5HXRA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 10mm ca2+
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
300
structure length
293
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
molecule keywords sodium,calcium exchanger
total genus 121
structure length 293
sequence length 300
ec nomenclature
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hxrA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hxrA02
5HWYA 5JDGA 5HWXA 5HXHA 5HXEA 5JDHA 5JDLA 5JDQA 5JDNA 3V5UA 5JDFA 3V5SA 5HYAA 5HXRA 5HXSA 5JDMA 5HXCA
chains in the Genus database with same CATH superfamily
1SA0E 1UUSA 5C2TA 4IDZA 3F57A 3PJAJ 5L3DB 4JI0T 2ES0A 3C51A 3CIRA 3F31A 2DI4A 3ONJA 5JDQA 4QX7B 2B1EA 1HNWT 2VWAA 1FMVA 2WCAA 3FZMB 3HKEE 2L9QA 4IDQA 4L0RA 4OK0A 2YU2A 1HTJF 2OA5A 3RGLA 4LF6T 2LQUA 2VKOA 5HAXA 2BVMA 2KINB 5AQIB 2Z6EA 2I59A 3UUXB 3ZCJA 4DR7T 3RIUC 4UVBB 5FZTA 2ZM0A 4JI3T 4ZI3D 4JI5T 4LF7T 3OVUA 4DIDB 4TNVA 4H63H 4YY3T 2LEHA 1H7CA 4MLKA 2M6BA 3JAFA 2RA1A 3PE0A 1LVKA 1LVFA 4U31A 5A1LA 2J1DG 2JQKA 5JREA 2V6YB 2JQQA 3LBXA 4KBMB 2N2NA 3RIAA 3ZPOA 1E2AA 3BQKA 2IDOB 2KVPA 3TLVA 4C90A 4GK0E 2LRKA 1YQ4A 3B57A 3Q5EA 4HEAA 4AXPA 3IA3A 1XNQT 3LDQB 2V7MA 4OYKA 2HH7A 2IC6A 3PUGA 5HXCA 4DNDA 4EB6E 4EYYR 5AQPB 5ABHA 4GOUA 3NZPA 2MOZA 5HEUA 4K0KT 3PUXF 2WY2A 1SHZC 3HKCE 2ZM6T 3C64A 4JI6T 1OEDE 1FMWA 3CX7B 1U4QA 1UGOA 2V7KA 2CLYC 3KVBA 3L09A 2DCFA 1YW0A 1R8IA 4QHOA 5EZYE 3LG7A 4HWCA 4WNKA 2VASA 2CHNA 3U3IA 3CK6A 4YXDA 3UQ4A 5LNKA 5DJQC 1J5ET 2LSKA 4GK5E 1QUUA 2UXBT 3P4WA 1KNZA 1I6ZA 5HEJA 1MMAA 3KVAA 3AEFA 3IBPA 3ZLIA 5ABFB 5LGTB 4JV5T 4HFDA 4U33A 4AQFC 3AY5A 4HKAA 4O2AE 1G73A 2BKNA 5C3JA 5HXSA 4N78D 1NAFA 4TX5A 3N9OA 5FL1A 2XSBA 1KNRA 1QLBA 2E8IA 3IF8B 4IGUA 5L4EA 4U74A 2NP9A 2X9XA 4NIQA 1MMNA 2XSAA 5AQJB 5IHYA 3UU8A 2AE9A 3ZCIA 1HG5A 4ONRA 4BGOA 3P7IA 4HWFA 3JCFA 2Q9QA 4U2YA 3RKOA 5KX5E 3AE3A 3KFWX 4ILAA 1ZP0A 1J1JA 4H9NC 2CBIA 3HKBE 4QH1A 4IE6A 3OTOT 4BJNA 4I0UA 4DBRA 4AQFA 2WP9A 2IUBA 3PU3A 4JYAT 2ACZA 2G0UA 3EDVA 3KV4A 3Q5XA 3UULA 1V9DA 1HR0T 4AQGA 4HGAA 3ZSSA 4JI1T 4LFAT 4ASKA 4B3ST 4GYRA 4Z8XA 4B3TT 2N1GA 4TZ4C 3ZMSB 1IZNB 3AE5A 3O1HA 4EZ4A 1OXZA 3AE8A 3AEAA 3GMIA 2FJEA 4EXTA 3LK3B 3J9X1 3ZT6A 1UX4A 5L3GB 1JNRA 1YQ3A 2C0SA 3LBXB 2CRBA 2XQYA 3OYZA 2L7NA 5H6RB 2IC9A 5JRCA 3UU4A 2C5IT 3C4XA 4F6RC 3K3NA 5CA1E 1OEDC 2BBJA 2V7JA 4YTNA 3WAJA 2QA7A 4OHFA 4HFHA 4PJLA 3RQUA 2HHHT 1S94A 3AEDA 2LOPA 3RYCE 5AQMB 2OLTA 5FY7A 2BS3A 1MNEA 4QXHB 2NW9A 5LMUT 3JADA 1HS7A 3ETUA 5FYMA 3P4PA 3CQXC 3SOLA 2X9WA 3ZJ1A 2ZM2A 1WLXA 4CN1A 5AFUL 4CI2B 3L3PA 2LOSA 4EEBA 4LFCT 4DMWA 3VJZA 4YSXA 3GN5B 1G8XA 4QKNA 4X1IE 3AE1A 2D0TA 4ZI3C 2W4XA 4XBFB 2YU1A 5L2LA 4H9QC 4UV9B 5JR9C 3UUBA 4UR9A 4EOZB 4PAGA 4DV7T 2Y48B 4JBWF 2X51A 3WSCA 2NTXA 4ANJA 2LE8A 4YTPA 4XAXB 2C5KT 5HEGA 2RP4A 2WDRA 4AI6A 3IEEA 5J1GA 3L8RA 4HFEA 3AXJB 3MXZA 2BG9A 3ETVA 2CMRA 2KNDA 1WFDA 3AA0B 3R84B 3ZMZB 1CHUA 3I9YA 2E5VA 3DYJA 1XWMA 1JNZA 3O1IA 4DV1T 2MAWA 1BR0A 2DL1A 3RKGA 2V5DA 4COFA 2W67A 4HWDA 4HWIB 4EIWA 2YEVC 4DUYT 3MA9A 2V6XA 3DTOA 3PUVF 4NPPA 4PJMA 5FXZA 4DUZT 1LRZA 1XDPA 4A5XA 2EHOB 5JR9A 5JDLA 3FBLA 3ZYKA 4X5TA 4Z90A 1VCTA 4KUMB 4H9SE 1BR1A 5JQGE 3C50A 2XAJB 3AE6A 5IYZE 2YINA 4KMCA 4UV8B 5L3EB 4GIWA 2VURA 3QOFA 5AQTB 3VRBA 5EK2A 3QUJA 4DR4T 4WYVA 2JQ9A 5HWYA 4HFIA 3T8OA 1D0YA 3A5XA 1ZHCA 4YLHA 4HE8A 2L10A 3C98B 3AVRA 2UU9T 4OYJA 2N9DA 3GA8A 5CB4E 3ZKRA 4EZHA 3AE7A 4C91A 2IHR1 2LHNA 4U7IA 4PFPA 3KDSE 1ZV4X 2CLYB 5LHHB 2JRKA 2FJBA 3ESLA 4IHJE 4WW0A 3SWHA 2PTFA 4UEMA 4YJ2E 1W0AA 3OPCA 4X1KE 3RRCA 5HWXA 3AVSA 3NKZA 4TV9E 3ZN1B 4CI3B 2DNXA 4DR5T 2CWYA 4MFRA 2R6GF 4OFZA 3FZHB 2XM2A 5DQWA 4QWNB 2BS2A 2V8SV 3P8CD 4ZEYA 3TLWA 5BMVE 4CI1B 2UUBT 1UURA 5LHGB 5E0OA 4OX9T 1YKHB 5JDFA 4I55E 2IW5B 2KSRA 2KLQA 3RRWA 3HL6A 5LMNT 3N2KE 4Z91A 2BVLA 2WS3A 4IL4A 5LGUB 2WWUA 1T7SA 2LM9A 3W15B 