5JDHA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 10 mm na+ and 10mm ca2+
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
Knots found
sequence length
301
structure length
297
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized membrane protein MJ0091
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 123
structure length 297
sequence length 301
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdhA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdhA02
5HXEA 5HWXA 5JDQA 5HXRA 5JDFA 3V5UA 5JDLA 5JDGA 5HWYA 5JDHA 5JDNA 3V5SA 5HXCA 5JDMA 5HXHA 5HXSA 5HYAA
chains in the Genus database with same CATH superfamily
3PU3A 5AQTB 2YK0A 1XDOA 4HFVA 3IA3A 5CJ5A 3Q5WA 2LSYA 5L47A 4DV3T 1W0AA 1L0VA 4EYUA 2XQ9A 2W67A 3QC9A 3RF1A 2BZBA 3IF8B 4DV7T 2KNDA 4NUVA 2LEHA 2ODUA 4GYSA 5AQFB 2KGXA 2WSSV 3ETUA 4AKHA 3R6NA 1G8XA 5HXEA 4JI5T 5LHHB 1ZP0A 2KWHA 1MMGA 4QKNA 3OKQA 3I9WA 4P09A 4A98A 3ZC0A 1WCRA 1H7CA 3IEEA 5LB7B 2LKGA 2JJ9A 5L2LA 3KVAA 4U31A 3O1HA 5JREA 1HF8A 1VRBA 5FNVE 2WU2A 5JR9A 1KNRA 2WP9A 1NAFA 5IYZE 3NZPA 1BR0A 4DUYT 3ZYKA 5J2TE 2VK9A 3ONXA 4F8HA 3QOFA 3F31A 2QVAA 4HWIB 1GQEA 5DABA 2LM2A 4H9RC 1V9DA 4H9SE 2CBIA 4W8PA 4HTEA 2XTLA 3CQGB 3NKZA 4IE6A 2KINB 4ZI3D 5J2UE 2HH7A 4QXCB 1HNWT 5F3JA 2KZ7B 4UVBB 2VVSA 3ZT7A 2BVMA 4CI2B 3ZYMA 4NPPA 3AE9A 3ONLC 2V6XA 4I4TE 1WRDA 4B3RT 2N9DA 3VRBA 2MYSA 5L3DB 1MIWA 5FVKA 1XMOT 1KEYA 3T1HT 4HWDA 4X65T 4JLEA 4M1PA 2HN1A 3CX6B 2LE8A 3C4ZA 3UT5E 2RP4A 4X1KE 2K5BB 3VJZA 5JQGE 3AVSA 3ZJ1A 4DBQA 3L39A 2OA5A 3AAEB 4AKRB 5LA6E 3WAKA 3HKBE 1D1BA 2ZMAA 2KVPA 4YHHT 1WYBA 4YLHA 2CHNA 4WBNE 2I59A 4IDPA 4GOUA 3C64A 5L4HA 5LNKA 1UX5A 3P4PA 2J1DG 4JI0T 2A3DA 2KXPB 3N2OA 3TLVA 3FXDB 2VQET 3C4XA 3RC3A 4EOZB 2YDRA 1D1CA 3PUWF 2NWBA 1MNEA 5FZTA 5HXCA 2H7VC 3RHWA 3CQXC 2D2SA 2JQ9A 4CXYA 3ZCJA 5AQHB 1OXZA 3FZKB 4TWHA 3VU7H 4EZ4A 4U7IA 2XQ8A 4YSZA 3D0TA 4HWFA 1J5ET 3MA9A 3PDYA 4U7YA 3UFGA 5AQUB 3L3PA 3ZPOA 2DWKA 3OBVE 2XQ4A 1LRZA 3K8PC 3RLFF 4ERRA 5HEOA 4P1NA 4YXDA 4P0AA 3T1YT 4JI6T 4BJNA 3K1SA 3K3QC 5E0OA 3PUGA 2BG9E 5AQJB 2XAJB 4GKJT 4QWNB 4H9QC 5C3JA 3KV9A 1XNRT 2W2UA 2YINA 5JDNA 1T8BA 3FZMB 4YTPA 3K3OA 4UV9B 3PUZF 5HWYA 4WNKA 2YEVC 3N2KE 2XPKA 3PURA 3FB2A 4XBFB 2UU9T 4IDNA 4PK4A 3Q5EA 5LGUB 4QHOA 5EZYE 4PJMA 2YU2A 2KSRA 2X0LB 4DR1T 3VKGA 3MKDA 3ZMTB 4MFRA 2W66A 2OLTA 2WM9A 4ONRA 3R84B 5LP6E 1VOMA 2E2AA 4X64T 2D0TA 4IDOA 3Q5XA 5HCMA 2VL8A 4ZHQE 5JDFA 3JAEA 1S94A 4AQYT 1W09A 4LMJA 1XMQT 1MIVA 5LHIB 5LJNA 2VL0A 4JI2T 2EHOD 3EAMA 5FYMA 1YKEB 2NP9A 1UX4A 2LHRA 4FI5A 1U5PA 3SRZA 4DV6T 2IC6A 5LMUT 1IJ5A 2NW9A 5T1DA 2XUEA 4ASKA 4HEAA 4KBMB 2CWOA 1E1HB 5LBQB 2V7KA 1UK5A 4UR9A 5IHYA 3FBLA 4EAHA 2WWVA 4U74A 2C0SA 4EYYR 4HKAA 5FY0A 5F8PA 4GK5E 1UGOA 3A5XA 2Y6XA 3SFDA 2XY8B 4ZXLA 4IIJE 1HR0T 2UXNB 1ZHCA 3HR0A 5JTGA 3RKGA 3ZC1A 2FJAA 4EXTA 4JI4T 4H9PC 3VR9A 4V1Av 2P9BA 4HFDA 4UV8B 1XWMA 3V5SA 4CN6A 3KV6A 4DR7T 5AQOB 1R8IA 3BQIA 3RIFA 4HFCA 4KUMB 2CWYA 4YHJA 3UFEA 4AKLA 5C2TA 5ABHA 1W9RA 3AY5A 1OWAA 4HE8A 5CGMA 5LMNT 3HA4A 3UUMA 4IREA 2YOEA 4LF6T 2QRXA 1NENA 1ZKEA 3PUSA 1DU2A 3RRWA 3PU8A 3PJAA 5BR8T 4X1IE 3KBUA 4KMCA 3DP7A 1YQ3A 2OV9A 3B5MA 2DHRA 2BS4A 4LF5T 4BA9A 2PJQA 4IE5A 3V5UA 2E8IA 4DBRA 3ZT5A 3QB5A 1I94T 3EDVA 4AXPA 4HWHA 2V7MA 2WBLA 4HFIA 3UUNA 4DR3T 5C8YE 3C4WA 3RYIE 3M1CA 5FKYA 4QH4A 4DR4T 2CXLA 4JEHB 4COFA 2BBJA 3MK7C 4XAXB 3PTRB 2QA7A 2JQHA 1KNZA 4PK5A 2FJEA 4EEDA 3H37A 4WZXA 3NWIA 2A72A 2NR4A 2UXXB 5AQIB 3IHRA 4NIQA 4ZS3A 4AI6A 1HNXT 2MAWA 2XAGB 2JPFA 2M6IA 4X62T 2MTQA 3UU3A 2CHOA 3ZSTA 1WR6A 3T8OA 4ANJA 4UIGA 3UQ4A 3OPCA 1Y64B 4ZI3C 3OTOT 2N2NA 1IBMT 4NXMT 3RIAA 3NBXX 5CB4E 4B3ST 2V5DA 2W63A 4YTNA 4IL9A 4O4LE 1IBLT 5HXRA 3RYHE 3VRAA 3RGLA 1WR0A 3I1AA 4U2ZA 5CA0E 1UCUA 4JEUB 2XSBA 3NRXA 3A7MA 2YDSA 5HAXA 1HCIA 3N9OA 3P4WA 5BMVE 2R6GF 4C91A 3CK6A 1WYCA 2UUCT 1MMDA 2DWGA 4TNVA 4JI1T 4ILBA 3UU5A 3AVRA 3MXZA 2FUPA 3E0ZA 5AQGB 4ILAA 3N9NA 3QUJA 4PK6A 1FEWA 3AE3A 4IE0A 2BS2A 2KLQA 2DNXA 5AQVB 3PF0A 3LJCA 2VKHA 1E7PA 2FJBA 3P8CD 1W0BA 4DUZT 5L3BB 2IHR1 2C5KT 4PAGA 5ETWA 3QK6A 2BKNA 3ABVA 4YTMA 3TLTA 2WMNA 3QNUA 4CI1B 2CXDA 4P0BA 3B13A 2RPAA 2H88A 2EHOB 3FZHB 5L4EA 4U33A 3ZJ2A 3AT7A 3PUXF 2FBWA 3F2EA 4CQIA 2KWIB 3AA1B 4GKKT 1MMAA 4ISTA 3KINB 3AE4A 4MLKA 2IDOB 2CLYB 5TAOA 3CMLA 5CA1E 4YT0A 3PUYF 3M3ZB 4GIWA 2XZEA 2XJ7A 3MZKB 5F5WA 4DR6T 3AE2A 