5HXRA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 10mm ca2+
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
300
structure length
293
Chain Sequence
b'MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 121
structure length 293
sequence length 300
ec nomenclature
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hxrA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hxrA02
5HWXA 5JDFA 5HXCA 5HXHA 5JDMA 5HXSA 5HYAA 5JDHA 5HWYA 5JDLA 5JDGA 5HXRA 5HXEA 5JDNA 3V5SA 5JDQA 3V5UA
chains in the Genus database with same CATH superfamily
3AAIA 4OK0A 4U7YA 4ISSA 4DV3T 3V5SA 4ZHQE 1WLXA 5AQMB 1XMOT 4PK4A 5HXCA 1G73A 4LMKA 3UFEA 2MOZA 1SE7A 4PJJA 5LG3A 5L3EB 4IHJE 3NVOA 1HCIA 2VKHA 2KVPA 3FXDB 5ETWA 4U72A 3T1HT 1UCUA 5LYJE 3FBZA 2XAGB 4L5GA 3WI3A 3QUJA 2NOXA 3ZN1B 5JDGA 3CQXC 4CXWA 3EHZA 5LGTB 3Q5WA 3UU6A 2ZMAA 3AXJA 3P4WA 2D0TA 1YD8G 3CVRA 4DNDA 1HNXT 2J1DG 5L4EA 4UVCB 4XBFB 3ETVA 3HI2A 2I59A 5FL0A 1MIYA 4IGUA 2YN6A 1GQEA 2BVLA 1OEDA 3M1CA 3MK7C 4X64T 4NXNT 4HE8A 3RYIE 4UF0A 2MYSA 3LK3B 4HTEA 4AI6A 3IHRA 4JI7T 2MBGA 4CI2B 3EVYA 2CXLA 3C64A 2PJQA 3RYCE 3UQ4A 2H3RA 2W61A 3P4PA 3ZMTB 3CPZA 3QB5A 2E5VA 2K3WA 5AQKB 2UU9T 3B13A 3EI0A 5AFUL 3AE9A 3UULA 1J1JA 3FBLA 2OV9A 2YINA 3J7Yq 2BS3A 3V5UA 5EK4A 1SA0E 1UX4A 2V6YB 2VL0A 4DV6T 4JBWF 3JC6C 4OYKA 4ZXLA 4I0UA 3QK6A 3N9OA 3AE4A 4YFSA 2CCQA 4DV5T 2D2SA 2LHNA 5JRCA 5LXTE 4YXDA 3N2GE 4OX9T 4OHFA 5DABA 3SFEA 4KP3C 4J2CA 2R6GF 4Z8XA 3TLUA 5AQJB 2X9YA 2XUEA 2XM2A 1IJ5A 5HEOA 3KV5A 3K1SA 3RRWA 3C51A 2XAJB 3NWIA 1I94T 3KV9A 2GK9A 1UK5A 3SS1A 3N9PA 2X0YA 5L3GB 1N33T 2E5LT 3RIUA 2QVAA 2WBLA 4MFRA 2LLYA 1VOMA 4QX8B 1W0AA 2HPLA 4GK0E 1HX8A 3WSCA 4AQFA 2V1DB 3N9NA 3F57A 4I50E 5LB7B 4A98A 5HEGA 4LMLA 2FJAA 3N9MA 5LBQB 4HFHA 4K0KT 4QH4A 2JPFA 2BBJA 3ZKRA 3RH3A 3KBUA 2X68A 4UELA 2XTLA 4QHOA 2YU1A 5LMUT 5IUXA 1YQ3A 5J1GA 3VRAA 3ZCIA 5LHIB 1SHZC 3PUQA 5F5WA 5KXJA 3PUZF 4V1Av 2CXDA 3JADA 4HFBA 5GONE 5L2LA 2XM1A 4UV9B 3OYZA 3I9WA 3RQUA 5FY1A 5JH7E 4YSYA 2YEVC 2LSGA 4NXMT 1SUMB 2FJDA 5BMVE 3EDVA 3JC6D 3ZT6A 2WY2A 1M62A 2WU5A 3EAMA 4O8SA 3CQGB 2VVNA 4U3CA 4EOZB 5LG4A 4P0AA 1CHUA 3DYJA 4ILAA 4I55E 4XZCA 3LBXA 4YSZA 2W67A 2CRBA 5HEHA 5DJQC 4AKHA 5J2UE 2XY8B 3FYQA 2BKOA 3AEFA 2L7NA 4YTNA 2YU2A 1VCSA 3OVUA 3U78A 2Z6EA 1U4QA 5LGUB 1MIVA 1KK7A 1UUSA 1W9RA 4X20E 3O1IA 2I0MA 5DQWA 5FY0A 5HXRA 3CQCB 5ABFB 2X0LB 1UX5A 4ZZBA 2WWUA 2Q9QA 1I6ZA 3QC9A 4EB6E 3ZMVB 1KFYA 1QLBA 3Q5XA 3NKZA 4EV6A 5J0ZA 4JYAT 2WWVA 5ABHA 1ZOYA 3ZT5A 5IHYA 4DV4T 1LVFA 1HX1B 3PE0A 4BGOA 3D0TA 2EHOA 3KVAA 3CWZB 3E08A 2E9XA 2UXBT 3AEAA 3K3OA 4P09A 3RIFA 2XQ4A 4A56A 5JDQA 2XQ8A 1HNWT 4YHHT 4JEHB 4XAXB 3C50A 4ASKA 2LSYA 2L9QA 2A3DA 1O3XA 2V7LA 2K9AA 5AQIB 4AIUA 3K8PC 5LNKA 2W0GA 4CQIA 2XAFB 2SPCA 4O4LE 4CN4A 3OBVE 4L9IA 4EAHA 2MTQA 4H63V 2A2FX 4P1NA 4HN9A 4ONRA 2KXPB 3MA9A 4HWCA 2WU2A 3PUGA 5KMGP 5HXHA 4JLEA 3IA3A 1N36T 1IAPA 3RC3A 3AA6B 3AEEA 3RKOA 2PTFA 3U3IA 2X51A 4X66T 3FHNA 3ZC1A 3A7MA 2KLQA 5JDFA 3N2KE 1G8XA 1MMAA 2ZLYA 3P4QA 4JI6T 3B57A 2LM2A 3DP7A 2VB6A 2A72A 3ANWB 1W0BA 2WAUA 3RRCA 3OPCA 4HGAA 3ZC0A 3Q5DA 2PFVA 3ONXA 3Q9DA 1M7KA 4FJOA 3RHWA 2QGSA 1XNQT 4X1KE 4NIQA 3VRBA 1KNZA 4C90A 2LM9A 4TWDA 4TNWA 4DIDB 4H9OC 3VJZA 4DUZT 5FXZA 1IZNB 5AQOB 3FXEB 4TZ4C 3A5XA 5LHGB 4HWFA 5TAOA 3VR9A 2FJBA 1E1HB 3L09A 3DTOA 5LP6E 3EUHA 2NWBA 4MLKA 2K5BB 3ABVA 4A5XA 1QSDA 4KX6A 2V26A 3ZSSA 4ISTA 1SJ7A 3UUXB 1MNEA 2JQHA 4PK6A 3KFWX 3RC8A 2M6IA 2CMRA 1D0ZA 3O9XA 2YOEA 5IYZE 4B3ST 3AE8A 2HN2A 5ADXL 2D0UA 4YTPA 2XQ9A 3CX6B 3OTOT 5AQNB 2KBBA 2XPKA 2ZM2A 2G0UA 3N9LA 3I0OA 4DVDA 3ZPOA 2KT9A 1ZV4X 4QWNB 3AY5A 3QB5K 4EYUA 4YJ3E 3UQ7A 2E2AA 3FZLB 1IBMT 4HWDA 4ZI2C 4WNKA 3C4WA 2ODVA 3AAEB 3S4UA 2LEHA 2C5IT 2F4VT 3C98B 3AEDA 3JAEA 5FVLA 3O1HA 4X1IE 1HG5A 2ES0A 3RKGA 3CKDA 2V7JA 4EEBA 5HYAA 5JDLA 5F8PA 4DR7T 3HKBE 3HKDE 2QRXA 3ZMZB 5HCJA 4JI8T 2JQKA 2UUCT 5L3BB 4B3MT 4YSXA 4KI0F 2JMHA 4LF6T 2AXDS 4DBQA 4IT4A 3E22E 2KZ7B 2X9HA 4ZOLE 2KNDA 5HWXA 4X65T 2DWKA 4H63H 2D5UA 2WS3A 2M6BA 5LCYA 5AQPB 4KHZF 2WQYA 3NZQA 1T72A 2QA7A 1YKHB 1N34T 1MMGA 2W63A 4ERRA 3G06A 5ABEA 2XSAA 2VKDA 3OJAA 2CBIA 3PUSA 3GMIA 5HXEA 4E7ZA 5H6QB 4IDNA 4IL4A 3TLTA 4G63A 2OA5A 4UXNB 5FKYA 3SFDA 4CN6A 4IE6A 4WW0A 4I43B 4YLHA 2N2NA 5J2TE 5LGNB 1S35A 3AE2A 1B7TA 1Y64B 1JNRA 1T7SA 2A9UA 5EK2A 4IE4A 2BBHA 3IEEA 1WR6A 3GN5B 3AEGA 