL A;  5L3C B;  3PUX F;  4HEA A;  3ZMV B;  2X9Y A;  4AI6 A;  4KI0 F;  4AKL A;  4ZHQ E;  3QOF A;  4QXB B;  3A7M A;  4DBQ A;  3P4W A;  4DR4 T;  2E9X A;  3BK9 A;  4DV4 T;  3P7I A;  3AE9 A;  5J2U E;  5DAB A;  3JAE A;  5A1L A;  1LVF A;  4UF0 B;  4GKK T;  4OYK A;  2WSS V;  2VK9 A;  4DR2 T;  4O4J E;  2DLR A;  1OED B;  3AAI A;  4IDP A;  2X66 A;  2KGX A;  2Q9Q A;  3AEB A;  4DR5 T;  4PAG A;  4ISS A;  4I4T E;  1XMO T;  2XAF B;  5F5W A;  5FY1 A;  1U4Q A;  4ZI2 D;  4EIW A;  2UXD T;  2I59 A;  1N32 T;  1V9D A;  3LG7 A;  5LYJ E;  2VVN A;  2XSA A;  3AEA A;  4YTM A;  4HTE A;  4YTP A;  1FIO A;  3RC3 A;  4L5G A;  2BS3 A;  4NIQ A;  3AED A;  2IHR 1;  5T1D A;  3HKB E;  4KBM B;  1HNZ T;  2VB6 A;  5JH7 E;  1GQE A;  1D1B A;  2VQF T;  3RIF A;  1FMV A;  4TV8 E;  2XJ7 A;  2D0T A;  3GN5 A;  5JVD E;  2Y8D A;  4WW0 A;  5JR9 B;  4AKG A;  3RH3 A;  2MOZ A;  4ILC A;  5ADX L;  3WI3 A;  5E0O A;  2XQ8 A;  4DMW A;  4YSZ A;  1VOM A;  5ABH A;  2XAQ B;  2BBJ A;  2A9U A;  4Z91 A;  5KMG P;  2RP4 A;  2XQ3 A;  4F6R C;  3ZLI A;  4EAH A;  2CXL A;  2KND A;  3N9N A;  5JRC B;  3AEG A;  4JI7 T;  5FXV A;  1ZP0 A;  4HE8 A;  2V6Y B;  2WB5 A;  3W15 B;  2LSI A;  3KVB A;  5F3J A;  4HFE A;  3DYJ A;  2N9D A;  1Z8U A;  2XQ7 A;  3UQ7 A;  2XQ6 A;  4U33 A;  3CPZ A;  2WP9 A;  2BZB A;  5AQV B;  1D0X A;  4DV6 T;  4COF A;  3N9O A;  1Z0P A;  1WR6 A;  3ZT6 A;  2NWB A;  3AA1 B;  1XNQ T;  2QVA A;  3PUZ F;  4CXX A;  4TN7 B;  3ZEF B;  3ANW B;  4MLK A;  1T98 A;  4DR1 T;  3FZH B;  1HS7 A;  2ZM2 A;  1AJ3 A;  3P4R A;  1QSD A;  3VKG A;  5FP3 A;  3C51 A;  2WS3 A;  3PJA J;  2J4G A;  5LGU B;  2V5D A;  3PUQ A;  3F2E A;  4AQG A;  3AE4 A;  3ESL A;  1XDO A;  4B6X A;  1KNR A;  3UU8 A;  3TLW A;  2V8S V;  3NWI A;  5IWA T;  4JEU B;  3AT7 A;  5FVL A;  2C0S A;  4U7Y A;  4U74 A;  3TLV A;  5AQH B;  2K48 A;  5JDF A;  2BS4 A;  2SPC A;  1KNP A;  4DR3 T;  1HG2 A;  4ANJ A;  2WWV A;  3T8O A;  2VKO A;  1W9R A;  1VCT A;  3UU5 A;  4CXW A;  2CBJ A;  2CXD A;  