4B6XA 3UUXB 4IGUA 4E7ZA 2K9AA 4OHFA 3EABA 2BS3A 3J7Yq 2KBBA 3TLUA 2AE9A 4TUYE 4Z8XA 3HKCE 2XM1A 3OYZA 5JRCA 2ACZA 2D0UA 3EUHA 3ANWA 3H3AA 2VVNA 4OYJA 4WYVA 4O8SA 5KDMC 4LMLA 3RRCA 4HFEA 5IUXA 1SE7A 2XAFB 2IAKA 5HEHA 1SJ8A 2LSIA 5H6RB 2HN2A 3AEGA 4WBOA 2H7OA 2CBJA 4KP3C 5ABEA 2NTXA 4MHCA 2L9QA 1QSDA 2WCAA 4BAYB 2ZM8A 4OYKA 1WLXA 1Z0PA 5AQMB 1VCSA 3QB5K 2XQAA 2UXCT 4YY3T 3MJXA 2WWUA 4A5XA 3RIUC 1UUSA 2BG9B 2WMOA 3GMIA 1BR4A 3AAAB 3KFWX 4C90A 4H63V 2V1DB 4OK0A 2M6BA 4AIUA 4ZI2D 2CRBA 1E2AA 4EGWA 1EZ3A 5L3GB 1N33T 3OJAA 2XQYA 2PFVA 1FMVA 4CI3B 3AE7A 2EHOC 2CXFA 4DV4T 4HGAA 4HFBA 4TWFA 1SJ7A 4OX9T 2IW5B 4PJLA 4AKGA 3L8RA 1QLBA 4AQFA 4YFSA 1NEKA 2N1GA 3AEAA 4JI8T 2CLYC 5FL0A 1HX8A 4HFHA 2V7JA 4JYAT 2LHNA 3AECA 4IE4A 1Z8UA 2W00A 3ZMSB 4UF0A 4B3MT 4TV9E 3FZFB 4N78D 3RIUA 3FZLB 3J9X1 3O1JA 2J62A 5FP3A 4I0UA 4CN4A 3AE6A 5FVLA 3UTKA 4Z90A 3UU4A 3UUBA 3C51A 4JUYA 1T72A 2LKHA 2PTFA 3OVUA 2XM2A 5LG3A 2BDEA 2D9DA 4IHJE 4AISA 3ZKRA 2EHOA 2WB5A 4PNIA 4DIDB 2UXBT 2JRKA 3WURA 4JV5T 2VKOA 2V6YB 4BJMA 2UUBT 1LVFA 1G73A 3PUAA 3GA8A 2LJLA 5GONE 2V26A 4JI3T 5HYAA 2DCFA 2DL1A 5H6QB 1OEDE 2VKJA 2FJDA 1N32T 3M65A 2V7IA 3CX8B 3KV5A 2BG9C 2LQUA 4DV1T 3RYCE 4WW0A 4ZZBA 5KX5E 4PJJA 3HKEE 4OFZA 2W62A 2VQFT 1SA0E 4X1YE 5EK4A 4L5GA 4UELA 5FXVA 2BBHA 1IZNB 1NWMX 4KHZF 2W0GA 3HL6A 3I9YA 3TLWA 2K3WA 4FJOA 3TKLB 1UURA 2ODVA 3B57A 3CWZB 4LF9T 3PUQA 2BKPA 4H9NC 2LOSA 1IJ6A 2X66A 4PJNA 2A9UA 3GN5B 3NZQA 3RI5A 4UEMA 4ZI7E 3RH3A 1FJGT 2L3LA 5FY1A 5FXZA 4I50E 2L7NA 3I0OA 2XQ3A 3KBTA 4H9OC 4MBQA 4U72A 2BG9A 3AE8A 5JRCB 3FYQA 5AQKB 5EK2A 4X5TA 2X9XA 5LCYA 2LRLA 3AEFA 3RYFE 3P4SA 2CA5A 1O3XA 3ESLA 5LYJE 3ANWB 4DV5T 2Q9QD 4U2YA 3RQWA 2X68A 5AQRB 4ZEYA 2E9XD 5FXXA 3SOLA 3JADA 2HHHT 5EK3A 3LSVA 4NUUA 3O9XA 1SUMB 5AQQB 2K24A 1XDPA 1N36T 2LLYA 1SHZC 3NVOA 4UVCB 4LF4T 2CM0A 3BK9A 4TN7B 4UVAB 1QUUA 1X79A 3K3NA 4EZHA 3ETVA 5HCJA 2X9WA 3JC6D 4YSYA 3LK42 5HEGA 3P4RA 2DLRA 2H89A 4DMWA 3RC8A 1MIYA 1XNQT 2KT9A 3LBXA 2MTCA 3EI0A 3EDUA 4Q25A 4J2CA 4E7SA 4O4JE 2LRKA 5KMGP 5JVDE 2C5IT 4ZS2A 3KV4A 2WY2A 3PUVF 4HWCA 2NTYA 4IDQA 2V8SV 4G2AA 4ECGA 3AB3B 3S4UA 1HFAA 3DYJA 3EHZA 4KHPT 3HI2A 3KVBA 3Q5DA 5AQPB 3ZMZB 3PE0A 5AQSB 2V6YA 4B3TT 3ZT6A 4CXXA 2MPKA 3OYXA 4LFCT 3AA7B 1OEDA 4AQGA 5A1LA 2MOZA 4UF0B 2WDVA 1N34T 5DQVA 2CE7A 3AE5A 5ABGA 3W15B 1XZYA 3L09A 1BR1A 1FIOA 1MMNA 2WDRA 4X66T 4ADZA 3DTOA 5AQNB 5AFUL 2PG8A 4XZCA 5ADXL 2Y8DA 4TX5A 4QX8B 1T98A 4DO0A 3VKHA 3AEBA 2VWAA 3N9PA 2XSAA 5FXWA 5LGNB 5FY7A 3E22E 3E08A 3WI3A 1HNZT 4PFOA 2YU1A 1US7B 3TLSA 2VURA 2E5VA 4G63A 3PJAJ 4JBWF 1MNDA 2JMKA 5DQWA 2X0CA 2HPLA 2V7LA 3AXJA 4A97A 2LSKA 1KNPA 3VR8A 4ILCA 4K0UA 1ZOYA 1HS7A 4EEBA 4TZ4C 2LT3A 1VCTA 4IL4A 3WAJA 2M67A 5JDQA 4NXNT 3GN5A 5HXHA 3G06A 1JNRA 1J5WA 2RA1A 1Y01A 1YD8G 2XQ6A 3AEEA 3ZN0B 3ZLIA 2Y48B 3RX6A 4DV2T 2WDQA 2VASA 4ZI2C 4Z91A 3CQCB 2YN6A 2CEAA 3UULA 1HG5A 5AQLB 3C98B 4H63H 2LOPA 2ZM0A 5JH7E 1T7SA 1IBKT 4DVDA 3JCFA 4CN1A 3Q9DA 2D5UA 5J0ZA 5FL1A 3P4QA 4DNDA 1YW0A 2C5JA 2JIWA 4A56A 1D0XA 4L9IA 5ABFB 2MBGA 4YJ3E 4LFAT 1FMWA 2A2FX 2X67A 4AQFC 3LDQB 2XAQB 2IIUA 5LOVE 2WZHA 2CCQA 1X9BA 4TV8E 1KFYA 3Q2MA 1CUNA 4DMVA 2G0UA 5L3CB 2H3RA 2XASB 4CZZB 3FXEB 2DI4A 3ZMUB 4O2BE 2K48A 3RPUA 5FMNA 4ZOLE 3CIRA 2ACXA 3LG7A 3ZN1B 5LHGB 5JDGA 2NW7A 4YJ2E 1YKHB 2Q9QB 3O1IA 3UU8A 2XHEB 2WS3A 4GYRA 2E9XB 2WAUA 4LMKA 1HX1B 1D0YA 5JDMA 2I0MA 4DR2T 2V5CA 5LG4A 2IC9A 2L8KA 4DR5T 2WZIA 2XQ7A 5LJMA 2UXDT 3ONJA 5LXTE 4DV0T 5L3EB 5JDHA 3LFMA 4UXNB 2YDQA 2CMRA 2CPTA 2ZM2A 2VB6A 1WFDA 2X0HA 4O4HE 5IWAT 2X51A 3SWHA 4GK0E 2UUAT 2NOXA 5KXJA 3BQLA 3ZYLA 3FBZA 2ES0A 3CX7B 1ZEEA 1YXRA 3CKDA 3LBXB 3A8YC 4EB6E 4LF8T 2ZM6T 1AJ3A 3O4XE 2WU5A 3AA6B 2IMLA 2X9YA 3F57A 3JAFA 4U3CA 5DJQC 2QYWA 4PFPA 3U3IA 2XQ5A 3SS1A 4YSXA 3CPZA 4BGOA 4I55E 4IDZA 3SFEA 4QH1A 4HN9A 2XAHB 3N9LA 5JDLA 3LK2B 2B76A 2B1EA 2QGSA 3EVYA 2ZLYA 1D1AA 3KDSE 3AAIA 2PBIA 1OEDB 2YKSA 4TNWA 2W4XA 3ZSSA 2I6HA 4L0RA 4QH5A 1M7KA 2LM9A 1KF6A 4ZZCA 2E5LT 5JR9B 3AEDA 3UU6A 4IT4A 4PW8A 3FHNA 1LKXA 2LSGA 1LVKA 1KK7A 3VHLA 1D0ZA 3ZMVB 3C50A 4IE7A 2AXDS 2HPJA 2JMHA 2VKDA 5LGTB 1S35A 3AA0B 1J1JA 2Q9QC 3HKDE 3BQKA 5J1GA 3GWHA 2E9XC 5HWXA 4LF7T 1JNZA 1U4QA 2BVLA 2J47A 2JQKA 3P50A 3LK3B 3PV0F 4X20E 3AXJB 2IUBA 5HEJA 1BR2A 4MALA 1I6ZA 3PHF1 5CFBA 2J4GA 3P7IA 2GK9A 2W61A 3CVRA 3ZEFB 5ABFA 4O4IE 4QXBB 1B7TA 1HG2A 4QX7B 4AKIA 1YQ4A 2X0YA 5LBMA 2JQQA 5M4YA 4EIWA 3WSCA 5L3FB 2X9HA 3JC6C 4I43B 1ZV4X 3N9QA 2KMFA 2L10A 3I0QA 3RQUA 4ISSA 4CXWA 4F6RC 2WQYA 2BKOA 2SPCA 4O2AE 3DJBA 3N5LA 1HTJF 3NRYA 4KX6A 3AE1A 2Q9QA 4TWDA 2Z6EA 3N2GE 2E9XA 3MACA 5HXSA 4ILUA 2F4VT 3X1DA 1CHUA 4KI0F 4F7GB 1M62A 3U78A 4QXHB 3RKOA 3N9MA 4JI7T 3H3MA 3IBPA 2NW8A 5HEUA 1OEDC 3ZCIA 1IAPA 3UQ7A 4EV6A 2LSJA 4K0KT 4LFBT 5JR9C
