5JDHA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 10 mm na+ and 10mm ca2+
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
Knots found
sequence length
301
structure length
297
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Uncharacterized membrane protein MJ0091
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
total genus 123
structure length 297
sequence length 301
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdhA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdhA02
5HXRA 5HXHA 5HXSA 5HXEA 5JDLA 5JDMA 5JDQA 5HXCA 3V5SA 5HWXA 3V5UA 5JDHA 5JDNA 5JDFA 5JDGA 5HWYA 5HYAA
chains in the Genus database with same CATH superfamily
3CKDA 2NTYA 3K8PC 2M6IA 2CRBA 5LJNA 2XQ9A 1VCSA 2ZM6T 2IMLA 5HEOA 3EDVA 3UFEA 4BJMA 2QGSA 1XDPA 3HKBE 1XNRT 5AQQB 2XAFB 5AQTB 3NKZA 5KXJA 2X9XA 4QH1A 1YD8G 4LF4T 3AA0B 4CI2B 1ZEEA 4ZXLA 4BAYB 3Q5DA 4WBNE 2NP9A 4JI1T 1SE7A 3VR8A 5DABA 3C98B 3CQXC 4UVCB 4CXXA 3N2OA 2DWKA 4IE7A 3PDYA 2WWUA 4YFSA 4B3ST 4AKHA 3ZMVB 2L9QA 4IL4A 2BDEA 2DL1A 3UTKA 2A2FX 1IJ5A 1MIWA 3KVBA 5HCMA 4PJLA 2X9WA 1XNQT 4OFZA 3AEAA 3VRAA 3CX7B 5FMNA 3G06A 1J5ET 4U74A 2KBBA 2PFVA 1HG5A 3DYJA 1BR0A 4AXPA 5ABHA 2SPCA 1IBMT 3KV5A 2XQAA 3ZCIA 4HE8A 1YQ4A 2BG9A 2NW8A 2YDQA 1D1BA 4DR1T 5AQLB 4IE5A 4DV0T 2LE8A 5ABFB 1W9RA 3IF8B 2EHOC 1WYBA 4DR2T 3VJZA 3LG7A 3MA9A 2A9UA 3KV6A 3PE0A 5ADXL 2ES0A 1UK5A 2LT3A 2CXLA 2WY2A 2LHNA 2IW5B 2XASB 2B76A 2W00A 1HS7A 4OK0A 5FY7A 4DMWA 3AE7A 5AQHB 3LSVA 3OPCA 1SJ8A 2JMHA 3ANWB 1IJ6A 2N1GA 3RGLA 4X1IE 1QSDA 4H63V 4OX9T 4UR9A 1LVKA 3FBLA 3ZC1A 2WDVA 2VQET 2V1DB 3RYIE 4JYAT 3PUVF 4X5TA 4JI2T 3WAJA 4IDZA 2X0YA 4LFAT 1QUUA 2X0CA 4ECGA 2KZ7B 2VK9A 3ABVA 3ZMUB 2V7KA 3ZMSB 3UQ7A 3JADA 4CXYA 4HN9A 3CQCB 2IUBA 1O3XA 3B13A 3UU4A 2XJ7A 4WW0A 5JDNA 3N9LA 2LSJA 4PK6A 1HCIA 2BVLA 3AT7A 4Z90A 2YKSA 1XMOT 2KLQA 4B3MT 4AKRB 5AQIB 3VKHA 4JI5T 4DIDB 3L8RA 3SRZA 3AAAB 4EYYR 1W0BA 2XQYA 2DNXA 4DBQA 1MMGA 2CA5A 2JQ9A 3PUAA 2BKPA 2X51A 5LMNT 3ZN1B 2XZEA 3PV0F 2H88A 4JUYA 1UX5A 5LG4A 3MXZA 2IHR1 4B3RT 1WR0A 2BG9B 4X66T 4YHJA 4LF6T 1CUNA 3FBZA 4P1NA 5L4HA 2LSKA 4IHJE 1OEDB 2E9XC 5LBMA 4JV5T 3Q2MA 3U3IA 4IIJE 3KVAA 1WCRA 4JI4T 1IZNB 4X65T 5LYJE 1KF6A 1MNDA 2J1DG 1FEWA 3DP7A 3EI0A 2YOEA 2Y48B 3HKDE 3PHF1 4E7SA 2Y8DA 5J2TE 2UUBT 5JDFA 2VKOA 2XY8B 2CHOA 3LJCA 2XHEB 2RP4A 2Q9QD 2W67A 4HFEA 2C5KT 1HX8A 2BBHA 3AXJA 5JDGA 4X64T 4I4TE 4QHOA 4H9NC 3UUNA 4HGAA 4EZHA 1KNZA 3PU8A 2A72A 2UU9T 2J62A 1WFDA 3ONJA 4HKAA 3UT5E 2M67A 4KMCA 4CN1A 3ZSSA 2PG8A 1KNPA 3F2EA 4EIWA 1FIOA 4GK0E 2HH7A 4A56A 2LQUA 2JQQA 4DMVA 3N2GE 5LHGB 3AE2A 3N2KE 3EDUA 2Y6XA 2E2AA 2QVAA 5AQJB 4I43B 4LMLA 5FKYA 2DHRA 5CB4E 4AQGA 4O4IE 5HAXA 5HEUA 2K48A 2KXPB 4E7ZA 4TWFA 4IREA 5CJ5A 3AVSA 3PUQA 3PJAJ 4AKIA 1N36T 3FZKB 1D1CA 3ZMZB 5FL1A 3Q5XA 4U72A 3VRBA 3ZPOA 4UEMA 3UFGA 2WZHA 2JPFA 5ETWA 4UVAB 5LXTE 2LLYA 5LB7B 1CHUA 1D0XA 3AE3A 4ASKA 5AFUL 3PJAA 2CCQA 2OLTA 3B5MA 2HN1A 2VWAA 3EVYA 2YEVC 2ZMAA 2ZM0A 2ZM2A 3AA7B 2OA5A 2CWOA 4B3TT 3RHWA 2ZM8A 4GIWA 4ZI3D 2FBWA 5T1DA 5DQVA 2J47A 4IDPA 3EAMA 3O4XE 5FNVE 3ZC0A 1Z0PA 2CE7A 4J2CA 3BQKA 4AI6A 4BJNA 4H9RC 4DVDA 3PUZF 4PFOA 3LK42 2LRKA 2LKGA 3AE8A 4YTPA 1MIVA 5DJQC 5AQUB 2UXDT 3FZMB 4YHHT 3H3AA 3QK6A 2UXBT 5AQVB 2PBIA 5HXRA 2A3DA 2DLRA 3H3MA 1D1AA 4W8PA 4A98A 4JEHB 4P0BA 3AEDA 4LF9T 4GK5E 3ZT7A 4ERRA 2Z6EA 1MMNA 3AXJB 3MZKB 1J1JA 2W63A 3ZYMA 3WURA 2CWYA 4KUMB 1HNXT 2JMKA 3N9MA 3V5UA 1U4QA 5H6RB 1LVFA 3KV9A 5JR9C 1I6ZA 4NXMT 2BBJA 4HFIA 5H6QB 3NZPA 2W62A 2FJBA 3AA1B 4DBRA 2H7VC 4QH4A 3VR9A 3NRXA 3CPZA 4AQFA 2C0SA 4O4HE 3SFEA 3AB3B 2LM9A 4YJ2E 5EZYE 1HX1B 1HFAA 3AAIA 1XDOA 4JI0T 2RPAA 3O1HA 2RA1A 3RQWA 4CI1B 2GK9A 3B57A 4A97A 2VKDA 2MBGA 3OYXA 2LOPA 4NUUA 1KNRA 4TX5A 1WRDA 2VKHA 2W0GA 3DTOA 5JH7E 2WAUA 2HHHT 5JDQA 2XQ4A 2YDSA 3I1AA 4QKNA 1YW0A 1UX4A 2VASA 2BZBA 2HN2A 4QXBB 3SWHA 2NWBA 1L0VA 2L3LA 4KI0F 4F6RC 5JDLA 3RI5A 5L2LA 3GN5B 3QB5A 3CIRA 2ZLYA 3M1CA 2WWVA 2N9DA 3MKDA 5FZTA 4EEBA 4YT0A 2XSBA 1N34T 3TLVA 4DR7T 2D5UA 2BG9C 4FJOA 4TZ4C 2XQ5A 3PUWF 3ZEFB 2V8SV 1OEDA 5ABGA 4GYRA 4MALA 3E22E 2X68A 1HNWT 4AKLA 5L3DB 3SS1A 3UUMA 3N9PA 3VKGA 2WZIA 3LFMA 2Q9QC 4H9PC 3C50A 1UGOA 4DV2T 2EHOA 3O1JA 4ILAA 5AQRB 2VVSA 4AIUA 4HWHA 2M6BA 3H37A 2E8IA 4JI7T 2JJ9A 3F57A 5LGNB 2K3WA 3ETVA 4GOUA 3L39A 3RLFF 2BG9E 2UXNB 2ODVA 2WM9A 3UUXB 3CK6A 3NWIA 2BS2A 4TV8E 3OYZA 5IWAT 