5HXRA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 10mm ca2+
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
300
structure length
293
Chain Sequence
b'MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 121
structure length 293
sequence length 300
ec nomenclature
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hxrA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hxrA02
5JDLA 5JDFA 5HWXA 5JDQA 5HXEA 5HXSA 5HYAA 5HXRA 3V5UA 5JDNA 5HWYA 5JDHA 5JDMA 3V5SA 5JDGA 5HXHA 5HXCA
chains in the Genus database with same CATH superfamily
3AEAA 4P0AA 3OYXA 2CHOA 4ONRA 4DR3T 1M7KA 3PJAJ 2FJAA 4COFA 3RX6A 1HNZT 4F7GB 2KZ7B 4PFPA 4CN1A 3ZCIA 1WLXA 3Q5WA 5L3CB 2JRKA 1HS7A 5EZYE 2CLYC 1HG2A 5HXSA 2CBJA 3N9LA 1T8BA 4DV5T 3TLWA 1ZEEA 3LK3B 5AQMB 4CN6A 5AQSB 3N9PA 2UXDT 5EK4A 2JMHA 4IDPA 4HFVA 3RRWA 3UU5A 4HWCA 4JEUB 2ACXA 3C50A 4CI2B 3IEEA 2W61A 5HEUA 2FBWA 4X1KE 5HXHA 4XZCA 3KFWX 3N9MA 3UFGA 5J0ZA 3I9WA 4AQGA 4ADZA 3UUNA 5L3EB 4X1YE 2LKGA 3CX7B 2KGXA 3AY5A 3N9NA 3RLFF 1W09A 2W2UA 3IA3A 3KV4A 3P4QA 2D5UA 4HKAA 3JC6D 4HWHA 1BR4A 4UELA 4JEHB 2E8IA 2UUCT 2DWGA 2MAWA 4UVCB 5LMNT 5IYZE 3KINB 4PFOA 5LB7B 3O1HA 2MTQA 4DV2T 2BDEA 2XAGB 3KDSE 4L0RA 3AEBA 2L10A 2LT3A 5H6RB 2WDQA 4KX6A 4C91A 4U7IA 3BQIA 4C90A 3L39A 4BJNA 1KFYA 2E9XD 3I1AA 2J1DG 2WU5A 1T98A 2KWHA 2HHHT 3IHRA 5LGUB 4TUYE 5ABEA 4GKKT 3V5SA 3CWZB 2CE7A 1UURA 5LJMA 2V5CA 4DR6T 4O2AE 2Q9QC 2JIWA 1QLBA 4U31A 5JR9A 3BQKA 4A97A 2V7LA 3H3AA 4JI2T 3VRBA 1IJ5A 2NTXA 2LSJA 3Q2MA 2WU2A 3SS1A 3UQ4A 3ZKRA 1KK7A 4QX8B 1XWMA 2ZM8A 2XQAA 3TLSA 2N1GA 3T1HT 4UV9B 1EZ3A 4PJJA 5AQGB 4AQYT 3PUWF 4HFHA 3ZEFB 2YU2A 4O4HE 2XPKA 5T1DA 4HWDA 3UT5E 2LHRA 2V26A 2XSBA 3EDUA 2KXPB 5F3JA 4MLKA 3KV6A 2UUAT 4IL4A 2G0UA 2CBIA 2AXDS 2ZM2A 3TKLB 5LMUT 2XJ7A 3C4ZA 4E7SA 4DNDA 2L9QA 3E22E 1SJ7A 2I6HA 2RPAA 4EV6A 3FHNA 3HKEE 4IHJE 3S4UA 3PUAA 5AQNB 4G63A 2BBJA 4A98A 1VRBA 3N9QA 3ZJ1A 2E5VA 5IWAT 4KI0F 4UF0A 5FXXA 3AA7B 1XMOT 2X68A 1HR0T 4LF9T 2WZIA 4Z91A 4DV7T 5ADXL 5AQHB 2WP9A 5HWYA 2K48A 4EGWA 2ZM6T 4DMWA 2M6BA 1M62A 1BR0A 1S35A 2ZM0A 5F5WA 1MMDA 3AE4A 2KVPA 4AKGA 3AXJA 4FJOA 3ZYMA 2UXBT 2MPKA 1YQ3A 4QX7B 3F31A 5LOVE 3UULA 3NVOA 5FNVE 4EEDA 2LRKA 1VCSA 2IUBA 3A7MA 3P4PA 2MOZA 1T72A 2A72A 1HX8A 2BZBA 1I6ZA 5LNKA 4DMVA 5HXCA 3AEEA 4ZXLA 3J9X1 5JTGA 2WBLA 4PW8A 3VKHA 1L0VA 1OEDE 2LSGA 3O9XA 1D1AA 3RKOA 4X62T 4ECGA 1NWMX 4EOZB 4O4JE 1IJ6A 2M6IA 4YSZA 5JDMA 4LF4T 3A8YC 4TV8E 1MNDA 2DI4A 4U72A 4ZS2A 2Q9QD 3V5UA 5LA6E 4MBQA 5AQPB 1LVKA 4WW0A 5FMNA 2VB6A 3PJAA 3PF0A 3HKCE 4YHJA 3EABA 2XAQB 4W8PA 4CI1B 2NW9A 3C4WA 1E7PA 2NOXA 1G73A 3D0TA 5LBQB 2BG9B 2WMOA 4HTEA 1ZP0A 3CKDA 4BAYB 3PUVF 4TX5A 5LBMA 2YDRA 4NIQA 5DQVA 4LMKA 4ILCA 5CGMA 5FKYA 4DV1T 4DV4T 2IC9A 3ZT5A 2MTCA 5ABFA 2WSSV 2XQ8A 3NZQA 2Y48B 5LHHB 4YXDA 2PTFA 4JI6T 4U33A 2W00A 2OV9A 2XTLA 1XNQT 2WWUA 4IDZA 1Y64B 3WAJA 3HR0A 5LG4A 3EDVA 3OKQA 1ZV4X 3KV5A 2XY8B 1YXRA 5BMVE 5CJ5A 2N2NA 3CQGB 2CEAA 4EEBA 4TN7B 5IUXA 4TV9E 4YLHA 1W0AA 3QC9A 5AQVB 3F2EA 4U3CA 2V7JA 2XM1A 3R6NA 4H63H 4KUMB 2D9DA 3QOFA 2BG9C 3ZN0B 4LMLA 3Q5EA 1OWAA 3ZT6A 3UFEA 5L4HA 5DQWA 2V6YB 1QUUA 4BJMA 3PDYA 4IT4A 3FZKB 4EYUA 4OFZA 5JR9B 3B13A 5LHGB 2GK9A 2JPFA 2UXCT 3JADA 2EHOC 3FXDB 3LBXA 1J5WA 5LGNB 4DUZT 3L09A 1ZOYA 2XQ3A 3GWHA 4P09A 1IBLT 4B3TT 3PHF1 4PNIA 3N5LA 4AQFA 4ILUA 3C51A 1UGOA 3PU8A 1FMWA 4B3ST 3ZT7A 1KNPA 4DR4T 2X0YA 1XMQT 2LKHA 4X1IE 4DVDA 5FVKA 2E9XA 1FEWA 4ERRA 2D0TA 4FI5A 2JQKA 4CXYA 4HE8A 1UX4A 4AI6A 2DLRA 4H9PC 3CQXC 4ILBA 2BS4A 5HAXA 1HX1B 5J1GA 1OXZA 4HN9A 4TNWA 3C98B 2J47A 5JVDE 3K8PC 3AE7A 2FUPA 2VL0A 4QXCB 4U2ZA 3RHWA 2UXNB 4IREA 4JBWF 4HGAA 3CX6B 4DR2T 2UUBT 3N2GE 4B3MT 3N2KE 3QB5A 4I0UA 2BKNA 2CMRA 1JNRA 5AFUL 2E5LT 1WR6A 4IE4A 4LF5T 3C64A 2VKOA 4ZI3C 4PK4A 5HEGA 3VJZA 3SRZA 1SJ8A 4IL9A 2A2FX 4DR5T 1KNZA 4AKLA 3CVRA 4EZ4A 5DJQC 1BR2A 1OEDA 3BK9A 5EK3A 2BS3A 2L8KA 3Q5DA 4YJ2E 3MACA 4UF0B 1YW0A 2W67A 4H9SE 3PV0F 1KNRA 5JH7E 2K3WA 2BKPA 4DUYT 3I0QA 4CN4A 4E7ZA 2YOEA 1CUNA 3P7IA 5JDNA 3PUGA 4EIWA 4DIDB 2X66A 2A9UA 4JI8T 4L9IA 3UU8A 1KEYA 5LYJE 5AQTB 1KF6A 4J2CA 4DR7T 1WR0A 3KBTA 4X66T 5IHYA 5HWXA 2YINA 3TLUA 3OYZA 5HYAA 2CHNA 3O1IA 2XHEB 1QSDA 1H7CA 4EZHA 4ZZCA 5L3DB 5JDHA 3ZSSA 2CM0A 4X65T 5H6QB 1SHZC 4O8SA 4EAHA 3K3NA 5JRCA 4TWFA 2FJEA 2VASA 3QNUA 4LF7T 2KSRA 5JREA 3ZYKA 1E2AA 2FJDA 4WYVA 1WRDA 3EVYA 