chains in the Genus database with same CATH topology
3PU3A 2XQYA 2YK0A 2PFVA 2HPLA 4IIJE 2V7LA 2UXNB 4HFVA 2LSKA 1ZHCA 4K0UA 1FMVA 3HR0A 4CI3B 1HS7A 2EHOC 4TZ4C 2CXFA 3Q5WA 4HGAA 2LT3A 2LSYA 3ZC1A 3WAJA 2M67A 4EXTA 4EYUA 4H9PC 4V1Av 2P9BA 2IW5B 3QC9A 5JDQA 4UV8B 4PJLA 2BZBA 3IF8B 3V5SA 3GN5A 5HXHA 4AKGA 3KV6A 2KNDA 4AQFA 2RA1A 4NUVA 4YFSA 3BQIA 1YD8G 2LEHA 2ODUA 4GYSA 2N1GA 2WSSV 3ETUA 4KUMB 4AKHA 2CWYA 3R6NA 3ZN0B 3ZLIA 2CLYC 1G8XA 2Y48B 4YHJA 1HX8A 3RX6A 3UFEA 2V7JA 4AKLA 2LHNA 2VASA 4ZI2C 5HXEA 4IE4A 5LHHB 2W00A 2KWHA 3CQCB 3ZMSB 1MMGA 4QKNA 4UF0A 1OWAA 3OKQA 3I9WA 4P09A 2CEAA 4HE8A 3UULA 1HG5A 3ZC0A 4TV9E 3C98B 4H63H 2LOPA 2ZM0A 3HA4A 3UUMA 5JH7E 1H7CA 4N78D 3IEEA 3J9X1 3O1JA 4DVDA 2JJ9A 5L2LA 5FP3A 1ZKEA 2D5UA 3PUSA 3Q9DA 3RRWA 3KVAA 3UTKA 3O1HA 4DNDA 5JREA 3PU8A 4X1IE 1HF8A 1VRBA 1YW0A 2C5JA 4A56A 5FNVE 1D0XA 3C51A 4L9IA 3KBUA 2MBGA 4YJ3E 4KMCA 4JUYA 1FMWA 2A2FX 2X67A 4AQFC 3DP7A 5JR9A 2XAQB 5LOVE 1NAFA 2DHRA 2BDEA 5IYZE 3NZPA 4BA9A 1BR0A 4IHJE 2CCQA 3ZYKA 2PJQA 4IE5A 2EHOA 2E8IA 4TV8E 3V5UA 4DBRA 5J2TE 4PNIA 2VK9A 3Q2MA 3ONXA 1CUNA 4DMVA 3EDVA 4AXPA 3F31A 2G0UA 2JRKA 3WURA 2VKOA 2V7MA 2WBLA 5L3CB 3UUNA 4BJMA 5DABA 2XASB 2H3RA 4CZZB 5C8YE 3FXEB 2DI4A 3C4WA 4H9RC 3RYIE 1LVFA 1V9DA 1G73A 4H9SE 4HTEA 2XTLA 3CQGB 3M1CA 3ZMUB 3PUAA 4IE6A 3GA8A 2LJLA 2KINB 5GONE 4O2BE 2CXLA 2K48A 2V26A 3RPUA 4ZI3D 5HYAA 2DCFA 4JEHB 5H6QB 5FMNA 5J2UE 4ZOLE 2HH7A 3MK7C 4QXCB 2ACXA 3LG7A 2KZ7B 4XAXB 3ZN1B 5F3JA 4UVBB 5LHGB 3PTRB 2NW7A 5JDGA 2VKJA 4YJ2E 2QA7A 1YKHB 2Q9QB 1KNZA 3O1IA 2BVMA 3M65A 2V7IA 4PK5A 2XHEB 4CI2B 3ZYMA 4GYRA 2E9XB 3H37A 2WAUA 2A72A 2UXXB 3IHRA 1D0YA 3CX8B 3KV5A 4ZS3A 4AI6A 5JDMA 2LQUA 4I4TE 1WRDA 5LG4A 2N9DA 2XAGB 2IC9A 2MYSA 2L8KA 5L3DB 1MIWA 2JPFA 4WW0A 3RYCE 2MTQA 4JLEA 5LJMA 4M1PA 5LXTE 5KX5E 5L3EB 5JDHA 3CX6B 2LE8A 4PJJA 3C4ZA 3HKEE 3LFMA 4OFZA 3UT5E 1WR6A 3T8OA 2W62A 4UXNB 1SA0E 4ANJA 2RP4A 4X1YE 2CMRA 4UIGA 4L5GA 5EK4A 2ZM2A 4UELA 2VB6A 4X1KE 2K5BB 1Y64B 5FXVA 4ZI3C 1IZNB 5JQGE 3VJZA 3AVSA 4O4HE 1NWMX 2W0GA 2N2NA 3ZJ1A 2X51A 3SWHA 4GK0E 4DBQA 2OA5A 3AAEB 3NBXX 2NOXA 5CB4E 4AKRB 5LA6E 2W63A 3HL6A 3BQLA 3I9YA 3WAKA 4O4LE 3HKBE 1D1BA 2ZMAA 3ZYLA 4FJOA 5HXRA 3RYHE 3TKLB 2ODVA 1WYBA 3B57A 3FBZA 3CWZB 4YLHA 3PUQA 2ES0A 3CX7B 4H9NC 1ZEEA 3I1AA 2LOSA 3CKDA 3LBXB 1IJ6A 4EB6E 4WBNE 1AJ3A 2X66A 3O4XE 4PJNA 2I59A 5CA0E 4GOUA 1UCUA 3AA6B 3C64A 4JEUB 5LNKA 3NRXA 3GN5B 3NZQA 2X9YA 3F57A 4UEMA 5DJQC 1UX5A 5HAXA 1HCIA 4ZI7E 3RH3A 3N9OA 4PFPA 3U3IA 2L3LA 5BMVE 2J1DG 5FY1A 3SS1A 4C91A 1WYCA 5FXZA 3CPZA 4I50E 2A3DA 1MMDA 2DWGA 2KXPB 3I0OA 4BGOA 3N2OA 3FXDB 3C4XA 3AVRA 3KBTA 3MXZA 4H9OC 4I55E 4MBQA 3RC3A 4IDZA 4EOZB 3E0ZA 4U72A 1D1CA 4HN9A 2XAHB 2NWBA 3N9LA 5JDLA 1MNEA 3N9NA 3LK2B 3QUJA 5JRCB 5HXCA 2H7VC 4PK6A 1FEWA 5EK2A 3CQXC 2X9XA 2D2SA 4IE0A 5LCYA 3RYFE 2KLQA 2DNXA 4CXYA 2CA5A 1O3XA 3ZCJA 1OXZA 3ESLA 5LYJE 2B1EA 2QGSA 3ANWB 3EVYA 2ZLYA 2Q9QD 1D1AA 3KDSE 3VU7H 2X68A 3AAIA 2PBIA 4EZ4A 3PF0A 3LJCA 2VKHA 2E9XD 3D0TA 3P8CD 5FXXA 3SOLA 5L3BB 5EK3A 3MA9A 3PDYA 2C5KT 4PAGA 4NUUA 5ETWA 3O9XA 3QK6A 4L0RA 2LM9A 2WMNA 3L3PA 3ZPOA 2DWKA 3OBVE 5JR9B 4CI1B 2K24A 1LRZA 2CXDA 3K8PC 4P0BA 4PW8A 3B13A 1SHZC 4ERRA 3FHNA 1LKXA 2EHOB 4P0AA 2LSGA 1LVKA 4UVCB 1KK7A 2CM0A 4BJNA 3ZJ2A 3K3QC 3BK9A 4TN7B 3VHLA 1D0ZA 3AT7A 4UVAB 3ZMVB 3C50A 1QUUA 1X79A 5E0OA 4IE7A 2HPJA 2JMHA 3F2EA 3PUGA 3K3NA 2VKDA 4EZHA 4CQIA 2KWIB 3ETVA 5LGTB 1S35A 3AA1B 3AA0B 2X9WA 3JC6D 1MMAA 2Q9QC 2XAJB 3HKDE 4ISTA 3BQKA 3LK42 5J1GA 4QWNB 4H9QC 3KV9A 3GWHA 3KINB 2E9XC 5HWXA 2DLRA 4MLKA 1U4QA 4DMWA 2BVLA 2CLYB 5DQWA 5TAOA 3RC8A 2YINA 5JDNA 3LK3B 3CMLA 1MIYA 5CA1E 2KT9A 3LBXA 2MTCA 3K3OA 3EDUA 4GIWA 4UV9B 4J2CA 4E7SA 4O4JE 5KMGP 5HWYA 4X20E 4WNKA 2YEVC 3PHF1 5JVDE 2C5IT 1BR2A 4MALA 3KV4A 4ZS2A 3MZKB 3N2KE 4B6XA 3PURA 3UUXB 3P7IA 3FB2A 4IGUA 2GK9A 2W61A 4XBFB 2NTYA 3CVRA 4E7ZA 3ZEFB 2K9AA 4O4IE 4OHFA 4PK4A 4QXBB 1B7TA 5LGUB 4G2AA 4QHOA 5EZYE 1HG2A 4QX7B 3J7Yq 4AKIA 4PJMA 