4YT0A 3K8PC 5HYAA 1WCRA 4PNIA 4V1Av 4CN4A 4QXBB 5LG3A 4A97A 4ILUA 5AQQB 1WR6A 3L39A 3NRXA 3PUWF 1MIYA 2BG9B 3H3MA 1SUMB 4P0BA 1HX1B 2JQHA 2WU2A 2WZHA 2YDSA 3Q9DA 1KK7A 1OEDA 4XZCA 4ADZA 3ZYMA 4PFOA 2DWKA 1D1BA 4YJ3E 5HCMA 3KV9A 4KX6A 3OYXA 3PUSA 1L0VA 4JI2T 3SRZA 1HF8A 5L3CB 1FJGT 3HR0A 5CA0E 4IIJE 2BDEA 1DU2A 1MMGA 3F2EA 4AKLA 1GQEA 4U2ZA 2CXLA 2XQ9A 5KMGP 5LB7B 5LXTE 2W61A 5EK4A 2FJDA 3UFGA 2ODVA 2UXXB 3CX6B 5AQGB 5FVKA 5LCYA 3J7Yq 2XQ8A 4O2BE 5C8YE 1AJ3A 1SE7A 4IE4A 4O8SA 5AQUB 2W63A 3VHLA 4G2AA 4CXXA 2CA5A 1XDOA 4AISA 5CFBA 1FEWA 3EVYA 1XMOT 2XM1A 1W9RA 3MJXA 2C5JA 2WDQA 3AAIA 4UF0A 3N9NA 4LF8T 2M6IA 3ZJ2A 2XTLA 5LP6E 4LF9T 2JIWA 1Y64B 2XAGB 4AQYT 5FXWA 4L5GA 3OBVE 1EZ3A 2X67A 4P09A 3WURA 2V5CA 3MKDA 4LMJA 2FJAA 4YFSA 2WMOA 2XZEA 4A98A 5LHIB 2V7IA 2XY8B 3DP7A 2ZM8A 2I0MA 2K9AA 2PJQA 2VB6A 3HKDE 3PDYA 4HTEA 4K0UA 4QXCB 5H6QB 2XHEB 2UUCT 2BKOA 5LBMA 5HEHA 3G06A 5JVDE 3ZSTA 4DO0A 1IBKT 4ZOLE 1SJ8A 4PK5A 3K3QC 2JJ9A 2WQYA 2NWBA 4HFVA 4YSYA 2LHRA 2YOEA 2W0GA 4CXYA 3AE4A 1N34T 3NRYA 4JEUB 5AQLB 4ZI2D 4UF0B 3LSVA 4CZZB 2CM0A 1IBLT 4NXMT 3I9WA 2V1DB 4ERRA 2I6HA 4NUVA 4KHZF 3ZC1A 1FIOA 2QGSA 3SFEA 5LJNA 3ZMVB 1D1CA 5J2TE 3N2OA 1KNPA 2IMLA 4DV5T 2NOXA 3QNUA 4EEDA 4KHPT 4EV6A 4BA9A 5AQKB 2BZBA 5HXHA 2GK9A 1WYBA 2QRXA 1HNZT 4ZS3A 1SJ7A 2A72A 2IAKA 1KEYA 2VL8A 3FZKB 4GKJT 1N32T 3UU6A 3WAKA 3RYFE 3AA6B 2SPCA 3P4QA 4I4TE 2HPJA 4PJJA 3RC3A 2X66A 1J5WA 1XZYA 2X9HA 2D9DA 3GN5A 4JLEA 3UTKA 5IUXA 4DR1T 3N9PA 1MNDA 2LJLA 2LSYA 3BQLA 5L3BB 3I0OA 4IREA 4L9IA 4LF5T 2BBHA 3Q5WA 3CQCB 3IHRA 2CXFA 3AB3B 2EHOA 5JR9B 4IE5A 4ISTA 3VRAA 4WZXA 1IBMT 3ZMUB 4AKGA 4BAYB 2X0HA 2LRLA 2LKHA 3KBUA 2MYSA 4E7SA 4DMVA 2NW7A 4EGWA 3SFDA 3B5MA 1HNXT 3FXEB 2ODUA 3AE2A 5JDNA 4GKKT 2VVSA 2P9BA 2XQ5A 2XQ6A 4JI4T 2H3RA 4O4JE 2H89A 3RQWA 2LSIA 3N2GE 4G63A 2BG9E 3A7MA 1HFAA 2WM9A 2H7OA 3EDUA 3OKQA 2E9XB 4DR3T 2X9YA 4EYUA 4ZI2C 3EABA 3VR9A 5J2UE 3BQIA 2X0LB 2VKHA 3RYIE 1UK5A 1WYCA 2E9XD 2KWIB 2L3LA 3ONXA 5AQRB 2XAHB 4UVAB 4ECGA 2LKGA 4TWHA 2A9UA 2JPFA 2KZ7B 2LSJA 2VL0A 3AAAB 3C4ZA 3D0TA 1X9BA 3I1AA 4LFBT 4CQIA 3V5UA 1B7TA 5F8PA 1D0ZA 4M1PA 1D0XA 1MIWA 4DV6T 4J2CA 4EAHA 4U3CA 3ZN0B 2IIUA 4IL9A 3RYHE 2KXPB 3AEGA 2XUEA 2WZIA 3NZQA 2KGXA 2LLYA 5LA6E 2PFVA 4LMKA 1Z8UA 3PUYF 3K1SA 3VKGA 4HN9A 4QH4A 2L8KA 2FUPA 4FJOA 3U78A 5AQSB 3QB5A 5FP3A 3RF1A 5F3JA 5JRCB 2HPLA 3NBXX 3BK9A 3MZKB 2B76A 4QH5A 5AQNB 4WBNE 2RPAA 5DABA 2XAQB 5L4HA 2VQET 1LKXA 1M62A 3AE9A 3E08A 2D0UA 3N9QA 2CHOA 3NVOA 4HFBA 3WI3A 5AQFB 2D2SA 3LK2B 4ILCA 1E1HB 3N9LA 3PHF1 5ADXL 2CEAA 2X0YA 4YTMA 3AT7A 3T1YT 3PUQA 1O3XA 4H9PC 3O4XE 4IDPA 3R6NA 4ZZBA 4ZZCA 5L47A 5HXRA 3CX8B 3M1CA 1E7PA 2W66A 4PK6A 4UIGA 4TUYE 5HXEA 1QSDA 5FY1A 2XQAA 3Q2MA 3CQGB 2DWGA 2EHOD 3FZLB 2CCQA 2XQ4A 1ZOYA 3N9MA 3FYQA 2Y8DA 4UELA 1YKEB 5FXXA 2QYWA 1D1AA 5F5WA 2E9XC 3ZT7A 4I50E 1W0BA 2Q9QD 4TWFA 3V5SA 2MTQA 3GWHA 2LSGA 3AXJA 1N36T 3RX6A 5BR8T 2VKDA 3UU5A 4PW8A 2J47A 5ETWA 2ACXA 2BS4A 3FZFB 1S35A 4X20E 1WRDA 2CBJA 5LG4A 3PF0A 2JMHA 1VCSA 3CKDA 3LK42 3EHZA 3K3OA 3N5LA 3RIFA 3PJAA 3RPUA 2H88A 2V6YA 4NUUA 4TWDA 1NENA 1I94T 1T98A 2Y6XA 2VQFT 3KV6A 5AQHB 1M7KA 2MTCA 5KDMC 2XAFB 4X62T 5ABEA 2MPKA 1UCUA 1HCIA 3QC9A 5LYJE 4AKHA 4E7ZA 4HFCA 4A56A 5J0ZA 2A2FX 3AA1B 5AQVB 2J62A 3E0ZA 5LBQB 3RI5A 4X64T 3HA4A 5ABGA 5LOVE 3B13A 4ZI7E 2F4VT 1OWAA 4DR6T 4B3MT 2LT3A 3MK7C 4KI0F 2MBGA 3ZYLA 3RC8A 2VKJA 2XQ7A 4U72A 4YSZA 2XJ7A 3ZEFB 3RLFF 3M65A 5CGMA 3QB5K 1W09A 4TNWA 4DV0T 3T1HT 3S4UA 2V26A 5EK3A 3UU3A 4X66T 2XQ3A 3CVRA 1NEKA 4MHCA 4UVCB 4PK4A 2CWOA 5JDMA 2WB5A 2VK9A 3AAEB 3ANWA 1US7B 3H37A 1HX8A 2M67A 3FXDB 3M3ZB 3PU8A 5AQOB 3UFEA 3RIUA 3KINB 3KV5A 2KMFA 4H9RC 1KF6A 1IJ5A 3I0QA 4O4LE 3VU7H 4AIUA 5JDHA 2KWHA 2YKSA 3P4RA 2LM2A 3PURA 4YHJA 2X68A 4I43B 5GONE 4ILBA 2CE7A 2FBWA 3TLUA 2VVNA 1XMQT 2H7VC 2QVAA 2E5LT 4YHHT 4DV2T 3C4WA 2HN2A 2OV9A 