4OHFA 3AEBA 4WYVA 2XAHB 4X62T 3QC9A 1H7CA 4OYKA 3O9XA 2XQ3A 2LM2A 1MNEA 5LJMA 1OWAA 2E5LT 3FB2A 5HXCA 3JC6D 4IDOA 2IC9A 3V5SA 4JI6T 2FJAA 2LSIA 1N32T 3RC8A 4PK5A 4MBQA 4WNKA 4UV8B 3MACA 4IE0A 5JREA 4ZI3C 1EZ3A 5BMVE 2JQHA 2X66A 2CLYB 2CXFA 2NTXA 5LHHB 4NXNT 5HWXA 2DWGA 1ZV4X 5HEJA 4U33A 3ONLC 4WZXA 3RQUA 5J0ZA 3FZLB 5HYAA 2KMFA 4QXCB 2AXDS 2KSRA 1BR1A 2P9BA 3HR0A 3P4SA 2J4GA 3AEEA 3Q9DA 2BS4A 3R84B 4DV4T 3CMLA 5L3GB 3HI2A 4TV9E 5FVKA 5FY1A 5EK4A 5AQFB 1BR2A 3ZSTA 2ODUA 3FYQA 2EHOD 2EHOB 3W15B 4U2YA 3IEEA 2LSGA 3EHZA 5HEHA 5AQGB 3RYFE 1NAFA 5FVLA 3PURA 2D9DA 4AISA 4H9SE 4HFCA 3R6NA 4TN7B 4I55E 3ZKRA 4NUVA 3KFWX 3JCFA 1YXRA 3ZJ2A 2VVNA 1KFYA 5IHYA 3LK3B 4LFBT 3KDSE 5FXXA 2WMOA 5M4YA 1V9DA 5TAOA 2WU2A 4PJNA 1ZHCA 1E1HB 3AE9A 2F4VT 3C64A 4L9IA 1R8IA 2KNDA 2YU2A 5AQOB 4HWCA 3U78A 3E08A 2XPKA 3BK9A 1T72A 4UF0B 4PK4A 2DCFA 3PUYF 4MHCA 3AE4A 3ZLIA 2XQ8A 3AECA 2N2NA 3Q5EA 1HF8A 4TWHA 3KINB 2WDQA 2BKOA 3JAEA 3NVOA 5LHIB 4DV7T 4ZS2A 4LF5T 4X1YE 3AVRA 1VRBA 3FZFB 5F8PA 5JDHA 2KVPA 1HG2A 1IBKT 3AE1A 4Z91A 3RKOA 2HPJA 3P4RA 2CMRA 4N78D 1YKEB 2CM0A 1VOMA 5JVDE 4A5XA 4EB6E 2YDRA 5LP6E 3WSCA 2X9YA 4AKGA 2KINB 3PF0A 5JTGA 2FJEA 3IHRA 5F3JA 3A5XA 1VCTA 4K0KT 2NOXA 2X0HA 3ZN0B 2X0LB 3TLWA 1I94T 1G8XA 5HXSA 4TNVA 3T8OA 4U2ZA 1G73A 4Q25A 5FXVA 4B6XA 2E5VA 3GN5A 2WP9A 1UUSA 1LRZA 4IDNA 2BVMA 3AEFA 5LNKA 3LBXB 5JRCA 2LJLA 5L3EB 2JRKA 3OKQA 3GMIA 1J5WA 5FP3A 4X20E 4IDQA 2UXXB 4CQIA 3P8CD 1WR6A 2MTCA 2X67A 2YU1A 3UU5A 4ZS3A 1WLXA 3RF1A 2CHNA 2IDOB 2XAQB 2NW7A 4COFA 1B7TA 1Z8UA 3CX8B 5F5WA 2D0TA 3SOLA 4ZZCA 2W66A 3CX6B 1X9BA 2V5DA 3F31A 5AQPB 4LMKA 3ETUA 4QH5A 3C4WA 2V7JA 1MIYA 4JLEA 4GKJT 1E7PA 2MAWA 2KGXA 4P0AA 4AQFC 4QX7B 1W09A 4UIGA 5JR9A 4L0RA 4F7GB 5CGMA 4CZZB 2JIWA 4PJJA 2MPKA 5DQWA 4KBMB 3PU3A 5LGTB 4CXWA 2UXCT 3RIUA 4CN6A 3HA4A 3HKEE 4O4LE 2LKHA 3SFDA 2WDRA 4XZCA 4YSYA 3RC3A 3ZJ1A 3TLUA 2V6YA 5EK3A 4XBFB 4G63A 1Y64B 2YINA 3KBUA 4IE6A 3RX6A 3LK2B 1DU2A 5KDMC 4ZI2D 5J1GA 5LG3A 2HPLA 3JC6C 4M1PA 5LMUT 2D0UA 5C3JA 3NBXX 2H3RA 2IAKA 3UULA 4H9QC 4ILBA 2VB6A 1ZP0A 3CWZB 2I6HA 5FL0A 5AQMB 5LGUB 2C5JA 3T1HT 2MTQA 1YKHB 3VHLA 3EABA 2KWIB 4OYJA 2V7MA 3M65A 3P4WA 2CLYC 1FJGT 2WCAA 4IE4A 3TKLB 5EK2A 1N33T 2WSSV 3S4UA 5LOVE 5JRCB 2L10A 1NEKA 1AJ3A 4DV3T 4DNDA 5KMGP 5C2TA 4ISTA 3RKGA 3J7Yq 2XSAA 2XTLA 4ZI7E 1OEDC 5GONE 3TLTA 4V1Av 5AQNB 3ZYLA 2B1EA 1M62A 5A1LA 3HKCE 2XAGB 4U7IA 2I0MA 4HWFA 4EZ4A 1D0YA 2CBIA 2WS3A 1US7B 1JNRA 3I9WA 4PW8A 4ONRA 2G0UA 1SUMB 5LA6E 4YLHA 1BR4A 4I50E 3UQ4A 3K3OA 1FMWA 3UUBA 1FMVA 5J2UE 1NENA 2MOZA 5FY0A 3GA8A 4ZHQE 4KHZF 3ZT5A 4XAXB 3PTRB 4X1KE 5L4EA 3L09A 3A7MA 4DO0A 4LF8T 2R6GF 3QUJA 4HFHA 5JR9B 3AA6B 4DR4T 2W61A 2Q9QA 2PTFA 4MFRA 1HNZT 5JQGE 4L5GA 4BA9A 2BKNA 5HXHA 4HWDA 3FHNA 4LF7T 3FZHB 5FYMA 2I59A 4H63H 3JAFA 1OEDE 1XWMA 3UU3A 2VKJA 4CN4A 3E0ZA 4ZOLE 2V6YB 3PUXF 1NWMX 3MJXA 4P09A 2CPTA 3NRYA 4IGUA 4UELA 5L3FB 2BS3A 1XMQT 3P7IA 1QLBA 1YQ3A 2XQ7A 4UF0A 2KT9A 4ILUA 1MMAA 4KX6A 1IAPA 4NPPA 2H89A 3P4PA 4F8HA 3T1YT 4DR3T 2ACXA 2W2UA 4UXNB 4IL9A 2XM1A 4JI3T 2AE9A 4MLKA 5FXWA 3AAEB 3OJAA 2IC6A 2WBLA 3ZCJA 1D0ZA 4Z8XA 2C5IT 2K5BB 4ZEYA 1X79A 3TLSA 5HEGA 2X9HA 2NW9A 4H9OC 4FI5A 5IUXA 5AQKB 2VQFT 4TWDA 4ISSA 4QXHB 1KEYA 4HTEA 4NIQA 3QB5K 1MMDA 2VL0A 2DI4A 2D2SA 4PAGA 4KHPT 3OTOT 4LMJA 3WI3A 3KV4A 2UUCT 2W4XA 3N5LA 3ZYKA 5HCJA 1IBLT 4PJMA 5HXEA 4QWNB 2QRXA 2YK0A 4ZZBA 2LOSA 4DV1T 1ZOYA 4EV6A 3LBXA 2L7NA 2V26A 3IBPA 4O2BE 1UURA 3N9QA 3LDQB 2E9XA 4C91A 3EUHA 3C51A 1OXZA 2V5CA 2K9AA 5L3CB 3MK7C 3BQIA 4IT4A 5C8YE 4EYUA 2WU5A 3QNUA 2VURA 5E0OA 2LSYA 3P50A 2Q9QB 4GKKT 4DV5T 3RYCE 4UVBB 3PUGA 1T7SA 3GWHA 3AEGA 2V7IA 1GQEA 3RYHE 3C4ZA 5LCYA 2H7OA 3K3NA 3ONXA 4G2AA 4U3CA 2JQKA 3UU6A 3QOFA 4GYSA 3WAKA 4ANJA 3FXEB 4HFBA 2CEAA 2FJDA 1XZYA 1KK7A 2XM2A 3AY5A 4HEAA 5FXZA 1E2AA 3OVUA 4DV6T 3RH3A 3J9X1 5ABEA 4JEUB 3ESLA 4YSZA 2QYWA 3CQGB 3RRCA 3ZT6A 3BQLA 3RIFA 4WBOA 2CXDA 1UCUA 4JBWF 4PNIA 1LKXA 3RIAA 2OV9A 4YTNA 3K3QC 5KX5E 3Q5WA 4ZI2C 2XUEA 5JDMA 5L47A 1WYCA 5LBQB 3K1SA 4AQYT 1HR0T 5CA0E 4BGOA 3I0OA 2UUAT 3ZMTB 2CBJA 4EXTA 3AE6A 4ADZA 2K24A 1SHZC 1JNZA 4QX8B 2MYSA 3OBVE 3IA3A 2V6XA 1SJ7A 2LEHA 2LRLA 4EGWA 2XAJB 5L3BB 2V7LA 4UV9B 3RPUA 4DUZT 3P4QA 3I0QA 3FXDB 4O4JE 2ACZA 1ZKEA 4DR6T 4ILCA 4EAHA 5CA1E 2WMNA 4EOZB 2E9XD 3PUSA 5BR8T 2YN6A 3RRWA 3O1IA 2E9XB 2KWHA 2VL8A 2XQ6A 4C90A 2FUPA 1W0AA 2PJQA 4DR5T 4K0UA 4YY3T 4I0UA 2WB5A 4YTMA 4TNWA 1SA0E 4CI3B 4DUYT 4HWIB 4O8SA 4YXDA 5AQSB 3HL6A 3UU8A 2L8KA 2QA7A 2IIUA 1S94A 4U7YA 4PFPA 5IYZE 3VU7H 4TUYE 3CVRA 5ABFA 3DJBA 3AE5A 3N9NA 4JI8T 4YSXA 2NR4A 3NZQA 3X1DA 4LFCT 5HWYA 4U31A 3I9YA 1T98A 4YJ3E 3D0TA 4EEDA 1T8BA 1M7KA 4KP3C 4HFDA 4HFVA 3A8YC 3RIUC 1Y01A 5CFBA 3M3ZB 2LHRA 3KBTA 3ANWA 3N9OA 1HTJF 2WQYA 4O2AE 1U5PA 1S35A 3C4XA 3L3PA