4QH1A 2EHOD 4PAGA 5C3JA 2DWKA 2PG8A 5M4YA 3B5MA 3CMLA 3RQUA 1S94A 1N33T 1N34T 2HH7A 2V8SV 4IE6A 3RC3A 5C2TA 5JDLA 2JQ9A 1IBKT 3LDQB 1E1HB 2DCFA 4PK6A 2L3LA 2HN1A 2IDOB 3FBLA 2YDQA 3A5XA 1NENA 2BKOA 4LFBT 3AE1A 2XZEA 5ABFB 2A3DA 2IMLA 1MIWA 3DJBA 1IZNB 3P4RA 3ONXA 3K3OA 5E0OA 2IC6A 4NXNT 5JDQA 3HKDE 4B6XA 4Z90A 4DV6T 2Q9QA 3UU4A 2XQYA 4H9NC 3AE3A 1YKHB 2XQ9A 5JDGA 4CQIA 4AKHA 4V1Av 2BVLA 3RIUC 2LSYA 3UTKA 3RIFA 2DHRA 1N36T 3U3IA 2VKJA 2VVNA 2WDRA 5FXZA 4EYYR 1YD8G 2D2SA 2M67A 4JV5T 5CB4E 2K24A 1B7TA 4NUVA 1LVFA 2RA1A 4QWNB 1XNRT 4ZI3D 4F6RC 4I4TE 4QH5A 2WCAA 5CFBA 3E0ZA 2R6GF 1ZKEA 2JJ9A 4KBMB 3SFDA 3AE6A 4I43B 4O4LE 2NW8A 3T8OA 3MZKB 3T1YT 5KX5E 3PUYF 1I94T 3EUHA 3RYHE 1BR1A 1G8XA 4UR9A 4M1PA 2V1DB 2XAFB 5GONE 4N78D 4DO0A 4QKNA 3ONLC 3QB5K 2LSKA 1FMVA 1HG5A 2QRXA 4I50E 5FY0A 3ZSTA 3RIAA 3ZJ2A 2OA5A 3ZCJA 2KT9A 3NWIA 3MK7C 3DP7A 1HNXT 2X9XA 4AIUA 2W62A 5AQIB 3OTOT 1D1BA 4ZEYA 4YTPA 2E9XB 3VU7H 2LOPA 4OYJA 2XASB 2UU9T 2ODUA 2H88A 4IGUA 4WZXA 3AAAB 2XAJB 3BQLA 1YKEB 2WQYA 3ESLA 3RYCE 1ZHCA 2KBBA 3OPCA 2IHR1 3ETUA 4YFSA 4G2AA 4JUYA 2YU1A 5CA0E 3PTRB 3ZMVB 3JC6C 5FVLA 2K9AA 3AAEB 3Q9DA 1WYCA 2YDSA 1U4QA 1WCRA 4ZI2C 4P0BA 4LF8T 5AQKB 4GIWA 3RGLA 3P50A 3UQ7A 2CPTA 4X5TA 3DYJA 1OEDB 3LFMA 2I0MA 5HEJA 2QVAA 2VWAA 4QH4A 3ANWA 3WURA 2CA5A 2DNXA 3FZMB 4DBQA 1NAFA 3J7Yq 5J2TE 2W66A 3RH3A 3GMIA 2VK9A 4U74A 3FZFB 3VHLA 3AECA 5LXTE 5CA1E 2XM2A 3UU6A 3HL6A 4JI1T 1Z8UA 3H37A 5LJNA 3H3MA 5L47A 1HNWT 1J5ET 1AJ3A 3O1JA 2CLYB 2LLYA 3L3PA 3JAEA 3JCFA 2N9DA 3NRXA 3HKBE 5ETWA 5A1LA 2VURA 2BBHA 3PUXF 4Q25A 4P1NA 3MXZA 4YTNA 4OX9T 2J62A 3GN5A 2LE8A 3VR9A 5BR8T 5LG3A 5HEHA 3UUBA 1YQ4A 4QXBB 5HXEA 4GKJT 4A56A 2K5BB 3RYIE 4NUUA 4QXHB 3PE0A 4KHZF 4MHCA 5JRCB 3LG7A 2VKHA 2X0LB 4U2YA 2MYSA 3TLTA 3FYQA 2YKSA 3ONJA 3RQWA 3AB3B 1HFAA 4ILAA 3E08A 1D0XA 2FJBA 1VCTA 1O3XA 4LMJA 1WFDA 2HPLA 3LJCA 5TAOA 2YK0A 1LKXA 3EHZA 3IBPA 4ZZBA 2ZLYA 2CWYA 1VOMA 3RKGA 3ZN1B 2I59A 2H7VC 2JQQA 3ZC1A 3N9OA 5EK2A 4HEAA 1MNEA 5AQQB 2F4VT 1WYBA 2W4XA 2PFVA 1J1JA 3P8CD 2QA7A 2V5DA 2B1EA 1MMAA 1N32T 3ABVA 3KVBA 5JR9C 3UUMA 1XZYA 2BG9A 2X9YA 3NRYA 3M1CA 4JI3T 3CK6A 2Q9QB 3AVSA 3W15B 3RRCA 4UIGA 3LK2B 1MIVA 3RI5A 2J4GA 1HTJF 2NTYA 2EHOA 1SUMB 3AA1B 2C0SA 2C5IT 1US7B 2BVMA 2OLTA 4JI5T 2X9WA 4L5GA 2NWBA 2CCQA 3ZLIA 3JAFA 2XQ6A 2V6XA 4ZI2D 3DTOA 3AA6B 3CPZA 5KDMC 2LOSA 4DV0T 2LHNA 1UK5A 3UUXB 3M65A 1HCIA 2LM9A 3SOLA 3AXJB 4I55E 4JLEA 3L8RA 4K0UA 5LP6E 2HN2A 4HFEA 3SWHA 5C8YE 4O2BE 1W0BA 3ZMZB 2IIUA 4HFBA 3FZHB 4ZS3A 2NR4A 3UU3A 5LGTB 4A5XA 2LM2A 3N2OA 5DABA 3AE2A 4GOUA 2KWIB 3GA8A 2L7NA 2CXLA 3RC8A 3KV9A 2V6YA 3AVRA 4K0KT 2ES0A 4DBRA 4CXWA 1UUSA 2XQ7A 5JQGE 1JNZA 1IAPA 5FXVA 4XBFB 2W0GA 3FZLB 2KLQA 1MMNA 4BA9A 5LHIB 4XAXB 2X9HA 4IE7A 5AQLB 4TZ4C 3WI3A 3AA0B 4IDNA 3P4SA 5AQFB 3EI0A 3FB2A 2LEHA 5FXWA 4HFDA 3NZPA 2JMKA 1XDOA 2Y6XA 2Y8DA 4H9RC 3HA4A 3LSVA 2VL8A 2IW5B 3OJAA 4IE0A 4QHOA 5KXJA 2WAUA 3P4WA 5FP3A 2CWOA 5AQJB 4ANJA 3ZYLA 4PJLA 2C5KT 1LRZA 4MFRA 3ETVA 5HCJA 2VQET 4YY3T 5FZTA 2MBGA 4BGOA 5AQUB 4EB6E 3QK6A 4IE5A 3FXEB 2BS2A 3ZMUB 2XAHB 2X0HA 1UCUA 4IDQA 4IDOA 4B3RT 2XQ5A 3K1SA 3ANWB 2SPCA 2LJLA 4X64T 1MMGA 4HFIA 1V9DA 2WB5A 5L3GB 3VR8A 2CXDA 4F8HA 5FL0A 4ZOLE 1NEKA 5FY7A 3KVAA 4TWDA 2CXFA 4UEMA 3ZMSB 5ABGA 4ZHQE 3WSCA 4PK5A 3RF1A 2WS3A 3NBXX 2PBIA 5J2UE 3WAKA 4ASKA 2RP4A 4HWFA 3AE8A 4CI3B 2X51A 4H9QC 3AAIA 3G06A 3PUSA 4WBOA 3PU3A 3GN5B 4ISSA 4LFAT 2VVSA 3ZPOA 2ACZA 1DU2A 2BG9E 3AE9A 2YEVC 3B57A 3FBZA 5F8PA 4AKRB 5L3BB 3AEFA 1FJGT 3LBXB 4GYRA 1D0ZA 4JI4T 4TNVA 3VKGA 3ZC0A 1W9RA 4CXXA 4OK0A 3IF8B 5L2LA 1T7SA 3MJXA 3AE5A 4DV3T 3AEDA 2CRBA 2WZHA 5HXRA 2XUEA 3HI2A 3OBVE 1IBMT 3CIRA 2NP9A 4O4IE 4H63V 5HEOA 3SFEA 3MKDA 4KHPT 3I9YA 2V7IA 2NW7A 3VRAA 4YSXA 4OHFA 2H89A 2KNDA 1MIYA 5AQOB 1GQEA 2Z6EA 3RIUA 2HPJA 1D0YA 1XDPA 2P9BA 4YSYA 4PJNA 4UVAB 4UVBB 3M3ZB 3LK42 5L3FB 1SA0E 2V7KA 4JI0T 3U78A 4ZI7E 3TLVA 3CX8B 2LRLA 4OYKA 1FIOA 4WBNE 3QUJA 2DL1A 2H3RA 3OVUA 5FL1A 2C5JA 2VQFT 2LQUA 5AQRB 2VKDA 2YN6A 4PJMA 4LF6T 3K3QC 3I0OA 1X79A 2W63A 1SE7A 4Z8XA 4YJ3E 3O4XE 4AQFC 4YHHT 4KP3C 3R84B 3RPUA 3PURA 5KMGP 2IAKA 2EHOB 5FYMA 4UV8B 4ISTA 1HF8A 1Y01A 4EXTA 4AISA 4JI7T 4MALA 4YTMA 5FY1A 2E9XC 4NXMT 4CZZB 2B76A 1X9BA 3EAMA 4KMCA 3AT7A 3CQCB 4LFCT 2QGSA 2XSAA 2X67A 4IIJE 3NKZA 4UXNB 5JDFA 4X20E 4U7YA 3ZMTB 4JYAT 2UXXB 1U5PA 2D0UA 4WNKA 2QYWA 2KINB 2ODVA 2E2AA 2LSIA 5ABHA 4GK5E 2WY2A 2WWVA 2ZMAA 2WM9A 3RYFE 2V7MA 5LCYA 1CHUA 1R8IA 4H9OC 5HCMA 4YT0A 4GYSA 3PUZF 1UX5A 5L4EA 3X1DA 4AXPA 1Z0PA 3KBUA 4DR1T 3C4XA 2WDVA 4AKIA 2JQHA 2AE9A 2XQ4A 2WMNA 3AEGA 4NPPA 4TWHA 2H7OA 2KMFA 1OEDC 2X0CA 1D1CA 3PUQA 4GK0E 2PJQA 3MA9A 4HFCA 3Q5XA 3F57A 4HWIB