2WDVA 1ZEEA 3AECA 4P0AA 5FXVA 2WAUA 3RHWA 4O4HE 4H9OC 2WBLA 4DV3T 2UXDT 1U5PA 4JI8T 3JC6D 3CMLA 4AKRB 1VRBA 3PV0F 5JTGA 5HCJA 4IE7A 5JDGA 2V7LA 1T72A 1NWMX 2ZLYA 3TLSA 1YXRA 3ZC0A 5JH7E 2BKPA 4IDNA 4KP3C 1Z0PA 3TLTA 1BR2A 3HI2A 4LMLA 5L3FB 2XASB 2UXNB 3CPZA 3FBZA 4X65T 4DBQA 2UXCT 4MBQA 1XNRT 5T1DA 2UUAT 3P50A 2KBBA 2YDRA 4BJMA 2AXDS 3KBTA 3O9XA 3ONLC 2J4GA 4JUYA 5FVLA 3H3AA 4B6XA 4DR2T 4F8HA 4IE0A 1X79A 2HN1A 4P1NA 2D5UA 3JAEA 2DLRA 2NW8A 4H63V 4ISSA 2WU5A 5IWAT 3UT5E 2K3WA 2WMNA 2YK0A 2YN6A 4MALA 4DVDA 1UX5A 4F7GB 2XPKA 2WWVA 4NXNT 1HG2A 2EHOC 5LJMA 2BG9C 2ZMAA 4O4IE 1WR0A 2A3DA 4U7YA 1MMDA 3OJAA 1OEDB 2JMKA 1IJ6A 2PG8A 3PUZF 5FNVE 2NTYA 3EAMA 3LJCA 4UXNB 2Q9QC 4Q25A 5FKYA 3VR8A 2E9XA 5M4YA 4JI7T 4LF4T 1N33T 4AKIA 3Q5DA 1T8BA 3LFMA 3PTRB 3UQ7A 5CJ5A 3EI0A 3O1JA 3RH3A 1IAPA 4CXWA 4CN6A 2NR4A 2DHRA 1CUNA 3A8YC 3AA7B 3CWZB 2CXDA 4TV8E 4WBOA 3AEEA 5HEOA 2KT9A 5LGNB 3ANWB 3VKHA 1VOMA 4W8PA 1MIVA 4IDOA 4TN7B 4GYSA 3E22E 3SS1A 2K24A 2X0CA 3QK6A 1KFYA 2W2UA 3JC6C 4HWHA 5DQVA 3ABVA 4FI5A 4PJNA 3X1DA 5KXJA 3FB2A 2K5BB 3MACA 4ZHQE 3DJBA 5ABFA 4QX8B 4ZXLA 1ZKEA 5TAOA 2YDQA 1YD8G 3UUNA 2W00A 4B3RT 4IT4A 5FY0A 3NWIA 3ZT5A 3P4SA 5FL0A 3ZMTB 2WSSV 2PBIA 4DV4T 3UUMA 4JEHB 5FMNA 2CPTA 2E2AA 2W62A 3TKLB 1Y01A 2K48A 3AEBA 1BR4A 4X1YE 4ZS2A 3FHNA 2Q9QB 3EUHA 3PUAA
chains in the Genus database with same CATH topology
1SA0E 5L3DB 4IDZA 3F57A 2ES0A 3C51A 3F31A 2DI4A 5JDQA 4QX7B 2B1EA 2VWAA 1FMVA 3HKEE 4L0RA 2L9QA 4OK0A 2YU2A 1HTJF 2OA5A 2LQUA 2VKOA 5HAXA 2BVMA 2KINB 2Z6EA 2I59A 3UUXB 3ZCJA 4UVBB 2ZM0A 4ZI3D 4H63H 2LEHA 1H7CA 4MLKA 2RA1A 3PE0A 1LVKA 1LVFA 5A1LA 2J1DG 2JQQA 3LBXA 4KBMB 2N2NA 3ZPOA 3BQKA 4C90A 4GK0E 3B57A 4HEAA 4AXPA 2V7MA 4OYKA 2HH7A 2IC6A 3PUGA 5HXCA 4DNDA 4EB6E 4EYYR 3WSCA 4GOUA 3NZPA 2MOZA 3HKCE 1SHZC 3C64A 3CX7B 1FMWA 1U4QA 2V7KA 3KVBA 2CLYC 3L09A 4QHOA 2DCFA 1YW0A 5EZYE 3LG7A 4WNKA 2VASA 3U3IA 5LNKA 5DJQC 2LSKA 4GK5E 1QUUA 1KNZA 1MMAA 3KVAA 3IBPA 3ZLIA 5LGTB 4AQFC 4HKAA 4O2AE 1G73A 5HXSA 4N78D 1NAFA 4TX5A 3N9OA 3IF8B 4IGUA 2E8IA 4U74A 2NP9A 2X9XA 1MMNA 5IHYA 3ZCIA 1HG5A 4BGOA 3P7IA 2Q9QA 3RKOA 5KX5E 3KFWX 4H9NC 3HKBE 4IE6A 4BJNA 4DBRA 4AQFA 3PU3A 2G0UA 3EDVA 3KV4A 3Q5XA 3UULA 1V9DA 4AQGA 4HGAA 4ASKA 4GYRA 4Z8XA 2N1GA 4TZ4C 1IZNB 4EZ4A 3O1HA 1OXZA 3GMIA 4EXTA 3LK3B 3J9X1 1UX4A 5L3GB 2C0SA 3LBXB 2XQYA 3OYZA 5H6RB 2IC9A 5JRCA 2C5IT 3C4XA 4F6RC 3K3NA 5CA1E 2V7JA 3WAJA 2QA7A 4OHFA 4PJLA 1S94A 2LOPA 3RYCE 5FY7A 1MNEA 4QXHB 2NW9A 1HS7A 3ETUA 5FYMA 3SOLA 3CQXC 2X9WA 3ZJ1A 2ZM2A 1WLXA 5AFUL 4CI2B 3L3PA 2LOSA 4DMWA 3VJZA 3GN5B 1G8XA 4QKNA 4X1IE 4XBFB 2D0TA 4ZI3C 2YU1A 5L2LA 4H9QC 4UV9B 5JR9C 4EOZB 4PAGA 2Y48B 2X51A 2NTXA 4ANJA 2LE8A 4XAXB 2C5KT 2RP4A 4AI6A 3IEEA 5J1GA 3MXZA 3ETVA 2CMRA 2KNDA 3AA0B 3R84B 3ZMZB 3I9YA 3O1IA 1BR0A 4EIWA 2YEVC 3MA9A 5FXZA 3DTOA 4PJMA 1LRZA 2EHOB 5JR9A 5JDLA 3FBLA 3ZYKA 4KUMB 4H9SE 1BR1A 5JQGE 3C50A 2XAJB 5IYZE 2YINA 4KMCA 4UV8B 5L3EB 4GIWA 5EK2A 3QUJA 5HWYA 3T8OA 1D0YA 3A5XA 1ZHCA 4YLHA 4HE8A 3C98B 3AVRA 4OYJA 2N9DA 3GA8A 5CB4E 4EZHA 4C91A 2LHNA 4PFPA 3KDSE 1ZV4X 2CLYB 5LHHB 2JRKA 4WW0A 3ESLA 4IHJE 3SWHA 4UEMA 4YJ2E 4X1KE 3RRCA 5HWXA 3AVSA 3ZN1B 4TV9E 4CI3B 2DNXA 2CWYA 4MFRA 4OFZA 5DQWA 4CI1B 4QWNB 3P8CD 5BMVE 5LHGB 5E0OA 1YKHB 5JDFA 4I55E 2IW5B 2KLQA 3RRWA 3HL6A 3N2KE 2BVLA 5LGUB 2WWUA 2LM9A 3W15B 3K8PC 5HYAA 4PNIA 4V1Av 4QXBB 4ILUA 1WR6A 3NRXA 1MIYA 4P0BA 4ADZA 3Q9DA 1KK7A 4XZCA 3ZYMA 4PFOA 2DWKA 1D1BA 4YJ3E 3SRZA 3KV9A 3OYXA 3PUSA 5L3CB 1HF8A 3HR0A 5CA0E 4IIJE 2BDEA 1MMGA 3F2EA 4AKLA 2CXLA 5KMGP 5LXTE 2W61A 5EK4A 2ODVA 2UXXB 3CX6B 5LCYA 3J7Yq 4O2BE 5C8YE 1AJ3A 4IE4A 4O8SA 2W63A 3VHLA 4G2AA 4CXXA 2CA5A 1FEWA 3EVYA 3MJXA 4UF0A 2C5JA 3AAIA 3N9NA 3ZJ2A 2XTLA 5LP6E 1Y64B 2XAGB 5FXWA 4L5GA 3OBVE 1EZ3A 2X67A 4P09A 3WURA 3MKDA 4YFSA 2WMOA 5LHIB 2V7IA 3ZMSB 3DP7A 2ZM8A 2K9AA 2PJQA 3HKDE 2VB6A 