2JQQA 4WBOA 2V5CA 2HHHT 4IE0A 4DR6T 3I1AA 2NW7A 1E7PA 2I6HA 2XASB 2CA5A 4HFDA 4TV9E 2BG9E 1T98A 3GA8A 2NW8A 4KUMB 3WAJA 2KSRA 4QKNA 4GK5E 2NTYA 3P4SA 1Z8UA 2IHR1 4ILUA 3AE7A 3X1DA 2LKGA 2Y48B 3HKCE 3AB3B 3BQIA 4M1PA 4QH1A 2UXDT 2BG9B 2NR4A 3MZKB 4TNVA 1NAFA 4JUYA 3PURA 2VKJA 3M65A 4PFOA 3T8OA 3AE1A 4HFCA 4LF7T 2V6YA 1ZEEA 5E0OA 1W09A 3I9YA 1CUNA 2H7OA 3FZFB 3EABA 3LG7A 2CWYA 4TWHA 1BR1A 3UUNA 3ETUA 1KNRA 4PJMA 5HEUA 3F31A 3MXZA 1WYBA 4HFEA 4BAYB 4F6RC 5FVKA 1LVKA 3R6NA 4MALA 3CIRA 5CJ5A 2VKOA 3RI5A 5HCMA 1OWAA 4ZI7E 2DL1A 2PG8A 5AQUB 5BR8T 2J47A 3H3MA 2EHOB 3PUVF 3ZMSB 2L10A 2HPJA 2W2UA 4K0UA 2CEAA 1X79A 2CWOA 2H7VC 4X5TA 2BZBA 4L0RA 4QXBB 2V5DA 2WDQA 3VU7H 3K3NA 5HXSA 4O2AE 2OLTA 4OYJA 4IDOA 2HN1A 3UTKA 2CHNA 3N2OA 4I4TE 3KV6A 1XZYA 3P7IA 1SJ8A 1US7B 3NRXA 3SRZA 4X62T 3KVBA 2X0CA 4PFPA 4IDZA 2BKPA 3O4XE 1J5WA 2BG9C 5JR9B 3LFMA 5AQRB 3PUAA 5C8YE 4MHCA 3A8YC 4O4JE 2CPTA 2X9WA 1XMQT 4ZS2A 2LJLA 3UU8A 2X67A 3LDQB 4ANJA 5JREA 3PDYA 4B3TT 3NRYA 4DV0T 2FJEA 3KINB 3ZEFB 4IREA 2ACXA 1D1AA 2BVMA 3PU3A 3VKHA 5CA1E 4KBMB 3HA4A 2NW9A 2LQUA 3FZKB 2B76A 4TUYE 4MBQA 3UFGA 2EHOC 2IW5B 1Y01A 4F8HA 2FUPA 2XJ7A 3SWHA 3CMLA 4H9QC 2NTXA 1FEWA 2VVSA 3HKEE 3AT7A 5HWYA 3TKLB 4AKIA 3ZYKA 1XNRT 2D9DA 4N78D 2VK9A 5EK3A 3BK9A 3VHLA 1T8BA 1QUUA 5FXXA 1D1CA 1D0XA 4DO0A 4ADZA 2KWHA 5LA6E 4OFZA 3HL6A 4TV8E 5JR9C 5L47A 2YDQA 3AAAB 4YJ2E 2WZHA 4WZXA 1HNZT 5AQLB 2WSSV 5FL1A 4GOUA 1ZKEA 1OEDE 4IIJE 5JVDE 2CM0A 5CA0E 4U33A 5JTGA 4HEAA 2W00A 3O1JA 2ZM0A 5ABFA 2LOSA 3MKDA 2J62A 2WMNA 2RA1A 3NZPA 5AQQB 3KBTA 3AXJB 3ZLIA 3ZYMA 4DMVA 2N9DA 5IWAT 5F3JA 2CXFA 2X9XA 5L3CB 3ONLC 4EXTA 2V7IA 4KMCA 1YQ4A 1OEDB 4U74A 1OXZA 2C5KT 4NUVA 3FB2A 4H9SE 1UURA 1BR2A 3FZHB 2WDVA 5ABGA 4UF0B 2KWIB 3RQWA 1ZP0A 3K3QC 2YDRA 3MJXA 2ODUA 2H89A 3ZMUB 2L8KA 2DI4A 3L3PA 5JDNA 5A1LA 2BKNA 3LK42 4HWHA 1BR4A 1VCTA 1D1BA 3AE3A 3AA7B 3IF8B 4DMWA 1MIWA 2W4XA 3TLSA 2EHOD 2VL8A 4IDPA 4LMJA 4CZZB 4NPPA 4C91A 3KV4A 3J9X1 4YHJA 4UR9A 1J5ET 4JEUB 2XQAA 4CXXA 2JJ9A 5L3FB 2WP9A 2MTCA 2XAQB 5LOVE 3M3ZB 3WURA 4JI2T 3UUBA 3VKGA 4UIGA 4UV8B 4PK5A 4UEMA 1XDPA 3OKQA 5AQFB 4DUYT 2XQ5A 5FXVA 4LF5T 1WR0A 5JRCB 3LK2B 4G2AA 3AVSA 2XZEA 3RYFE 3AA1B 4Z91A 3ANWA 4WBNE 4NUUA 1YW0A 5LBMA 3ESLA 4PJLA 5AQGB 5C3JA 4EGWA 1OEDC 2MPKA 5L4HA 3JCFA 4LFCT 3ZT7A 4DV7T 2KMFA 4IE5A 2XSBA 2E8IA 3AE5A 3PU8A 4GIWA 2UXCT 2V8SV 3ONJA 2AE9A 1JNZA 3TLWA 3P8CD 2DNXA 1NWMX 1VRBA 3L8RA 1HG2A 2QYWA 4LF9T 4GKJT 3F2EA 2JMKA 4U2YA 4CXYA 2DWGA 1MMDA 2DCFA 2K24A 2V7KA 1HR0T 4YY3T 2N1GA 3LSVA 1KF6A 2IDOB 5LMNT 4CN1A 2LSJA 5KX5E 4IL9A 1WRDA 4ZI3C 3RX6A 4E7SA 4JI5T 4JI0T 2K48A 2FBWA 2RPAA 3PTRB 4PNIA 1MMNA 1FJGT 4FI5A 4UVBB 5EZYE 5AQHB 2LOPA 5JQGE 2VASA 4GKKT 3N5LA 2BS4A 2KINB 4QX7B 1BR0A 4BA9A 1NENA 4TX5A 4ZS3A 4DV2T 2IIUA 4UVAB 1N32T 4IDQA 3RF1A 4P0BA 4EZ4A 4Z90A 5FP3A 2KGXA 3RIUC 2IUBA 3LBXB 4ZI2D 4H9PC 2YK0A 5FNVE 4DR5T 1HFAA 3N9QA 4AQFC 3P50A 1U5PA 4LF8T 2L3LA 5JDMA 2JQ9A 2WMOA 1S94A 2DHRA 2J4GA 3CX8B 2XHEB 4AKLA 2WB5A 4ZEYA 1YKEB 2JIWA 2W62A 5LJMA 3R84B 1X9BA 1KNPA 3H3AA 1H7CA 4HWIB 4DR2T 2WDRA 3CX7B 4PAGA 2B1EA 3ZN0B 4H9RC 2X66A 4H9NC 3AVRA 2MAWA 3UUMA 4O4HE 1MNDA 4YTMA 3VR8A 5AQVB 2Q9QB 3WAKA 1ZHCA 2IC6A 3PJAJ 2UXXB 1NEKA 4GYSA 3CK6A 3H37A 2C5JA 4ECGA 5LJNA 4JI1T 2BDEA 3AA0B 2IMLA 5JDHA 4A97A 3RIAA 1FIOA 2M67A 4O2BE 1KEYA 3GN5A 4AXPA 3P4RA 5CGMA 1E2AA 4HFIA 3EDUA 4U7IA 3PUYF 2E9XB 2WCAA 3ZJ2A 4ZI3D 2VWAA 1IBKT 2WZIA 4CI3B 2NP9A 4W8PA 2LSKA 2VQET 3C4XA 2JRKA 2LHRA 2RP4A 1XWMA 1Z0PA 1WYCA 1LRZA 1AJ3A 1FMWA 4EIWA 1XDOA 5FXWA 4LFAT 2XQ7A 4LF4T 3B5MA 5FYMA 5AQTB 4BJNA 3W15B 1LKXA 2V7MA 5KDMC 4EZHA 1V9DA 2HH7A 4AISA 2BG9A 3NBXX 2YKSA 3RGLA 4QH5A 1L0VA 3QNUA 2IC9A 2UUBT 2CLYB 2WM9A 2UXNB 3Q5EA 1UGOA 1D0YA 3BQLA 3SOLA 2Q9QC 2YDSA 4GYRA 3JAFA 3RYHE 3L39A 2UUAT 4O4IE 4CI1B 3KDSE 4LFBT 3UU5A 3ZJ1A 4ZZCA 5FZTA 3C4ZA 4COFA 5CB4E 2CHOA 2E9XC 4IE7A 3Q2MA 4DR4T 1WFDA 4AQGA 4Q25A 4JV5T 2CE7A 1WCRA 3PHF1 5L3DB 4ILBA 5FMNA 1HTJF 1R8IA 2BS2A 2VURA 4PW8A 4DV1T 3TLVA 3E0ZA 2PBIA 2LE8A 4JI4T 1FMVA 4HFVA 4PJNA 1IJ6A 3UU4A 4DBRA 5M4YA 2V6XA 4YT0A 2X0HA 1EZ3A 2CBJA 4B3RT 3RLFF 1YXRA 5DQVA 4AKGA 3OYXA 5JR9A 5C2TA 3GWHA 2Y8DA 4QXHB 4X1YE 3PF0A 3I0QA 5AQSB 2ZM6T 2ACZA 1IBLT 2CLYC 4QXCB 3UU3A 2ZM8A 4ILCA 2LKHA 2W66A 5FY7A 3AE6A 4EYYR 5HAXA 5CFBA 3AEBA 3PV0F 4TN7B 4DR1T 2XQ6A 1HS7A 5HEJA 4BJMA 4U2ZA 4U31A 4WYVA 2LRKA 3ZYLA 3UT5E 2IAKA 4EEDA 5T1DA 3ZCJA 2P9BA 4TWFA 3QOFA 2XAHB 3IBPA 2C0SA 2Y6XA 2VQFT 5H6RB 3ZSTA 3HR0A 4DR3T 1HF8A 4F7GB 2H88A 2Q9QD 3FZMB 4AKRB 3MACA 3RPUA 3BQKA 3LJCA 3PUXF 3AECA 1DU2A 4B6XA 3T1YT 3PUWF 4JI3T 2LT3A 4AQYT 2LRLA 3PJAA 2DLRA 4HKAA 4KHPT 5LHHB 2XQYA 2XQ3A 3DJBA 2LSIA 2E9XD