chains in the Genus database with same CATH topology
3CKDA 4BAYB 5LGTB 2DHRA 4P0AA 3OYXA 4TX5A 2VKJA 3U3IA 4ONRA 5LBMA 5FXZA 4EYYR 1YD8G 3N2OA 5DABA 2D2SA 2M67A 5DQVA 4GOUA 3RX6A 5CB4E 2KZ7B 4PFPA 2K24A 1B7TA 2KWIB 3ZCIA 3GA8A 1WLXA 4NUVA 1LVFA 3Q5WA 2RA1A 2IC9A 4QWNB 2MTCA 2CXLA 3RC8A 4ZI3D 3KV9A 2WSSV 4F6RC 3AVRA 3NZQA 5L3CB 2ES0A 4I4TE 4DBRA 2Y48B 2JRKA 1HS7A 4CXWA 5EZYE 2CLYC 1HG2A 5HXSA 3E0ZA 5JQGE 3N9LA 1IAPA 1ZEEA 1ZKEA 5LHHB 2JJ9A 4KBMB 3LK3B 5FXVA 4I43B 4O4LE 2NW8A 3N9PA 2W00A 4XBFB 5EK4A 2W0GA 2JMHA 2XTLA 2KLQA 1MMNA 3T8OA 2WWUA 3MZKB 4HFVA 4IDZA 3RRWA 1Y64B 5KX5E 4JEUB 3WAJA 3HR0A 4BA9A 5LHIB 2ACXA 3C50A 4XAXB 3EUHA 4CI2B 2X9HA 4IE7A 5LG4A 3EDVA 1BR1A 3IEEA 3RYHE 3OKQA 1G8XA 1ZV4X 2W61A 3KV5A 4TZ4C 4M1PA 3WI3A 2V1DB 3AA0B 2XAFB 5GONE 4N78D 4X1KE 4DO0A 5HXHA 4QKNA 4XZCA 5BMVE 3KFWX 3N9MA 2N2NA 2LSKA 1FMVA 3FB2A 3CQGB 2CEAA 3I9WA 2LEHA 5FXWA 4AQGA 1HG5A 4I50E 4TN7B 5FY0A 3UUNA 4ADZA 3NZPA 4TV9E 5L3EB 4YLHA 3ZJ2A 2JMKA 4X1YE 2Y6XA 3QC9A 2Y8DA 3CX7B 3F2EA 3N9NA 4H9RC 2OA5A 3HA4A 3ZCJA 3KV4A 2V7JA 3R6NA 2KT9A 4H63H 4KUMB 2VL8A 3MK7C 3DP7A 2D5UA 2X9XA 4HKAA 2IW5B 3OJAA 4IE0A 4QHOA 3JC6D 1BR4A 2WAUA 3ZN0B 4UELA 4JEHB 2W62A 5FP3A 2CWOA 2E8IA 4ANJA 3ZYLA 1OWAA 2DWGA 4PJLA 2C5KT 4UVCB 3UFEA 1D1BA 1LRZA 5DQWA 2E9XB 4BJMA 1QUUA 4MFRA 5IYZE 3ETVA 3KINB 4PFOA 3PDYA 2MBGA 4BGOA 3VU7H 4EYUA 2LOPA 3O1HA 3QK6A 4OFZA 4OYJA 4IE5A 4EB6E 2MTQA 5JR9B 3B13A 5LHGB 2GK9A 2XASB 2ODUA 3FXEB 3ZMUB 2JPFA 2XAHB 4IGUA 2BDEA 1UCUA 2EHOC 3AAAB 3FXDB 2XAJB 2XAGB 3LBXA 3BQLA 1YKEB 3KDSE 4L0RA 5LGNB 2LT3A 3ESLA 5H6RB 3RYCE 3L09A 3GWHA 4P09A 3PHF1 4PNIA 3N5LA 1ZHCA 4AQFA 4C91A 3BQIA 4ILUA 3ANWB 4C90A 2SPCA 3C51A 3ETUA 3PU8A 4BJNA 2E9XD 2LJLA 3I1AA 2J1DG 4YFSA 1FMWA 1MMGA 1T98A 2KWHA 4G2AA 4JUYA 2YU1A 3IHRA 5LGUB 5CA0E 4TUYE 4X1IE 1V9DA 3PTRB 3ZMVB 3JC6C 2K9AA 3AAEB 3Q9DA 4DVDA 5L3GB 2CXDA 3V5SA 1WYCA 3CWZB 4ZOLE 2CE7A 2E9XA 1FEWA 4ERRA 5LJMA 1U4QA 2D0TA 4FI5A 4O2AE 5FY7A 4CXYA 2Q9QC 4HE8A 3KVAA 1UX4A 4ZI2C 2CXFA 4UEMA 3ZMSB 4AI6A 2DLRA 4H9PC 4ZHQE 4P0BA 5JR9A 3WSCA 4PK5A 3BQKA 3CQXC 3NBXX 2PBIA 5J2UE 4GIWA 3WAKA 5HAXA 5J1GA 1OXZA 4ASKA 2RP4A 2V7LA 4HN9A 4CI3B 3C98B 2X51A 4H9QC 3LFMA 5JVDE 3H3AA 3K8PC 3AAIA 3PUSA 4WBOA 4QXCB 3PU3A 1IJ5A 3GN5B 4ISSA 2NTXA 2LSJA 3ZPOA 3Q2MA 2UXNB 2VWAA 3ANWA 3SS1A 3WURA 4HGAA 2CA5A 2DNXA 3CX6B 2YEVC 3B57A 3FBZA 3N2GE 3N2KE 4DBQA 5F8PA 1NAFA 4AKRB 3J7Yq 5J2TE 5L3BB 1KK7A 3RH3A 2CMRA 3LBXB 4GYRA 4QX8B 1D0ZA 5AFUL 2ZM8A 1WR6A 3VKGA 4IE4A 2N1GA 3ZC0A 4UV9B 3GMIA 2VK9A 4U74A 1EZ3A 4CXXA 3C64A 4OK0A 3VHLA 3IF8B 4PJJA 5LXTE 5CA1E 5L2LA 2VKOA 3MJXA 4ZI3C 4PK4A 3VJZA 3SRZA 3HL6A 5LJNA 2A2FX 3H37A 3ZEFB 1KNZA 5HXRA 1AJ3A 3O1JA 2XUEA 3HI2A 3OBVE 2YU2A 2CLYB 4O4HE 3L3PA 4AKLA 3CVRA 4O4IE 2NP9A 4H63V 4EZ4A 2N9DA 3NRXA 5T1DA 5DJQC 1BR2A 3UT5E 3HKBE 3BK9A 5EK3A 5ETWA 5A1LA 2LHRA 3MKDA 3I9YA 2L8KA 3MXZA 2V26A 4YJ2E 2V7IA 2NW7A 3MACA 3GN5A 4UF0B 4OHFA 2LE8A 2KNDA 3EDUA 1MIYA 1YW0A 2KXPB 4H9SE 5F3JA 2Z6EA 5JH7E 2HPJA 1D0YA 2P9BA 4QXBB 4MLKA 4PJNA 3KV6A 5HXEA 4UVAB 4UVBB 2G0UA 3I0QA 3LK42 4E7ZA 5L3FB 4A56A 2K5BB 1SA0E 2ZM2A 3RYIE 2V7KA 3U78A 4ZI7E 1CUNA 3P7IA 4NUUA 3TKLB 3CX8B 4QXHB 3C4ZA 3PE0A 4E7SA 4MHCA 5JDNA 4DNDA 3PUGA 4EIWA 2L9QA 5JRCB 3LG7A 4OYKA 2VKHA 1FIOA 2X66A 4WBNE 2X0LB 3QUJA 3E22E 2H3RA 2MYSA 4L9IA 2C5JA 2LQUA 3FHNA 5LYJE 3HKEE 2VKDA 4IHJE 4PJMA 3K3QC 3I0OA 3PUAA 3S4UA 3AB3B 1HFAA 4G63A 3E08A 1D0XA 4J2CA 1VRBA 3N9QA 1O3XA 1X79A 3ZJ1A 3KBTA 4UF0A 5IHYA 2HPLA 3LJCA 5FXXA 5TAOA 2YK0A 2YINA 5HWXA 3AA7B 1LKXA 2W63A 3OYZA 5HYAA 2X68A 3IBPA 4Z8XA 3O1IA 2ZLYA 2CWYA 2XHEB 1VOMA 3O4XE 4YJ3E 4AQFC 1QSDA 1H7CA 5ADXL 4EZHA 4KP3C 3R84B 3ZN1B 5HWYA 3RPUA 2K48A 2I59A 5JDHA 2H7VC 5L3DB 2CM0A 2JQQA 3PURA 3N9OA 3ZC1A 4DMWA 5EK2A 5KMGP 2IAKA 2EHOB 4HEAA 1MNEA 5FYMA 1WYBA 4UV8B 4ISTA 1HF8A 5H6QB 1SHZC 1BR0A 1S35A 2PFVA 4EXTA 4O8SA 4MALA 4EAHA 2ZM0A 1MMDA 3P8CD 3K3NA 2QA7A 5JRCA 2B1EA 4AKGA 1MMAA 5FY1A 2E9XC 4FJOA 3ZYMA 2VASA 4CZZB 4QX7B 3F31A 4KMCA 5LOVE 3AT7A 5JREA 3CQCB 3KVBA 