chains in the Genus database with same CATH topology
2MOZA 2YEVC 5FY0A 2KMFA 3GA8A 4ZHQE 2ZMAA 2ZM0A 2ZM2A 3AA7B 2OA5A 3PTRB 4XAXB 4QXCB 4X1KE 3CKDA 2NTYA 2CWOA 3K8PC 3L09A 2ZM8A 4DO0A 3QUJA 1BR1A 2P9BA 4GIWA 3HR0A 5LJNA 5JR9B 4ZI3D 3AA6B 3Q9DA 5T1DA 3EDVA 3UFEA 5DQVA 3R84B 3CMLA 5L3GB 4BJMA 2QGSA 2Q9QA 2W61A 3HI2A 4MFRA 4TV9E 3HKBE 3O4XE 5JQGE 5FNVE 4L5GA 4BA9A 5HXHA 3ZC0A 1Z0PA 3FHNA 5FY1A 5EK4A 2XAFB 2CE7A 5FYMA 1BR2A 4J2CA 2I59A 3BQKA 2X9XA 4H63H 4AI6A 2ODUA 4BJNA 1YD8G 2EHOD 4H9RC 4DVDA 2VKJA 3AA0B 4CI2B 1ZEEA 4PFOA 2EHOB 3LK42 3W15B 4BAYB 3E0ZA 4ZOLE 4WBNE 3IEEA 2NP9A 1NWMX 1MIVA 2LSGA 3MJXA 5DJQC 5DABA 4P09A 3NRYA 4IGUA 3RYFE 1NAFA 3H3AA 3C98B 3CQXC 4UELA 3QK6A 3L3PA 5L3FB 3PURA 4UVCB 3N2OA 4CXXA 2PBIA 3P7IA 5HXRA 2DWKA 4IE7A 3PDYA 2WWUA 2A3DA 4H9SE 3R6NA 2DLRA 1D1AA 4UF0A 4TN7B 4I55E 4YFSA 4NUVA 3KFWX 2KT9A 4ILUA 1MMAA 4AKHA 1IAPA 3ZJ2A 4JEHB 4P0BA 3ZMVB 5IHYA 2L9QA 3LK3B 2ACXA 4GK5E 2BDEA 4UXNB 4ERRA 3UTKA 3KDSE 5FXXA 2Z6EA 2WMOA 2A2FX 1IJ5A 1MMNA 4MLKA 1MIWA 5FXWA 3AAEB 5M4YA 3OJAA 1V9DA 3KVBA 5TAOA 2IC6A 2WBLA 3ZCJA 1D0ZA 4Z8XA 4PJNA 1ZHCA 1E1HB 3MZKB 2W63A 4PJLA 3ZYMA 3WURA 2C5IT 2CWYA 2X9WA 3C64A 4KUMB 4L9IA 2JMKA 4OFZA 2K5BB 2KNDA 2YU2A 3N9MA 3V5UA 1U4QA 1X79A 2X9HA 3CX7B 2NW9A 5FMNA 3U78A 4H9OC 3E08A 5H6RB 1LVFA 3BK9A 3KV9A 4FI5A 4U74A 4PK4A 4UF0B 5JR9C 2PFVA 2DCFA 4MHCA 1HG5A 4ISSA 4QXHB 1BR0A 4AXPA 3ZLIA 2SPCA 3KV5A 4HTEA 2N2NA 3ZCIA 1HF8A 4HE8A 3KINB 1MMDA 2DI4A 5LHIB 2D2SA 2NW8A 4PAGA 4ZS2A 4X1YE 5H6QB 3NZPA 1D1BA 2W62A 3AA1B 4DBRA 3WI3A 3AVRA 3KV4A 4IE5A 2LE8A 2H7VC 1VRBA 5F8PA 5JDHA 3IF8B 1HG2A 2EHOC 1WYBA 3N5LA 3CPZA 3NRXA 3ZYKA 3LG7A 4AQFA 3VJZA 3MA9A 2C0SA 4O4HE 3AB3B 2LM9A 4YJ2E 4PJMA 5EZYE 3KV6A 3RKOA 5HXEA 3PE0A 2HPJA 2CMRA 5ADXL 4N78D 2ES0A 1HFAA 1YKEB 4QWNB 2CM0A 1VOMA 3AAIA 2LT3A 2YK0A 5JVDE 2LOSA 2CXLA 4EB6E 5LP6E 3WSCA 2X9YA 2LHNA 4AKGA 2KINB 2IW5B 3PF0A 2XASB 3O1HA 2RA1A 3IHRA 2W00A 5F3JA 1HS7A 3A5XA 3LBXA 4CI1B 2GK9A 4OK0A 3B57A 5FY7A 4DMWA 2NOXA 2VKDA 2MBGA 2V26A 3IBPA 3OYXA 4O2BE 3ZN0B 2JMHA 2LOPA 2X0LB 3ANWB 4NUUA 3N9QA 1IJ6A 1G8XA 2N1GA 1WRDA 4TX5A 4X1IE 2VKHA 5HXSA 2E9XA 4C91A 3EUHA 2W0GA 3C51A 3DTOA 3T8OA 1QSDA 1OXZA 5JH7E 1G73A 2K9AA 2WAUA 4H63V 5FXVA 4B6XA 5JDQA 1LVKA 3GN5A 5L3CB 3MK7C 3BQIA 3FBLA 3ZC1A 5C8YE 4EYUA 3I1AA 4QKNA 1LRZA 2V1DB 3RYIE 5E0OA 1YW0A 2LSYA 2BVMA 1UX4A 3WAJA 2Q9QB 2VASA 4IDZA 2BZBA 5LNKA 3LBXB 1QUUA 3RYCE 5JRCA 4QXBB 2LJLA 5J2UE 5L3EB 2JRKA 2KZ7B 4ECGA 2VK9A 3GMIA 3OKQA 3SWHA 3ZMUB 2NWBA 4UVBB 2V7KA 5FP3A 3PUGA 3ZMSB 4X20E 4CXYA 3GWHA 2UXXB 2L3LA 4HN9A 3CQCB 2V7IA 1O3XA 3B13A 4CQIA 4F6RC 5JDLA 3P8CD 1WR6A 3RYHE 5L2LA 3GN5B 2MTCA 2X67A 2YU1A 3C4ZA 5LCYA 2H7OA 4ZS3A 1WLXA 4WW0A 3K3NA 3ONXA 2XAQB 2ZLYA 4G2AA 3M1CA 2NW7A 5JDNA 1B7TA 3N9LA 2LSJA 4PK6A 2N9DA 3MKDA 1HCIA 3CX8B 2BVLA 4GYSA 3AT7A 2D0TA 3SOLA 3FXEB 3WAKA 2CEAA 4ANJA 3CX6B 2KLQA 4AKRB 3VKHA 3F31A 1KK7A 2D5UA 3ETUA 4HEAA 5FXZA 3C4WA 4FJOA 2V7JA 1MIYA 4TZ4C 3SRZA 4JLEA 3AAAB 3RH3A 4EYYR 3ZEFB 3J9X1 4JEUB 2XQYA 4P0AA 2DNXA 3ESLA 4AQFC 4GYRA 4QX7B 4MALA 3CQGB 3E22E 4DBQA 3RRCA 1MMGA 4UIGA 5JR9A 2X68A 3BQLA 4L0RA 2CA5A 3PUAA 4WBOA 2CXDA 4AKLA 1UCUA 4PNIA 1LKXA 2X51A 4CZZB 5L3DB 4PJJA 3SS1A 3K3QC 5DQWA 5KX5E 4KBMB 3PU3A 5LGTB 3Q5WA 4CXWA 4ZI2C 3UUMA 3ZN1B 2XUEA 5JDMA 3N9PA 4JUYA 3VKGA 3LFMA 1UX5A 1WYCA 5LG4A 2Q9QC 4H9PC 3HA4A 3HKEE 3MXZA 3C50A 5LBQB 4O4LE 5CA0E 4BGOA 3I0OA 3ZMTB 4XZCA 4YHJA 2EHOA 3RC3A 3ZJ1A 3O1JA 1CUNA 4EXTA 3FBZA 5EK3A 2LSKA 4IHJE 4XBFB 4ADZA 2E9XC 5LBMA 4G63A 3Q2MA 1Y64B 3H37A 3U3IA 2YINA 2E8IA 3KBUA 3KVAA 2K24A 2JJ9A 4IIJE 4IE6A 3F57A 5LGNB 1IZNB 3RX6A 1SHZC 5LYJE 1MNDA 2J1DG 3ETVA 1FEWA 3DP7A 3LK2B 2Y48B 4GOUA 4QX8B 5KDMC 3HKDE 3PHF1 4E7SA 2MYSA 2Y8DA 3OBVE 4ZI2D 5J2TE 2LEHA 2UXNB 5JDFA 2VKOA 2ODVA 2XAJB 5J1GA 5L3BB 3LJCA 2XHEB 2V7LA 2RP4A 4UV9B 2Q9QD 2WM9A 3RPUA 2HPLA 3I0QA 3JC6C 4M1PA 3UUXB 3FXDB 2D0UA 4O4JE 1ZKEA 2C5KT 1HX8A 5JDGA 4I4TE 4QHOA 3NBXX 4EAHA 