4ECGA 3AB3B 2YU2A 3S4UA 5LBMA 1HFAA 2JQQA 5M4YA 4EIWA 2X0LB 4TUYE 4Z8XA 3MKDA 3VKGA 3HI2A 5L3FB 3WSCA 3HKCE 2X9HA 3ZMTB 3OYZA 3KVBA 4MFRA 3JC6C 5JRCA 4I43B 3ZMZB 1ZV4X 2D0UA 3PE0A 3N9QA 3EUHA 2KMFA 2WM9A 3ANWA 3I0QA 4CXXA 4ONRA 3H3AA 3R84B 4OYJA 5LP6E 1VOMA 4O8SA 2D0TA 3OYXA 5KDMC 3Q5XA 3AA7B 2VL8A 4ISSA 3RRCA 4CXWA 4F6RC 4AQGA 5A1LA 2MOZA 4UF0B 2XAFB 2IAKA 5DQVA 2SPCA 4O2AE 2CE7A 4ZHQE 5JDFA 3DJBA 2LSIA 3N5LA 5H6RB 1S94A 1HTJF 3NRYA 3W15B 4WBOA 2H7OA 3L09A 1BR1A 1FIOA 1MMNA 4KP3C 2Q9QA 2Z6EA 1MIVA 5LHIB 2NTXA 5LJNA 4ADZA 3DTOA 3N2GE 5AFUL 2PG8A 4MHCA 4XZCA 2E9XA 2EHOD 3MACA 5FYMA 5ADXL 5HXSA 4ILUA 2L9QA 2Y8DA 1QSDA 1YKEB 4BAYB 4TX5A 4QX8B 1T98A 2NP9A 2ZM8A 4OYKA 1WLXA 1Z0PA 4DO0A 1UX4A 2LHRA 3VKHA 4FI5A 1U5PA 3SRZA 2IC6A 2VWAA 1IJ5A 3N9PA 2NW9A 3MJXA 5FXWA 3U78A 5LGNB 2WWUA 4QXHB 5T1DA 2XUEA 4ASKA 4HEAA 4KBMB 2CWOA 3RKOA 5FY7A 1E1HB 5LBQB 3N9MA 3E22E 2V7KA 3E08A 3IBPA 2NW8A 2WMOA 3GMIA 1BR4A 5IHYA 3AAAB 3KFWX 3WI3A 3ZCIA 4H63V 1IAPA 3FBLA 4C90A 4EAHA 4PFOA 4U74A 2YU1A 1US7B 2V1DB 4OK0A 2C0SA 4EYYR 2LSJA 4HKAA 5FY0A 5F8PA 4GK5E 3A5XA 4G63A 4ZI2D 1EZ3A 5L3GB 2Y6XA 1MNDA 2JMKA 3OJAA 5JR9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXE A;  5HWX A;  5JDQ A;  5HXR A;  5JDF A;  3V5U A;  5JDL A;  5JDG A;  5HWY A;  5JDH A;  5JDN A;  3V5S A;  5HXC A;  5JDM A;  5HXH A;  5HXS A;  5HYA A; 
#chains in the Genus database with same CATH topology
 3PU3 A;  5AQT B;  2YK0 A;  1XDO A;  4HFV A;  3IA3 A;  5CJ5 A;  3Q5W A;  2LSY A;  5L47 A;  4DV3 T;  1W0A A;  1L0V A;  4EYU A;  2XQ9 A;  2W67 A;  3QC9 A;  3RF1 A;  2BZB A;  3IF8 B;  4DV7 T;  2KND A;  4NUV A;  2LEH A;  2ODU A;  4GYS A;  5AQF B;  2KGX A;  2WSS V;  3ETU A;  4AKH A;  3R6N A;  1G8X A;  5HXE A;  4JI5 T;  5LHH B;  1ZP0 A;  2KWH A;  1MMG A;  4QKN A;  3OKQ A;  3I9W A;  4P09 A;  4A98 A;  3ZC0 A;  1WCR A;  1H7C A;  3IEE A;  5LB7 B;  2LKG A;  2JJ9 A;  5L2L A;  3KVA A;  4U31 A;  3O1H A;  5JRE A;  1HF8 A;  1VRB A;  5FNV E;  2WU2 A;  5JR9 A;  1KNR A;  2WP9 A;  1NAF A;  5IYZ E;  3NZP A;  1BR0 A;  4DUY T;  3ZYK A;  5J2T E;  2VK9 A;  3ONX A;  4F8H A;  3QOF A;  3F31 A;  2QVA A;  4HWI B;  1GQE A;  5DAB A;  2LM2 A;  4H9R C;  1V9D A;  4H9S E;  2CBI A;  4W8P A;  4HTE A;  2XTL A;  3CQG B;  3NKZ A;  4IE6 A;  2KIN B;  4ZI3 D;  5J2U E;  2HH7 A;  4QXC B;  1HNW T;  5F3J A;  2KZ7 B;  4UVB B;  2VVS A;  3ZT7 A;  2BVM A;  4CI2 B;  3ZYM A;  4NPP A;  3AE9 A;  3ONL C;  2V6X A;  4I4T E;  1WRD A;  4B3R T;  2N9D A;  3VRB A;  2MYS A;  5L3D B;  1MIW A;  5FVK A;  1XMO T;  1KEY A;  3T1H T;  4HWD A;  4X65 T;  4JLE A;  4M1P A;  2HN1 A;  3CX6 B;  2LE8 A;  3C4Z A;  3UT5 E;  2RP4 A;  4X1K E;  2K5B B;  3VJZ A;  5JQG E;  3AVS A;  3ZJ1 A;  4DBQ A;  3L39 A;  2OA5 A;  3AAE B;  4AKR B;  5LA6 E;  3WAK A;  3HKB E;  1D1B A;  2ZMA A;  2KVP A;  4YHH T;  1WYB A;  4YLH A;  2CHN A;  4WBN E;  2I59 A;  4IDP A;  4GOU A;  3C64 A;  5L4H A;  5LNK A;  1UX5 A;  3P4P A;  2J1D G;  4JI0 T;  2A3D A;  2KXP B;  3N2O A;  3TLV A;  3FXD B;  2VQE T;  3C4X A;  3RC3 A;  4EOZ B;  2YDR A;  1D1C A;  3PUW F;  2NWB A;  1MNE A;  5FZT A;  5HXC A;  2H7V C;  3RHW A;  3CQX C;  2D2S A;  2JQ9 A;  4CXY A;  3ZCJ A;  5AQH B;  1OXZ A;  3FZK B;  4TWH A;  3VU7 H;  4EZ4 A;  4U7I A;  2XQ8 A;  4YSZ A;  3D0T A;  4HWF A;  1J5E T;  3MA9 A;  3PDY A;  4U7Y A;  3UFG A;  5AQU B;  3L3P A;  3ZPO A;  2DWK A;  3OBV E;  2XQ4 A;  1LRZ A;  3K8P C;  3RLF F;  4ERR A;  5HEO A;  4P1N A;  4YXD A;  4P0A A;  3T1Y T;  4JI6 T;  4BJN A;  3K1S A;  3K3Q C;  5E0O A;  3PUG A;  2BG9 E;  5AQJ B;  2XAJ B;  4GKJ T;  4QWN B;  4H9Q C;  5C3J A;  3KV9 A;  1XNR T;  2W2U A;  2YIN A;  5JDN A;  1T8B A;  3FZM B;  4YTP A;  3K3O A;  4UV9 B;  3PUZ F;  5HWY A;  4WNK A;  2YEV C;  3N2K E;  2XPK A;  3PUR A;  3FB2 A;  4XBF B;  2UU9 T;  4IDN A;  4PK4 A;  3Q5E A;  5LGU B;  4QHO A;  5EZY E;  4PJM A;  2YU2 A;  2KSR A;  2X0L B;  4DR1 T;  3VKG A;  3MKD A;  3ZMT B;  4MFR A;  2W66 A;  2OLT A;  2WM9 A;  4ONR A;  3R84 B;  5LP6 E;  1VOM A;  2E2A A;  4X64 T;  2D0T A;  4IDO A;  3Q5X A;  5HCM A;  2VL8 A;  4ZHQ E;  5JDF A;  3JAE A;  1S94 A;  4AQY T;  1W09 A;  4LMJ A;  1XMQ T;  1MIV A;  5LHI B;  5LJN A;  2VL0 A;  4JI2 T;  2EHO D;  3EAM A;  5FYM A;  1YKE B;  2NP9 A;  1UX4 A;  2LHR A;  4FI5 A;  1U5P A;  3SRZ A;  4DV6 T;  2IC6 A;  5LMU T;  1IJ5 A;  2NW9 A;  5T1D A;  2XUE A;  4ASK A;  4HEA