3PDYA 4HTEA 4K0UA 4QXCB 5H6QB 2XHEB 5LBMA 4DO0A 5JVDE 4ZOLE 4PK5A 3K3QC 2JJ9A 2NWBA 4HFVA 2LHRA 2W0GA 4CXYA 3NRYA 4JEUB 4ZI2D 4UF0B 4CZZB 2CM0A 3I9WA 2V1DB 4ERRA 4NUVA 3ZC1A 1FIOA 2QGSA 5LJNA 3ZMVB 1D1CA 5J2TE 3N2OA 2NOXA 4BA9A 2BZBA 5HXHA 2GK9A 1WYBA 4ZS3A 2A72A 2IAKA 2VL8A 3WAKA 3RYFE 3AA6B 2SPCA 3RC3A 4I4TE 2HPJA 4PJJA 5JREA 2X66A 2X9HA 3GN5A 4JLEA 3UTKA 3N9PA 1MNDA 2LJLA 2LSYA 3BQLA 5L3BB 3I0OA 4L9IA 3Q5WA 3CQCB 3IHRA 2CXFA 3AB3B 2EHOA 5JR9B 4IE5A 4ISTA 4AKGA 3ZMUB 4BAYB 3KBUA 2MYSA 4E7SA 4DMVA 2NW7A 3FXEB 2ODUA 5JDNA 2P9BA 2H3RA 4O4JE 2LSIA 3N2GE 4G63A 1HFAA 2WM9A 2H7OA 3EDUA 3OKQA 2E9XB 2X9YA 4EYUA 4ZI2C 5J2UE 3BQIA 2X0LB 2VKHA 3RYIE 1WYCA 2E9XD 2KWIB 2L3LA 3ONXA 4ECGA 2XAHB 4UVAB 2JPFA 2KZ7B 2LSJA 3AAAB 3C4ZA 3D0TA 3I1AA 4CQIA 3V5UA 1B7TA 5F8PA 1D0ZA 4M1PA 1D0XA 1MIWA 4J2CA 4EAHA 3ZN0B 3RYHE 2KXPB 2XUEA 3NZQA 5LA6E 2PFVA 3VKGA 4HN9A 2L8KA 4FJOA 3U78A 5FP3A 5F3JA 5JRCB 2HPLA 3NBXX 3BK9A 3MZKB 4WBNE 5DABA 2XAQB 1LKXA 3N9QA 3WI3A 3E08A 2D0UA 2D2SA 3LK2B 1E1HB 3N9LA 3PHF1 5ADXL 2CEAA 3AT7A 3PUQA 1O3XA 4H9PC 3O4XE 3R6NA 5HXRA 3CX8B 3M1CA 4UIGA 4PK6A 4TUYE 5HXEA 1QSDA 5FY1A 3Q2MA 3CQGB 2DWGA 2EHOD 2CCQA 3N9MA 2Y8DA 4UELA 1YKEB 5FXXA 1D1AA 2E9XC 4I50E 2Q9QD 3V5SA 2MTQA 3GWHA 2LSGA 3RX6A 2VKDA 4PW8A 5ETWA 2ACXA 4X20E 5LG4A 1S35A 3PF0A 1WRDA 2JMHA 3CKDA 3LK42 3N5LA 3K3OA 3RPUA 4NUUA 1T98A 2Y6XA 3KV6A 2MTCA 5KDMC 2XAFB 1UCUA 1HCIA 3QC9A 5LYJE 4AKHA 4E7ZA 4A56A 2A2FX 3AA1B 3E0ZA 5LBQB 3HA4A 4ZI7E 5LOVE 3B13A 1OWAA 2LT3A 3MK7C 2MBGA 3ZYLA 3RC8A 2VKJA 4U72A 3ZEFB 3M65A 3S4UA 2V26A 5EK3A 4UVCB 3CVRA 4MHCA 4PK4A 2CWOA 5JDMA 2VK9A 3AAEB 3ANWA 1US7B 3H37A 1HX8A 2M67A 3FXDB 3PU8A 3UFEA 3KINB 3KV5A 2KMFA 4H9RC 3I0QA 1IJ5A 4O4LE 3VU7H 5JDHA 2KWHA 4I43B 4YHJA 3PURA 2X68A 5GONE 2CE7A 2H7VC 3C4WA 4P0AA 1ZEEA 5FXVA 2WAUA 4O4HE 4H9OC 2WBLA 1U5PA 3JC6D 3CMLA 4AKRB 1VRBA 5JDGA 4IE7A 2V7LA 2ZLYA 1NWMX 3ZC0A 5JH7E 4KP3C 1Z0PA 1BR2A 3HI2A 5L3FB 2XASB 2UXNB 3CPZA 3FBZA 4DBQA 4MBQA 5T1DA 4BJMA 3KBTA 3O9XA 4JUYA 4B6XA 3H3AA 4ONRA 4IE0A 1X79A 2D5UA 4ISSA 2DLRA 2NW8A 4H63V 3UT5E 2WMNA 2YK0A 4MALA 4DVDA 1UX5A 1HG2A 2EHOC 5LJMA 2ZMAA 4O4IE 2A3DA 1MMDA 3OJAA 2JMKA 1IJ6A 2PG8A 5FNVE 2NTYA 3LJCA 4UXNB 2Q9QC 5M4YA 2E9XA 4AKIA 3LFMA 3PTRB 3O1JA 3RH3A 1IAPA 4CXWA 2DHRA 1CUNA 3AA7B 3CWZB 4TV8E 2CXDA 4WBOA 5LGNB 2KT9A 3VKHA 3ANWB 1VOMA 1MIVA 4TN7B 4GYSA 3E22E 3SS1A 2K24A 3QK6A 3JC6C 5DQVA 4FI5A 4PJNA 3FB2A 2K5BB 3MACA 4ZHQE 3DJBA 4QX8B 1ZKEA 5TAOA 1YD8G 3UUNA 2W00A 5FY0A 3ZMTB 2WSSV 2PBIA 3UUMA 4JEHB 5FMNA 3TKLB 2W62A 4X1YE 2K48A 4ZS2A 1BR4A 3FHNA 2Q9QB 3EUHA 3PUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWY A;  5JDG A;  5HWX A;  5HXH A;  5HXE A;  5JDH A;  5JDL A;  5JDQ A;  5JDN A;  3V5U A;  5JDF A;  3V5S A;  5HYA A;  5HXR A;  5HXS A;  5JDM A;  5HXC A; 
#chains in the Genus database with same CATH topology
 1SA0 E;  1UUS A;  5C2T A;  4IDZ A;  3F57 A;  3PJA J;  5L3D B;  4JI0 T;  2ES0 A;  3C51 A;  3CIR A;  3F31 A;  2DI4 A;  3ONJ A;  5JDQ A;  4QX7 B;  2B1E A;  1HNW T;  2VWA A;  1FMV A;  2WCA A;  3FZM B;  3HKE E;  2L9Q A;  4IDQ A;  4L0R A;  4OK0 A;  2YU2 A;  1HTJ F;  2OA5 A;  3RGL A;  4LF6 T;  2LQU A;  2VKO A;  5HAX A;  2BVM A;  2KIN B;  5AQI B;  2Z6E A;  2I59 A;  3UUX B;  3ZCJ A;  4DR7 T;  3RIU C;  4UVB B;  5FZT A;  2ZM0 A;  4JI3 T;  4ZI3 D;  4JI5 T;  4LF7 T;  3OVU A;  4DID B;  4TNV A;  4H63 H;  4YY3 T;  2LEH A;  1H7C A;  4MLK A;  2M6B A;  3JAF A;  2RA1 A;  3PE0 A;  1LVK A;  1LVF A;  4U31 A;  5A1L A;  2J1D G;  2JQK A;  5JRE A;  2V6Y B;  2JQQ A;  3LBX A;  4KBM B;  2N2N A;  3RIA A;  3ZPO A;  1E2A A;  3BQK A;  2IDO B;  2KVP A;  3TLV A;  4C90 A;  4GK0 E;  2LRK A;  1YQ4 A;  3B57 A;  3Q5E A;  4HEA A;  4AXP A;  3IA3 A;  1XNQ T;  3LDQ B;  2V7M A;  4OYK A;  2HH7 A;  2IC6 A;  3PUG A;  5HXC A;  4DND A;  4EB6 E;  4EYY R;  5AQP B;  5ABH A;  4GOU