chains in the Genus database with same CATH topology
3AAIA 4ZI7E 1OWAA 4OK0A 2K48A 4JEHB 4XAXB 2PG8A 3C50A 4ISSA 3PTRB 4ASKA 3V5SA 4PNIA 1MMNA 2L9QA 2LSYA 2A3DA 4ZHQE 1O3XA 1WLXA 2EHOB 4FI5A 2V7LA 4PK4A 4UVBB 5EZYE 2K9AA 3ZMSB 3K8PC 2LOPA 5HXCA 5LNKA 2HPJA 1G73A 3UFEA 2W0GA 4K0UA 4CQIA 2MOZA 5JQGE 2VASA 4PJJA 2XAFB 5L3EB 2CEAA 2SPCA 1X79A 3N5LA 4IHJE 1HCIA 2CWOA 2KINB 2H7VC 2BZBA 2VKHA 4QX7B 1BR0A 4O4LE 3FXDB 4L0RA 4QXBB 5ETWA 3OBVE 4L9IA 4BA9A 4EAHA 2MTQA 4H63V 2A2FX 4U72A 3VU7H 4HN9A 3K3NA 4ONRA 1UCUA 2KXPB 5HXSA 5LYJE 3FBZA 4TX5A 2XAGB 3MA9A 4O2AE 4L5GA 4OYJA 4ZS3A 3PUGA 3WI3A 5KMGP 3QUJA 2NOXA 5HXHA 4JLEA 3ZN1B 5JDGA 1IAPA 3CQXC 4UVAB 4CXWA 3RC3A 5LGTB 3UTKA 3Q5WA 2ZMAA 3AA6B 3N2OA 3RKOA 2D0TA 1YD8G 4I4TE 3KV6A 3CVRA 4P0BA 3P7IA 2X51A 3U3IA 4DNDA 2J1DG 1US7B 3NRXA 4EZ4A 3SRZA 4UVCB 3KVBA 4PFPA 4IDZA 5FP3A 4XBFB 3O4XE 3FHNA 3ETVA 3LBXB 3ZC1A 5JR9B 4ZI2D 3HI2A 4H9PC 2KLQA 5JDFA 2YK0A 3N2KE 2I59A 5FNVE 3LFMA 1MIYA 1G8XA 1MMAA 4IGUA 3PUAA 5C8YE 4MHCA 4O4JE 2BVLA 2ZLYA 1HFAA 3B57A 3MK7C 3N9QA 4AQFC 3M1CA 1U5PA 2X9WA 3DP7A 2L3LA 5JDMA 2VB6A 4HE8A 4ZS2A 2LJLA 2A72A 2X67A 3ANWB 2WMOA 4ANJA 1S94A 3RYIE 5JREA 2WAUA 3PDYA 2DHRA 4UF0A 2MYSA 3CX8B 3LK3B 2XHEB 3RRCA 4HGAA 3NRYA 4AKLA 3ZC0A 4HTEA 2PFVA 1YKEB 4AI6A 3ONXA 2W62A 3Q9DA 3IHRA 3R84B 5LJMA 3KINB 4FJOA 2QGSA 2MBGA 3ZEFB 4CI2B 4X1KE 1KNZA 3EVYA 3H3AA 4C90A 1H7CA 2CXLA 2LM9A 2ACXA 3C64A 3CX7B 4PAGA 2PJQA 2B1EA 3RYCE 1D1AA 2H3RA 2W61A 3ZN0B 4H9RC 2BVMA 2X66A 3PU3A 4H9NC 3ZMTB 3AVRA 3UUMA 3VKHA 5CA1E 4KBMB 4H9OC 3VJZA 3HA4A 4O4HE 2NW9A 1MNDA 3CPZA 2LQUA 5FXZA 1IZNB 3FXEB 4TZ4C 4TUYE 3B13A 3A5XA 4MBQA 2Q9QB 5LHGB 2EHOC 2IW5B 5AFUL 3WAKA 5TAOA 1ZHCA 2IC6A 2UXXB 1E1HB 3SWHA 4GYSA 3UULA 3CMLA 3FBLA 3L09A 4H9QC 3DTOA 2NTXA 2YINA 3H37A 3J7Yq 2C5JA 4ECGA 5LJNA 5LP6E 2BDEA 1FEWA 3V5UA 3AA0B 3EUHA 3HKEE 2NWBA 4MLKA 5EK4A 3AT7A 1SA0E 2K5BB 5JDHA 1UX4A 5HWYA 3TKLB 1QSDA 4AKIA 3ZYKA 3JC6C 4OYKA 1FIOA 2V26A 4N78D 2M67A 4O2BE 4ISTA 2VK9A 3GN5A 4AXPA 3QK6A 5EK3A 3N9OA 3BK9A 3UUXB 1MNEA 3EDUA 4PK6A 3KFWX 2E9XB 4YFSA 3RC8A 2CCQA 2CMRA 3VHLA 1D0ZA 3ZJ2A 3O9XA 5IYZE 2D2SA 4ZI3D 2VWAA 1QUUA 2LHNA 5JRCA 4CI3B 5ADXL 2D0UA 5LXTE 2NP9A 5FXXA 2LSKA 1D1CA 3CX6B 3N2GE 1D0XA 4DO0A 4ADZA 4OHFA 2KWHA 3C4XA 5DABA 2JRKA 4OFZA 5LA6E 2ZM2A 3HL6A 2LHRA 4TV8E 5JR9C 2G0UA 2RP4A 4KP3C 3N9LA 3I0OA 1Z0PA 4J2CA 4DVDA 3ZPOA 1WYCA 2KT9A 3AAAB 4YJ2E 1LRZA 1ZV4X 4QWNB 1AJ3A 1FMWA 4Z8XA 4EIWA 4EYUA 4YJ3E 5FXWA 2X9YA 2XUEA 2WSSV 1IJ5A 4ZI2C 5FYMA 3KV5A 4WNKA 3C4WA 4GOUA 1ZKEA 2ODVA 4BJNA 3W15B 3RRWA 3AAEB 1LKXA 2XAJB 3C51A 4IIJE 2V7MA 5JVDE 3S4UA 2CM0A 5CA0E 5KDMC 3KV9A 2GK9A 2LEHA 2C5IT 4HEAA 3SS1A 3C98B 2W00A 3O1JA 2ZM0A 4EZHA 3N9PA 1V9DA 3O1HA 5L3GB 2LOSA 2HH7A 4X1IE 3MKDA 2WBLA 4MFRA 1HG5A 2ES0A 1VOMA 4QX8B 3NBXX 2WMNA 2RA1A 2HPLA 3NZPA 4GK0E 3KBTA 1HX8A 2V7JA 3CKDA 3ZLIA 2IC9A 5HYAA 5JDLA 3WSCA 3ZYMA 4AQFA 2V1DB 3N9NA 3F57A 5F8PA 4DMVA 2N9DA 2CLYB 2WM9A 4I50E 3HKBE 3HKDE 3ZMZB 2UXNB 5F3JA 1D0YA 3N9MA 2CXFA 2X9XA 3BQLA 3SOLA 5L3CB 2Q9QC 4EXTA 2V7IA 5LBQB 4KMCA 4GYRA 5L3BB 3RYHE 4U74A 1OXZA 2JPFA 2C5KT 2JMHA 4O4IE 4NUVA 3FB2A 4DBQA 4CI1B 3E22E 3KDSE 4H9SE 1BR2A 2KZ7B 2X9HA 4ZOLE 2KNDA 5HWXA 3RH3A 4UF0B 2DWKA 3ZJ1A 4H63H 3KBUA 2D5UA 2KWIB 5LCYA 3K3QC 3MJXA 2ODUA 3NZQA 3C4ZA 3ZMUB 2QA7A 2L8KA 2X68A 4UELA 5CB4E 1YKHB 2DI4A 2E9XC 2XTLA 4IE7A 1MMGA 2W63A 3L3PA 4QHOA 2YU1A 3Q2MA 5JDNA 5A1LA 5J1GA 3ZCIA 4AQGA 3LK42 5LHIB 4ERRA 1SHZC 2VKDA 3PUQA 3OJAA 1BR4A 3PUSA 1D1BA 3GMIA 5HXEA 2CE7A 3AA7B 3IF8B 4DMWA 1MIWA 4E7ZA 5H6QB 3PHF1 4V1Av 2CXDA 2EHOD 2VL8A 5L3DB 4G63A 5FMNA 2OA5A 4UXNB 1HTJF 4CZZB 5GONE 4C91A 3KV4A 5L2LA 4PW8A 4UV9B 3OYZA 3J9X1 4YHJA 3I9WA 4IE6A 3E0ZA 5FY1A 2PBIA 4WW0A 5JH7E 2LE8A 4I43B 4JEUB 2YEVC 2LSGA 4YLHA 1FMVA 2N2NA 5J2TE 4HFVA 4PJNA 5BMVE 5LGNB 1S35A 3EDVA 3JC6D 1IJ6A 4CXXA 4DBRA 2JJ9A 5M4YA 1B7TA 1Y64B 5L3FB 5EK2A 4IE4A 4O8SA 3CQGB 3IEEA 1WR6A 2MTCA 2XAQB 5LOVE 4EOZB 5LG4A 3WURA 3GN5B 4P0AA 1EZ3A 2JQQA 4WBOA 3VKGA 4UIGA 4I55E 4UV8B 4IE0A 5DQVA 