2DNX A;  3NVO A;  2ZM0 A;  2WMO A;  3ZMT B;  2MPK A;  4DR7 T;  5LA6 E;  5JDH A;  2JRK A;  3HR0 A;  1UK5 A;  5FXZ A;  2V26 A;  1UCU A;  5JTG A;  3P8C D;  3LBX A;  1UUR A;  3B5M A;  3OKQ A;  3OPC A;  1E7P A;  4HWC A;  3Q2M A;  4H9N C;  3T1H T;  3ZCJ A;  3VR9 A;  3RRC A;  5HEO A;  2ACZ A;  4IRE A;  2Y6X A;  4JI8 T;  3IA3 A;  4B3R T;  2L10 A;  5AQG B;  3ZYK A;  4PK5 A;  4ADZ A;  4O4L E;  1W0A A;  3IEE A;  1DU2 A;  2M67 A;  3QNU A;  4HKA A;  5HCJ A;  2KLQ A;  4UR9 A;  3FZM B;  2EHO C;  3ZT5 A;  2BDE A;  3MJX A;  4DR6 T;  3FB2 A;  2JQK A;  3LK2 B;  3PF0 A;  5HWX A;  4IE6 A;  3VRB A;  2YN6 A;  4BJM A;  2MTQ A;  3JCF A;  4E7S A;  3PJA A;  5HEG A;  3WAK A;  2LM2 A;  3ZJ2 A;  3O4X E;  3MKD A;  3AE3 A;  3K3Q C;  4HFV A;  2LQU A;  2B76 A;  5LMU T;  4U3C A;  2XAG B;  4HFC A;  4CI1 B;  3HKE E;  2V7M A;  3O1H A;  5JDL A;  3FXE B;  3ZC1 A;  4Q25 A;  3VR8 A;  4ZI7 E;  5FKY A;  3JC6 D;  1HF8 A;  3AXJ B;  4YLH A;  1HR0 T;  4H63 V;  1CUN A;  2OA5 A;  2V1D B;  4YHJ A;  3UFG A;  3N9P A;  5AQS B;  2RPA A;  2CLY B;  2XHE B;  1OWA A;  3AAE B;  3RX6 A;  4H63 H;  3FBZ A;  1HX8 A;  3UU3 A;  3AEC A;  3N9M A;  2IML A;  2X0L B;  3VRA A;  2J1D G;  2XM1 A;  1MIY A;  2KBB A;  4H9S E;  4UVA B;  2UXB T;  2CPT A;  3FHN A;  4HFI A;  1UGO A;  4X5T A;  2WWU A;  2EHO A;  4IE5 A;  2YOE A;  4PK6 A;  4HGA A;  4WYV A;  4H9P C;  3UFE A;  4YXD A;  4X1I E;  2Q9Q C;  3EUH A;  3N9L A;  4DBR A;  3AA0 B;  4YY3 T;  3N2G E;  2LEH A;  4JLE A;  5JQG E;  3RKG A;  2OV9 A;  1B7T A;  4C91 A;  2G0U A;  3RIU A;  5AQL B;  2XAS B;  4XZC A;  3UU6 A;  5J2T E;  4B3T T;  5F8P A;  1NWM X;  4H9O C;  3EI0 A;  2QGS A;  1X79 A;  4CI2 B;  2VKH A;  3C64 A;  3ZN1 B;  4NUV A;  1QLB A;  3E08 A;  2VAS A;  3D0T A;  3AEE A;  4BGO A;  1HTJ F;  2NR4 A;  3JAD A;  2V7K A;  2CEA A;  2JJ9 A;  2QA7 A;  1YQ3 A;  5J0Z A;  3I1A A;  5BMV E;  5LP6 E;  3ZST A;  5JDN A;  4L9I A;  4JI6 T;  2F4V T;  4CXY A;  2BKN A;  3GA8 A;  2XTL A;  4EYY R;  2L8K