A;  3NZP A;  2MOZ A;  5HEU A;  4K0K T;  3PUX F;  2WY2 A;  1SHZ C;  3HKC E;  2ZM6 T;  3C64 A;  4JI6 T;  1OED E;  1FMW A;  3CX7 B;  1U4Q A;  1UGO A;  2V7K A;  2CLY C;  3KVB A;  3L09 A;  2DCF A;  1YW0 A;  1R8I A;  4QHO A;  5EZY E;  3LG7 A;  4HWC A;  4WNK A;  2VAS A;  2CHN A;  3U3I A;  3CK6 A;  4YXD A;  3UQ4 A;  5LNK A;  5DJQ C;  1J5E T;  2LSK A;  4GK5 E;  1QUU A;  2UXB T;  3P4W A;  1KNZ A;  1I6Z A;  5HEJ A;  1MMA A;  3KVA A;  3AEF A;  3IBP A;  3ZLI A;  5ABF B;  5LGT B;  4JV5 T;  4HFD A;  4U33 A;  4AQF C;  3AY5 A;  4HKA A;  4O2A E;  1G73 A;  2BKN A;  5C3J A;  5HXS A;  4N78 D;  1NAF A;  4TX5 A;  3N9O A;  5FL1 A;  2XSB A;  1KNR A;  1QLB A;  2E8I A;  3IF8 B;  4IGU A;  5L4E A;  4U74 A;  2NP9 A;  2X9X A;  4NIQ A;  1MMN A;  2XSA A;  5AQJ B;  5IHY A;  3UU8 A;  2AE9 A;  3ZCI A;  1HG5 A;  4ONR A;  4BGO A;  3P7I A;  4HWF A;  3JCF A;  2Q9Q A;  4U2Y A;  3RKO A;  5KX5 E;  3AE3 A;  3KFW X;  4ILA A;  1ZP0 A;  1J1J A;  4H9N C;  2CBI A;  3HKB E;  4QH1 A;  4IE6 A;  3OTO T;  4BJN A;  4I0U A;  4DBR A;  4AQF A;  2WP9 A;  2IUB A;  3PU3 A;  4JYA T;  2ACZ A;  2G0U A;  3EDV A;  3KV4 A;  3Q5X A;  3UUL A;  1V9D A;  1HR0 T;  4AQG A;  4HGA A;  3ZSS A;  4JI1 T;  4LFA T;  4ASK A;  4B3S T;  4GYR A;  4Z8X A;  4B3T T;  2N1G A;  4TZ4 C;  3ZMS B;  1IZN B;  3AE5 A;  3O1H A;  4EZ4 A;  1OXZ A;  3AE8 A;  3AEA A;  3GMI A;  2FJE A;  4EXT A;  3LK3 B;  3J9X 1;  3ZT6 A;  1UX4 A;  5L3G B;  1JNR A;  1YQ3 A;  2C0S A;  3LBX B;  2CRB A;  2XQY A;  3OYZ A;  2L7N A;  5H6R B;  2IC9 A;  5JRC A;  3UU4 A;  2C5I T;  3C4X A;  4F6R C;  3K3N A;  5CA1 E;  1OED C;  2BBJ A;  2V7J A;  4YTN A;  3WAJ A;  2QA7 A;  4OHF A;  4HFH A;  4PJL A;  3RQU A;  2HHH T;  1S94 A;  3AED A;  2LOP A;  3RYC E;  5AQM B;  2OLT A;  5FY7 A;  2BS3 A;  1MNE A;  4QXH B;  2NW9 A;  5LMU T;  3JAD A;  1HS7 A;  3ETU A;  5FYM A;  3P4P A;  3CQX C;  3SOL A;  2X9W A;  3ZJ1 A;  2ZM2 A;  1WLX A;  4CN1 A;  5AFU L;  4CI2 B;  3L3P A;  2LOS A;  4EEB A;  4LFC T;  4DMW A;  3VJZ A;  4YSX A;  3GN5 B;  1G8X A;  4QKN A;  4X1I E;  3AE1 A;  2D0T A;  4ZI3 C;  2W4X A;  4XBF B;  2YU1 A;  5L2L A;  4H9Q C;  4UV9 B;  5JR9 C;  3UUB A;  4UR9 A;  4EOZ B;  4PAG A;  4DV7 T;  2Y48 B;  4JBW F;  2X51 A;  3WSC A;  2NTX A;  4ANJ A;  2LE8 A;  4YTP A;  4XAX B;  2C5K T;  5HEG A;  2RP4 A;  2WDR A;  4AI6 A;  3IEE A;  5J1G A;  3L8R A;  4HFE A;  3AXJ B;  3MXZ A;  2BG9 A;  3ETV A;  2CMR A;  2KND A;  1WFD A;  3AA0 B;  3R84 B;  3ZMZ B;  1CHU A;  3I9Y A;  2E5V A;  3DYJ A;  1XWM A;  1JNZ A;  3O1I A;  4DV1 T;  2MAW A;  1BR0 A;  2DL1 A;  3RKG A;  2V5D A;  4COF A;  2W67 A;  4HWD A;  4HWI B;  4EIW A;  2YEV C;  4DUY T;  3MA9 A;  2V6X A;  3DTO A;  3PUV F;  4NPP A;  4PJM A;  5FXZ A;  4DUZ T;  1LRZ A;  1XDP A;  4A5X A;  2EHO B;  5JR9 A;  5JDL A;  3FBL A;  3ZYK A;  4X5T A;  4Z90 A;  1VCT A;  4KUM B;  4H9S E;  1BR1 A;  5JQG E;  3C50 A;  2XAJ B;  3AE6 A;  5IYZ E;  2YIN A;  4KMC A;  4UV8 B;  5L3E B;  4GIW A;  2VUR A;  3QOF A;  5AQT B;  3VRB A;  5EK2 A;  3QUJ A;  4DR4 T;  4WYV A;  2JQ9 A;  5HWY A;  4HFI A;  3T8O A;  1D0Y A;  3A5X A;  1ZHC A;  4YLH A;  4HE8 A;  2L10 A;  3C98 B;  3AVR A;  2UU9 T;  4OYJ A;  2N9D A;  3GA8 A;  5CB4 E;  3ZKR A;  4EZH A;  3AE7 A;  4C91 A;  2IHR 1;  2LHN A;  4U7I A;  4PFP A;  3KDS E;  1ZV4 X;  2CLY B;  5LHH B;  2JRK A;  2FJB A;  3ESL A;  4IHJ E;  4WW0 A;  3SWH A;  2PTF A;  4UEM A;  4YJ2 E;  1W0A A;  3OPC A;  4X1K E;  3RRC A;  5HWX A;  3AVS A;  3NKZ A;  4TV9 E;  3ZN1 B;  4CI3 B;  2DNX A;  4DR5 T;  2CWY A;  4MFR A;  2R6G F;  4OFZ A;  3FZH B;  2XM2 A;  5DQW A;  4QWN B;  2BS2 A;  2V8S V;  3P8C D;  4ZEY A;  3TLW A;  5BMV E;  4CI1 B;  2UUB T;  1UUR A;  5LHG B;  5E0O A;  4OX9 T;  1YKH B;  5JDF A;  4I55 E;  2IW5 B;  2KSR A;  2KLQ A;  3RRW A;  3HL6 A;  5LMN T;  3N2K E;  4Z91 A;  2BVL A;  2WS3 A;  4IL4 A;  5LGU B;  2WWU A;  1T7S A;  2LM9 A;  3W15 