4AKGA 4PK5A 3I1AA 3OYXA 3LBXA 4UEMA 4XZCA 5JR9A 2NW7A 3OKQA 2XASB 3GWHA 2Y8DA 2CA5A 5FXVA 4QXHB 5JRCB 4X1YE 3PF0A 3LK2B 3I0QA 4G2AA 3AVSA 5DJQC 3RYFE 4TV9E 2CLYC 4AKHA 4QXCB 5J2UE 3AA1B 1T98A 3ANWA 3GA8A 2ZM8A 4WBNE 2NW8A 4NUUA 1YW0A 4KUMB 5LBMA 3ESLA 2YU2A 5FY7A 4PJLA 3U78A 4EYYR 3WAJA 2Z6EA 1U4QA 5LGUB 5HAXA 4QKNA 4GK5E 2NTYA 4TN7B 1MIVA 1KK7A 1HS7A 4ILUA 4X20E 4BJMA 2KMFA 4IE5A 2Y48B 3O1IA 3HKCE 3AB3B 2E8IA 3BQIA 3PU8A 5DQWA 4GIWA 3ZYLA 5FY0A 3UT5E 2IAKA 4M1PA 5T1DA 5HXRA 3CQCB 3ZCJA 2P9BA 2X0LB 1UX5A 2XAHB 3MZKB 3IBPA 2WWUA 2C0SA 2Q9QA 3QC9A 4EB6E 3ZMVB 1NAFA 3Q5XA 2Y6XA 4JUYA 5H6RB 3PURA 2VKJA 3M65A 3P8CD 2DNXA 3HR0A 1NWMX 4PFOA 3T8OA 1VRBA 1HF8A 1HG2A 2Q9QD 4AKRB 3MACA 5IHYA 1LVFA 1ZEEA 3RPUA 3BQKA 3F2EA 5E0OA 3LJCA 2JMKA 3I9YA 3PE0A 4B6XA 4BGOA 1CUNA 3D0TA 2H7OA 4CXYA 2EHOA 2DWGA 2LT3A 3KVAA 3CWZB 1MMDA 2CWYA 3LG7A 3E08A 3UUNA 1BR1A 2DCFA 2K24A 3ETUA 2E9XA 2V7KA 4PJMA 3F31A 2N1GA 3MXZA 2DLRA 1WYBA 3K3OA 4HKAA 4P09A 4A56A 2LSJA 5KX5E 5LHHB 4BAYB 2XQYA 4F6RC 5JDQA 1WRDA 1LVKA 3DJBA 2LSIA 3R6NA 4MALA 4ZI3C 2E9XD 3RX6A 4E7SA 2VKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWX A;  5JDF A;  5HXC A;  5HXH A;  5JDM A;  5HXS A;  5HYA A;  5JDH A;  5HWY A;  5JDL A;  5JDG A;  5HXR A;  5HXE A;  5JDN A;  3V5S A;  5JDQ A;  3V5U A; 
#chains in the Genus database with same CATH topology
 3AAI A;  4OK0 A;  4U7Y A;  4ISS A;  4DV3 T;  3V5S A;  4ZHQ E;  1WLX A;  5AQM B;  1XMO T;  4PK4 A;  5HXC A;  1G73 A;  4LMK A;  3UFE A;  2MOZ A;  1SE7 A;  4PJJ A;  5LG3 A;  5L3E B;  4IHJ E;  3NVO A;  1HCI A;  2VKH A;  2KVP A;  3FXD B;  5ETW A;  4U72 A;  3T1H T;  1UCU A;  5LYJ E;  3FBZ A;  2XAG B;  4L5G A;  3WI3 A;  3QUJ A;  2NOX A;  3ZN1 B;  5JDG A;  3CQX C;  4CXW A;  3EHZ A;  5LGT B;  3Q5W A;  3UU6 A;  2ZMA A;  3AXJ A;  3P4W A;  2D0T A;  1YD8 G;  3CVR A;  4DND A;  1HNX T;  2J1D G;  5L4E A;  4UVC B;  4XBF B;  3ETV A;  3HI2 A;  2I59 A;  5FL0 A;  1MIY A;  4IGU A;  2YN6 A;  1GQE A;  2BVL A;  1OED A;  3M1C A;  3MK7 C;  4X64 T;  4NXN T;  4HE8 A;  3RYI E;  4UF0 A;  2MYS A;  3LK3 B;  4HTE A;  4AI6 A;  3IHR A;  4JI7 T;  2MBG A;  4CI2 B;  3EVY A;  2CXL A;  3C64 A;  2PJQ A;  3RYC E;  3UQ4 A;  2H3R A;  2W61 A;  3P4P A;  3ZMT B;  3CPZ A;  3QB5 A;  2E5V A;  2K3W A;  5AQK B;  2UU9 T;  3B13 A;  3EI0 A;  5AFU L;  3AE9 A;  3UUL A;  1J1J A;  3FBL A;  2OV9 A;  2YIN A;  3J7Y q;  2BS3 A;  3V5U A;  5EK4 A;  1SA0 E;  1UX4 A;  2V6Y B;  2VL0 A;  4DV6 T;  4JBW F;  3JC6 C;  4OYK A;  4ZXL A;  4I0U A;  3QK6 A;  3N9O A;  3AE4 A;  4YFS A;  2CCQ A;  4DV5 T;  2D2S A;  2LHN A;  5JRC A;  5LXT E;  4YXD A;  3N2G E;  4OX9 T;  4OHF A;  5DAB A;  3SFE A;  4KP3 C;  4J2C A;  2R6G F;  4Z8X A;  3TLU A;  5AQJ B;  2X9Y A;  2XUE A;  2XM2 A;  1IJ5 A;  5HEO A;  3KV5 A;  3K1S A;  3RRW A;  3C51 A;  2XAJ B;  3NWI A;  1I94 T;  3KV9 A;  2GK9 A;  1UK5 A;  3SS1 A;  3N9P A;  2X0Y A;  5L3G B;  1N33 T;  2E5L T;  3RIU A;  2QVA A;  2WBL A;  4MFR A;  2LLY A;  1VOM A;  4QX8 B;  1W0A A;  2HPL A;  4GK0 E;  1HX8 A;  3WSC A;  4AQF A;  2V1D B;  3N9N A;  3F57 A;  4I50 E;  5LB7 B;  4A98 A;  5HEG A;  4LML A;  2FJA A;  3N9M A;  5LBQ B;  4HFH A;  4K0K T;  4QH4 A;  2JPF A;  2BBJ A;  3ZKR A;  3RH3 A;  3KBU A;  2X68 A;  4UEL A;  2XTL A;  4QHO A;  2YU1 A;  5LMU T;  5IUX A;  1YQ3 A;  5J1G A;  3VRA A;  3ZCI A;  5LHI B;  1SHZ C;  3PUQ A;  5F5W A;  5KXJ A;  3PUZ F;  4V1A v;  2CXD A;  3JAD A;  4HFB A;  5GON E;  5L2L A;  2XM1 A;  4UV9 B;  3OYZ A;  3I9W A;  3RQU A;  5FY1 A;  5JH7 E;  4YSY A;  2YEV C;  2LSG A;  4NXM T;  1SUM B;  2FJD A;  5BMV E;  3EDV A;  3JC6 D;  3ZT6 A;  2WY2 A;  1M62 A;  2WU5 A;  3EAM A;  4O8S A;  3CQG B;  2VVN A;  4U3C A;  4EOZ B;  5LG4 A;  4P0A A;  1CHU A;  3DYJ A;  4ILA A;  4I55 E;  4XZC A;  3LBX A;  4YSZ A;  2W67 A;  2CRB A;  5HEH A;  5DJQ C;  4AKH A;  5J2U E;  2XY8 B;  3FYQ A;  2BKO A;  3AEF A;  2L7N A;  4YTN A;  2YU2 A;  1VCS A;  3OVU A;  3U78 A;  2Z6E A;  1U4Q A;  5LGU B;  1MIV A;  1KK7 A;  1UUS A;  1W9R A;  4X20 E;  3O1I A;  2I0M A;  5DQW A;  5FY0 A;  5HXR A;  3CQC B;  5ABF B;  2X0L B;  1UX5 A;  4ZZB A;  2WWU A;  2Q9Q A;  1I6Z A;  3QC9 A;  4EB6 E;  3ZMV B;  1KFY A;  1QLB A;  3Q5X A;  3NKZ A;  4EV6 A;  5J0Z A;  4JYA T;  2WWV A;  5ABH A;  1ZOY A;  3ZT5 A;  5IHY A;  4DV4 T;  1LVF A;  1HX1 B;  3PE0 A;  4BGO A;  3D0T A;  2EHO A;  3KVA A;  