A;  3PUG A;  3R6N A;  4WBN E;  3ONJ A;  3K1S A;  5JR9 A;  2Z6E A;  4TNV A;  3AE5 A;  4MFR A;  2HHH T;  2H7O A;  3L3P A;  2ACX A;  4ZOL E;  4OHF A;  3ZKR A;  2UUA T;  2P9B A;  5H6Q B;  2L3L A;  5L3B B;  2MTC A;  4QX8 B;  4AXP A;  3FZL B;  4DND A;  5LJM A;  1J5E T;  2UUC T;  1ZKE A;  4I55 E;  3EDV A;  1J5W A;  1BR0 A;  2VQE T;  1H7C A;  2UXX B;  2KWH A;  2H3R A;  5LGN B;  2W63 A;  5HCM A;  3RYH E;  4IGU A;  5JRC A;  3RF1 A;  3LDQ B;  3VJZ A;  4DV0 T;  3ONL C;  2CE7 A;  1KNZ A;  5KX5 E;  1IZN B;  4C90 A;  4OFZ A;  3MAC A;  3MA9 A;  2ZM8 A;  3WAJ A;  2IUB A;  4ZI3 D;  1S94 A;  4AIS A;  4ZZB A;  2B1E A;  2K24 A;  4YT0 A;  1YQ4 A;  2NOX A;  1LVK A;  5AQJ B;  3RQW A;  2FUP A;  2DL1 A;  3HA4 A;  4QH5 A;  4ZEY A;  3Q5W A;  5AQF B;  5AQR B;  5LB7 B;  3QB5 K;  4ZI2 C;  2LRL A;  4YSX A;  3FZK B;  4GOU A;  1E1H B;  3IBP A;  5CGM A;  4PJM A;  4LF6 T;  3ZYL A;  2D9D A;  4OYJ A;  2BVM A;  1UUS A;  3PV0 F;  3A8Y C;  1FMW A;  5L3E B;  2V5C A;  5FL1 A;  5L2L A;  1MMA A;  2BG9 B;  4N78 D;  1CHU A;  5DJQ C;  4AQF C;  1IBL T;  4QKN A;  2XQ5 A;  1EZ3 A;  4EV6 A;  3C98 B;  4H9R C;  1W09 A;  4NXN T;  4P1N A;  1E2A A;  2D5U A;  4JI2 T;  2H89 A;  3O1I A;  2ZM6 T;  4KUM B;  2WM9 A;  3NRY A;  3F57 A;  3H3M A;  2WU5 A;  2CBI A;  2PG8 A;  3Q9D A;  4A97 A;  1KK7 A;  3EDU A;  1WR0 A;  4IL4 A;  4TUY E;  4DV3 T;  1NEK A;  2XQ4 A;  4QXC B;  3V5U A;  4OX9 T;  4BA9 A;  2JQ9 A;  4CN4 A;  4X20 E;  5FXW A;  2UUB T;  3J9X 1;  2WMN A;  3KBT A;  4A56 A;  5LBQ B;  3CWZ B;  3CX6 B;  3RI5 A;  2C5J A;  2NTX A;  3AA7 B;  1W0B A;  2D0U A;  2CLY C;  1US7 B;  3RIA A;  4YHH T;  3GN5 B;  1HNW T;  5C2T A;  5LHG B;  3PUV F;  3U3I A;  5LXT E;  5AQK B;  5JDQ A;  4DID B;  4ERR A;  1IBM T;  1D0Y A;  2IC9 A;  4BAY B;  1R8I A;  5DQW A;  3FXD B;  4GIW A;  5GON E;  2NTY A;  4UVC B;  4U7I A;  4LF7 T;  2W4X A;  4IE4 A;  1YKH B;  1N34 T;  3NBX X;  3MXZ A;  3SFD A;  4UXN B;  3UUL A;  4AQF A;  2W61 A;  2KVP A;  3S4U A;  