3ZYKA 5JR9C 3UULA 3UUMA 2QGSA 2X9YA 2X67A 3NRYA 5FNVE 4IIJE 3M1CA 1WRDA 4UXNB 3EVYA 5JDFA 4X20E 3ZMTB 2EHOD 4PAGA 2UXXB 2DWKA 2PG8A 2Q9QB 3AVSA 1U5PA 5M4YA 3CMLA 3W15B 2D0UA 3RRCA 4WNKA 1S94A 4UIGA 2KINB 2MOZA 2ODVA 2A72A 1HX8A 2BZBA 2LSIA 3LK2B 1MIVA 2HH7A 5LNKA 4DMVA 4IE6A 3RC3A 5HXCA 4GK5E 5JDLA 3J9X1 1HTJF 2WBLA 2NTYA 2WM9A 2ZMAA 4PW8A 1E1HB 2EHOA 3RYFE 3VKHA 3AA1B 2LSGA 3O9XA 2DCFA 1D1AA 2V7MA 4PK6A 3RKOA 2C0SA 2L3LA 4ECGA 1NWMX 5LCYA 2C5IT 4EOZB 4O4JE 1IJ6A 1US7B 4H9OC 2BVMA 2X9WA 5JDMA 3FBLA 4GYSA 3A5XA 1UX5A 4L5GA 2NWBA 2CCQA 4TV8E 4AXPA 3ZLIA 1Z0PA 1MNDA 2DI4A 3KBUA 3C4XA 4U72A 4ZS2A 2A3DA 2Q9QD 1MIWA 3DJBA 3DTOA 4ZI2D 3AA6B 3V5UA 5LA6E 1IZNB 3CPZA 4MBQA 4AKIA 5KDMC 1LVKA 2LOSA 4WW0A 5FMNA 2VB6A 2LHNA 3PF0A 3UUXB 3HKCE 2WMNA 4YHJA 3M65A 3ONXA 2H7OA 2XAQB 2KMFA 3K3OA 5E0OA 1HCIA 2IC6A 2LM9A 4CI1B 5JDQA 3HKDE 4B6XA 3SOLA 4I55E 3C4WA 2NW9A 1D1CA 2Q9QA 4JLEA 3PUQA 2NOXA 4GK0E 1G73A 4K0UA 3D0TA 2PJQA 5LBQB 2XQYA 4H9NC 3MA9A 5LP6E 3SWHA 3Q5XA 1YKHB 5C8YE 5JDGA 4O2BE 2WMOA 3ZMZB 3F57A 4CQIA 4AKHA 4V1Av 2BVLA 4HTEA 4ZS3A 2LSYA 3UTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDL A;  5JDF A;  5HWX A;  5JDQ A;  5HXE A;  5HXS A;  5HYA A;  5HXR A;  3V5U A;  5JDN A;  5HWY A;  5JDH A;  5JDM A;  3V5S A;  5JDG A;  5HXH A;  5HXC A; 
#chains in the Genus database with same CATH topology
 3AEA A;  4P0A A;  3OYX A;  2CHO A;  4ONR A;  4DR3 T;  1M7K A;  3PJA J;  2FJA A;  4COF A;  3RX6 A;  1HNZ T;  4F7G B;  2KZ7 B;  4PFP A;  4CN1 A;  3ZCI A;  1WLX A;  3Q5W A;  5L3C B;  2JRK A;  1HS7 A;  5EZY E;  2CLY C;  1HG2 A;  5HXS A;  2CBJ A;  3N9L A;  1T8B A;  4DV5 T;  3TLW A;  1ZEE A;  3LK3 B;  5AQM B;  4CN6 A;  5AQS B;  3N9P A;  2UXD T;  5EK4 A;  2JMH A;  4IDP A;  4HFV A;  3RRW A;  3UU5 A;  4HWC A;  4JEU B;  2ACX A;  3C50 A;  4CI2 B;  3IEE A;  2W61 A;  5HEU A;  2FBW A;  4X1K E;  5HXH A;  4XZC A;  3KFW X;  3N9M A;  3UFG A;  5J0Z A;  3I9W A;  4AQG A;  4ADZ A;  3UUN A;  5L3E B;  4X1Y E;  2LKG A;  3CX7 B;  2KGX A;  3AY5 A;  3N9N A;  3RLF F;  1W09 A;  2W2U A;  3IA3 A;  3KV4 A;  3P4Q A;  2D5U A;  4HKA A;  3JC6 D;  4HWH A;  1BR4 A;  4UEL A;  4JEH B;  2E8I A;  2UUC T;  2DWG A;  2MAW A;  4UVC B;  5LMN T;  5IYZ E;  3KIN B;  4PFO A;  5LB7 B;  3O1H A;  2MTQ A;  4DV2 T;  2BDE A;  2XAG B;  3KDS E;  4L0R A;  3AEB A;  2L10 A;  2LT3 A;  5H6R B;  2WDQ A;  4KX6 A;  4C91 A;  4U7I A;  3BQI A;  4C90 A;  3L39 A;  4BJN A;  1KFY A;  2E9X D;  3I1A A;  2J1D G;  2WU5 A;  1T98 A;  2KWH A;  2HHH T;  3IHR A;  5LGU B;  4TUY E;  5ABE A;  4GKK T;  3V5S A;  3CWZ B;  2CE7 A;  1UUR A;  5LJM A;  2V5C A;  4DR6 T;  4O2A E;  2Q9Q C;  2JIW A;  1QLB A;  4U31 A;  5JR9 A;  3BQK A;  4A97 A;  2V7L A;  3H3A A;  4JI2 T;  3VRB A;  1IJ5 A;  2NTX A;  2LSJ A;  3Q2M A;  2WU2 A;  3SS1 A;  3UQ4 A;  3ZKR A;  1KK7 A;  4QX8 B;  1XWM A;  2ZM8 A;  2XQA A;  3TLS A;  2N1G A;  3T1H T;  4UV9 B;  1EZ3 A;  4PJJ A;  5AQG B;  4AQY T;  3PUW F;  4HFH A;  3ZEF B;  2YU2 A;  4O4H E;  2XPK A;  5T1D A;  4HWD A;  3UT5 E;  2LHR A;  2V26 A;  2XSB A;  3EDU A;  2KXP B;  5F3J A;  4MLK A;  3KV6 A;  2UUA T;  4IL4 A;  2G0U A;  2CBI A;  2AXD S;  2ZM2 A;  3TKL B;  5LMU T;  2XJ7 A;  3C4Z A;  4E7S A;  4DND A;  2L9Q A;  3E22 E;  1SJ7 A;  2I6H A;  2RPA A;  4EV6 A;  3FHN A;  3HKE E;  4IHJ E;  3S4U A;  3PUA A;  5AQN B;  4G63 A;  2BBJ A;  4A98 A;  1VRB A;  3N9Q A;  3ZJ1 A;  2E5V A;  5IWA T;  4KI0 F;  4UF0 A;  5FXX A;  3AA7 B;  1XMO T;  2X68 A;  1HR0 T;  4LF9 T;  2WZI A;  4Z91 A;  4DV7 T;  5ADX L;  5AQH B;  2WP9 A;  5HWY A;  2K48 A;  4EGW A;  2ZM6 T;  4DMW A;  2M6B A;  1M62 A;  1BR0 A;  1S35 A;  2ZM0 A;  5F5W A;  1MMD A;  3AE4 A;  2KVP A;  4AKG A;  3AXJ A;  4FJO A;  3ZYM A;  2UXB T;  2MPK A;  1YQ3 A;  4QX7 B;  3F31 A;  5LOV E;  3UUL A;  3NVO A;  5FNV E;  4EED A;  2LRK A;  1VCS A;  2IUB A;  3A7M A;  3P4P A;  2MOZ A;  1T72 A;  2A72 A;  1HX8 A;  2BZB A;  1I6Z A;  5LNK A;  4DMV A;  5HXC A;  3AEE A;  4ZXL A;  3J9X 1;  5JTG A;  2WBL A;  4PW8 A;  3VKH A;  1L0V A;  1OED E;  2LSG A;  3O9X A;  1D1A A;  3RKO A;  4X62 T;  4ECG A;  1NWM X;  4EOZ B;  4O4J E;  1IJ6 A;  2M6I A;  4YSZ A;  5JDM A;  4LF4 T;  3A8Y C;  4TV8 E;  1MND A;  2DI4 A;  4U72 A;  4ZS2 A;  2Q9Q D;  3V5U A;  5LA6 E;  4MBQ A;  5AQP B;  1LVK A;  4WW0 A;  5FMN A;  2VB6 A;  3PJA A;  3PF0 A;  3HKC E;  4YHJ A;  3EAB A;  