4H9NC 2H3RA 2IAKA 3UUNA 3UULA 2WMNA 5CA1E 4TV8E 4EOZB 2E9XD 3OYZA 3PUSA 4H9QC 4HGAA 4EZHA 1KNZA 2VB6A 3PU8A 4OHFA 3RRWA 3CWZB 2A72A 2E9XB 2KWHA 2VL8A 3O1IA 4C90A 2XAHB 3QC9A 1H7CA 2PJQA 5LGUB 4OYKA 2C5JA 4HKAA 2MTQA 1YKHB 3VHLA 3O9XA 3UT5E 1MNEA 4K0UA 2M67A 4KMCA 2KWIB 5LJMA 1OWAA 2PG8A 1FMVA 4OYJA 2V7MA 3M65A 3F2EA 1SA0E 4CI3B 4EIWA 1FIOA 2CLYC 4GK0E 4O8SA 2HH7A 3FB2A 4A56A 5HXCA 3HL6A 2LQUA 2JQQA 4IE4A 4DMVA 3N2GE 3JC6D 3TKLB 5EK2A 2L8KA 2WSSV 3S4UA 2QA7A 5LHGB 3N2KE 3EDUA 2Y6XA 1S94A 5LOVE 5JRCB 4PFPA 4I43B 5IYZE 2IC9A 3VU7H 4TUYE 1AJ3A 3V5SA 3CVRA 2DHRA 3DJBA 4DNDA 5CB4E 5KMGP 4ISTA 4AQGA 3J7Yq 4O4IE 2LSIA 2XTLA 3RC8A 5HAXA 4PK5A 3N9NA 2K48A 4MBQA 4ZI7E 4WNKA 5GONE 2KXPB 4E7ZA 4UV8B 3NZQA 4V1Av 5HWYA 3I9YA 3MACA 4IE0A 5JREA 3ZYLA 1T98A 3AVSA 2B1EA 3D0TA 4YJ3E 4ZI3C 3PUQA 1EZ3A 5A1LA 4AKIA 5BMVE 3HKCE 2XAGB 4KP3C 1D1CA 2X66A 3ZMZB 2CLYB 3Q5XA 4U72A 4HFVA 4EZ4A 3ZPOA 1D0YA 2CXFA 4UEMA 1US7B 2JPFA 2NTXA 5ETWA 2LHRA 5LHHB 3I9WA 3KBTA 4UVAB 4PW8A 5LXTE 4ONRA 3ANWA 2G0UA 5LA6E 3N9OA 4YLHA 1HTJF 5HWXA 2DWGA 1ZV4X 1D0XA 4ASKA 1BR4A 4I50E 4O2AE 3K3OA 5AFUL 1U5PA 1FMWA 1S35A 2CCQA 3C4XA 2VWAA 3EVYA 5HYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXR A;  5HXH A;  5HXS A;  5HXE A;  5JDL A;  5JDM A;  5JDQ A;  5HXC A;  3V5S A;  5HWX A;  3V5U A;  5JDH A;  5JDN A;  5JDF A;  5JDG A;  5HWY A;  5HYA A; 
#chains in the Genus database with same CATH topology
 3CKD A;  2NTY A;  3K8P C;  2M6I A;  2CRB A;  5LJN A;  2XQ9 A;  1VCS A;  2ZM6 T;  2IML A;  5HEO A;  3EDV A;  3UFE A;  4BJM A;  2QGS A;  1XDP A;  3HKB E;  1XNR T;  5AQQ B;  2XAF B;  5AQT B;  3NKZ A;  5KXJ A;  2X9X A;  4QH1 A;  1YD8 G;  4LF4 T;  3AA0 B;  4CI2 B;  1ZEE A;  4ZXL A;  4BAY B;  3Q5D A;  4WBN E;  2NP9 A;  4JI1 T;  1SE7 A;  3VR8 A;  5DAB A;  3C98 B;  3CQX C;  4UVC B;  4CXX A;  3N2O A;  2DWK A;  4IE7 A;  3PDY A;  2WWU A;  4YFS A;  4B3S T;  4AKH A;  3ZMV B;  2L9Q A;  4IL4 A;  2BDE A;  2DL1 A;  3UTK A;  2A2F X;  1IJ5 A;  1MIW A;  3KVB A;  5HCM A;  4PJL A;  2X9W A;  1XNQ T;  4OFZ A;  3AEA A;  3VRA A;  3CX7 B;  5FMN A;  3G06 A;  1J5E T;  4U74 A;  2KBB A;  2PFV A;  1HG5 A;  3DYJ A;  1BR0 A;  4AXP A;  5ABH A;  2SPC A;  1IBM T;  3KV5 A;  2XQA A;  3ZCI A;  4HE8 A;  1YQ4 A;  2BG9 A;  2NW8 A;  2YDQ A;  1D1B A;  4DR1 T;  5AQL B;  4IE5 A;  4DV0 T;  2LE8 A;  5ABF B;  1W9R A;  3IF8 B;  2EHO C;  1WYB A;  4DR2 T;  3VJZ A;  3LG7 A;  3MA9 A;  2A9U A;  3KV6 A;  3PE0 A;  5ADX L;  2ES0 A;  1UK5 A;  2LT3 A;  2CXL A;  2WY2 A;  2LHN A;  2IW5 B;  2XAS B;  2B76 A;  2W00 A;  1HS7 A;  4OK0 A;  5FY7 A;  4DMW A;  3AE7 A;  5AQH B;  3LSV A;  3OPC A;  1SJ8 A;  2JMH A;  3ANW B;  1IJ6 A;  2N1G A;  3RGL A;  4X1I E;  1QSD A;  4H63 V;  4OX9 T;  4UR9 A;  1LVK A;  3FBL A;  3ZC1 A;  2WDV A;  2VQE T;  2V1D B;  3RYI E;  4JYA T;  3PUV F;  4X5T A;  4JI2 T;  3WAJ A;  4IDZ A;  2X0Y A;  4LFA T;  1QUU A;  2X0C A;  4ECG A;  2KZ7 B;  2VK9 A;  3ABV A;  3ZMU B;  2V7K A;  3ZMS B;  3UQ7 A;  3JAD A;  4CXY A;  4HN9 A;  3CQC B;  2IUB A;  1O3X A;  3B13 A;  3UU4 A;  2XJ7 A;  4WW0 A;  5JDN A;  3N9L A;  2LSJ A;  4PK6 A;  1HCI A;  2BVL A;  3AT7 A;  4Z90 A;  2YKS A;  1XMO T;  2KLQ A;  4B3M T;  4AKR B;  5AQI B;  3VKH A;  4JI5 T;  4DID B;  3L8R A;  3SRZ A;  3AAA B;  4EYY R;  1W0B A;  2XQY A;  2DNX A;  4DBQ A;  1MMG A;  2CA5 A;  2JQ9 A;  3PUA A;  2BKP A;  2X51 A;  5LMN T;  3ZN1 B;  2XZE A;  3PV0 F;  2H88 A;  4JUY A;  1UX5 A;  5LG4 A;  3MXZ A;  2IHR 1;  4B3R T;  1WR0 A;  2BG9 B;  4X66 T;  4YHJ A;  4LF6 T;  1CUN A;  3FBZ A;  4P1N A;  5L4H A;  2LSK A;  4IHJ E;  1OED B;  2E9X C;  5LBM A;  4JV5 T;  3Q2M A;  3U3I A;  4IIJ E;  3KVA A;  1WCR A;  4JI4 T;  1IZN B;  4X65 T;  5LYJ E;  1KF6 A;  1MND A;  2J1D G;  1FEW A;  3DP7 A;  3EI0 A;  2YOE A;  2Y48 B;  3HKD E;  3PHF 1;  4E7S A;  2Y8D A;  5J2T E;  2UUB T;  5JDF A;  2VKO A;  2XY8 B;  2CHO A;  3LJC A;  2XHE B;  2RP4 A;  2Q9Q D;  2W67 A;  4HFE A;  2C5K T;  1HX8 A;  2BBH A;  3AXJ A;  5JDG A;  4X64 T;  4I4T E;  4QHO A;  4H9N C;  3UUN A;  4HGA A;  4EZH A;  1KNZ A;  3PU8 A;  2A72 A;  2UU9 T;  2J62 A;  1WFD A;  3ONJ A;  4HKA A;  3UT5 E;  2M67 A;  4KMC A;  4CN1 A;  3ZSS A;  2PG8 A;  1KNP A;  3F2E A;  4EIW A;  1FIO A;  4GK0 E;  2HH7 A;  4A56 A;  2LQU A;  2JQQ A;  4DMV A;  3N2G E;  5LHG B;  3AE2 A;  3N2K E;  3EDU A;  2Y6X A;  2E2A A;  2QVA A;  5AQJ B;  