5AQN B;  5KDM C;  1MMN A;  4TZ4 C;  3L8R A;  3F31 A;  5HWY A;  2FJA A;  1LRZ A;  3T1Y T;  5JDG A;  2DCF A;  3CK6 A;  2N2N A;  4LFB T;  4B3S T;  1BR1 A;  2A72 A;  3UU4 A;  5HXE A;  4CI3 B;  4EZ4 A;  1N36 T;  4MAL A;  1T8B A;  3RPU A;  2E5L T;  4WNK A;  4AQY T;  1SJ7 A;  3UT5 E;  3PHF 1;  3N2O A;  2MBG A;  4GK5 E;  4LMJ A;  3ZT7 A;  3OBV E;  2XM2 A;  4YJ3 E;  3AXJ A;  4IIJ E;  2PBI A;  4X65 T;  3U78 A;  5C3J A;  3CKD A;  3O1J A;  2YK0 A;  3H3A A;  4V1A v;  3EAM A;  4XAX B;  3AVS A;  1WYB A;  5LOV E;  2YU2 A;  3C4X A;  3ABV A;  3ZMS B;  3AEF A;  1BR2 A;  4IDO A;  2FJB A;  4ECG A;  2ZLY A;  2UXC T;  2YU1 A;  2W0G A;  3RKO A;  4DUY T;  5FZT A;  3GMI A;  3UUX B;  5L3D B;  2NP9 A;  3PTR B;  3RYC E;  4JI0 T;  4K0U A;  3PUR A;  2CCQ A;  2VL8 A;  4LMK A;  5HXH A;  1OED C;  3IHR A;  5M4Y A;  2DHR A;  3QC9 A;  2V7J A;  3KIN B;  3RIU C;  3FBL A;  4MBQ A;  4X64 T;  2WDQ A;  3IF8 B;  3C4Z A;  2LT3 A;  4KMC A;  1Y64 B;  2L7N A;  4ZS2 A;  1KEY A;  2E8I A;  1XZY A;  4AKH A;  4I0U A;  2Y48 B;  4U31 A;  5JRE A;  2W2U A;  2KT9 A;  3PE0 A;  1WCR A;  3ZYM A;  5KXJ A;  2NW9 A;  2LRK A;  2BBH A;  4F8H A;  4P0B A;  4UVB B;  4AIU A;  2LSK A;  2E9X D;  2CWY A;  4J2C A;  2N1G A;  2VWA A;  2DWG A;  3ZMU B;  1T72 A;  3J7Y q;  4AKI A;  1OXZ A;  4DUZ T;  4JI5 T;  4KX6 A;  4E7Z A;  3HI2 A;  2XSB A;  4YTN A;  3AE6 A;  2JMK A;  4Z90 A;  5LG4 A;  4EYU A;  3ONX A;  5JR9 C;  4NUU A;  2WDV A;  3TKL B;  2M6B A;  1Y01 A;  1IBK T;  3AE1 A;  3JC6 C;  3FZF B;  1WLX A;  4ONR A;  2BS2 A;  3BQK A;  1MIV A;  2FBW A;  4P0A A;  2PFV A;  2JQH A;  3H37 A;  3KV6 A;  3AA6 B;  5HAX A;  2AXD S;  2BG9 C;  3KV9 A;  4QX7 B;  4WZX A;  4EEB A;  3V5S A;  1FEW A;  1HCI A;  2AE9 A;  2V7I A;  2IC6 A;  1BR4 A;  5AQI B;  4P09 A;  4U2Y A;  4UF0 A;  2I6H A;  2X9W A;  4U2Z A;  4GYS A;  1LKX A;  4G2A A;  1OED A;  3LFM A;  3RGL A;  4YSY A;  3ZMZ B;  3NZP A;  2DI4 A;  2X0C A;  2CMR A;  2KXP B;  4TX5 A;  2X68 A;  3UTK A;  1ZHC A;  5FY7 A;  5LHI B;  4X1Y E;  3HKC E;  3ZJ1 A;  3LK3 B;  3PUA A;  3RLF F;  1I94 T;  3HKD E;  3RC8 A;  5FY0 A;  1U5P A;  2HPL A;  1JNR A;  2XQY A;  4LF8 T;  1HNX T;  3L09 A;  5LG3 A;  4TNW A;  5AQT B; 
#chains in the Genus database with same CATH homology
 1D0Z A;  4H9Q C;  4UV9 B;  2XAJ B;  2SPC A;  1FMW A;  5L3E B;  3C4W A;  2KZ7 B;  5L2L A;  3NZQ A;  1MMA A;  2ODV A;  3WUR A;  2HPJ A;  1HG2 A;  4N78 D;  5DJQ C;  4ANJ A;  3LBX B;  4AQF C;  3OJA A;  3T8O A;  1MMD A;  2VKO A;  3A5X A;  3AAA B;  4QKN A;  1YKE B;  2K9A A;  3SRZ A;  4CXW A;  1EZ3 A;  3C98 B;  4H9R C;  5HYA A;  3ZC0 A;  2CXD A;  2DNX A;  3AVR A;  3ETU A;  4UEM A;  2ZM0 A;  3I0O A;  2WMO A;  4KP3 C;  3K8P C;  5DQV A;  4BJN A;  2LSG A;  3ZMT B;  3BQL A;  5LA6 E;  5JDH A;  2JRK A;  2D5U A;  3HL6 A;  2RA1 A;  3O1I A;  3HR0 A;  4YFS A;  4KUM B;  2V26 A;  2WM9 A;  5FXZ A;  2LSJ A;  1UCU A;  3NRY A;  3F57 A;  2PG8 A;  4UIG A;  2EHO B;  3P8C D;  5JDM A;  3Q9D A;  4QXH B;  3LBX A;  1KK7 A;  1IJ6 A;  4TV9 E;  2Q9Q D;  5LBM A;  3EDU A;  2H7V C;  4EXT A;  4O2A E;  3I0Q A;  4TUY E;  3OKQ A;  2E9X C;  2UXN B;  5EK3 A;  3DP7 A;  5EZY E;  2X67 A;  3Q2M A;  4QXC B;  3UUM A;  4H9N C;  3V5U A;  3Q5X A;  2IAK A;  5IYZ E;  3ZCJ A;  2ZMA A;  4BA9 A;  4X20 E;  2XAH B;  4PFO A;  3RRC A;  5FXW A;  3VU7 H;  3J9X 1;  2WMN A;  2L9Q A;  3KBT A;  3E22 E;  4A56 A;  5LBQ B;  3CWZ B;  2Y6X A;  3RYI E;  4PJN A;  4IE7 A;  3CX6 B;  2KIN B;  4DVD A;  4HN9 A;  1G8X A;  2C5J A;  3GWH A;  4QHO A;  2CXF A;  5L3F B;  3CQG B;  2IW5 B;  3CX7 B;  2NTX A;  3ZYK A;  4PK5 A;  3AA7 B;  3LK4 2;  4ADZ A;  3R84 B;  4O4L E;  4UEL A;  2D0U A;  3I9Y A;  3IEE A;  2M67 A;  2CLY C;  1US7 B;  4HKA A;  3B57 A;  4PFP A;  5L3G B;  2KLQ A;  2CWO A;  2K5B B;  1WRD A;  4PJJ A;  2EHO C;  2VKJ A;  3VHL A;  2BDE A;  2A3D A;  3GN5 B;  3MJX A;  2NW7 A;  3FB2 A;  1VRB A;  3AB3 B;  3LJC A;  4GYR A;  2LSY A;  5LHG B;  3U3I A;  1G73 A;  5LXT E;  3MZK B;  3LK2 B;  