2XAQ B;  4W8P A;  4CI1 B;  2NW9 A;  3C4W A;  1E7P A;  2NOX A;  1G73 A;  3D0T A;  5LBQ B;  2BG9 B;  2WMO A;  4HTE A;  1ZP0 A;  3CKD A;  4BAY B;  3PUV F;  4TX5 A;  5LBM A;  2YDR A;  4NIQ A;  5DQV A;  4LMK A;  4ILC A;  5CGM A;  5FKY A;  4DV1 T;  4DV4 T;  2IC9 A;  3ZT5 A;  2MTC A;  5ABF A;  2WSS V;  2XQ8 A;  3NZQ A;  2Y48 B;  5LHH B;  4YXD A;  2PTF A;  4JI6 T;  4U33 A;  2W00 A;  2OV9 A;  2XTL A;  1XNQ T;  2WWU A;  4IDZ A;  1Y64 B;  3WAJ A;  3HR0 A;  5LG4 A;  3EDV A;  3OKQ A;  1ZV4 X;  3KV5 A;  2XY8 B;  1YXR A;  5BMV E;  5CJ5 A;  2N2N A;  3CQG B;  2CEA A;  4EEB A;  4TN7 B;  5IUX A;  4TV9 E;  4YLH A;  1W0A A;  3QC9 A;  5AQV B;  3F2E A;  4U3C A;  2V7J A;  2XM1 A;  3R6N A;  4H63 H;  4KUM B;  2D9D A;  3QOF A;  2BG9 C;  3ZN0 B;  4LML A;  3Q5E A;  1OWA A;  3ZT6 A;  3UFE A;  5L4H A;  5DQW A;  2V6Y B;  1QUU A;  4BJM A;  3PDY A;  4IT4 A;  3FZK B;  4EYU A;  4OFZ A;  5JR9 B;  3B13 A;  5LHG B;  2GK9 A;  2JPF A;  2UXC T;  3JAD A;  2EHO C;  3FXD B;  3LBX A;  1J5W A;  5LGN B;  4DUZ T;  3L09 A;  1ZOY A;  2XQ3 A;  3GWH A;  4P09 A;  1IBL T;  4B3T T;  3PHF 1;  4PNI A;  3N5L A;  4AQF A;  4ILU A;  3C51 A;  1UGO A;  3PU8 A;  1FMW A;  4B3S T;  3ZT7 A;  1KNP A;  4DR4 T;  2X0Y A;  1XMQ T;  2LKH A;  4X1I E;  4DVD A;  5FVK A;  2E9X A;  1FEW A;  4ERR A;  2D0T A;  4FI5 A;  2JQK A;  4CXY A;  4HE8 A;  1UX4 A;  4AI6 A;  2DLR A;  4H9P C;  3CQX C;  4ILB A;  2BS4 A;  5HAX A;  1HX1 B;  5J1G A;  1OXZ A;  4HN9 A;  4TNW A;  3C98 B;  2J47 A;  5JVD E;  3K8P C;  3AE7 A;  2FUP A;  2VL0 A;  4QXC B;  4U2Z A;  3RHW A;  2UXN B;  4IRE A;  4JBW F;  4HGA A;  3CX6 B;  4DR2 T;  2UUB T;  3N2G E;  4B3M T;  3N2K E;  3QB5 A;  4I0U A;  2BKN A;  2CMR A;  1JNR A;  5AFU L;  2E5L T;  1WR6 A;  4IE4 A;  4LF5 T;  3C64 A;  2VKO A;  4ZI3 C;  4PK4 A;  5HEG A;  3VJZ A;  3SRZ A;  1SJ8 A;  4IL9 A;  2A2F X;  4DR5 T;  1KNZ A;  4AKL A;  3CVR A;  4EZ4 A;  5DJQ C;  1BR2 A;  1OED A;  3BK9 A;  5EK3 A;  2BS3 A;  2L8K A;  3Q5D A;  4YJ2 E;  3MAC A;  4UF0 B;  1YW0 A;  2W67 A;  4H9S E;  3PV0 F;  1KNR A;  5JH7 E;  2K3W A;  2BKP A;  4DUY T;  3I0Q A;  4CN4 A;  4E7Z A;  2YOE A;  1CUN A;  3P7I A;  5JDN A;  3PUG A;  4EIW A;  4DID B;  2X66 A;  2A9U A;  4JI8 T;  4L9I A;  3UU8 A;  1KEY A;  5LYJ E;  5AQT B;  1KF6 A;  4J2C A;  4DR7 T;  1WR0 A;  3KBT A;  4X66 T;  5IHY A;  5HWX A;  2YIN A;  3TLU A;  3OYZ A;  5HYA A;  2CHN A;  3O1I A;  2XHE B;  1QSD A;  1H7C A;  4EZH A;  4ZZC A;  5L3D B;  5JDH A;  3ZSS A;  2CM0 A;  4X65 T;  5H6Q B;  1SHZ C;  4O8S A;  4EAH A;  3K3N A;  5JRC A;  4TWF A;  2FJE A;  2VAS A;  3QNU A;  4LF7 T;  2KSR A;  5JRE A;  3ZYK A;  1E2A A;  2FJD A;  4WYV A;  1WRD A;  3EVY A;  4QH1 A;  2EHO D;  4PAG A;  5C3J A;  2DWK A;  2PG8 A;  5M4Y A;  3B5M A;  3CML A;  3RQU A;  1S94 A;  1N33 T;  1N34 T;  2HH7 A;  2V8S V;  4IE6 A;  3RC3 A;  5C2T A;  5JDL A;  2JQ9 A;  1IBK T;  3LDQ B;  1E1H B;  2DCF A;  4PK6 A;  2L3L A;  2HN1 A;  2IDO B;  3FBL A;  2YDQ A;  3A5X A;  1NEN A;  2BKO A;  4LFB T;  3AE1 A;  2XZE A;  5ABF B;  2A3D A;  2IML A;  1MIW A;  3DJB A;  1IZN B;  3P4R A;  3ONX A;  3K3O A;  5E0O A;  2IC6 A;  4NXN T;  5JDQ A;  3HKD E;  4B6X A;  4Z90 A;  4DV6 T;  2Q9Q A;  3UU4 A;  2XQY A;  4H9N C;  3AE3 A;  1YKH B;  2XQ9 A;  5JDG A;  4CQI A;  4AKH A;  4V1A v;  2BVL A;  3RIU C;  2LSY A;  3UTK A;  3RIF A;  2DHR A;  1N36 T;  3U3I A;  2VKJ A;  2VVN A;  2WDR A;  5FXZ A;  4EYY R;  1YD8 G;  2D2S A;  2M67 A;  4JV5 T;  5CB4 E;  2K24 A;  1B7T A;  4NUV A;  1LVF A;  2RA1 A;  4QWN B;  1XNR T;  4ZI3 D;  4F6R C;  4I4T E;  4QH5 A;  2WCA A;  5CFB A;  3E0Z A;  2R6G F;  1ZKE A;  2JJ9 A;  4KBM B;  3SFD A;  3AE6 A;  4I43 B;  4O4L E;  2NW8 A;  3T8O A;  3MZK B;  3T1Y T;  5KX5 E;  3PUY F;  1I94 T;  3EUH A;  3RYH E;  1BR1 A;  1G8X A;  4UR9 A;  4M1P A;  2V1D B;  2XAF B;  5GON E;  4N78 D;  4DO0 A;  4QKN A;  3ONL C;  3QB5 K;  2LSK A;  1FMV A;  1HG5 A;  2QRX A;  4I50 E;  5FY0 A;  3ZST A;  3RIA A;  3ZJ2 A;  2OA5 A;  3ZCJ A;  2KT9 A;  3NWI A;  3MK7 C;  3DP7 A;  1HNX T;  2X9X A;  4AIU A;  2W62 A;  5AQI B;  3OTO T;  1D1B A;  4ZEY A;  4YTP A;  2E9X B;  3VU7 H;  2LOP A;  4OYJ A;  2XAS B;  2UU9 T;  2ODU A;  2H88 A;  4IGU A;  4WZX A;  3AAA B;  2XAJ B;  3BQL A;  1YKE B;  2WQY A;  3ESL A;  3RYC E;  1ZHC A;  2KBB A;  3OPC A;  2IHR 1;  3ETU A;  4YFS A;  4G2A A;  4JUY A;  2YU1 A;  5CA0 E;  3PTR B;  3ZMV