3CWZ B;  3E08 A;  2E9X A;  2UXB T;  3AEA A;  3K3O A;  4P09 A;  3RIF A;  2XQ4 A;  4A56 A;  5JDQ A;  2XQ8 A;  1HNW T;  4YHH T;  4JEH B;  4XAX B;  3C50 A;  4ASK A;  2LSY A;  2L9Q A;  2A3D A;  1O3X A;  2V7L A;  2K9A A;  5AQI B;  4AIU A;  3K8P C;  5LNK A;  2W0G A;  4CQI A;  2XAF B;  2SPC A;  4O4L E;  4CN4 A;  3OBV E;  4L9I A;  4EAH A;  2MTQ A;  4H63 V;  2A2F X;  4P1N A;  4HN9 A;  4ONR A;  2KXP B;  3MA9 A;  4HWC A;  2WU2 A;  3PUG A;  5KMG P;  5HXH A;  4JLE A;  3IA3 A;  1N36 T;  1IAP A;  3RC3 A;  3AA6 B;  3AEE A;  3RKO A;  2PTF A;  3U3I A;  2X51 A;  4X66 T;  3FHN A;  3ZC1 A;  3A7M A;  2KLQ A;  5JDF A;  3N2K E;  1G8X A;  1MMA A;  2ZLY A;  3P4Q A;  4JI6 T;  3B57 A;  2LM2 A;  3DP7 A;  2VB6 A;  2A72 A;  3ANW B;  1W0B A;  2WAU A;  3RRC A;  3OPC A;  4HGA A;  3ZC0 A;  3Q5D A;  2PFV A;  3ONX A;  3Q9D A;  1M7K A;  4FJO A;  3RHW A;  2QGS A;  1XNQ T;  4X1K E;  4NIQ A;  3VRB A;  1KNZ A;  4C90 A;  2LM9 A;  4TWD A;  4TNW A;  4DID B;  4H9O C;  3VJZ A;  4DUZ T;  5FXZ A;  1IZN B;  5AQO B;  3FXE B;  4TZ4 C;  3A5X A;  5LHG B;  4HWF A;  5TAO A;  3VR9 A;  2FJB A;  1E1H B;  3L09 A;  3DTO A;  5LP6 E;  3EUH A;  2NWB A;  4MLK A;  2K5B B;  3ABV A;  4A5X A;  1QSD A;  4KX6 A;  2V26 A;  3ZSS A;  4IST A;  1SJ7 A;  3UUX B;  1MNE A;  2JQH A;  4PK6 A;  3KFW X;  3RC8 A;  2M6I A;  2CMR A;  1D0Z A;  3O9X A;  2YOE A;  5IYZ E;  4B3S T;  3AE8 A;  2HN2 A;  5ADX L;  2D0U A;  4YTP A;  2XQ9 A;  3CX6 B;  3OTO T;  5AQN B;  2KBB A;  2XPK A;  2ZM2 A;  2G0U A;  3N9L A;  3I0O A;  4DVD A;  3ZPO A;  2KT9 A;  1ZV4 X;  4QWN B;  3AY5 A;  3QB5 K;  4EYU A;  4YJ3 E;  3UQ7 A;  2E2A A;  3FZL B;  1IBM T;  4HWD A;  4ZI2 C;  4WNK A;  3C4W A;  2ODV A;  3AAE B;  3S4U A;  2LEH A;  2C5I T;  2F4V T;  3C98 B;  3AED A;  3JAE A;  5FVL A;  3O1H A;  4X1I E;  1HG5 A;  2ES0 A;  3RKG A;  3CKD A;  2V7J A;  4EEB A;  5HYA A;  5JDL A;  5F8P A;  4DR7 T;  3HKB E;  3HKD E;  2QRX A;  3ZMZ B;  5HCJ A;  4JI8 T;  2JQK A;  2UUC T;  5L3B B;  4B3M T;  4YSX A;  4KI0 F;  2JMH A;  4LF6 T;  2AXD S;  4DBQ A;  4IT4 A;  3E22 E;  2KZ7 B;  2X9H A;  4ZOL E;  2KND A;  5HWX A;  4X65 T;  2DWK A;  4H63 H;  2D5U A;  2WS3 A;  2M6B A;  5LCY A;  5AQP B;  4KHZ F;  2WQY A;  3NZQ A;  1T72 A;  2QA7 A;  1YKH B;  1N34 T;  1MMG A;  2W63 A;  4ERR A;  3G06 A;  5ABE A;  2XSA A;  2VKD A;  3OJA A;  2CBI A;  3PUS A;  3GMI A;  5HXE A;  4E7Z A;  5H6Q B;  4IDN A;  4IL4 A;  3TLT A;  4G63 A;  2OA5 A;  4UXN B;  5FKY A;  3SFD A;  4CN6 A;  4IE6 A;  4WW0 A;  4I43 B;  4YLH A;  2N2N A;  5J2T E;  5LGN B;  1S35 A;  3AE2 A;  1B7T A;  1Y64 B;  1JNR A;  1T7S A;  2A9U A;  5EK2 A;  4IE4 A;  2BBH A;  3IEE A;  1WR6 A;  3GN5 B;  3AEG A;  2JQQ A;  4WBO A;  2V5C A;  2HHH T;  4IE0 A;  4DR6 T;  3I1A A;  2NW7 A;  1E7P A;  2I6H A;  2XAS B;  2CA5 A;  4HFD A;  4TV9 E;  2BG9 E;  1T98 A;  3GA8 A;  2NW8 A;  4KUM B;  3WAJ A;  2KSR A;  4QKN A;  4GK5 E;  2NTY A;  3P4S A;  1Z8U A;  2IHR 1;  4ILU A;  3AE7 A;  3X1D A;  2LKG A;  2Y48 B;  3HKC E;  3AB3 B;  3BQI A;  4M1P A;  4QH1 A;  2UXD T;  2BG9 B;  2NR4 A;  3MZK B;  4TNV A;  1NAF A;  4JUY A;  3PUR A;  2VKJ A;  3M65 A;  4PFO A;  3T8O A;  3AE1 A;  4HFC A;  4LF7 T;  2V6Y A;  1ZEE A;  5E0O A;  1W09 A;  3I9Y A;  1CUN A;  2H7O A;  3FZF B;  3EAB A;  3LG7 A;  2CWY A;  4TWH A;  1BR1 A;  3UUN A;  3ETU A;  1KNR A;  4PJM A;  5HEU A;  3F31 A;  3MXZ A;  1WYB A;  4HFE A;  4BAY B;  4F6R C;  5FVK A;  1LVK A;  3R6N A;  4MAL A;  3CIR A;  5CJ5 A;  2VKO A;  3RI5 A;  5HCM A;  1OWA A;  4ZI7 E;  2DL1 A;  2PG8 A;  5AQU B;  5BR8 T;  2J47 A;  3H3M A;  2EHO B;  3PUV F;  3ZMS B;  2L10 A;  2HPJ A;  2W2U A;  4K0U A;  2CEA A;  1X79 A;  2CWO A;  2H7V C;  4X5T A;  2BZB A;  4L0R A;  4QXB B;  2V5D A;  2WDQ A;  3VU7 H;  3K3N A;  5HXS A;  4O2A E;  2OLT A;  4OYJ A;  4IDO A;  2HN1 A;  3UTK A;  2CHN A;  3N2O A;  4I4T E;  3KV6 A;  1XZY A;  3P7I A;  1SJ8 A;  1US7 B;  3NRX A;  3SRZ A;  4X62 T;  3KVB A;  2X0C A;  4PFP A;  4IDZ A;  2BKP A;  3O4X E;  1J5W A;  2BG9 C;  5JR9 B;  3LFM A;  5AQR B;  3PUA A;  5C8Y E;  4MHC A;  3A8Y C;  4O4J E;  2CPT A;  2X9W A;  1XMQ T;  4ZS2 A;  2LJL A;  3UU8 A;  2X67 A;  3LDQ B;  4ANJ A;  5JRE A;  3PDY A;  4B3T T;  3NRY A;  4DV0 T;  2FJE A;  3KIN B;  3ZEF B;  4IRE A;  2ACX A;  1D1A A;  2BVM A;  3PU3 A;  3VKH A;  5CA1 E;  4KBM B;  3HA4 A;  2NW9 A;  2LQU A;  3FZK B;  2B76 A;  4TUY E;  4MBQ A;  3UFG A;  2EHO C;  2IW5 B;  1Y01 A;  4F8H A;  2FUP A;  2XJ7 A;  3SWH A;  3CML A;  4H9Q C;  2NTX A;  1FEW A;  2VVS A;  3HKE E;  3AT7 A;  5HWY A;  3TKL B;  4AKI A;  3ZYK A;  1XNR T;  2D9D A;  4N78 D;  2VK9 A;  5EK3 A;  3BK9 A;  3VHL A;  1T8B A;  1QUU A;  5FXX A;  1D1C A;  1D0X A;  4DO0 A;  4ADZ A;  2KWH A;  5LA6 E;  4OFZ A;  3HL6 A;  4TV8 E;  5JR9 C;  5L47 A;  2YDQ A;  3AAA B;  4YJ2 E;  2WZH A;  4WZX A;  1HNZ T;  5AQL B;  2WSS V;  5FL1 A;  4GOU A;  1ZKE A;  1OED E;  4IIJ E;  5JVD E;  2CM0 A;  5CA0 E;  4U33 A;  5JTG A;  4HEA A;  2W00 A;  3O1J A;  2ZM0 A;  5ABF A;  2LOS A;  3MKD A;  2J62 A;  2WMN A;  2RA1 A;  3NZP A;  5AQQ B;  3KBT A;  3AXJ B;  3ZLI A;  3ZYM A;  4DMV A;  2N9D A;  5IWA T;  5F3J A;  2CXF A;  2X9X A;  5L3C B;  3ONL C;  4EXT A;  2V7I A;  4KMC A;  1YQ4 A;  1OED B;  4U74 A;  1OXZ A;  2C5K T;  4NUV A;  3FB2 A;  4H9S E;  1UUR A;  1BR2 A;  3FZH B;  2WDV A;  5ABG A;  4UF0 B;  2KWI B;  3RQW A;  1ZP0 A;  3K3Q C;  2YDR A;  3MJX A;  2ODU A;  2H89 A;  3ZMU B;  2L8K A;  2DI4 A;  3L3P A;  5JDN A;  5A1L A;  2BKN A;  3LK4 2;  4HWH A;  1BR4 A;  1VCT A;  1D1B A;  3AE3 A;  3AA7 B;  3IF8 B;  4DMW A;  1MIW A;  2W4X A;  3TLS A;  2EHO D;  2VL8 A;  4IDP A;  4LMJ A;  4CZZ B;  4NPP A;  4C91 A;  3KV4 A;  3J9X 1;  4YHJ A;  4UR9 A;  1J5E T;  4JEU B;  2XQA A;  4CXX A;  2JJ9 A;  5L3F B;  2WP9 A;  2MTC A;  2XAQ B;  5LOV E;  3M3Z B;  3WUR A;  4JI2 T;  3UUB A;  3VKG A;  4UIG A;  4UV8 B;  4PK5 A;  4UEM A;  1XDP A;  3OKQ A;  5AQF B;  4DUY T;  2XQ5 A;  5FXV A;  4LF5 T;  1WR0 A;  5JRC B;  3LK2 B;  4G2A A;  3AVS A;  2XZE A;  3RYF E;  3AA1 B;  4Z91 A;  3ANW A;  4WBN E;  4NUU A;  1YW0 A;  5LBM A;  3ESL A;  4PJL A;  5AQG B;  5C3J A;  4EGW A;  1OED C;  2MPK A;  5L4H A;  3JCF A;  4LFC T;  3ZT7 A;  4DV7 T;  2KMF A;  4IE5 A;  2XSB A;  2E8I A;  3AE5 A;  3PU8 A;  4GIW A;  2UXC T;  2V8S V;  3ONJ A;  2AE9 A;  1JNZ A;  3TLW A;  3P8C D;  2DNX A;  1NWM X;  1VRB A;  3L8R A;  1HG2 A;  2QYW A;  4LF9 T;  4GKJ T;  3F2E A;  2JMK A;  4U2Y A;  4CXY A;  2DWG A;  1MMD A;  2DCF A;  2K24 A;  2V7K A;  1HR0 T;  4YY3 T;  2N1G A;  3LSV A;  1KF6 A;  2IDO B;  5LMN T;  4CN1 A;  2LSJ A;  5KX5 E;  4IL9 A;  1WRD A;  4ZI3 C;  3RX6 A;  4E7S A;  4JI5 T;  4JI0 T;  2K48 A;  2FBW A;  2RPA A;  3PTR B;  4PNI A;  1MMN A;  1FJG T;  4FI5 A;  4UVB B;  5EZY E;  5AQH B;  2LOP A;  5JQG E;  2VAS A;  4GKK T;  3N5L A;  2BS4 A;  2KIN B;  4QX7 B;  1BR0 A;  4BA9 A;  1NEN A;  4TX5 A;  4ZS3 A;  4DV2 T;  2IIU A;  4UVA B;  1N32 T;  4IDQ A;  3RF1 A;  4P0B A;  4EZ4 A;  4Z90 A;  5FP3 A;  2KGX A;  3RIU C;  2IUB A;  3LBX B;  4ZI2 D;  4H9P C;  2YK0 A;  5FNV E;  4DR5 T;  1HFA A;  3N9Q A;  4AQF C;  3P50 A;  1U5P A;  4LF8 T;  2L3L A;  5JDM A;  2JQ9 A;  2WMO A;  1S94 A;  2DHR A;  2J4G A;  3CX8 B;  2XHE B;  4AKL A;  2WB5 A;  4ZEY A;  1YKE B;  2JIW A;  2W62 A;  5LJM A;  3R84 B;  1X9B A;  1KNP A;  3H3A A;  1H7C A;  4HWI B;  4DR2 T;  2WDR A;  3CX7 B;  4PAG A;  2B1E A;  3ZN0 B;  4H9R C;  2X66 A;  4H9N C;  3AVR A;  2MAW A;  3UUM A;  4O4H E;  1MND A;  4YTM A;  3VR8 A;  5AQV B;  2Q9Q B;  3WAK A;  1ZHC A;  2IC6 A;  3PJA J;  2UXX B;  1NEK A;  4GYS A;  3CK6 A;  3H37 A;  2C5J A;  4ECG A;  5LJN A;  4JI1 T;  2BDE A;  3AA0 B;  2IML A;  5JDH A;  4A97 A;  3RIA A;  1FIO A;  2M67 A;  4O2B E;  1KEY A;  3GN5 A;  4AXP A;  3P4R A;  5CGM A;  1E2A A;  4HFI A;  3EDU A;  4U7I A;  3PUY F;  2E9X B;  2WCA A;  3ZJ2 A;  4ZI3 D;  2VWA A;  1IBK T;  2WZI A;  4CI3 B;  2NP9 A;  4W8P A;  2LSK A;  2VQE T;  3C4X A;  2JRK A;  2LHR A;  2RP4 A;  1XWM A;  1Z0P A;  1WYC A;  1LRZ A;  1AJ3 A;  1FMW A;  4EIW A;  1XDO A;  5FXW A;  4LFA T;  2XQ7 A;  4LF4 T;  3B5M A;  5FYM A;  5AQT B;  4BJN A;  3W15 B;  1LKX A;  2V7M A;  5KDM C;  4EZH A;  1V9D A;  2HH7 A;  4AIS A;  2BG9 A;  3NBX X;  2YKS A;  3RGL A;  4QH5 A;  1L0V A;  3QNU A;  2IC9 A;  2UUB T;  2CLY B;  2WM9 A;  2UXN B;  3Q5E A;  1UGO A;  1D0Y A;  3BQL A;  3SOL A;  2Q9Q C;  2YDS A;  4GYR A;  3JAF A;  3RYH E;  3L39 A;  2UUA T;  4O4I E;  4CI1 B;  3KDS E;  4LFB T;  3UU5 A;  3ZJ1 A;  4ZZC A;  5FZT A;  3C4Z A;  4COF A;  5CB4 E;  2CHO A;  2E9X C;  4IE7 A;  3Q2M A;  4DR4 T;  1WFD A;  4AQG A;  4Q25 A;  4JV5 T;  2CE7 A;  1WCR A;  3PHF 1;  5L3D B;  4ILB A;  5FMN A;  1HTJ F;  1R8I A;  2BS2 A;  2VUR A;  4PW8 A;  4DV1 T;  3TLV A;  3E0Z A;  2PBI A;  2LE8 A;  4JI4 