B;  4YT0 A;  3K8P C;  5HYA A;  1WCR A;  4PNI A;  4V1A v;  4CN4 A;  4QXB B;  5LG3 A;  4A97 A;  4ILU A;  5AQQ B;  1WR6 A;  3L39 A;  3NRX A;  3PUW F;  1MIY A;  2BG9 B;  3H3M A;  1SUM B;  4P0B A;  1HX1 B;  2JQH A;  2WU2 A;  2WZH A;  2YDS A;  3Q9D A;  1KK7 A;  1OED A;  4XZC A;  4ADZ A;  3ZYM A;  4PFO A;  2DWK A;  1D1B A;  4YJ3 E;  5HCM A;  3KV9 A;  4KX6 A;  3OYX A;  3PUS A;  1L0V A;  4JI2 T;  3SRZ A;  1HF8 A;  5L3C B;  1FJG T;  3HR0 A;  5CA0 E;  4IIJ E;  2BDE A;  1DU2 A;  1MMG A;  3F2E A;  4AKL A;  1GQE A;  4U2Z A;  2CXL A;  2XQ9 A;  5KMG P;  5LB7 B;  5LXT E;  2W61 A;  5EK4 A;  2FJD A;  3UFG A;  2ODV A;  2UXX B;  3CX6 B;  5AQG B;  5FVK A;  5LCY A;  3J7Y q;  2XQ8 A;  4O2B E;  5C8Y E;  1AJ3 A;  1SE7 A;  4IE4 A;  4O8S A;  5AQU B;  2W63 A;  3VHL A;  4G2A A;  4CXX A;  2CA5 A;  1XDO A;  4AIS A;  5CFB A;  1FEW A;  3EVY A;  1XMO T;  2XM1 A;  1W9R A;  3MJX A;  2C5J A;  2WDQ A;  3AAI A;  4UF0 A;  3N9N A;  4LF8 T;  2M6I A;  3ZJ2 A;  2XTL A;  5LP6 E;  4LF9 T;  2JIW A;  1Y64 B;  2XAG B;  4AQY T;  5FXW A;  4L5G A;  3OBV E;  1EZ3 A;  2X67 A;  4P09 A;  3WUR A;  2V5C A;  3MKD A;  4LMJ A;  2FJA A;  4YFS A;  2WMO A;  2XZE A;  4A98 A;  5LHI B;  2V7I A;  2XY8 B;  3DP7 A;  2ZM8 A;  2I0M A;  2K9A A;  2PJQ A;  2VB6 A;  3HKD E;  3PDY A;  4HTE A;  4K0U A;  4QXC B;  5H6Q B;  2XHE B;  2UUC T;  2BKO A;  5LBM A;  5HEH A;  3G06 A;  5JVD E;  3ZST A;  4DO0 A;  1IBK T;  4ZOL E;  1SJ8 A;  4PK5 A;  3K3Q C;  2JJ9 A;  2WQY A;  2NWB A;  4HFV A;  4YSY A;  2LHR A;  2YOE A;  2W0G A;  4CXY A;  3AE4 A;  1N34 T;  3NRY A;  4JEU B;  5AQL B;  4ZI2 D;  4UF0 B;  3LSV A;  4CZZ B;  2CM0 A;  1IBL T;  4NXM T;  3I9W A;  2V1D B;  4ERR A;  2I6H A;  4NUV A;  4KHZ F;  3ZC1 A;  1FIO A;  2QGS A;  3SFE A;  5LJN A;  3ZMV B;  1D1C A;  5J2T E;  3N2O A;  1KNP A;  2IML A;  4DV5 T;  2NOX A;  3QNU A;  4EED A;  4KHP T;  4EV6 A;  4BA9 A;  5AQK B;  2BZB A;  5HXH A;  2GK9 A;  1WYB A;  2QRX A;  1HNZ T;  4ZS3 A;  1SJ7 A;  2A72 A;  2IAK A;  1KEY A;  2VL8 A;  3FZK B;  4GKJ T;  1N32 T;  3UU6 A;  3WAK A;  3RYF E;  3AA6 B;  2SPC A;  3P4Q A;  4I4T E;  2HPJ A;  4PJJ A;  3RC3 A;  2X66 A;  1J5W A;  1XZY A;  2X9H A;  2D9D A;  3GN5 A;  4JLE A;  3UTK A;  5IUX A;  4DR1 T;  3N9P A;  1MND A;  2LJL A;  2LSY A;  3BQL A;  5L3B B;  3I0O A;  4IRE A;  4L9I A;  4LF5 T;  2BBH A;  3Q5W A;  3CQC B;  3IHR A;  2CXF A;  3AB3 B;  2EHO A;  5JR9 B;  4IE5 A;  4IST A;  3VRA A;  4WZX A;  1IBM T;  3ZMU B;  4AKG A;  4BAY B;  2X0H A;  2LRL A;  2LKH A;  3KBU A;  2MYS A;  4E7S A;  4DMV A;  2NW7 A;  4EGW A;  3SFD A;  3B5M A;  1HNX T;  3FXE B;  2ODU A;  3AE2 A;  5JDN A;  4GKK T;  2VVS A;  2P9B A;  2XQ5 A;  2XQ6 A;  4JI4 T;  2H3R A;  4O4J E;  2H89 A;  3RQW A;  2LSI A;  3N2G E;  4G63 A;  2BG9 E;  3A7M A;  1HFA A;  2WM9 A;  2H7O A;  3EDU A;  3OKQ A;  2E9X B;  4DR3 T;  2X9Y A;  4EYU A;  4ZI2 C;  3EAB A;  3VR9 A;  5J2U E;  3BQI A;  2X0L B;  2VKH A;  3RYI E;  1UK5 A;  1WYC A;  2E9X D;  2KWI B;  2L3L A;  3ONX A;  5AQR B;  2XAH B;  4UVA B;  4ECG A;  2LKG A;  4TWH A;  2A9U A;  2JPF A;  2KZ7 B;  2LSJ A;  2VL0 A;  3AAA B;  3C4Z A;  3D0T A;  1X9B A;  3I1A A;  4LFB T;  4CQI A;  3V5U A;  1B7T A;  5F8P A;  1D0Z A;  4M1P A;  1D0X A;  1MIW A;  4DV6 T;  4J2C A;  4EAH A;  4U3C A;  3ZN0 B;  2IIU A;  4IL9 A;  3RYH E;  2KXP B;  3AEG A;  2XUE A;  2WZI A;  3NZQ A;  2KGX A;  2LLY A;  5LA6 E;  2PFV A;  4LMK A;  1Z8U A;  3PUY F;  3K1S A;  3VKG A;  4HN9 A;  4QH4 A;  2L8K A;  2FUP A;  4FJO A;  3U78 A;  5AQS B;  3QB5 A;  5FP3 A;  3RF1 A;  5F3J A;  5JRC B;  2HPL A;  3NBX X;  3BK9 A;  3MZK B;  2B76 A;  4QH5 A;  5AQN B;  4WBN E;  2RPA A;  5DAB A;  2XAQ B;  5L4H A;  2VQE T;  1LKX A;  1M62 A;  3AE9 A;  3E08 A;  2D0U A;  3N9Q A;  2CHO A;  3NVO A;  4HFB A;  3WI3 A;  5AQF B;  2D2S A;  3LK2 B;  4ILC A;  1E1H B;  3N9L A;  3PHF 1;  5ADX L;  2CEA A;  2X0Y A;  