B;  3JC6 C;  5FVL A;  2K9A A;  3AAE B;  3Q9D A;  1WYC A;  2YDS A;  1U4Q A;  1WCR A;  4ZI2 C;  4P0B A;  4LF8 T;  5AQK B;  4GIW A;  3RGL A;  3P50 A;  3UQ7 A;  2CPT A;  4X5T A;  3DYJ A;  1OED B;  3LFM A;  2I0M A;  5HEJ A;  2QVA A;  2VWA A;  4QH4 A;  3ANW A;  3WUR A;  2CA5 A;  2DNX A;  3FZM B;  4DBQ A;  1NAF A;  3J7Y q;  5J2T E;  2W66 A;  3RH3 A;  3GMI A;  2VK9 A;  4U74 A;  3FZF B;  3VHL A;  3AEC A;  5LXT E;  5CA1 E;  2XM2 A;  3UU6 A;  3HL6 A;  4JI1 T;  1Z8U A;  3H37 A;  5LJN A;  3H3M A;  5L47 A;  1HNW T;  1J5E T;  1AJ3 A;  3O1J A;  2CLY B;  2LLY A;  3L3P A;  3JAE A;  3JCF A;  2N9D A;  3NRX A;  3HKB E;  5ETW A;  5A1L A;  2VUR A;  2BBH A;  3PUX F;  4Q25 A;  4P1N A;  3MXZ A;  4YTN A;  4OX9 T;  2J62 A;  3GN5 A;  2LE8 A;  3VR9 A;  5BR8 T;  5LG3 A;  5HEH A;  3UUB A;  1YQ4 A;  4QXB B;  5HXE A;  4GKJ T;  4A56 A;  2K5B B;  3RYI E;  4NUU A;  4QXH B;  3PE0 A;  4KHZ F;  4MHC A;  5JRC B;  3LG7 A;  2VKH A;  2X0L B;  4U2Y A;  2MYS A;  3TLT A;  3FYQ A;  2YKS A;  3ONJ A;  3RQW A;  3AB3 B;  1HFA A;  4ILA A;  3E08 A;  1D0X A;  2FJB A;  1VCT A;  1O3X A;  4LMJ A;  1WFD A;  2HPL A;  3LJC A;  5TAO A;  2YK0 A;  1LKX A;  3EHZ A;  3IBP A;  4ZZB A;  2ZLY A;  2CWY A;  1VOM A;  3RKG A;  3ZN1 B;  2I59 A;  2H7V C;  2JQQ A;  3ZC1 A;  3N9O A;  5EK2 A;  4HEA A;  1MNE A;  5AQQ B;  2F4V T;  1WYB A;  2W4X A;  2PFV A;  1J1J A;  3P8C D;  2QA7 A;  2V5D A;  2B1E A;  1MMA A;  1N32 T;  3ABV A;  3KVB A;  5JR9 C;  3UUM A;  1XZY A;  2BG9 A;  2X9Y A;  3NRY A;  3M1C A;  4JI3 T;  3CK6 A;  2Q9Q B;  3AVS A;  3W15 B;  3RRC A;  4UIG A;  3LK2 B;  1MIV A;  3RI5 A;  2J4G A;  1HTJ F;  2NTY A;  2EHO A;  1SUM B;  3AA1 B;  2C0S A;  2C5I T;  1US7 B;  2BVM A;  2OLT A;  4JI5 T;  2X9W A;  4L5G A;  2NWB A;  2CCQ A;  3ZLI A;  3JAF A;  2XQ6 A;  2V6X A;  4ZI2 D;  3DTO A;  3AA6 B;  3CPZ A;  5KDM C;  2LOS A;  4DV0 T;  2LHN A;  1UK5 A;  3UUX B;  3M65 A;  1HCI A;  2LM9 A;  3SOL A;  3AXJ B;  4I55 E;  4JLE A;  3L8R A;  4K0U A;  5LP6 E;  2HN2 A;  4HFE A;  3SWH A;  5C8Y E;  4O2B E;  1W0B A;  3ZMZ B;  2IIU A;  4HFB A;  3FZH B;  4ZS3 A;  2NR4 A;  3UU3 A;  5LGT B;  4A5X A;  2LM2 A;  3N2O A;  5DAB A;  3AE2 A;  4GOU A;  2KWI B;  3GA8 A;  2L7N A;  2CXL A;  3RC8 A;  3KV9 A;  2V6Y A;  3AVR A;  4K0K T;  2ES0 A;  4DBR A;  4CXW A;  1UUS A;  2XQ7 A;  5JQG E;  1JNZ A;  1IAP A;  5FXV A;  4XBF B;  2W0G A;  3FZL B;  2KLQ A;  1MMN A;  4BA9 A;  5LHI B;  4XAX B;  2X9H A;  4IE7 A;  5AQL B;  4TZ4 C;  3WI3 A;  3AA0 B;  4IDN A;  3P4S A;  5AQF B;  3EI0 A;  3FB2 A;  2LEH A;  5FXW A;  4HFD A;  3NZP A;  2JMK A;  1XDO A;  2Y6X A;  2Y8D A;  4H9R C;  3HA4 A;  3LSV A;  2VL8 A;  2IW5 B;  3OJA A;  4IE0 A;  4QHO A;  5KXJ A;  2WAU A;  3P4W A;  5FP3 A;  2CWO A;  5AQJ B;  4ANJ A;  3ZYL A;  4PJL A;  2C5K T;  1LRZ A;  4MFR A;  3ETV A;  5HCJ A;  2VQE T;  4YY3 T;  5FZT A;  2MBG A;  4BGO A;  5AQU B;  4EB6 E;  3QK6 A;  4IE5 A;  3FXE B;  2BS2 A;  3ZMU B;  2XAH B;  2X0H A;  1UCU A;  4IDQ A;  4IDO A;  4B3R T;  2XQ5 A;  3K1S A;  3ANW B;  2SPC A;  2LJL A;  4X64 T;  1MMG A;  4HFI A;  1V9D A;  2WB5 A;  5L3G B;  3VR8 A;  2CXD A;  4F8H A;  5FL0 A;  4ZOL E;  1NEK A;  5FY7 A;  3KVA A;  4TWD A;  2CXF A;  4UEM A;  3ZMS B;  5ABG A;  4ZHQ E;  3WSC A;  4PK5 A;  3RF1 A;  2WS3 A;  3NBX X;  2PBI A;  5J2U E;  3WAK A;  4ASK A;  2RP4 A;  4HWF A;  3AE8 A;  4CI3 B;  2X51 A;  4H9Q C;  3AAI A;  3G06 A;  3PUS A;  4WBO A;  3PU3 A;  3GN5 B;  4ISS A;  4LFA T;  2VVS A;  3ZPO A;  2ACZ A;  1DU2 A;  2BG9 E;  3AE9 A;  2YEV C;  3B57 A;  3FBZ A;  5F8P A;  4AKR B;  5L3B B;  3AEF A;  1FJG T;  3LBX B;  4GYR A;  1D0Z A;  4JI4 T;  4TNV A;  3VKG A;  3ZC0 A;  1W9R A;  4CXX A;  4OK0 A;  3IF8 B;  5L2L A;  1T7S A;  3MJX A;  3AE5 A;  4DV3 T;  3AED A;  2CRB A;  2WZH A;  5HXR A;  2XUE A;  3HI2 A;  3OBV E;  1IBM T;  3CIR A;  2NP9 A;  4O4I E;  4H63 V;  5HEO A;  3SFE A;  3MKD A;  4KHP T;  3I9Y A;  2V7I A;  2NW7 A;  3VRA A;  4YSX A;  4OHF A;  2H89 A;  2KND A;  1MIY A;  5AQO B;  1GQE A;  2Z6E A;  3RIU A;  2HPJ A;  1D0Y A;  1XDP A;  2P9B A;  4YSY A;  4PJN A;  4UVA B;  4UVB B;  3M3Z B;  3LK4 2;  5L3F B;  1SA0 E;  2V7K A;  4JI0 T;  3U78 A;  4ZI7 E;  3TLV A;  3CX8 B;  2LRL A;  4OYK A;  1FIO A;  4WBN E;  3QUJ A;  2DL1 A;  2H3R A;  3OVU A;  5FL1 A;  2C5J A;  2VQF T;  2LQU A;  5AQR B;  2VKD A;  2YN6 A;  4PJM A;  4LF6 T;  3K3Q C;  3I0O