T;  1FMV A;  4HFV A;  4PJN A;  1IJ6 A;  3UU4 A;  4DBR A;  5M4Y A;  2V6X A;  4YT0 A;  2X0H A;  1EZ3 A;  2CBJ A;  4B3R T;  3RLF F;  1YXR A;  5DQV A;  4AKG A;  3OYX A;  5JR9 A;  5C2T A;  3GWH A;  2Y8D A;  4QXH B;  4X1Y E;  3PF0 A;  3I0Q A;  5AQS B;  2ZM6 T;  2ACZ A;  1IBL T;  2CLY C;  4QXC B;  3UU3 A;  2ZM8 A;  4ILC A;  2LKH A;  2W66 A;  5FY7 A;  3AE6 A;  4EYY R;  5HAX A;  5CFB A;  3AEB A;  3PV0 F;  4TN7 B;  4DR1 T;  2XQ6 A;  1HS7 A;  5HEJ A;  4BJM A;  4U2Z A;  4U31 A;  4WYV A;  2LRK A;  3ZYL A;  3UT5 E;  2IAK A;  4EED A;  5T1D A;  3ZCJ A;  2P9B A;  4TWF A;  3QOF A;  2XAH B;  3IBP A;  2C0S A;  2Y6X A;  2VQF T;  5H6R B;  3ZST A;  3HR0 A;  4DR3 T;  1HF8 A;  4F7G B;  2H88 A;  2Q9Q D;  3FZM B;  4AKR B;  3MAC A;  3RPU A;  3BQK A;  3LJC A;  3PUX F;  3AEC A;  1DU2 A;  4B6X A;  3T1Y T;  3PUW F;  4JI3 T;  2LT3 A;  4AQY T;  2LRL A;  3PJA A;  2DLR A;  4HKA A;  4KHP T;  5LHH B;  2XQY A;  2XQ3 A;  3DJB A;  2LSI A;  2E9X D; 
#chains in the Genus database with same CATH homology
 3AAI A;  4ZI7 E;  1OWA A;  4OK0 A;  2K48 A;  4JEH B;  4XAX B;  2PG8 A;  3C50 A;  4ISS A;  3PTR B;  4ASK A;  3V5S A;  4PNI A;  1MMN A;  2L9Q A;  2LSY A;  2A3D A;  4ZHQ E;  1O3X A;  1WLX A;  2EHO B;  4FI5 A;  2V7L A;  4PK4 A;  4UVB B;  5EZY E;  2K9A A;  3ZMS B;  3K8P C;  2LOP A;  5HXC A;  5LNK A;  2HPJ A;  1G73 A;  3UFE A;  2W0G A;  4K0U A;  4CQI A;  2MOZ A;  5JQG E;  2VAS A;  4PJJ A;  2XAF B;  5L3E B;  2CEA A;  2SPC A;  1X79 A;  3N5L A;  4IHJ E;  1HCI A;  2CWO A;  2KIN B;  2H7V C;  2BZB A;  2VKH A;  4QX7 B;  1BR0 A;  4O4L E;  3FXD B;  4L0R A;  4QXB B;  5ETW A;  3OBV E;  4L9I A;  4BA9 A;  4EAH A;  2MTQ A;  4H63 V;  2A2F X;  4U72 A;  3VU7 H;  4HN9 A;  3K3N A;  4ONR A;  1UCU A;  2KXP B;  5HXS A;  5LYJ E;  3FBZ A;  4TX5 A;  2XAG B;  3MA9 A;  4O2A E;  4L5G A;  4OYJ A;  4ZS3 A;  3PUG A;  3WI3 A;  5KMG P;  3QUJ A;  2NOX A;  5HXH A;  4JLE A;  3ZN1 B;  5JDG A;  1IAP A;  3CQX C;  4UVA B;  4CXW A;  3RC3 A;  5LGT B;  3UTK A;  3Q5W A;  2ZMA A;  3AA6 B;  3N2O A;  3RKO A;  2D0T A;  1YD8 G;  4I4T E;  3KV6 A;  3CVR A;  4P0B A;  3P7I A;  2X51 A;  3U3I A;  4DND A;  2J1D G;  1US7 B;  3NRX A;  4EZ4 A;  3SRZ A;  4UVC B;  3KVB A;  4PFP A;  4IDZ A;  5FP3 A;  4XBF B;  3O4X E;  3FHN A;  3ETV A;  3LBX B;  3ZC1 A;  5JR9 B;  4ZI2 D;  3HI2 A;  4H9P C;  2KLQ A;  5JDF A;  2YK0 A;  3N2K E;  2I59 A;  5FNV E;  3LFM A;  1MIY A;  1G8X A;  1MMA A;  4IGU A;  3PUA A;  5C8Y E;  4MHC A;  4O4J E;  2BVL A;  2ZLY A;  1HFA A;  3B57 A;  3MK7 C;  3N9Q A;  4AQF C;  3M1C A;  1U5P A;  2X9W A;  3DP7 A;  2L3L A;  5JDM A;  2VB6 A;  4HE8 A;  4ZS2 A;  2LJL A;  2A72 A;  2X67 A;  3ANW B;  2WMO A;  4ANJ A;  1S94 A;  3RYI E;  5JRE A;  2WAU A;  3PDY A;  2DHR A;  4UF0 A;  2MYS A;  3CX8 B;  3LK3 B;  2XHE B;  3RRC A;  4HGA A;  3NRY A;  4AKL A;  3ZC0 A;  4HTE A;  2PFV A;  1YKE B;  4AI6 A;  3ONX A;  2W62 A;  3Q9D A;  3IHR A;  3R84 B;  5LJM A;  3KIN B;  4FJO A;  2QGS A;  2MBG A;  3ZEF B;  4CI2 B;  4X1K E;  1KNZ A;  3EVY A;  3H3A A;  4C90 A;  1H7C A;  2CXL A;  2LM9 A;  2ACX A;  3C64 A;  3CX7 B;  4PAG A;  2PJQ A;  2B1E A;  3RYC E;  1D1A A;  2H3R A;  2W61 A;  3ZN0 B;  4H9R C;  2BVM A;  2X66 A;  3PU3 A;  4H9N C;  3ZMT B;  3AVR A;  3UUM A;  3VKH A;  5CA1 E;  4KBM B;  4H9O C;  3VJZ A;  3HA4 A;  4O4H E;  2NW9 A;  1MND A;  3CPZ A;  2LQU A;  5FXZ A;  1IZN B;  3FXE B;  4TZ4 C;  4TUY E;  3B13 A;  3A5X A;  4MBQ A;  2Q9Q B;  5LHG B;  2EHO C;  2IW5 B;  5AFU L;  3WAK A;  5TAO A;  1ZHC A;  2IC6 A;  2UXX B;  1E1H B;  3SWH A;  4GYS A;  3UUL A;  3CML A;  3FBL A;  3L09 A;  4H9Q C;  3DTO A;  2NTX A;  2YIN A;  3H37 A;  3J7Y q;  2C5J A;  4ECG A;  5LJN A;  5LP6 E;  2BDE A;  1FEW A;  3V5U A;  3AA0 B;  3EUH A;  3HKE E;  2NWB A;  4MLK A;  5EK4 A;  3AT7 A;  1SA0 E;  2K5B B;  5JDH A;  1UX4 A;  5HWY A;  3TKL B;  1QSD A;  4AKI A;  3ZYK A;  3JC6 C;  4OYK A;  1FIO A;  2V26 A;  4N78 D;  2M67 A;  4O2B E;  4IST A;  2VK9 A;  3GN5 A;  4AXP A;  3QK6 A;  5EK3 A;  3N9O A;  3BK9 A;  3UUX B;  1MNE A;  3EDU A;  4PK6 A;  3KFW X;  2E9X B;  4YFS A;  3RC8 A;  2CCQ A;  2CMR A;  3VHL A;  1D0Z A;  3ZJ2 A;  3O9X A;  5IYZ E;  2D2S A;  4ZI3 D;  2VWA A;  1QUU A;  2LHN A;  5JRC A;  4CI3 B;  5ADX L;  2D0U A;  5LXT E;  2NP9 A;  5FXX A;  2LSK A;  1D1C A;  3CX6 B;  3N2G E;  1D0X A;  4DO0 A;  4ADZ A;  4OHF A;  2KWH A;  3C4X