4I43 B;  4LML A;  5FKY A;  2DHR A;  5CB4 E;  4AQG A;  4O4I E;  5HAX A;  5HEU A;  2K48 A;  2KXP B;  4E7Z A;  4TWF A;  4IRE A;  5CJ5 A;  3AVS A;  3PUQ A;  3PJA J;  4AKI A;  1N36 T;  3FZK B;  1D1C A;  3ZMZ B;  5FL1 A;  3Q5X A;  4U72 A;  3VRB A;  3ZPO A;  4UEM A;  3UFG A;  2WZH A;  2JPF A;  5ETW A;  4UVA B;  5LXT E;  2LLY A;  5LB7 B;  1CHU A;  1D0X A;  3AE3 A;  4ASK A;  5AFU L;  3PJA A;  2CCQ A;  2OLT A;  3B5M A;  2HN1 A;  2VWA A;  3EVY A;  2YEV C;  2ZMA A;  2ZM0 A;  2ZM2 A;  3AA7 B;  2OA5 A;  2CWO A;  4B3T T;  3RHW A;  2ZM8 A;  4GIW A;  4ZI3 D;  2FBW A;  5T1D A;  5DQV A;  2J47 A;  4IDP A;  3EAM A;  3O4X E;  5FNV E;  3ZC0 A;  1Z0P A;  2CE7 A;  4J2C A;  3BQK A;  4AI6 A;  4BJN A;  4H9R C;  4DVD A;  3PUZ F;  4PFO A;  3LK4 2;  2LRK A;  2LKG A;  3AE8 A;  4YTP A;  1MIV A;  5DJQ C;  5AQU B;  2UXD T;  3FZM B;  4YHH T;  3H3A A;  3QK6 A;  2UXB T;  5AQV B;  2PBI A;  5HXR A;  2A3D A;  2DLR A;  3H3M A;  1D1A A;  4W8P A;  4A98 A;  4JEH B;  4P0B A;  3AED A;  4LF9 T;  4GK5 E;  3ZT7 A;  4ERR A;  2Z6E A;  1MMN A;  3AXJ B;  3MZK B;  1J1J A;  2W63 A;  3ZYM A;  3WUR A;  2CWY A;  4KUM B;  1HNX T;  2JMK A;  3N9M A;  3V5U A;  1U4Q A;  5H6R B;  1LVF A;  3KV9 A;  5JR9 C;  1I6Z A;  4NXM T;  2BBJ A;  4HFI A;  5H6Q B;  3NZP A;  2W62 A;  2FJB A;  3AA1 B;  4DBR A;  2H7V C;  4QH4 A;  3VR9 A;  3NRX A;  3CPZ A;  4AQF A;  2C0S A;  4O4H E;  3SFE A;  3AB3 B;  2LM9 A;  4YJ2 E;  5EZY E;  1HX1 B;  1HFA A;  3AAI A;  1XDO A;  4JI0 T;  2RPA A;  3O1H A;  2RA1 A;  3RQW A;  4CI1 B;  2GK9 A;  3B57 A;  4A97 A;  2VKD A;  2MBG A;  3OYX A;  2LOP A;  4NUU A;  1KNR A;  4TX5 A;  1WRD A;  2VKH A;  2W0G A;  3DTO A;  5JH7 E;  2WAU A;  2HHH T;  5JDQ A;  2XQ4 A;  2YDS A;  3I1A A;  4QKN A;  1YW0 A;  1UX4 A;  2VAS A;  2BZB A;  2HN2 A;  4QXB B;  3SWH A;  2NWB A;  1L0V A;  2L3L A;  4KI0 F;  4F6R C;  5JDL A;  3RI5 A;  5L2L A;  3GN5 B;  3QB5 A;  3CIR A;  2ZLY A;  3M1C A;  2WWV A;  2N9D A;  3MKD A;  5FZT A;  4EEB A;  4YT0 A;  2XSB A;  1N34 T;  3TLV A;  4DR7 T;  2D5U A;  2BG9 C;  4FJO A;  4TZ4 C;  2XQ5 A;  3PUW F;  3ZEF B;  2V8S V;  1OED A;  5ABG A;  4GYR A;  4MAL A;  3E22 E;  2X68 A;  1HNW T;  4AKL A;  5L3D B;  3SS1 A;  3UUM A;  3N9P A;  3VKG A;  2WZI A;  3LFM A;  2Q9Q C;  4H9P C;  3C50 A;  1UGO A;  4DV2 T;  2EHO A;  3O1J A;  4ILA A;  5AQR B;  2VVS A;  4AIU A;  4HWH A;  2M6B A;  3H37 A;  2E8I A;  4JI7 T;  2JJ9 A;  3F57 A;  5LGN B;  2K3W A;  3ETV A;  4GOU A;  3L39 A;  3RLF F;  2BG9 E;  2UXN B;  2ODV A;  2WM9 A;  3UUX B;  3CK6 A;  3NWI A;  2BS2 A;  4TV8 E;  3OYZ A;  5IWA T;  4OHF A;  3AEB A;  4WYV A;  2XAH B;  4X62 T;  3QC9 A;  1H7C A;  4OYK A;  3O9X A;  2XQ3 A;  2LM2 A;  1MNE A;  5LJM A;  1OWA A;  2E5L T;  3FB2 A;  5HXC A;  3JC6 D;  4IDO A;  2IC9 A;  3V5S A;  4JI6 T;  2FJA A;  2LSI A;  1N32 T;  3RC8 A;  4PK5 A;  4MBQ A;  4WNK A;  4UV8 B;  3MAC A;  4IE0 A;  5JRE A;  4ZI3 C;  1EZ3 A;  5BMV E;  2JQH A;  2X66 A;  2CLY B;  2CXF A;  2NTX A;  5LHH B;  4NXN T;  5HWX A;  2DWG A;  1ZV4 X;  5HEJ A;  4U33 A;  3ONL C;  4WZX A;  3RQU A;  5J0Z A;  3FZL B;  5HYA A;  2KMF A;  4QXC B;  2AXD S;  2KSR A;  1BR1 A;  2P9B A;  3HR0 A;  3P4S A;  2J4G A;  3AEE A;  3Q9D A;  2BS4 A;  3R84 B;  4DV4 T;  3CML A;  5L3G B;  3HI2 A;  4TV9 E;  5FVK A;  5FY1 A;  5EK4 A;  5AQF B;  1BR2 A;  3ZST A;  2ODU A;  3FYQ A;  2EHO D;  2EHO B;  3W15 B;  4U2Y A;  3IEE A;  2LSG A;  3EHZ A;  5HEH A;  5AQG B;  3RYF E;  1NAF A;  5FVL A;  3PUR A;  2D9D A;  4AIS A;  4H9S E;  4HFC A;  3R6N A;  4TN7 B;  4I55 E;  3ZKR A;  4NUV A;  3KFW X;  3JCF A;  1YXR A;  3ZJ2 A;  2VVN A;  1KFY A;  5IHY A;  3LK3 B;  4LFB T;  3KDS E;  5FXX A;  2WMO A;  5M4Y A;  1V9D A;  5TAO A;  2WU2 A;  4PJN A;  1ZHC A;  1E1H B;  3AE9 A;  2F4V T;  3C64 A;  4L9I A;  1R8I A;  2KND A;  2YU2 A;  5AQO B;  4HWC A;  3U78 A;  3E08 A;  2XPK A;  3BK9 A;  1T72 A;  4UF0 B;  4PK4 A;  2DCF A;  3PUY F;  4MHC A;  3AE4 A;  3ZLI A;  2XQ8 A;  3AEC A;  2N2N A;  3Q5E A;  1HF8 A;  4TWH A;  3KIN B;  2WDQ A;  2BKO A;  3JAE A;  3NVO A;  5LHI B;  4DV7 T;  4ZS2 A;  4LF5 T;  4X1Y E;  3AVR A;  1VRB A;  3FZF B;  5F8P A;  5JDH A;  2KVP A;  1HG2 A;  1IBK T;  3AE1 A;  4Z91 A;  3RKO A;  2HPJ A;  3P4R A;  2CMR A;  4N78 D;  1YKE B;  2CM0 A;  1VOM A;  5JVD E;  4A5X A;  4EB6 E;  2YDR A;  5LP6 E;  3WSC A;  2X9Y A;  4AKG A;  2KIN B;  3PF0 A;  5JTG A;  2FJE A;  3IHR