4YTM A;  3AT7 A;  3T1Y T;  3PUQ A;  1O3X A;  4H9P C;  3O4X E;  4IDP A;  3R6N A;  4ZZB A;  4ZZC A;  5L47 A;  5HXR A;  3CX8 B;  3M1C A;  1E7P A;  2W66 A;  4PK6 A;  4UIG A;  4TUY E;  5HXE A;  1QSD A;  5FY1 A;  2XQA A;  3Q2M A;  3CQG B;  2DWG A;  2EHO D;  3FZL B;  2CCQ A;  2XQ4 A;  1ZOY A;  3N9M A;  3FYQ A;  2Y8D A;  4UEL A;  1YKE B;  5FXX A;  2QYW A;  1D1A A;  5F5W A;  2E9X C;  3ZT7 A;  4I50 E;  1W0B A;  2Q9Q D;  4TWF A;  3V5S A;  2MTQ A;  3GWH A;  2LSG A;  3AXJ A;  1N36 T;  3RX6 A;  5BR8 T;  2VKD A;  3UU5 A;  4PW8 A;  2J47 A;  5ETW A;  2ACX A;  2BS4 A;  3FZF B;  1S35 A;  4X20 E;  1WRD A;  2CBJ A;  5LG4 A;  3PF0 A;  2JMH A;  1VCS A;  3CKD A;  3LK4 2;  3EHZ A;  3K3O A;  3N5L A;  3RIF A;  3PJA A;  3RPU A;  2H88 A;  2V6Y A;  4NUU A;  4TWD A;  1NEN A;  1I94 T;  1T98 A;  2Y6X A;  2VQF T;  3KV6 A;  5AQH B;  1M7K A;  2MTC A;  5KDM C;  2XAF B;  4X62 T;  5ABE A;  2MPK A;  1UCU A;  1HCI A;  3QC9 A;  5LYJ E;  4AKH A;  4E7Z A;  4HFC A;  4A56 A;  5J0Z A;  2A2F X;  3AA1 B;  5AQV B;  2J62 A;  3E0Z A;  5LBQ B;  3RI5 A;  4X64 T;  3HA4 A;  5ABG A;  5LOV E;  3B13 A;  4ZI7 E;  2F4V T;  1OWA A;  4DR6 T;  4B3M T;  2LT3 A;  3MK7 C;  4KI0 F;  2MBG A;  3ZYL A;  3RC8 A;  2VKJ A;  2XQ7 A;  4U72 A;  4YSZ A;  2XJ7 A;  3ZEF B;  3RLF F;  3M65 A;  5CGM A;  3QB5 K;  1W09 A;  4TNW A;  4DV0 T;  3T1H T;  3S4U A;  2V26 A;  5EK3 A;  3UU3 A;  4X66 T;  2XQ3 A;  3CVR A;  1NEK A;  4MHC A;  4UVC B;  4PK4 A;  2CWO A;  5JDM A;  2WB5 A;  2VK9 A;  3AAE B;  3ANW A;  1US7 B;  3H37 A;  1HX8 A;  2M67 A;  3FXD B;  3M3Z B;  3PU8 A;  5AQO B;  3UFE A;  3RIU A;  3KIN B;  3KV5 A;  2KMF A;  4H9R C;  1KF6 A;  1IJ5 A;  3I0Q A;  4O4L E;  3VU7 H;  4AIU A;  5JDH A;  2KWH A;  2YKS A;  3P4R A;  2LM2 A;  3PUR A;  4YHJ A;  2X68 A;  4I43 B;  5GON E;  4ILB A;  2CE7 A;  2FBW A;  3TLU A;  2VVN A;  1XMQ T;  2H7V C;  2QVA A;  2E5L T;  4YHH T;  4DV2 T;  3C4W A;  2HN2 A;  2OV9 A;  2WDV A;  1ZEE A;  3AEC A;  4P0A A;  5FXV A;  2WAU A;  3RHW A;  4O4H E;  4H9O C;  2WBL A;  4DV3 T;  2UXD T;  1U5P A;  4JI8 T;  3JC6 D;  3CML A;  4AKR B;  1VRB A;  3PV0 F;  5JTG A;  5HCJ A;  4IE7 A;  5JDG A;  2V7L A;  1T72 A;  1NWM X;  2ZLY A;  3TLS A;  1YXR A;  3ZC0 A;  5JH7 E;  2BKP A;  4IDN A;  4KP3 C;  1Z0P A;  3TLT A;  1BR2 A;  3HI2 A;  4LML A;  5L3F B;  2XAS B;  2UXN B;  3CPZ A;  3FBZ A;  4X65 T;  4DBQ A;  2UXC T;  4MBQ A;  1XNR T;  5T1D A;  2UUA T;  3P50 A;  2KBB A;  2YDR A;  4BJM A;  2AXD S;  3KBT A;  3O9X A;  3ONL C;  2J4G A;  4JUY A;  5FVL A;  3H3A A;  4B6X A;  4DR2 T;  4F8H A;  4IE0 A;  1X79 A;  2HN1 A;  4P1N A;  2D5U A;  3JAE A;  2DLR A;  2NW8 A;  4H63 V;  4ISS A;  2WU5 A;  5IWA T;  3UT5 E;  2K3W A;  2WMN A;  2YK0 A;  2YN6 A;  4MAL A;  4DVD A;  1UX5 A;  4F7G B;  2XPK A;  2WWV A;  4NXN T;  1HG2 A;  2EHO C;  5LJM A;  2BG9 C;  2ZMA A;  4O4I E;  1WR0 A;  2A3D A;  4U7Y A;  1MMD A;  3OJA A;  1OED B;  2JMK A;  1IJ6 A;  2PG8 A;  3PUZ F;  5FNV E;  2NTY A;  3EAM A;  3LJC A;  4UXN B;  2Q9Q C;  4Q25 A;  5FKY A;  3VR8 A;  2E9X A;  5M4Y A;  4JI7 T;  4LF4 T;  1N33 T;  4AKI A;  3Q5D A;  1T8B A;  3LFM A;  3PTR B;  3UQ7 A;  5CJ5 A;  3EI0 A;  3O1J A;  3RH3 A;  1IAP A;  4CXW A;  4CN6 A;  2NR4 A;  2DHR A;  1CUN A;  3A8Y C;  3AA7 B;  3CWZ B;  2CXD A;  4TV8 E;  4WBO A;  3AEE A;  5HEO A;  2KT9 A;  5LGN B;  3ANW B;  3VKH A;  1VOM A;  4W8P A;  1MIV A;  4IDO A;  4TN7 B;  4GYS A;  3E22 E;  3SS1 A;  2K24 A;  2X0C A;  3QK6 A;  1KFY A;  2W2U A;  3JC6 C;  4HWH A;  5DQV A;  3ABV A;  4FI5 A;  4PJN A;  3X1D A;  5KXJ A;  3FB2 A;  2K5B B;  3MAC A;  4ZHQ E;  3DJB A;  5ABF A;  4QX8 B;  4ZXL A;  1ZKE A;  5TAO A;  2YDQ A;  1YD8 G;  3UUN A;  2W00 A;  4B3R T;  4IT4 A;  5FY0 A;  3NWI A;  3ZT5 A;  3P4S A;  5FL0 A;  3ZMT B;  2WSS V;  2PBI A;  4DV4 T;  3UUM A;  4JEH B;  5FMN A;  2CPT A;  2E2A A;  2W62 A;  3TKL B;  1Y01 A;  2K48 A;  3AEB A;  1BR4 A;  4X1Y E;  4ZS2 A;  3FHN A;  2Q9Q B;  3EUH A;  3PUA A; 