3PU3 A;  3PF0 A;  5HWX A;  1HG5 A;  2MYS A;  4IE6 A;  4U72 A;  5JDQ A;  2HH7 A;  4UV8 B;  4ERR A;  5EK2 A;  1D0Y A;  2IC9 A;  4ZS3 A;  4BAY B;  4BJM A;  2MTQ A;  3ANW A;  4O2B E;  4E7S A;  3N9Q A;  5DQW A;  2KMF A;  2PJQ A;  3WAK A;  3FXD B;  4GIW A;  2DWK A;  5GON E;  2LHR A;  1UX4 A;  5LJN A;  2NTY A;  3ZJ2 A;  3O4X E;  4I50 E;  4UVC B;  3KFW X;  1O3X A;  2ES0 A;  2LOS A;  3K3Q C;  2W00 A;  3MKD A;  3QUJ A;  4IE4 A;  4HFV A;  3E0Z A;  4ZI3 C;  2LQU A;  1YKH B;  1IJ5 A;  5LHH B;  1UX5 A;  2KWI B;  3NBX X;  3KDS E;  3BQI A;  3MXZ A;  3UUL A;  4UXN B;  4AQF A;  2XAG B;  4CI1 B;  2W61 A;  3S4U A;  3HKE E;  2V7M A;  2E9X B;  1D1A A;  1MMN A;  3O1H A;  4TZ4 C;  5JDL A;  5KDM C;  3F31 A;  3FXE B;  3ZC1 A;  4CQI A;  4PJL A;  4GK0 E;  3RRW A;  5HWY A;  5FNV E;  2YEV C;  2ODU A;  5TAO A;  2WBL A;  4ZI7 E;  1SHZ C;  3OYX A;  1LRZ A;  5JDG A;  2DCF A;  5L3C B;  4MHC A;  3JC6 D;  1MMG A;  2N2N A;  1HF8 A;  3M65 A;  4HEA A;  4YLH A;  1BR1 A;  3ZMV B;  2X9Y A;  4AI6 A;  4L0R A;  2A72 A;  4H63 V;  4AKL A;  4ZHQ E;  5HXE A;  4CI3 B;  1HFA A;  4EZ4 A;  4MAL A;  1CUN A;  3RPU A;  2OA5 A;  4QXB B;  4EB6 E;  2JMH A;  2V1D B;  4YHJ A;  3CX8 B;  4WNK A;  3UT5 E;  3PHF 1;  5ETW A;  4DBQ A;  2LJL A;  3N9P A;  4PNI A;  4ILU A;  2E9X A;  3BK9 A;  3N2O A;  2CLY B;  5CB4 E;  2XHE B;  2Q9Q B;  2MBG A;  1OWA A;  3KV4 A;  4GK5 E;  3AAE B;  3RX6 A;  4H63 H;  3FBZ A;  3P7I A;  1HX8 A;  3OBV E;  5CA1 E;  5J2U E;  3QK6 A;  3N9M A;  4YJ3 E;  5DAB A;  3O9X A;  3PU8 A;  4G63 A;  4IIJ E;  1MIW A;  2X0L B;  3ZN0 B;  5A1L A;  1LVF A;  2PBI A;  4UF0 B;  3U78 A;  4OYK A;  2WSS V;  4M1P A;  2J1D G;  2VK9 A;  3CKD A;  1MIY A;  4H9S E;  4UVA B;  3O1J A;  3FHN A;  2YK0 A;  3N5L A;  1YW0 A;  3H3A A;  4V1A v;  3PDY A;  4O4J E;  3C50 A;  3AVS A;  1WYB A;  4JEH B;  4XAX B;  2DLR A;  4I43 B;  5LOV E;  1S35 A;  2LHN A;  3AAI A;  3PUS A;  1YD8 G;  2X66 A;  2YU2 A;  3I9W A;  3C4X A;  3M1C A;  5FYM A;  2Q9Q A;  3VKH A;  4PAG A;  4ISS A;  4I4T E;  2WWU A;  2EHO A;  3ZMS B;  5C8Y E;  4IE5 A;  4PK6 A;  2XAF B;  3KVA A;  2WAU A;  4HGA A;  1BR2 A;  4H9P C;  5FY1 A;  1U4Q A;  5LCY A;  1ZV4 X;  4ZI2 D;  4EIW A;  4ECG A;  3UFE A;  2XUE A;  2I59 A;  2ZLY A;  2YU1 A;  4X1I E;  1MND A;  1V9D A;  2Q9Q C;  2W0G A;  3LG7 A;  5LYJ E;  3RKO A;  3EUH A;  3MK7 C;  3N9L A;  4DBR A;  3AA0 B;  1MNE A;  3N2G E;  2LEH A;  4JLE A;  3B13 A;  5JQG E;  3GMI A;  3UUX B;  4HTE A;  3RYF E;  5H6R B;  1B7T A;  4C91 A;  5L3D B;  1FIO A;  2NP9 A;  3PTR B;  5J1G A;  3RYC E;  3RC3 A;  4L5G A;  2G0U A;  1NAF A;  3N2K E;  4K0U A;  4DO0 A;  3PUR A;  2CCQ A;  2XAS B;  4XZC A;  5T1D A;  2VL8 A;  3HKB E;  4KBM B;  5HXH A;  1SA0 E;  5J2T E;  2VB6 A;  5JH7 E;  5F8P A;  1NWM X;  3CQX C;  1D1B A;  3IHR A;  4H9O C;  3SOL A;  2DHR A;  3ZCI A;  4DMV A;  2W62 A;  2QGS A;  2V7J A;  3QC9 A;  5M4Y A;  1FMV A;  3KIN B;  4TV8 E;  1X79 A;  3FBL A;  4MBQ A;  2VKH A;  3C64 A;  2LE8 A;  4ASK A;  4CI2 B;  3ZN1 B;  3IF8 B;  2D0T A;  2LT3 A;  3C4Z A;  3GN5 A;  4NUV A;  4KMC A;  1Y64 B;  3E08 A;  5JVD E;  2VAS A;  3DTO A;  2Y8D A;  4ZS2 A;  3D0T A;  2X9X A;  1HTJ F;  2E8I A;  4BGO A;  2CM0 A;  4WW0 A;  4AKH A;  5JR9 B;  2Y48 B;  4IE0 A;  2V7K A;  5JRE A;  1IAP A;  2KT9 A;  4AKG A;  3RH3 A;  2CEA A;  3PE0 A;  2A2F X;  2JJ9 A;  2MOZ A;  4WBO A;  3ZYM A;  4YJ2 E;  2QA7 A;  3I1A A;  5BMV E;  5ADX L;  2NW9 A;  1WYC A;  5LP6 E;  2JPF A;  3WI3 A;  5E0O A;  4P0B A;  4DMW A;  4UVB B;  1VOM A;  5FXX A;  4L9I A;  5JDN A;  3SWH A;  5HXS A;  2XAQ B;  5HXC A;  2LSK A;  3OYZ A;  2E9X D;  5KMG P;  2RP4 A;  1D1C A;  4CXY A;  3GA8 A;  2CWY A;  4OK0 A;  2XTL A;  4F6R C;  4EYY R;  2L8K A;  3UUN A;  3ZLI A;  5CA0 E;  4J2C A;  3KBU A;  3PUG A;  3R6N A;  4WBN E;  2N1G A;  2VWA A;  4EAH A;  5JR9 A;  2DWG A;  3ZMU B;  2Z6E A;  3K3O A;  3J7Y q;  4MFR A;  5LGT B;  2CXL A;  4AKI A;  2X51 A;  3KV5 A;  4PW8 A;  2H7O A;  3L3P A;  2ACX A;  2KND A;  