A;  5DAB A;  2JRK A;  4OFZ A;  5LA6 E;  2ZM2 A;  3HL6 A;  2LHR A;  4TV8 E;  5JR9 C;  2G0U A;  2RP4 A;  4KP3 C;  3N9L A;  3I0O A;  1Z0P A;  4J2C A;  4DVD A;  3ZPO A;  1WYC A;  2KT9 A;  3AAA B;  4YJ2 E;  1LRZ A;  1ZV4 X;  4QWN B;  1AJ3 A;  1FMW A;  4Z8X A;  4EIW A;  4EYU A;  4YJ3 E;  5FXW A;  2X9Y A;  2XUE A;  2WSS V;  1IJ5 A;  4ZI2 C;  5FYM A;  3KV5 A;  4WNK A;  3C4W A;  4GOU A;  1ZKE A;  2ODV A;  4BJN A;  3W15 B;  3RRW A;  3AAE B;  1LKX A;  2XAJ B;  3C51 A;  4IIJ E;  2V7M A;  5JVD E;  3S4U A;  2CM0 A;  5CA0 E;  5KDM C;  3KV9 A;  2GK9 A;  2LEH A;  2C5I T;  4HEA A;  3SS1 A;  3C98 B;  2W00 A;  3O1J A;  2ZM0 A;  4EZH A;  3N9P A;  1V9D A;  3O1H A;  5L3G B;  2LOS A;  2HH7 A;  4X1I E;  3MKD A;  2WBL A;  4MFR A;  1HG5 A;  2ES0 A;  1VOM A;  4QX8 B;  3NBX X;  2WMN A;  2RA1 A;  2HPL A;  3NZP A;  4GK0 E;  3KBT A;  1HX8 A;  2V7J A;  3CKD A;  3ZLI A;  2IC9 A;  5HYA A;  5JDL A;  3WSC A;  3ZYM A;  4AQF A;  2V1D B;  3N9N A;  3F57 A;  5F8P A;  4DMV A;  2N9D A;  2CLY B;  2WM9 A;  4I50 E;  3HKB E;  3HKD E;  3ZMZ B;  2UXN B;  5F3J A;  1D0Y A;  3N9M A;  2CXF A;  2X9X A;  3BQL A;  3SOL A;  5L3C B;  2Q9Q C;  4EXT A;  2V7I A;  5LBQ B;  4KMC A;  4GYR A;  5L3B B;  3RYH E;  4U74 A;  1OXZ A;  2JPF A;  2C5K T;  2JMH A;  4O4I E;  4NUV A;  3FB2 A;  4DBQ A;  4CI1 B;  3E22 E;  3KDS E;  4H9S E;  1BR2 A;  2KZ7 B;  2X9H A;  4ZOL E;  2KND A;  5HWX A;  3RH3 A;  4UF0 B;  2DWK A;  3ZJ1 A;  4H63 H;  3KBU A;  2D5U A;  2KWI B;  5LCY A;  3K3Q C;  3MJX A;  2ODU A;  3NZQ A;  3C4Z A;  3ZMU B;  2QA7 A;  2L8K A;  2X68 A;  4UEL A;  5CB4 E;  1YKH B;  2DI4 A;  2E9X C;  2XTL A;  4IE7 A;  1MMG A;  2W63 A;  3L3P A;  4QHO A;  2YU1 A;  3Q2M A;  5JDN A;  5A1L A;  5J1G A;  3ZCI A;  4AQG A;  3LK4 2;  5LHI B;  4ERR A;  1SHZ C;  2VKD A;  3PUQ A;  3OJA A;  1BR4 A;  3PUS A;  1D1B A;  3GMI A;  5HXE A;  2CE7 A;  3AA7 B;  3IF8 B;  4DMW A;  1MIW A;  4E7Z A;  5H6Q B;  3PHF 1;  4V1A v;  2CXD A;  2EHO D;  2VL8 A;  5L3D B;  4G63 A;  5FMN A;  2OA5 A;  4UXN B;  1HTJ F;  4CZZ B;  5GON E;  4C91 A;  3KV4 A;  5L2L A;  4PW8 A;  4UV9 B;  3OYZ A;  3J9X 1;  4YHJ A;  3I9W A;  4IE6 A;  3E0Z A;  5FY1 A;  2PBI A;  4WW0 A;  5JH7 E;  2LE8 A;  4I43 B;  4JEU B;  2YEV C;  2LSG A;  4YLH A;  1FMV A;  2N2N A;  5J2T E;  4HFV A;  4PJN A;  5BMV E;  5LGN B;  1S35 A;  3EDV A;  3JC6 D;  1IJ6 A;  4CXX A;  4DBR A;  2JJ9 A;  5M4Y A;  1B7T A;  1Y64 B;  5L3F B;  5EK2 A;  4IE4 A;  4O8S A;  3CQG B;  3IEE A;  1WR6 A;  2MTC A;  2XAQ B;  5LOV E;  4EOZ B;  5LG4 A;  3WUR A;  3GN5 B;  4P0A A;  1EZ3 A;  2JQQ A;  4WBO A;  3VKG A;  4UIG A;  4I55 E;  4UV8 B;  4IE0 A;  5DQV A;  4AKG A;  4PK5 A;  3I1A A;  3OYX A;  3LBX A;  4UEM A;  4XZC A;  5JR9 A;  2NW7 A;  3OKQ A;  2XAS B;  3GWH A;  2Y8D A;  2CA5 A;  5FXV A;  4QXH B;  5JRC B;  4X1Y E;  3PF0 A;  3LK2 B;  3I0Q A;  4G2A A;  3AVS A;  5DJQ C;  3RYF E;  4TV9 E;  2CLY C;  4AKH A;  4QXC B;  5J2U E;  3AA1 B;  1T98 A;  3ANW A;  3GA8 A;  2ZM8 A;  4WBN E;  2NW8 A;  4NUU A;  1YW0 A;  4KUM B;  5LBM A;  3ESL A;  2YU2 A;  5FY7 A;  4PJL A;  3U78 A;  4EYY R;  3WAJ A;  2Z6E A;  1U4Q A;  5LGU B;  5HAX A;  4QKN A;  4GK5 E;  2NTY A;  4TN7 B;  1MIV A;  1KK7 A;  1HS7 A;  4ILU A;  4X20 E;  4BJM A;  2KMF A;  4IE5 A;  2Y48 B;  3O1I A;  3HKC E;  3AB3 B;  2E8I A;  3BQI A;  3PU8 A;  5DQW A;  4GIW A;  3ZYL A;  5FY0 A;  3UT5 E;  2IAK A;  4M1P A;  5T1D A;  5HXR A;  3CQC B;  3ZCJ A;  2P9B A;  2X0L B;  1UX5 A;  2XAH B;  3MZK B;  3IBP A;  2WWU A;  2C0S A;  2Q9Q A;  3QC9 A;  4EB6 E;  3ZMV B;  1NAF A;  3Q5X A;  2Y6X A;  4JUY A;  5H6R B;  3PUR A;  2VKJ A;  3M65 A;  3P8C D;  2DNX A;  3HR0 A;  1NWM X;  4PFO A;  3T8O A;  1VRB A;  1HF8 A;  1HG2 A;  2Q9Q D;  4AKR B;  3MAC A;  5IHY A;  1LVF A;  1ZEE A;  3RPU A;  3BQK A;  3F2E A;  5E0O A;  3LJC A;  2JMK A;  3I9Y A;  3PE0 A;  4B6X A;  4BGO A;  1CUN A;  3D0T A;  2H7O A;  4CXY A;  2EHO A;  2DWG A;  2LT3 A;  3KVA A;  3CWZ B;  1MMD A;  2CWY A;  3LG7 A;  3E08 A;  3UUN A;  1BR1 A;  2DCF A;  2K24 A;  3ETU A;  2E9X A;  2V7K A;  4PJM A;  3F31 A;  2N1G A;  3MXZ A;  2DLR A;  1WYB A;  3K3O A;  4HKA A;  4P09 A;  4A56 A;  2LSJ A;  5KX5 E;  5LHH B;  4BAY B;  2XQY A;  4F6R C;  5JDQ A;  1WRD A;  1LVK A;  3DJB A;  2LSI A;  3R6N A;  4MAL A;  4ZI3 C;  2E9X D;  3RX6 A;  4E7S A;  2VKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...