A;  4KBM B;  2CWO A;  1E1H B;  5LBQ B;  2V7K A;  1UK5 A;  4UR9 A;  5IHY A;  3FBL A;  4EAH A;  2WWV A;  4U74 A;  2C0S A;  4EYY R;  4HKA A;  5FY0 A;  5F8P A;  4GK5 E;  1UGO A;  3A5X A;  2Y6X A;  3SFD A;  2XY8 B;  4ZXL A;  4IIJ E;  1HR0 T;  2UXN B;  1ZHC A;  3HR0 A;  5JTG A;  3RKG A;  3ZC1 A;  2FJA A;  4EXT A;  4JI4 T;  4H9P C;  3VR9 A;  4V1A v;  2P9B A;  4HFD A;  4UV8 B;  1XWM A;  3V5S A;  4CN6 A;  3KV6 A;  4DR7 T;  5AQO B;  1R8I A;  3BQI A;  3RIF A;  4HFC A;  4KUM B;  2CWY A;  4YHJ A;  3UFE A;  4AKL A;  5C2T A;  5ABH A;  1W9R A;  3AY5 A;  1OWA A;  4HE8 A;  5CGM A;  5LMN T;  3HA4 A;  3UUM A;  4IRE A;  2YOE A;  4LF6 T;  2QRX A;  1NEN A;  1ZKE A;  3PUS A;  1DU2 A;  3RRW A;  3PU8 A;  3PJA A;  5BR8 T;  4X1I E;  3KBU A;  4KMC A;  3DP7 A;  1YQ3 A;  2OV9 A;  3B5M A;  2DHR A;  2BS4 A;  4LF5 T;  4BA9 A;  2PJQ A;  4IE5 A;  3V5U A;  2E8I A;  4DBR A;  3ZT5 A;  3QB5 A;  1I94 T;  3EDV A;  4AXP A;  4HWH A;  2V7M A;  2WBL A;  4HFI A;  3UUN A;  4DR3 T;  5C8Y E;  3C4W A;  3RYI E;  3M1C A;  5FKY A;  4QH4 A;  4DR4 T;  2CXL A;  4JEH B;  4COF A;  2BBJ A;  3MK7 C;  4XAX B;  3PTR B;  2QA7 A;  2JQH A;  1KNZ A;  4PK5 A;  2FJE A;  4EED A;  3H37 A;  4WZX A;  3NWI A;  2A72 A;  2NR4 A;  2UXX B;  5AQI B;  3IHR A;  4NIQ A;  4ZS3 A;  4AI6 A;  1HNX T;  2MAW A;  2XAG B;  2JPF A;  2M6I A;  4X62 T;  2MTQ A;  3UU3 A;  2CHO A;  3ZST A;  1WR6 A;  3T8O A;  4ANJ A;  4UIG A;  3UQ4 A;  3OPC A;  1Y64 B;  4ZI3 C;  3OTO T;  2N2N A;  1IBM T;  4NXM T;  3RIA A;  3NBX X;  5CB4 E;  4B3S T;  2V5D A;  2W63 A;  4YTN A;  4IL9 A;  4O4L E;  1IBL T;  5HXR A;  3RYH E;  3VRA A;  3RGL A;  1WR0 A;  3I1A A;  4U2Z A;  5CA0 E;  1UCU A;  4JEU B;  2XSB A;  3NRX A;  3A7M A;  2YDS A;  5HAX A;  1HCI A;  3N9O A;  3P4W A;  5BMV E;  2R6G F;  4C91 A;  3CK6 A;  1WYC A;  2UUC T;  1MMD A;  2DWG A;  4TNV A;  4JI1 T;  4ILB A;  3UU5 A;  3AVR A;  3MXZ A;  2FUP A;  3E0Z A;  5AQG B;  4ILA A;  3N9N A;  3QUJ A;  4PK6 A;  1FEW A;  3AE3 A;  4IE0 A;  2BS2 A;  2KLQ A;  2DNX A;  5AQV B;  3PF0 A;  3LJC A;  2VKH A;  1E7P A;  2FJB A;  3P8C D;  1W0B A;  4DUZ T;  5L3B B;  2IHR 1;  2C5K T;  4PAG A;  5ETW A;  3QK6 A;  2BKN A;  3ABV A;  4YTM A;  3TLT A;  2WMN A;  3QNU A;  4CI1 B;  2CXD A;  4P0B A;  3B13 A;  2RPA A;  2H88 A;  2EHO B;  3FZH B;  5L4E A;  4U33 A;  3ZJ2 A;  3AT7 A;  3PUX F;  2FBW A;  3F2E A;  4CQI A;  2KWI B;  3AA1 B;  4GKK T;  1MMA A;  4IST A;  3KIN B;  3AE4 A;  4MLK A;  2IDO B;  2CLY B;  5TAO A;  3CML A;  5CA1 E;  4YT0 A;  3PUY F;  3M3Z B;  4GIW A;  2XZE A;  2XJ7 A;  3MZK B;  5F5W A;  4DR6 T;  3AE2 A;  4B6X A;  3UUX B;  4IGU A;  4E7Z A;  2K9A A;  4OHF A;  3EAB A;  2BS3 A;  3J7Y q;  2KBB A;  3TLU A;  2AE9 A;  4TUY E;  4Z8X A;  3HKC E;  2XM1 A;  3OYZ A;  5JRC A;  2ACZ A;  2D0U A;  3EUH A;  3ANW A;  3H3A A;  2VVN A;  4OYJ A;  4WYV A;  4O8S A;  5KDM C;  4LML A;  3RRC A;  4HFE A;  5IUX A;  1SE7 A;  2XAF B;  2IAK A;  5HEH A;  1SJ8 A;  2LSI A;  5H6R B;  2HN2 A;  3AEG A;  4WBO A;  2H7O A;  2CBJ A;  4KP3 C;  5ABE A;  2NTX A;  4MHC A;  2L9Q A;  1QSD A;  2WCA A;  4BAY B;  2ZM8 A;  4OYK A;  1WLX A;  1Z0P A;  5AQM B;  1VCS A;  3QB5 K;  2XQA A;  2UXC T;  4YY3 T;  3MJX A;  2WWU A;  4A5X A;  3RIU C;  1UUS A;  2BG9 B;  2WMO A;  3GMI A;  1BR4 A;  3AAA B;  3KFW X;  4C90 A;  4H63 V;  2V1D B;  4OK0 A;  2M6B A;  4AIU A;  4ZI2 D;  2CRB A;  1E2A A;  4EGW A;  1EZ3 A;  5L3G B;  1N33 T;  3OJA A;  2XQY A;  2PFV A;  1FMV A;  4CI3 B;  3AE7 A;  2EHO C;  2CXF A;  4DV4 T;  4HGA A;  4HFB A;  4TWF A;  1SJ7 A;  4OX9 T;  2IW5 B;  4PJL A;  4AKG A;  3L8R A;  1QLB A;  4AQF A;  4YFS A;  1NEK A;  2N1G A;  3AEA A;  4JI8 T;  2CLY C;  5FL0 A;  1HX8 A;  4HFH A;  2V7J A;  4JYA T;  2LHN A;  3AEC A;  4IE4 A;  1Z8U A;  2W00 A;  3ZMS B;  4UF0 A;  4B3M T;  4TV9 E;  3FZF B;  4N78 D;  3RIU A;  3FZL B;  3J9X 1;  3O1J A;  2J62 A;  5FP3 A;  4I0U A;  4CN4 A;  3AE6 A;  5FVL A;  3UTK A;  4Z90 A;  3UU4 A;  3UUB A;  3C51 A;  4JUY A;  1T72 A;  2LKH A;  2PTF A;  3OVU A;  2XM2 A;  5LG3 A;  2BDE A;  2D9D A;  4IHJ E;  4AIS A;  3ZKR A;  2EHO A;  2WB5 A;  4PNI A;  4DID B;  2UXB T;  2JRK A;  3WUR A;  4JV5 T;  2VKO A;  2V6Y B;  4BJM A;  2UUB T;  1LVF A;  1G73 A;  3PUA A;  3GA8 A;  2LJL A;  5GON E;  2V26 A;  4JI3 T;  5HYA A;  2DCF A;  2DL1 A;  5H6Q B;  1OED E;  2VKJ A;  2FJD A;  1N32 T;  3M65 A;  2V7I A;  3CX8 B;  3KV5 A;  2BG9 C;  2LQU A;  4DV1 T;  3RYC E;  4WW0 A;  4ZZB A;  5KX5 E;  4PJJ A;  3HKE E;  4OFZ A;  2W62 A;  2VQF T;  1SA0 E;  4X1Y E;  5EK4 A;  4L5G A;  4UEL A;  5FXV A;  2BBH A;  1IZN B;  1NWM X;  4KHZ F;  2W0G A;  3HL6 A;  3I9Y A;  3TLW A;  2K3W A;  4FJO A;  3TKL B;  1UUR A;  2ODV A;  3B57 A;  3CWZ B;  4LF9 T;  3PUQ A;  2BKP A;  4H9N C;  2LOS A;  1IJ6 A;  2X66 A;  4PJN A;  2A9U A;  3GN5 B;  3NZQ A;  3RI5 A;  4UEM A;  4ZI7 E;  3RH3 A;  1FJG T;  2L3L A;  5FY1 A;  5FXZ A;  4I50 E;  2L7N A;  3I0O A;  2XQ3 A;  3KBT A;  4H9O C;  4MBQ A;  4U72 A;  2BG9 A;  3AE8 A;  5JRC B;  3FYQ A;  5AQK B;  5EK2 A;  4X5T A;  2X9X A;  5LCY A;  2LRL A;  3AEF A;  3RYF E;  3P4S A;  2CA5 A;  1O3X A;  3ESL A;  5LYJ E;  3ANW B;  4DV5 T;  2Q9Q D;  4U2Y A;  3RQW A;  2X68 A;  5AQR B;  4ZEY A;  2E9X D;  5FXX A;  3SOL A;  3JAD A;  2HHH T;  5EK3 A;  3LSV A;  4NUU A;  3O9X A;  1SUM B;  5AQQ B;  2K24 A;  1XDP A;  1N36 T;  2LLY A;  1SHZ C;  3NVO A;  4UVC B;  4LF4 T;  2CM0 A;  3BK9 A;  4TN7 B;  4UVA B;  1QUU A;  1X79 A;  3K3N A;  4EZH A;  3ETV A;  5HCJ A;  2X9W A;  3JC6 D;  4YSY A;  3LK4 2;  5HEG A;  3P4R A;  2DLR A;  2H89 A;  4DMW A;  3RC8 A;  1MIY A;  1XNQ T;  2KT9 A;  3LBX A;  2MTC A;  3EI0 A;  3EDU A;  4Q25 A;  4J2C A;  4E7S A;  4O4J E;  2LRK A;  5KMG P;  5JVD E;  2C5I T;  4ZS2 A;  3KV4 A;  2WY2 A;  3PUV F;  4HWC A;  2NTY A;  4IDQ A;  2V8S V;  4G2A A;  4ECG A;  3AB3 B;  3S4U A;  1HFA A;  3DYJ A;  3EHZ A;  4KHP T;  3HI2 A;  3KVB A;  3Q5D A;  5AQP B;  3ZMZ B;  3PE0 A;  5AQS B;  2V6Y A;  4B3T T;  3ZT6 A;  4CXX A;  2MPK A;  3OYX A;  4LFC T;  3AA7 B;  1OED A;  4AQG A;  5A1L A;  2MOZ A;  4UF0 B;  2WDV A;  1N34 T;  5DQV A;  2CE7 A;  3AE5 A;  5ABG A;  3W15 B;  1XZY A;  3L09 A;  1BR1 A;  1FIO A;  1MMN A;  2WDR A;  4X66 T;  4ADZ A;  3DTO A;  5AQN B;  5AFU L;  2PG8 A;  4XZC A;  5ADX L;  2Y8D A;  4TX5 A;  4QX8 B;  1T98 A;  4DO0 A;  3VKH A;  3AEB A;  2VWA A;  3N9P A;  2XSA A;  5FXW A;  5LGN B;  5FY7 A;  3E22 E;  3E08 A;  3WI3 A;  1HNZ T;  4PFO A;  2YU1 A;  1US7 B;  3TLS A;  2VUR A;  2E5V A;  4G63 A;  3PJA J;  4JBW F;  1MND A;  2JMK A;  5DQW A;  2X0C A;  2HPL A;  2V7L A;  3AXJ A;  4A97 A;  2LSK A;  1KNP A;  3VR8 A;  4ILC A;  4K0U A;  1ZOY A;  1HS7 A;  4EEB A;  4TZ4 C;  2LT3 A;  1VCT A;  4IL4 A;  3WAJ A;  2M67 A;  5JDQ A;  4NXN T;  3GN5 A;  5HXH A;  3G06 A;  1JNR A;  1J5W A;  2RA1 A;  1Y01 A;  1YD8 G;  2XQ6 A;  3AEE A;  3ZN0 B;  3ZLI A;  2Y48 B;  3RX6 A;  4DV2 T;  2WDQ A;  2VAS A;  4ZI2 C;  4Z91 A;  3CQC B;  2YN6 A;  2CEA A;  3UUL A;  1HG5 A;  5AQL B;  3C98 B;  4H63 H;  2LOP A;  2ZM0 A;  5JH7 E;  1T7S A;  1IBK T;  4DVD A;  3JCF A;  4CN1 A;  3Q9D A;  2D5U A;  5J0Z A;  5FL1 A;  3P4Q A;  4DND A;  1YW0 A;  2C5J A;  2JIW A;  4A56 A;  1D0X A;  4L9I A;  5ABF B;  2MBG A;  4YJ3 E;  4LFA T;  1FMW A;  2A2F X;  2X67 A;  4AQF C;  3LDQ B;  2XAQ B;  2IIU A;  5LOV E;  2WZH A;  2CCQ A;  1X9B A;  4TV8 E;  1KFY A;  3Q2M A;  1CUN A;  4DMV A;  2G0U A;  5L3C B;  2H3R A;  2XAS B;  4CZZ B;  3FXE B;  2DI4 A;  3ZMU B;  4O2B E;  2K48 A;  3RPU A;  5FMN A;  4ZOL E;  3CIR A;  2ACX A;  3LG7 A;  3ZN1 B;  5LHG B;  5JDG A;  2NW7 A;  4YJ2 E;  1YKH B;  2Q9Q B;  3O1I A;  3UU8 A;  2XHE B;  2WS3 A;  4GYR A;  2E9X B;  2WAU A;  4LMK A;  1HX1 B;  1D0Y A;  5JDM A;  2I0M A;  4DR2 T;  2V5C A;  5LG4 A;  2IC9 A;  2L8K A;  4DR5 T;  2WZI A;  2XQ7 A;  5LJM A;  2UXD T;  3ONJ A;  5LXT E;  4DV0 T;  5L3E B;  5JDH A;  3LFM A;  4UXN B;  2YDQ A;  2CMR A;  2CPT A;  2ZM2 A;  2VB6 A;  1WFD A;  2X0H A;  4O4H E;  5IWA T;  2X51 A;  3SWH A;  4GK0 E;  2UUA T;  2NOX A;  5KXJ A;  3BQL A;  3ZYL A;  3FBZ A;  2ES0 A;  3CX7 B;  1ZEE A;  1YXR A;  3CKD A;  3LBX B;  3A8Y C;  4EB6 E;  4LF8 T;  2ZM6 T;  1AJ3 A;  3O4X E;  2WU5 A;  3AA6 B;  2IML A;  2X9Y A;  3F57 A;  3JAF A;  4U3C A;  5DJQ C;  2QYW A;  4PFP A;  3U3I A;  2XQ5 A;  3SS1 A;  4YSX A;  3CPZ A;  4BGO A;  4I55 E;  4IDZ A;  3SFE A;  4QH1 A;  4HN9 A;  2XAH B;  3N9L A;  5JDL A;  3LK2 B;  2B76 A;  2B1E A;  2QGS A;  3EVY A;  2ZLY A;  1D1A A;  3KDS E;  3AAI A;  2PBI A;  1OED B;  2YKS A;  4TNW A;  2W4X A;  3ZSS A;  2I6H A;  4L0R A;  4QH5 A;  1M7K A;  2LM9 A;  1KF6 A;  4ZZC A;  2E5L T;  5JR9 B;  3AED A;  3UU6 A;  4IT4 A;  4PW8 A;  3FHN A;  1LKX A;  2LSG A;  1LVK A;  1KK7 A;  3VHL A;  1D0Z A;  3ZMV B;  3C50 A;  4IE7 A;  2AXD S;  2HPJ A;  2JMH A;  