1OXZ A;  4ZOL E;  3N9N A;  4OHF A;  5JRC B;  2P9B A;  5FXV A;  5H6Q B;  2L3L A;  4HE8 A;  3HI2 A;  4FJO A;  4E7Z A;  5L3B B;  3ETV A;  5LG4 A;  2JMK A;  2MTC A;  4EYU A;  3W15 B;  3ONX A;  4XBF B;  2LSI A;  3KVB A;  4NUU A;  5JR9 C;  3TKL B;  4QX8 B;  2VKD A;  5F3J A;  4AXP A;  3JC6 C;  5AFU L;  1WLX A;  4DND A;  4ONR A;  2N9D A;  3BQK A;  3CQC B;  5LJM A;  2GK9 A;  1MIV A;  3SS1 A;  1ZKE A;  4I55 E;  4P0A A;  2PFV A;  2EHO D;  3CPZ A;  3EDV A;  2BZB A;  3H37 A;  1BR0 A;  5FMN A;  1H7C A;  3KV6 A;  2UXX B;  3AA6 B;  1D0X A;  5HAX A;  2KWH A;  5IHY A;  4EOZ B;  2H3R A;  5LGN B;  2W63 A;  3RYH E;  3KV9 A;  4IGU A;  3N9O A;  4QX7 B;  1QUU A;  5JRC A;  1Z0P A;  4EZH A;  3V5S A;  1FEW A;  1HCI A;  2V7I A;  3VJZ A;  2IC6 A;  1WR6 A;  1BR4 A;  2NWB A;  3AA1 B;  2CE7 A;  4P09 A;  1KNZ A;  5KX5 E;  4AKR B;  4O4I E;  4UF0 A;  1IZN B;  2X9W A;  4C90 A;  4GYS A;  4O4H E;  4OFZ A;  3MAC A;  4CXX A;  1LKX A;  4G2A A;  2YIN A;  4TN7 B;  3ZEF B;  3ANW B;  3MA9 A;  4MLK A;  2ZM8 A;  3WSC A;  3WAJ A;  1T98 A;  2C5K T;  3LFM A;  2C5I T;  4ZI3 D;  1S94 A;  1HS7 A;  2CA5 A;  2ZM2 A;  1AJ3 A;  4X1K E;  1QSD A;  3VKG A;  3ZMZ B;  3NZP A;  2B1E A;  2DI4 A;  2K24 A;  3K3N A;  3CML A;  5FP3 A;  3C51 A;  2CMR A;  2KXP B;  2NOX A;  1ZEE A;  1LVK A;  4Z8X A;  4TX5 A;  2JQQ A;  4IDZ A;  4PK4 A;  2X68 A;  5LGU B;  3UTK A;  3HA4 A;  3Q5W A;  4IHJ E;  2BVL A;  1ZHC A;  3PUQ A;  3F2E A;  4CZZ B;  2NW8 A;  3EVY A;  5FY7 A;  4AQG A;  3DJB A;  2LOP A;  4ZI2 C;  3ESL A;  5LHI B;  2V7L A;  4X1Y E;  3HKC E;  4B6X A;  3ZJ1 A;  3LK3 B;  3NRX A;  3PUA A;  4JUY A;  4GOU A;  4IST A;  2X9H A;  4QWN B;  3HKD E;  5LNK A;  5HXR A;  1E1H B;  3IBP A;  4FI5 A;  4JEU B;  3AT7 A;  5EK4 A;  2LM9 A;  3RC8 A;  5FY0 A;  4O8S A;  4PJM A;  1U5P A;  2HPL A;  3CVR A;  2D2S A;  2XQY A;  3ZYL A;  2C0S A;  3L09 A;  4U74 A;  3ZPO A;  4OYJ A;  2K48 A;  2BVM A;  5JDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...