A;  1X79 A;  2W63 A;  1SE7 A;  4Z8X A;  4YJ3 E;  3O4X E;  4AQF C;  4YHH T;  4KP3 C;  3R84 B;  3RPU A;  3PUR A;  5KMG P;  2IAK A;  2EHO B;  5FYM A;  4UV8 B;  4IST A;  1HF8 A;  1Y01 A;  4EXT A;  4AIS A;  4JI7 T;  4MAL A;  4YTM A;  5FY1 A;  2E9X C;  4NXM T;  4CZZ B;  2B76 A;  1X9B A;  3EAM A;  4KMC A;  3AT7 A;  3CQC B;  4LFC T;  2QGS A;  2XSA A;  2X67 A;  4IIJ E;  3NKZ A;  4UXN B;  5JDF A;  4X20 E;  4U7Y A;  3ZMT B;  4JYA T;  2UXX B;  1U5P A;  2D0U A;  4WNK A;  2QYW A;  2KIN B;  2ODV A;  2E2A A;  2LSI A;  5ABH A;  4GK5 E;  2WY2 A;  2WWV A;  2ZMA A;  2WM9 A;  3RYF E;  2V7M A;  5LCY A;  1CHU A;  1R8I A;  4H9O C;  5HCM A;  4YT0 A;  4GYS A;  3PUZ F;  1UX5 A;  5L4E A;  3X1D A;  4AXP A;  1Z0P A;  3KBU A;  4DR1 T;  3C4X A;  2WDV A;  4AKI A;  2JQH A;  2AE9 A;  2XQ4 A;  2WMN A;  3AEG A;  4NPP A;  4TWH A;  2H7O A;  2KMF A;  1OED C;  2X0C A;  1D1C A;  3PUQ A;  4GK0 E;  2PJQ A;  3MA9 A;  4HFC A;  3Q5X A;  3F57 A;  4HWI B; 
#chains in the Genus database with same CATH homology
 3CKD A;  4BAY B;  5LGT B;  2DHR A;  4P0A A;  3OYX A;  4TX5 A;  2VKJ A;  3U3I A;  4ONR A;  5LBM A;  5FXZ A;  4EYY R;  1YD8 G;  3N2O A;  5DAB A;  2D2S A;  2M67 A;  5DQV A;  4GOU A;  3RX6 A;  5CB4 E;  2KZ7 B;  4PFP A;  2K24 A;  1B7T A;  2KWI B;  3ZCI A;  3GA8 A;  1WLX A;  4NUV A;  1LVF A;  3Q5W A;  2RA1 A;  2IC9 A;  4QWN B;  2MTC A;  2CXL A;  3RC8 A;  4ZI3 D;  3KV9 A;  2WSS V;  4F6R C;  3AVR A;  3NZQ A;  5L3C B;  2ES0 A;  4I4T E;  4DBR A;  2Y48 B;  2JRK A;  1HS7 A;  4CXW A;  5EZY E;  2CLY C;  1HG2 A;  5HXS A;  3E0Z A;  5JQG E;  3N9L A;  1IAP A;  1ZEE A;  1ZKE A;  5LHH B;  2JJ9 A;  4KBM B;  3LK3 B;  5FXV A;  4I43 B;  4O4L E;  2NW8 A;  3N9P A;  2W00 A;  4XBF B;  5EK4 A;  2W0G A;  2JMH A;  2XTL A;  2KLQ A;  1MMN A;  3T8O A;  2WWU A;  3MZK B;  4HFV A;  4IDZ A;  3RRW A;  1Y64 B;  5KX5 E;  4JEU B;  3WAJ A;  3HR0 A;  4BA9 A;  5LHI B;  2ACX A;  3C50 A;  4XAX B;  3EUH A;  4CI2 B;  2X9H A;  4IE7 A;  5LG4 A;  3EDV A;  1BR1 A;  3IEE A;  3RYH E;  3OKQ A;  1G8X A;  1ZV4 X;  2W61 A;  3KV5 A;  4TZ4 C;  4M1P A;  3WI3 A;  2V1D B;  3AA0 B;  2XAF B;  5GON E;  4N78 D;  4X1K E;  4DO0 A;  5HXH A;  4QKN A;  4XZC A;  5BMV E;  3KFW X;  3N9M A;  2N2N A;  2LSK A;  1FMV A;  3FB2 A;  3CQG B;  2CEA A;  3I9W A;  2LEH A;  5FXW A;  4AQG A;  1HG5 A;  4I50 E;  4TN7 B;  5FY0 A;  3UUN A;  4ADZ A;  3NZP A;  4TV9 E;  5L3E B;  4YLH A;  3ZJ2 A;  2JMK A;  4X1Y E;  2Y6X A;  3QC9 A;  2Y8D A;  3CX7 B;  3F2E A;  3N9N A;  4H9R C;  2OA5 A;  3HA4 A;  3ZCJ A;  3KV4 A;  2V7J A;  3R6N A;  2KT9 A;  4H63 H;  4KUM B;  2VL8 A;  3MK7 C;  3DP7 A;  2D5U A;  2X9X A;  4HKA A;  2IW5 B;  3OJA A;  4IE0 A;  4QHO A;  3JC6 D;  1BR4 A;  2WAU A;  3ZN0 B;  4UEL A;  4JEH B;  2W62 A;  5FP3 A;  2CWO A;  2E8I A;  4ANJ A;  3ZYL A;  1OWA A;  2DWG A;  4PJL A;  2C5K T;  4UVC B;  3UFE A;  1D1B A;  1LRZ A;  5DQW A;  2E9X B;  4BJM A;  1QUU A;  4MFR A;  5IYZ E;  3ETV A;  3KIN B;  4PFO A;  3PDY A;  2MBG A;  4BGO A;  3VU7 H;  4EYU A;  2LOP A;  3O1H A;  3QK6 A;  4OFZ A;  4OYJ A;  4IE5 A;  4EB6 E;  2MTQ A;  5JR9 B;  3B13 A;  5LHG B;  2GK9 A;  2XAS B;  2ODU A;  3FXE B;  3ZMU B;  2JPF A;  2XAH B;  4IGU A;  2BDE A;  1UCU A;  2EHO C;  3AAA B;  3FXD B;  2XAJ B;  2XAG B;  3LBX A;  3BQL A;  1YKE B;  3KDS E;  4L0R A;  5LGN B;  2LT3 A;  3ESL A;  5H6R B;  3RYC E;  3L09 A;  3GWH A;  4P09 A;  3PHF 1;  4PNI A;  3N5L A;  1ZHC A;  4AQF A;  4C91 A;  3BQI A;  4ILU A;  3ANW B;  4C90 A;  2SPC A;  3C51 A;  3ETU A;  3PU8 A;  4BJN A;  2E9X D;  2LJL A;  3I1A A;  2J1D G;  4YFS A;  1FMW A;  1MMG A;  1T98 A;  2KWH A;  4G2A A;  4JUY A;  2YU1 A;  3IHR A;  5LGU B;  5CA0 E;  4TUY E;  4X1I E;  1V9D A;  3PTR B;  3ZMV B;  3JC6 C;  2K9A A;  3AAE B;  3Q9D A;  4DVD A;  5L3G B;  2CXD A;  3V5S A;  1WYC A;  3CWZ B;  4ZOL E;  2CE7 A;  2E9X A;  1FEW A;  4ERR A;  5LJM A;  1U4Q A;  2D0T A;  4FI5 A;  4O2A E;  5FY7 A;  4CXY A;  2Q9Q C;  4HE8 A;  3KVA A;  1UX4 A;  4ZI2 C;  2CXF A;  4UEM A;  3ZMS B;  4AI6 A;  2DLR A;  4H9P C;  4ZHQ E;  4P0B A;  5JR9 A;  3WSC A;  4PK5 A;  3BQK A;  3CQX C;  3NBX X;  2PBI A;  5J2U E;  4GIW A;  3WAK A;  5HAX A;  5J1G A;  1OXZ A;  4ASK A;  2RP4 A;  2V7L A;  4HN9 A;  4CI3 B;  3C98 B;  2X51 A;  4H9Q C;  3LFM A;  5JVD E;  3H3A A;  3K8P C;  3AAI A;  3PUS A;  4WBO A;  4QXC B;  3PU3 A;  1IJ5 A;  3GN5 B;  4ISS