2VKD A;  5LGT B;  1S35 A;  3AA0 B;  1J1J A;  2Q9Q C;  3HKD E;  3BQK A;  5J1G A;  3GWH A;  2E9X C;  5HWX A;  4LF7 T;  1JNZ A;  1U4Q A;  2BVL A;  2J47 A;  2JQK A;  3P50 A;  3LK3 B;  3PV0 F;  4X20 E;  3AXJ B;  2IUB A;  5HEJ A;  1BR2 A;  4MAL A;  1I6Z A;  3PHF 1;  5CFB A;  2J4G A;  3P7I A;  2GK9 A;  2W61 A;  3CVR A;  3ZEF B;  5ABF A;  4O4I E;  4QXB B;  1B7T A;  1HG2 A;  4QX7 B;  4AKI A;  1YQ4 A;  2X0Y A;  5LBM A;  2JQQ A;  5M4Y A;  4EIW A;  3WSC A;  5L3F B;  2X9H A;  3JC6 C;  4I43 B;  1ZV4 X;  3N9Q A;  2KMF A;  2L10 A;  3I0Q A;  3RQU A;  4ISS A;  4CXW A;  4F6R C;  2WQY A;  2BKO A;  2SPC A;  4O2A E;  3DJB A;  3N5L A;  1HTJ F;  3NRY A;  4KX6 A;  3AE1 A;  2Q9Q A;  4TWD A;  2Z6E A;  3N2G E;  2E9X A;  3MAC A;  5HXS A;  4ILU A;  2F4V T;  3X1D A;  1CHU A;  4KI0 F;  4F7G B;  1M62 A;  3U78 A;  4QXH B;  3RKO A;  3N9M A;  4JI7 T;  3H3M A;  3IBP A;  2NW8 A;  5HEU A;  1OED C;  3ZCI A;  1IAP A;  3UQ7 A;  4EV6 A;  2LSJ A;  4K0K T;  4LFB T;  5JR9 C; 
#chains in the Genus database with same CATH homology
 3PU3 A;  2XQY A;  2YK0 A;  2PFV A;  2HPL A;  4IIJ E;  2V7L A;  2UXN B;  4HFV A;  2LSK A;  1ZHC A;  4K0U A;  1FMV A;  3HR0 A;  4CI3 B;  1HS7 A;  2EHO C;  4TZ4 C;  2CXF A;  3Q5W A;  4HGA A;  2LT3 A;  2LSY A;  3ZC1 A;  3WAJ A;  2M67 A;  4EXT A;  4EYU A;  4H9P C;  4V1A v;  2P9B A;  2IW5 B;  3QC9 A;  5JDQ A;  4UV8 B;  4PJL A;  2BZB A;  3IF8 B;  3V5S A;  3GN5 A;  5HXH A;  4AKG A;  3KV6 A;  2KND A;  4AQF A;  2RA1 A;  4NUV A;  4YFS A;  3BQI A;  1YD8 G;  2LEH A;  2ODU A;  4GYS A;  2N1G A;  2WSS V;  3ETU A;  4KUM B;  4AKH A;  2CWY A;  3R6N A;  3ZN0 B;  3ZLI A;  2CLY C;  1G8X A;  2Y48 B;  4YHJ A;  1HX8 A;  3RX6 A;  3UFE A;  2V7J A;  4AKL A;  2LHN A;  2VAS A;  4ZI2 C;  5HXE A;  4IE4 A;  5LHH B;  2W00 A;  2KWH A;  3CQC B;  3ZMS B;  1MMG A;  4QKN A;  4UF0 A;  1OWA A;  3OKQ A;  3I9W A;  4P09 A;  2CEA A;  4HE8 A;  3UUL A;  1HG5 A;  3ZC0 A;  4TV9 E;  3C98 B;  4H63 H;  2LOP A;  2ZM0 A;  3HA4 A;  3UUM A;  5JH7 E;  1H7C A;  4N78 D;  3IEE A;  3J9X 1;  3O1J A;  4DVD A;  2JJ9 A;  5L2L A;  5FP3 A;  1ZKE A;  2D5U A;  3PUS A;  3Q9D A;  3RRW A;  3KVA A;  3UTK A;  3O1H A;  4DND A;  5JRE A;  3PU8 A;  4X1I E;  1HF8 A;  1VRB A;  1YW0 A;  2C5J A;  4A56 A;  5FNV E;  1D0X A;  3C51 A;  4L9I A;  3KBU A;  2MBG A;  4YJ3 E;  4KMC A;  4JUY A;  1FMW A;  2A2F X;  2X67 A;  4AQF C;  3DP7 A;  5JR9 A;  2XAQ B;  5LOV E;  1NAF A;  2DHR A;  2BDE A;  5IYZ E;  3NZP A;  4BA9 A;  1BR0 A;  4IHJ E;  2CCQ A;  3ZYK A;  2PJQ A;  4IE5 A;  2EHO A;  2E8I A;  4TV8 E;  3V5U A;  4DBR A;  5J2T E;  4PNI A;  2VK9 A;  3Q2M A;  3ONX A;  1CUN A;  4DMV A;  3EDV A;  4AXP A;  3F31 A;  2G0U A;  2JRK A;  3WUR A;  2VKO A;  2V7M A;  2WBL A;  5L3C B;  3UUN A;  4BJM A;  5DAB A;  2XAS B;  2H3R A;  4CZZ B;  5C8Y E;  3FXE B;  2DI4 A;  3C4W A;  4H9R C;  3RYI E;  1LVF A;  1V9D A;  1G73 A;  4H9S E;  4HTE A;  2XTL A;  3CQG B;  3M1C A;  3ZMU B;  3PUA A;  4IE6 A;  3GA8 A;  2LJL A;  2KIN B;  5GON E;  4O2B E;  2CXL A;  2K48 A;  2V26 A;  3RPU A;  4ZI3 D;  5HYA A;  2DCF A;  4JEH B;  5H6Q B;  5FMN A;  5J2U E;  4ZOL E;  2HH7 A;  3MK7 C;  4QXC B;  2ACX A;  3LG7 A;  2KZ7 B;  4XAX B;  3ZN1 B;  5F3J A;  4UVB B;  5LHG B;  3PTR B;  2NW7 A;  5JDG A;  2VKJ A;  4YJ2 E;  2QA7 A;  1YKH B;  2Q9Q B;  1KNZ A;  3O1I A;  2BVM A;  3M65 A;  2V7I A;  4PK5 A;  2XHE B;  4CI2 B;  3ZYM A;  4GYR A;  2E9X B;  3H37 A;  2WAU A;  2A72 A;  2UXX B;  3IHR A;  1D0Y A;  3CX8 B;  3KV5 A;  4ZS3 A;  4AI6 A;  5JDM A;  2LQU A;  4I4T E;  1WRD A;  5LG4 A;  2N9D A;  2XAG B;  2IC9 A;  2MYS A;  2L8K A;  5L3D B;  1MIW A;  2JPF A;  4WW0 A;  3RYC E;  2MTQ A;  4JLE A;  5LJM A;  4M1P A;  5LXT E;  5KX5 E;  5L3E B;  5JDH A;  3CX6 B;  2LE8 A;  4PJJ A;  3C4Z A;  3HKE E;  3LFM A;  4OFZ A;  3UT5 E;  1WR6 A;  3T8O A;  2W62 A;  4UXN B;  1SA0 E;  4ANJ A;  2RP4 A;  4X1Y E;  2CMR A;  4UIG A;  4L5G A;  5EK4 A;  2ZM2 A;  4UEL A;  2VB6 A;  4X1K E;  2K5B B;  1Y64 B;  5FXV A;  4ZI3 C;  1IZN B;  5JQG E;  3VJZ A;  3AVS A;  4O4H E;  1NWM X;  2W0G A;  2N2N A;  3ZJ1 A;  2X51 A;  3SWH A;  4GK0 E;  4DBQ A;  2OA5 A;  3AAE B;  3NBX X;  2NOX A;  5CB4 E;  4AKR B;  5LA6 E;  2W63 A;  3HL6 A;  3BQL A;  3I9Y A;  3WAK A;  4O4L E;  3HKB E;  1D1B A;  2ZMA A;  3ZYL A;  4FJO A;  5HXR A;  3RYH E;  3TKL B;  2ODV A;  1WYB A;  3B57 A;  3FBZ A;  3CWZ B;  4YLH A;  3PUQ A;  2ES0 A;  3CX7 B;  4H9N C;  1ZEE A;  3I1A A;  2LOS A;  3CKD A;  3LBX B;  1IJ6 A;  4EB6 E;  4WBN E;  1AJ3 A;  2X66 A;  3O4X E;  4PJN A;  2I59 A;  5CA0 E;  4GOU A;  1UCU A;  3AA6 B;  3C64 A;  4JEU B;  5LNK A;  3NRX A;  3GN5 B;  3NZQ A;  2X9Y A;  3F57 A;  4UEM A;  5DJQ C;  1UX5 A;  5HAX A;  1HCI A;  4ZI7 E;  3RH3 A;  3N9O A;  4PFP A;  3U3I A;  2L3L A;  5BMV E;  2J1D G;  5FY1 A;  3SS1 A;  4C91 A;  1WYC A;  5FXZ A;  3CPZ A;  4I50 E;  2A3D A;  1MMD A;  2DWG A;  2KXP B;  3I0O A;  4BGO A;  3N2O A;  3FXD B;  3C4X A;  3AVR A;  3KBT A;  3MXZ A;  4H9O C;  4I55 E;  4MBQ A;  3RC3 A;  4IDZ A;  4EOZ B;  3E0Z A;  4U72 A;  1D1C A;  4HN9 A;  2XAH B;  2NWB A;  3N9L A;  5JDL A;  1MNE A;  3N9N A;  3LK2 B;  3QUJ A;  5JRC B;  5HXC A;  2H7V C;  4PK6 A;  1FEW A;  5EK2 A;  3CQX C;  2X9X A;  2D2S A;  4IE0 A;  5LCY A;  3RYF E;  2KLQ A;  2DNX A;  4CXY A;  2CA5 A;  1O3X A;  3ZCJ A;  1OXZ A;  3ESL A;  5LYJ E;  2B1E A;  2QGS A;  3ANW B;  3EVY A;  2ZLY A;  2Q9Q D;  1D1A A;  3KDS E;  3VU7 H;  2X68 A;  3AAI A;  2PBI A;  4EZ4 A;  3PF0 A;  3LJC A;  2VKH A;  2E9X D;  3D0T A;  3P8C D;  5FXX A;  3SOL A;  5L3B B;  5EK3 A;  3MA9 A;  3PDY A;  2C5K T;  4PAG A;  4NUU A;  5ETW A;  3O9X A;  3QK6 A;  4L0R A;  2LM9 A;  2WMN A;  3L3P A;  3ZPO A;  2DWK A;  3OBV E;  5JR9 B;  4CI1 B;  2K24 A;  1LRZ A;  2CXD A;  3K8P C;  4P0B A;  4PW8 A;  3B13 A;  1SHZ C;  4ERR A;  3FHN A;  1LKX A;  2EHO B;  4P0A A;  2LSG A;  1LVK A;  4UVC B;  1KK7 A;  2CM0 A;  4BJN A;  3ZJ2 A;  3K3Q C;  3BK9 A;  4TN7 B;  3VHL A;  1D0Z A;  3AT7 A;  4UVA B;  3ZMV B;  3C50 A;  1QUU A;  1X79 A;  5E0O A;  4IE7 A;  2HPJ A;  2JMH A;  3F2E A;  3PUG A;  3K3N A;  2VKD A;  4EZH A;  4CQI A;  2KWI B;  3ETV A;  5LGT B;  1S35 A;  3AA1 B;  3AA0 B;  2X9W A;  3JC6 D;  1MMA A;  2Q9Q C;  2XAJ B;  3HKD E;  4IST A;  3BQK A;  3LK4 2;  5J1G A;  4QWN B;  4H9Q C;  3KV9 A;  3GWH A;  3KIN B;  2E9X C;  5HWX A;  2DLR A;  4MLK A;  1U4Q A;  4DMW A;  2BVL A;  2CLY B;  5DQW A;  5TAO A;  3RC8 A;  2YIN A;  5JDN A;  3LK3 B;  3CML A;  1MIY A;  5CA1 E;  2KT9 A;  3LBX A;  2MTC A;  3K3O A;  3EDU A;  4GIW A;  4UV9 B;  4J2C A;  4E7S A;  4O4J E;  5KMG P;  5HWY A;  4X20 E;  4WNK A;  2YEV C;  3PHF 1;  5JVD E;  2C5I T;  1BR2 A;  4MAL A;  3KV4 A;  4ZS2 A;  3MZK B;  3N2K E;  4B6X A;  3PUR A;  3UUX B;  3P7I A;  3FB2 A;  4IGU A;  2GK9 A;  2W61 A;  4XBF B;  2NTY A;  3CVR A;  4E7Z A;  3ZEF B;  2K9A A;  4O4I E;  4OHF A;  4PK4 A;  4QXB B;  1B7T A;  5LGU B;  4G2A A;  4QHO A;  5EZY E;  1HG2 A;  4QX7 B;  3J7Y q;  4AKI A;  4PJM A;  4ECG A;  3AB3 B;  2YU2 A;  3S4U A;  5LBM A;  1HFA A;  2JQQ A;  5M4Y A;  4EIW A;  2X0L B;  4TUY E;  4Z8X A;  3MKD A;  3VKG A;  3HI2 A;  5L3F B;  3WSC A;  3HKC E;  2X9H A;  3ZMT B;  3OYZ A;  3KVB A;  4MFR A;  3JC6 C;  5JRC A;  4I43 B;  3ZMZ B;  1ZV4 X;  2D0U A;  3PE0 A;  3N9Q A;  3EUH A;  2KMF A;  2WM9 A;  3ANW A;  3I0Q A;  4CXX A;  4ONR A;  3H3A A;  3R84 B;  4OYJ A;  5LP6 E;  1VOM A;  4O8S A;  2D0T A;  3OYX A;  5KDM C;  3Q5X A;  3AA7 B;  2VL8 A;  4ISS A;  3RRC A;  4CXW A;  4F6R C;  4AQG A;  5A1L A;  2MOZ A;  4UF0 B;  2XAF B;  2IAK A;  5DQV A;  2SPC A;  4O2A E;  2CE7 A;  4ZHQ E;  5JDF A;  3DJB A;  2LSI A;  3N5L A;  5H6R B;  1S94 A;  1HTJ F;  3NRY A;  3W15 B;  4WBO A;  2H7O A;  3L09 A;  1BR1 A;  1FIO A;  1MMN A;  4KP3 C;  2Q9Q A;  2Z6E A;  1MIV A;  5LHI B;  2NTX A;  5LJN A;  4ADZ A;  3DTO A;  3N2G E;  5AFU L;  2PG8 A;  4MHC A;  4XZC A;  2E9X A;  2EHO D;  3MAC A;  5FYM A;  5ADX L;  5HXS A;  4ILU A;  2L9Q A;  2Y8D A;  1QSD A;  1YKE B;  4BAY B;  4TX5 A;  4QX8 B;  1T98 A;  2NP9 A;  2ZM8 A;  4OYK A;  1WLX A;  1Z0P A;  4DO0 A;  1UX4 A;  2LHR A;  3VKH A;  4FI5 A;  1U5P A;  3SRZ A;  2IC6 A;  2VWA A;  1IJ5 A;  3N9P A;  2NW9 A;  3MJX A;  5FXW A;  3U78 A;  5LGN B;  2WWU A;  4QXH B;  5T1D A;  2XUE A;  4ASK A;  4HEA A;  4KBM B;  2CWO A;  3RKO A;  5FY7 A;  1E1H B;  5LBQ B;  3N9M A;  3E22 E;  2V7K A;  3E08 A;  3IBP A;  2NW8 A;  2WMO A;  3GMI A;  1BR4 A;  5IHY A;  3AAA B;  3KFW X;  3WI3 A;  3ZCI A;  4H63 V;  1IAP A;  3FBL A;  4C90 A;  4EAH A;  4PFO A;  4U74 A;  2YU1 A;  1US7 B;  2V1D B;  4OK0 A;  2C0S A;  4EYY R;  2LSJ A;  4HKA A;  5FY0 A;  5F8P A;  4GK5 E;  3A5X A;  4G63 A;  4ZI2 D;  1EZ3 A;  5L3G B;  2Y6X A;  1MND A;  2JMK A;  3OJA A;  5JR9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...