A;  5F3J A;  3A5X A;  1VCT A;  4K0K T;  2NOX A;  2X0H A;  3ZN0 B;  2X0L B;  3TLW A;  1I94 T;  1G8X A;  5HXS A;  4TNV A;  3T8O A;  4U2Z A;  1G73 A;  4Q25 A;  5FXV A;  4B6X A;  2E5V A;  3GN5 A;  2WP9 A;  1UUS A;  1LRZ A;  4IDN A;  2BVM A;  3AEF A;  5LNK A;  3LBX B;  5JRC A;  2LJL A;  5L3E B;  2JRK A;  3OKQ A;  3GMI A;  1J5W A;  5FP3 A;  4X20 E;  4IDQ A;  2UXX B;  4CQI A;  3P8C D;  1WR6 A;  2MTC A;  2X67 A;  2YU1 A;  3UU5 A;  4ZS3 A;  1WLX A;  3RF1 A;  2CHN A;  2IDO B;  2XAQ B;  2NW7 A;  4COF A;  1B7T A;  1Z8U A;  3CX8 B;  5F5W A;  2D0T A;  3SOL A;  4ZZC A;  2W66 A;  3CX6 B;  1X9B A;  2V5D A;  3F31 A;  5AQP B;  4LMK A;  3ETU A;  4QH5 A;  3C4W A;  2V7J A;  1MIY A;  4JLE A;  4GKJ T;  1E7P A;  2MAW A;  2KGX A;  4P0A A;  4AQF C;  4QX7 B;  1W09 A;  4UIG A;  5JR9 A;  4L0R A;  4F7G B;  5CGM A;  4CZZ B;  2JIW A;  4PJJ A;  2MPK A;  5DQW A;  4KBM B;  3PU3 A;  5LGT B;  4CXW A;  2UXC T;  3RIU A;  4CN6 A;  3HA4 A;  3HKE E;  4O4L E;  2LKH A;  3SFD A;  2WDR A;  4XZC A;  4YSY A;  3RC3 A;  3ZJ1 A;  3TLU A;  2V6Y A;  5EK3 A;  4XBF B;  4G63 A;  1Y64 B;  2YIN A;  3KBU A;  4IE6 A;  3RX6 A;  3LK2 B;  1DU2 A;  5KDM C;  4ZI2 D;  5J1G A;  5LG3 A;  2HPL A;  3JC6 C;  4M1P A;  5LMU T;  2D0U A;  5C3J A;  3NBX X;  2H3R A;  2IAK A;  3UUL A;  4H9Q C;  4ILB A;  2VB6 A;  1ZP0 A;  3CWZ B;  2I6H A;  5FL0 A;  5AQM B;  5LGU B;  2C5J A;  3T1H T;  2MTQ A;  1YKH B;  3VHL A;  3EAB A;  2KWI B;  4OYJ A;  2V7M A;  3M65 A;  3P4W A;  2CLY C;  1FJG T;  2WCA A;  4IE4 A;  3TKL B;  5EK2 A;  1N33 T;  2WSS V;  3S4U A;  5LOV E;  5JRC B;  2L10 A;  1NEK A;  1AJ3 A;  4DV3 T;  4DND A;  5KMG P;  5C2T A;  4IST A;  3RKG A;  3J7Y q;  2XSA A;  2XTL A;  4ZI7 E;  1OED C;  5GON E;  3TLT A;  4V1A v;  5AQN B;  3ZYL A;  2B1E A;  1M62 A;  5A1L A;  3HKC E;  2XAG B;  4U7I A;  2I0M A;  4HWF A;  4EZ4 A;  1D0Y A;  2CBI A;  2WS3 A;  1US7 B;  1JNR A;  3I9W A;  4PW8 A;  4ONR A;  2G0U A;  1SUM B;  5LA6 E;  4YLH A;  1BR4 A;  4I50 E;  3UQ4 A;  3K3O A;  1FMW A;  3UUB A;  1FMV A;  5J2U E;  1NEN A;  2MOZ A;  5FY0 A;  3GA8 A;  4ZHQ E;  4KHZ F;  3ZT5 A;  4XAX B;  3PTR B;  4X1K E;  5L4E A;  3L09 A;  3A7M A;  4DO0 A;  4LF8 T;  2R6G F;  3QUJ A;  4HFH A;  5JR9 B;  3AA6 B;  4DR4 T;  2W61 A;  2Q9Q A;  2PTF A;  4MFR A;  1HNZ T;  5JQG E;  4L5G A;  4BA9 A;  2BKN A;  5HXH A;  4HWD A;  3FHN A;  4LF7 T;  3FZH B;  5FYM A;  2I59 A;  4H63 H;  3JAF A;  1OED E;  1XWM A;  3UU3 A;  2VKJ A;  4CN4 A;  3E0Z A;  4ZOL E;  2V6Y B;  3PUX F;  1NWM X;  3MJX A;  4P09 A;  2CPT A;  3NRY A;  4IGU A;  4UEL A;  5L3F B;  2BS3 A;  1XMQ T;  3P7I A;  1QLB A;  1YQ3 A;  2XQ7 A;  4UF0 A;  2KT9 A;  4ILU A;  1MMA A;  4KX6 A;  1IAP A;  4NPP A;  2H89 A;  3P4P A;  4F8H A;  3T1Y T;  4DR3 T;  2ACX A;  2W2U A;  4UXN B;  4IL9 A;  2XM1 A;  4JI3 T;  2AE9 A;  4MLK A;  5FXW A;  3AAE B;  3OJA A;  2IC6 A;  2WBL A;  3ZCJ A;  1D0Z A;  4Z8X A;  2C5I T;  2K5B B;  4ZEY A;  1X79 A;  3TLS A;  5HEG A;  2X9H A;  2NW9 A;  4H9O C;  4FI5 A;  5IUX A;  5AQK B;  2VQF T;  4TWD A;  4ISS A;  4QXH B;  1KEY A;  4HTE A;  4NIQ A;  3QB5 K;  1MMD A;  2VL0 A;  2DI4 A;  2D2S A;  4PAG A;  4KHP T;  3OTO T;  4LMJ A;  3WI3 A;  3KV4 A;  2UUC T;  2W4X A;  3N5L A;  3ZYK A;  5HCJ A;  1IBL T;  4PJM A;  5HXE A;  4QWN B;  2QRX A;  2YK0 A;  4ZZB A;  2LOS A;  4DV1 T;  1ZOY A;  4EV6 A;  3LBX A;  2L7N A;  2V26 A;  3IBP A;  4O2B E;  1UUR A;  3N9Q A;  3LDQ B;  2E9X A;  4C91 A;  3EUH A;  3C51 A;  1OXZ A;  2V5C A;  2K9A A;  5L3C B;  3MK7 C;  3BQI A;  4IT4 A;  5C8Y E;  4EYU A;  2WU5 A;  3QNU A;  2VUR A;  5E0O A;  2LSY A;  3P50 A;  2Q9Q B;  4GKK T;  4DV5 T;  3RYC E;  4UVB B;  3PUG A;  1T7S A;  3GWH A;  3AEG A;  2V7I A;  1GQE A;  3RYH E;  3C4Z A;  5LCY A;  2H7O A;  3K3N A;  3ONX A;  4G2A A;  4U3C A;  2JQK A;  3UU6 A;  3QOF A;  4GYS A;  3WAK A;  4ANJ A;  3FXE B;  4HFB A;  2CEA A;  2FJD A;  1XZY A;  1KK7 A;  2XM2 A;  3AY5 A;  4HEA A;  5FXZ A;  1E2A A;  3OVU A;  4DV6 T;  3RH3 A;  3J9X 1;  5ABE A;  4JEU B;  3ESL A;  4YSZ A;  2QYW A;  3CQG B;  3RRC A;  3ZT6 A;  3BQL A;  3RIF A;  4WBO A;  2CXD A;  1UCU A;  4JBW F;  4PNI A;  1LKX A;  3RIA A;  2OV9 A;  4YTN A;  3K3Q C;  5KX5 E;  3Q5W A;  4ZI2 C;  2XUE A;  5JDM A;  5L47 A;  1WYC A;  5LBQ B;  3K1S A;  4AQY T;  1HR0 T;  5CA0 E;  4BGO A;  3I0O A;  2UUA T;  3ZMT B;  2CBJ A;  4EXT A;  3AE6 A;  4ADZ A;  2K24 A;  1SHZ C;  1JNZ A;  4QX8 B;  2MYS A;  3OBV E;  3IA3 A;  2V6X A;  1SJ7 A;  2LEH A;  2LRL A;  4EGW A;  2XAJ B;  5L3B B;  2V7L A;  4UV9 B;  3RPU A;  4DUZ T;  3P4Q A;  3I0Q A;  3FXD B;  4O4J E;  2ACZ A;  1ZKE A;  4DR6 T;  4ILC A;  4EAH A;  5CA1 E;  2WMN A;  4EOZ B;  2E9X D;  3PUS A;  5BR8 T;  2YN6 A;  3RRW A;  3O1I A;  2E9X B;  2KWH A;  2VL8 A;  2XQ6 A;  4C90 A;  2FUP A;  1W0A A;  2PJQ A;  4DR5 T;  4K0U A;  4YY3 T;  4I0U A;  2WB5 A;  4YTM A;  4TNW A;  1SA0 E;  4CI3 B;  4DUY T;  4HWI B;  4O8S A;  4YXD A;  5AQS B;  3HL6 A;  3UU8 A;  2L8K A;  2QA7 A;  2IIU A;  1S94 A;  4U7Y A;  4PFP A;  5IYZ E;  3VU7 H;  4TUY E;  3CVR A;  5ABF A;  3DJB A;  3AE5 A;  3N9N A;  4JI8 T;  4YSX A;  2NR4 A;  3NZQ A;  3X1D A;  4LFC T;  5HWY A;  4U31 A;  3I9Y A;  1T98 A;  4YJ3 E;  3D0T A;  4EED A;  1T8B A;  1M7K A;  4KP3 C;  4HFD A;  4HFV A;  3A8Y C;  3RIU C;  1Y01 A;  5CFB A;  3M3Z B;  2LHR A;  3KBT A;  3ANW A;  3N9O A;  1HTJ F;  2WQY A;  4O2A E;  1U5P A;  1S35 A;  3C4X A;  3L3P A; 
#chains in the Genus database with same CATH homology
 2MOZ A;  2YEV C;  5FY0 A;  2KMF A;  3GA8 A;  4ZHQ E;  2ZMA A;  2ZM0 A;  2ZM2 A;  3AA7 B;  2OA5 A;  3PTR B;  4XAX B;  4QXC B;  4X1K E;  3CKD A;  2NTY A;  2CWO A;  3K8P C;  3L09 A;  2ZM8 A;  4DO0 A;  3QUJ A;  1BR1 A;  2P9B A;  4GIW A;  3HR0 A;  5LJN A;  5JR9 B;  4ZI3 D;  3AA6 B;  3Q9D A;  5T1D A;  3EDV A;  3UFE A;  5DQV A;  3R84 B;  3CML A;  5L3G B;  4BJM A;  2QGS A;  2Q9Q A;  2W61 A;  3HI2 A;  4MFR A;  4TV9 E;  3HKB E;  3O4X E;  5JQG E;  5FNV E;  4L5G A;  4BA9 A;  5HXH A;  3ZC0 A;  1Z0P A;  3FHN A;  5FY1 A;  5EK4 A;  2XAF B;  2CE7 A;  5FYM A;  1BR2 A;  4J2C A;  2I59 A;  3BQK A;  2X9X A;  4H63 H;  4AI6 A;  2ODU A;  4BJN A;  1YD8 G;  2EHO D;  4H9R C;  4DVD A;  2VKJ A;  3AA0 B;  4CI2 B;  1ZEE A;  4PFO A;  2EHO B;  3LK4 2;  3W15 B;  4BAY B;  3E0Z A;  4ZOL E;  4WBN E;  3IEE A;  2NP9 A;  1NWM X;  1MIV A;  2LSG A;  3MJX A;  5DJQ C;  5DAB A;  4P09 A;  3NRY A;  4IGU A;  3RYF E;  1NAF A;  3H3A A;  3C98 B;  3CQX C;  4UEL A;  3QK6 A;  3L3P A;  5L3F B;  3PUR A;  4UVC B;  3N2O A;  4CXX A;  2PBI A;  3P7I A;  5HXR A;  2DWK A;  4IE7 A;  3PDY A;  2WWU A;  2A3D A;  4H9S E;  3R6N A;  2DLR A;  1D1A A;  4UF0 A;  4TN7 B;  4I55 E;  4YFS A;  4NUV A;  3KFW X;  2KT9 A;  4ILU A;  1MMA A;  4AKH A;  1IAP A;  3ZJ2 A;  4JEH B;  4P0B A;  3ZMV B;  5IHY A;  2L9Q A;  3LK3 B;  2ACX A;  4GK5 E;  2BDE A;  4UXN B;  4ERR A;  3UTK A;  3KDS E;  5FXX A;  2Z6E A;  2WMO A;  2A2F X;  1IJ5 A;  1MMN A;  4MLK A;  1MIW A;  5FXW A;  3AAE B;  5M4Y A;  3OJA A;  1V9D A;  3KVB A;  5TAO A;  2IC6 A;  2WBL A;  3ZCJ A;  1D0Z A;  4Z8X A;  4PJN A;  1ZHC A;  1E1H B;  3MZK B;  2W63 A;  4PJL A;  3ZYM A;  3WUR A;  2C5I T;  2CWY A;  2X9W A;  3C64 A;  4KUM B;  4L9I A;  2JMK A;  4OFZ A;  2K5B B;  2KND A;  2YU2 A;  3N9M A;  3V5U A;  1U4Q A;  1X79 A;  2X9H A;  3CX7 B;  2NW9 A;  5FMN A;  3U78 A;  4H9O C;  3E08 A;  5H6R B;  1LVF A;  3BK9 A;  3KV9 A;  4FI5 A;  4U74 A;  4PK4 A;  4UF0 B;  5JR9 C;  2PFV A;  2DCF A;  4MHC A;  1HG5 A;  4ISS A;  4QXH B;  1BR0 A;  4AXP A;  3ZLI A;  2SPC A;  3KV5 A;  4HTE A;  2N2N A;  3ZCI A;  1HF8 A;  4HE8 A;  3KIN B;  1MMD A;  2DI4 A;  5LHI B;  2D2S A;  2NW8 A;  4PAG A;  4ZS2 A;  4X1Y E;  5H6Q B;  3NZP A;  1D1B A;  2W62 A;  3AA1 B;  4DBR A;  3WI3 A;  3AVR A;  3KV4 A;  4IE5 A;  2LE8 A;  2H7V C;  1VRB A;  5F8P A;  5JDH A;  3IF8 B;  1HG2 A;  2EHO C;  1WYB A;  3N5L A;  3CPZ A;  3NRX A;  3ZYK A;  3LG7 A;  4AQF A;  3VJZ A;  3MA9 A;  2C0S A;  4O4H E;  3AB3 B;  2LM9 A;  4YJ2 E;  4PJM A;  5EZY E;  3KV6 A;  3RKO A;  5HXE A;  3PE0 A;  2HPJ A;  2CMR A;  5ADX L;  4N78 D;  2ES0 A;  1HFA A;  1YKE B;  4QWN B;  2CM0 A;  1VOM A;  3AAI A;  2LT3 A;  2YK0 A;  5JVD E;  2LOS A;  2CXL A;  4EB6 E;  5LP6 E;  3WSC A;  2X9Y A;  2LHN A;  4AKG A;  2KIN B;  2IW5 B;  3PF0 A;  2XAS B;  3O1H A;  2RA1 A;  3IHR A;  2W00 A;  5F3J A;  1HS7 A;  3A5X A;  3LBX A;  4CI1 B;  2GK9 A;  4OK0 A;  3B57 A;  5FY7 A;  4DMW A;  2NOX A;  2VKD A;  2MBG A;  2V26 A;  3IBP A;  3OYX A;  4O2B E;  3ZN0 B;  2JMH A;  2LOP A;  2X0L B;  3ANW B;  4NUU A;  3N9Q A;  1IJ6 A;  1G8X A;  2N1G A;  1WRD A;  4TX5 A;  4X1I E;  2VKH A;  5HXS A;  2E9X A;  4C91 A;  3EUH A;  2W0G A;  3C51 A;  3DTO A;  3T8O A;  1QSD A;  1OXZ A;  5JH7 E;  1G73 A;  2K9A A;  2WAU A;  4H63 V;  5FXV A;  4B6X A;  5JDQ A;  1LVK A;  