A;  2NTX A;  2LSJ A;  3ZPO A;  3Q2M A;  2UXN B;  2VWA A;  3ANW A;  3SS1 A;  3WUR A;  4HGA A;  2CA5 A;  2DNX A;  3CX6 B;  2YEV C;  3B57 A;  3FBZ A;  3N2G E;  3N2K E;  4DBQ A;  5F8P A;  1NAF A;  4AKR B;  3J7Y q;  5J2T E;  5L3B B;  1KK7 A;  3RH3 A;  2CMR A;  3LBX B;  4GYR A;  4QX8 B;  1D0Z A;  5AFU L;  2ZM8 A;  1WR6 A;  3VKG A;  4IE4 A;  2N1G A;  3ZC0 A;  4UV9 B;  3GMI A;  2VK9 A;  4U74 A;  1EZ3 A;  4CXX A;  3C64 A;  4OK0 A;  3VHL A;  3IF8 B;  4PJJ A;  5LXT E;  5CA1 E;  5L2L A;  2VKO A;  3MJX A;  4ZI3 C;  4PK4 A;  3VJZ A;  3SRZ A;  3HL6 A;  5LJN A;  2A2F X;  3H37 A;  3ZEF B;  1KNZ A;  5HXR A;  1AJ3 A;  3O1J A;  2XUE A;  3HI2 A;  3OBV E;  2YU2 A;  2CLY B;  4O4H E;  3L3P A;  4AKL A;  3CVR A;  4O4I E;  2NP9 A;  4H63 V;  4EZ4 A;  2N9D A;  3NRX A;  5T1D A;  5DJQ C;  1BR2 A;  3UT5 E;  3HKB E;  3BK9 A;  5EK3 A;  5ETW A;  5A1L A;  2LHR A;  3MKD A;  3I9Y A;  2L8K A;  3MXZ A;  2V26 A;  4YJ2 E;  2V7I A;  2NW7 A;  3MAC A;  3GN5 A;  4UF0 B;  4OHF A;  2LE8 A;  2KND A;  3EDU A;  1MIY A;  1YW0 A;  2KXP B;  4H9S E;  5F3J A;  2Z6E A;  5JH7 E;  2HPJ A;  1D0Y A;  2P9B A;  4QXB B;  4MLK A;  4PJN A;  3KV6 A;  5HXE A;  4UVA B;  4UVB B;  2G0U A;  3I0Q A;  3LK4 2;  4E7Z A;  5L3F B;  4A56 A;  2K5B B;  1SA0 E;  2ZM2 A;  3RYI E;  2V7K A;  3U78 A;  4ZI7 E;  1CUN A;  3P7I A;  4NUU A;  3TKL B;  3CX8 B;  4QXH B;  3C4Z A;  3PE0 A;  4E7S A;  4MHC A;  5JDN A;  4DND A;  3PUG A;  4EIW A;  2L9Q A;  5JRC B;  3LG7 A;  4OYK A;  2VKH A;  1FIO A;  2X66 A;  4WBN E;  2X0L B;  3QUJ A;  3E22 E;  2H3R A;  2MYS A;  4L9I A;  2C5J A;  2LQU A;  3FHN A;  5LYJ E;  3HKE E;  2VKD A;  4IHJ E;  4PJM A;  3K3Q C;  3I0O A;  3PUA A;  3S4U A;  3AB3 B;  1HFA A;  4G63 A;  3E08 A;  1D0X A;  4J2C A;  1VRB A;  3N9Q A;  1O3X A;  1X79 A;  3ZJ1 A;  3KBT A;  4UF0 A;  5IHY A;  2HPL A;  3LJC A;  5FXX A;  5TAO A;  2YK0 A;  2YIN A;  5HWX A;  3AA7 B;  1LKX A;  2W63 A;  3OYZ A;  5HYA A;  2X68 A;  3IBP A;  4Z8X A;  3O1I A;  2ZLY A;  2CWY A;  2XHE B;  1VOM A;  3O4X E;  4YJ3 E;  4AQF C;  1QSD A;  1H7C A;  5ADX L;  4EZH A;  4KP3 C;  3R84 B;  3ZN1 B;  5HWY A;  3RPU A;  2K48 A;  2I59 A;  5JDH A;  2H7V C;  5L3D B;  2CM0 A;  2JQQ A;  3PUR A;  3N9O A;  3ZC1 A;  4DMW A;  5EK2 A;  5KMG P;  2IAK A;  2EHO B;  4HEA A;  1MNE A;  5FYM A;  1WYB A;  4UV8 B;  4IST A;  1HF8 A;  5H6Q B;  1SHZ C;  1BR0 A;  1S35 A;  2PFV A;  4EXT A;  4O8S A;  4MAL A;  4EAH A;  2ZM0 A;  1MMD A;  3P8C D;  3K3N A;  2QA7 A;  5JRC A;  2B1E A;  4AKG A;  1MMA A;  5FY1 A;  2E9X C;  4FJO A;  3ZYM A;  2VAS A;  4CZZ B;  4QX7 B;  3F31 A;  4KMC A;  5LOV E;  3AT7 A;  5JRE A;  3CQC B;  3KVB A;  3ZYK A;  5JR9 C;  3UUL A;  3UUM A;  2QGS A;  2X9Y A;  2X67 A;  3NRY A;  5FNV E;  4IIJ E;  3M1C A;  1WRD A;  4UXN B;  3EVY A;  5JDF A;  4X20 E;  3ZMT B;  2EHO D;  4PAG A;  2UXX B;  2DWK A;  2PG8 A;  2Q9Q B;  3AVS A;  1U5P A;  5M4Y A;  3CML A;  3W15 B;  2D0U A;  3RRC A;  4WNK A;  1S94 A;  4UIG A;  2KIN B;  2MOZ A;  2ODV A;  2A72 A;  1HX8 A;  2BZB A;  2LSI A;  3LK2 B;  1MIV A;  2HH7 A;  5LNK A;  4DMV A;  4IE6 A;  3RC3 A;  5HXC A;  4GK5 E;  5JDL A;  3J9X 1;  1HTJ F;  2WBL A;  2NTY A;  2WM9 A;  2ZMA A;  4PW8 A;  1E1H B;  2EHO A;  3RYF E;  3VKH A;  3AA1 B;  2LSG A;  3O9X A;  2DCF A;  1D1A A;  2V7M A;  4PK6 A;  3RKO A;  2C0S A;  2L3L A;  4ECG A;  1NWM X;  5LCY A;  2C5I T;  4EOZ B;  4O4J E;  1IJ6 A;  1US7 B;  4H9O C;  2BVM A;  2X9W A;  5JDM A;  3FBL A;  4GYS A;  3A5X A;  1UX5 A;  4L5G A;  2NWB A;  2CCQ A;  4TV8 E;  4AXP A;  3ZLI A;  1Z0P A;  1MND A;  2DI4 A;  3KBU A;  3C4X A;  4U72 A;  4ZS2 A;  2A3D A;  2Q9Q D;  1MIW A;  3DJB A;  3DTO A;  4ZI2 D;  3AA6 B;  3V5U A;  5LA6 E;  1IZN B;  3CPZ A;  4MBQ A;  4AKI A;  5KDM C;  1LVK A;  2LOS A;  4WW0 A;  5FMN A;  2VB6 A;  2LHN A;  3PF0 A;  3UUX B;  3HKC E;  2WMN A;  4YHJ A;  3M65 A;  3ONX A;  2H7O A;  2XAQ B;  2KMF A;  3K3O A;  5E0O A;  1HCI A;  2IC6 A;  2LM9 A;  4CI1 B;  5JDQ A;  3HKD E;  4B6X A;  3SOL A;  4I55 E;  3C4W A;  2NW9 A;  1D1C A;  2Q9Q A;  4JLE A;  3PUQ A;  2NOX A;  4GK0 E;  1G73 A;  4K0U A;  3D0T A;  2PJQ A;  5LBQ B;  2XQY A;  4H9N C;  3MA9 A;  5LP6 E;  3SWH A;  3Q5X A;  1YKH B;  5C8Y E;  5JDG A;  4O2B E;  2WMO A;  3ZMZ B;  3F57 A;  4CQI A;  4AKH A;  4V1A v;  2BVL A;  4HTE A;  4ZS3 A;  2LSY A;  3UTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...