3GN5 A;  5L3C B;  3MK7 C;  3BQI A;  3FBL A;  3ZC1 A;  5C8Y E;  4EYU A;  3I1A A;  4QKN A;  1LRZ A;  2V1D B;  3RYI E;  5E0O A;  1YW0 A;  2LSY A;  2BVM A;  1UX4 A;  3WAJ A;  2Q9Q B;  2VAS A;  4IDZ A;  2BZB A;  5LNK A;  3LBX B;  1QUU A;  3RYC E;  5JRC A;  4QXB B;  2LJL A;  5J2U E;  5L3E B;  2JRK A;  2KZ7 B;  4ECG A;  2VK9 A;  3GMI A;  3OKQ A;  3SWH A;  3ZMU B;  2NWB A;  4UVB B;  2V7K A;  5FP3 A;  3PUG A;  3ZMS B;  4X20 E;  4CXY A;  3GWH A;  2UXX B;  2L3L A;  4HN9 A;  3CQC B;  2V7I A;  1O3X A;  3B13 A;  4CQI A;  4F6R C;  5JDL A;  3P8C D;  1WR6 A;  3RYH E;  5L2L A;  3GN5 B;  2MTC A;  2X67 A;  2YU1 A;  3C4Z A;  5LCY A;  2H7O A;  4ZS3 A;  1WLX A;  4WW0 A;  3K3N A;  3ONX A;  2XAQ B;  2ZLY A;  4G2A A;  3M1C A;  2NW7 A;  5JDN A;  1B7T A;  3N9L A;  2LSJ A;  4PK6 A;  2N9D A;  3MKD A;  1HCI A;  3CX8 B;  2BVL A;  4GYS A;  3AT7 A;  2D0T A;  3SOL A;  3FXE B;  3WAK A;  2CEA A;  4ANJ A;  3CX6 B;  2KLQ A;  4AKR B;  3VKH A;  3F31 A;  1KK7 A;  2D5U A;  3ETU A;  4HEA A;  5FXZ A;  3C4W A;  4FJO A;  2V7J A;  1MIY A;  4TZ4 C;  3SRZ A;  4JLE A;  3AAA B;  3RH3 A;  4EYY R;  3ZEF B;  3J9X 1;  4JEU B;  2XQY A;  4P0A A;  2DNX A;  3ESL A;  4AQF C;  4GYR A;  4QX7 B;  4MAL A;  3CQG B;  3E22 E;  4DBQ A;  3RRC A;  1MMG A;  4UIG A;  5JR9 A;  2X68 A;  3BQL A;  4L0R A;  2CA5 A;  3PUA A;  4WBO A;  2CXD A;  4AKL A;  1UCU A;  4PNI A;  1LKX A;  2X51 A;  4CZZ B;  5L3D B;  4PJJ A;  3SS1 A;  3K3Q C;  5DQW A;  5KX5 E;  4KBM B;  3PU3 A;  5LGT B;  3Q5W A;  4CXW A;  4ZI2 C;  3UUM A;  3ZN1 B;  2XUE A;  5JDM A;  3N9P A;  4JUY A;  3VKG A;  3LFM A;  1UX5 A;  1WYC A;  5LG4 A;  2Q9Q C;  4H9P C;  3HA4 A;  3HKE E;  3MXZ A;  3C50 A;  5LBQ B;  4O4L E;  5CA0 E;  4BGO A;  3I0O A;  3ZMT B;  4XZC A;  4YHJ A;  2EHO A;  3RC3 A;  3ZJ1 A;  3O1J A;  1CUN A;  4EXT A;  3FBZ A;  5EK3 A;  2LSK A;  4IHJ E;  4XBF B;  4ADZ A;  2E9X C;  5LBM A;  4G63 A;  3Q2M A;  1Y64 B;  3H37 A;  3U3I A;  2YIN A;  2E8I A;  3KBU A;  3KVA A;  2K24 A;  2JJ9 A;  4IIJ E;  4IE6 A;  3F57 A;  5LGN B;  1IZN B;  3RX6 A;  1SHZ C;  5LYJ E;  1MND A;  2J1D G;  3ETV A;  1FEW A;  3DP7 A;  3LK2 B;  2Y48 B;  4GOU A;  4QX8 B;  5KDM C;  3HKD E;  3PHF 1;  4E7S A;  2MYS A;  2Y8D A;  3OBV E;  4ZI2 D;  5J2T E;  2LEH A;  2UXN B;  5JDF A;  2VKO A;  2ODV A;  2XAJ B;  5J1G A;  5L3B B;  3LJC A;  2XHE B;  2V7L A;  2RP4 A;  4UV9 B;  2Q9Q D;  2WM9 A;  3RPU A;  2HPL A;  3I0Q A;  3JC6 C;  4M1P A;  3UUX B;  3FXD B;  2D0U A;  4O4J E;  1ZKE A;  2C5K T;  1HX8 A;  5JDG A;  4I4T E;  4QHO A;  3NBX X;  4EAH A;  4H9N C;  2H3R A;  2IAK A;  3UUN A;  3UUL A;  2WMN A;  5CA1 E;  4TV8 E;  4EOZ B;  2E9X D;  3OYZ A;  3PUS A;  4H9Q C;  4HGA A;  4EZH A;  1KNZ A;  2VB6 A;  3PU8 A;  4OHF A;  3RRW A;  3CWZ B;  2A72 A;  2E9X B;  2KWH A;  2VL8 A;  3O1I A;  4C90 A;  2XAH B;  3QC9 A;  1H7C A;  2PJQ A;  5LGU B;  4OYK A;  2C5J A;  4HKA A;  2MTQ A;  1YKH B;  3VHL A;  3O9X A;  3UT5 E;  1MNE A;  4K0U A;  2M67 A;  4KMC A;  2KWI B;  5LJM A;  1OWA A;  2PG8 A;  1FMV A;  4OYJ A;  2V7M A;  3M65 A;  3F2E A;  1SA0 E;  4CI3 B;  4EIW A;  1FIO A;  2CLY C;  4GK0 E;  4O8S A;  2HH7 A;  3FB2 A;  4A56 A;  5HXC A;  3HL6 A;  2LQU A;  2JQQ A;  4IE4 A;  4DMV A;  3N2G E;  3JC6 D;  3TKL B;  5EK2 A;  2L8K A;  2WSS V;  3S4U A;  2QA7 A;  5LHG B;  3N2K E;  3EDU A;  2Y6X A;  1S94 A;  5LOV E;  5JRC B;  4PFP A;  4I43 B;  5IYZ E;  2IC9 A;  3VU7 H;  4TUY E;  1AJ3 A;  3V5S A;  3CVR A;  2DHR A;  3DJB A;  4DND A;  5CB4 E;  5KMG P;  4IST A;  4AQG A;  3J7Y q;  4O4I E;  2LSI A;  2XTL A;  3RC8 A;  5HAX A;  4PK5 A;  3N9N A;  2K48 A;  4MBQ A;  4ZI7 E;  4WNK A;  5GON E;  2KXP B;  4E7Z A;  4UV8 B;  3NZQ A;  4V1A v;  5HWY A;  3I9Y A;  3MAC A;  4IE0 A;  5JRE A;  3ZYL A;  1T98 A;  3AVS A;  2B1E A;  3D0T A;  4YJ3 E;  4ZI3 C;  3PUQ A;  1EZ3 A;  5A1L A;  4AKI A;  5BMV E;  3HKC E;  2XAG B;  4KP3 C;  1D1C A;  2X66 A;  3ZMZ B;  2CLY B;  3Q5X A;  4U72 A;  4HFV A;  4EZ4 A;  3ZPO A;  1D0Y A;  2CXF A;  4UEM A;  1US7 B;  2JPF A;  2NTX A;  5ETW A;  2LHR A;  5LHH B;  3I9W A;  3KBT A;  4UVA B;  4PW8 A;  5LXT E;  4ONR A;  3ANW A;  2G0U A;  5LA6 E;  3N9O A;  4YLH A;  1HTJ F;  5HWX A;  2DWG A;  1ZV4 X;  1D0X A;  4ASK A;  1BR4 A;  4I50 E;  4O2A E;  3K3O A;  5AFU L;  1U5P A;  1FMW A;  1S35 A;  2CCQ A;  3C4X A;  2VWA A;  3EVY A;  5HYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...