#chains in the Genus database with same CATH homology
 1SA0 E;  5L3D B;  4IDZ A;  3F57 A;  2ES0 A;  3C51 A;  3F31 A;  2DI4 A;  5JDQ A;  4QX7 B;  2B1E A;  2VWA A;  1FMV A;  3HKE E;  4L0R A;  2L9Q A;  4OK0 A;  2YU2 A;  1HTJ F;  2OA5 A;  2LQU A;  2VKO A;  5HAX A;  2BVM A;  2KIN B;  2Z6E A;  2I59 A;  3UUX B;  3ZCJ A;  4UVB B;  2ZM0 A;  4ZI3 D;  4H63 H;  2LEH A;  1H7C A;  4MLK A;  2RA1 A;  3PE0 A;  1LVK A;  1LVF A;  5A1L A;  2J1D G;  2JQQ A;  3LBX A;  4KBM B;  2N2N A;  3ZPO A;  3BQK A;  4C90 A;  4GK0 E;  3B57 A;  4HEA A;  4AXP A;  2V7M A;  4OYK A;  2HH7 A;  2IC6 A;  3PUG A;  5HXC A;  4DND A;  4EB6 E;  4EYY R;  3WSC A;  4GOU A;  3NZP A;  2MOZ A;  3HKC E;  1SHZ C;  3C64 A;  3CX7 B;  1FMW A;  1U4Q A;  2V7K A;  3KVB A;  2CLY C;  3L09 A;  4QHO A;  2DCF A;  1YW0 A;  5EZY E;  3LG7 A;  4WNK A;  2VAS A;  3U3I A;  5LNK A;  5DJQ C;  2LSK A;  4GK5 E;  1QUU A;  1KNZ A;  1MMA A;  3KVA A;  3IBP A;  3ZLI A;  5LGT B;  4AQF C;  4HKA A;  4O2A E;  1G73 A;  5HXS A;  4N78 D;  1NAF A;  4TX5 A;  3N9O A;  3IF8 B;  4IGU A;  2E8I A;  4U74 A;  2NP9 A;  2X9X A;  1MMN A;  5IHY A;  3ZCI A;  1HG5 A;  4BGO A;  3P7I A;  2Q9Q A;  3RKO A;  5KX5 E;  3KFW X;  4H9N C;  3HKB E;  4IE6 A;  4BJN A;  4DBR A;  4AQF A;  3PU3 A;  2G0U A;  3EDV A;  3KV4 A;  3Q5X A;  3UUL A;  1V9D A;  4AQG A;  4HGA A;  4ASK A;  4GYR A;  4Z8X A;  2N1G A;  4TZ4 C;  1IZN B;  4EZ4 A;  3O1H A;  1OXZ A;  3GMI A;  4EXT A;  3LK3 B;  3J9X 1;  1UX4 A;  5L3G B;  2C0S A;  3LBX B;  2XQY A;  3OYZ A;  5H6R B;  2IC9 A;  5JRC A;  2C5I T;  3C4X A;  4F6R C;  3K3N A;  5CA1 E;  2V7J A;  3WAJ A;  2QA7 A;  4OHF A;  4PJL A;  1S94 A;  2LOP A;  3RYC E;  5FY7 A;  1MNE A;  4QXH B;  2NW9 A;  1HS7 A;  3ETU A;  5FYM A;  3SOL A;  3CQX C;  2X9W A;  3ZJ1 A;  2ZM2 A;  1WLX A;  5AFU L;  4CI2 B;  3L3P A;  2LOS A;  4DMW A;  3VJZ A;  3GN5 B;  1G8X A;  4QKN A;  4X1I E;  4XBF B;  2D0T A;  4ZI3 C;  2YU1 A;  5L2L A;  4H9Q C;  4UV9 B;  5JR9 C;  4EOZ B;  4PAG A;  2Y48 B;  2X51 A;  2NTX A;  4ANJ A;  2LE8 A;  4XAX B;  2C5K T;  2RP4 A;  4AI6 A;  3IEE A;  5J1G A;  3MXZ A;  3ETV A;  2CMR A;  2KND A;  3AA0 B;  3R84 B;  3ZMZ B;  3I9Y A;  3O1I A;  1BR0 A;  4EIW A;  2YEV C;  3MA9 A;  5FXZ A;  3DTO A;  4PJM A;  1LRZ A;  2EHO B;  5JR9 A;  5JDL A;  3FBL A;  3ZYK A;  4KUM B;  4H9S E;  1BR1 A;  5JQG E;  3C50 A;  2XAJ B;  5IYZ E;  2YIN A;  4KMC A;  4UV8 B;  5L3E B;  4GIW A;  5EK2 A;  3QUJ A;  5HWY A;  3T8O A;  1D0Y A;  3A5X A;  1ZHC A;  4YLH A;  4HE8 A;  3C98 B;  3AVR A;  4OYJ A;  2N9D A;  3GA8 A;  5CB4 E;  4EZH A;  4C91 A;  2LHN A;  4PFP A;  3KDS E;  1ZV4 X;  2CLY B;  5LHH B;  2JRK A;  4WW0 A;  3ESL A;  4IHJ E;  3SWH A;  4UEM A;  4YJ2 E;  4X1K E;  3RRC A;  5HWX A;  3AVS A;  3ZN1 B;  4TV9 E;  4CI3 B;  2DNX A;  2CWY A;  4MFR A;  4OFZ A;  5DQW A;  4CI1 B;  4QWN B;  3P8C D;  5BMV E;  5LHG B;  5E0O A;  1YKH B;  5JDF A;  4I55 E;  2IW5 B;  2KLQ A;  3RRW A;  3HL6 A;  3N2K E;  2BVL A;  5LGU B;  2WWU A;  2LM9 A;  3W15 B;  3K8P C;  5HYA A;  4PNI A;  4V1A v;  4QXB B;  4ILU A;  1WR6 A;  3NRX A;  1MIY A;  4P0B A;  4ADZ A;  3Q9D A;  1KK7 A;  4XZC A;  3ZYM A;  4PFO A;  2DWK A;  1D1B A;  4YJ3 E;  3SRZ A;  3KV9 A;  3OYX A;  3PUS A;  5L3C B;  1HF8 A;  3HR0 A;  5CA0 E;  4IIJ E;  2BDE A;  1MMG A;  3F2E A;  4AKL A;  2CXL A;  5KMG P;  5LXT E;  2W61 A;  5EK4 A;  2ODV A;  2UXX B;  3CX6 B;  5LCY A;  3J7Y q;  4O2B E;  5C8Y E;  1AJ3 A;  4IE4 A;  4O8S A;  2W63 A;  3VHL A;  4G2A A;  4CXX A;  2CA5 A;  1FEW A;  3EVY A;  3MJX A;  4UF0 A;  2C5J A;  3AAI A;  3N9N A;  3ZJ2 A;  2XTL A;  5LP6 E;  1Y64 B;  2XAG B;  5FXW A;  4L5G A;  3OBV E;  1EZ3 A;  2X67 A;  4P09 A;  3WUR A;  3MKD A;  4YFS A;  2WMO A;  5LHI B;  2V7I A;  3ZMS B;  3DP7 A;  2ZM8 A;  2K9A A;  2PJQ A;  3HKD E;  2VB6 A;  3PDY A;  4HTE A;  4K0U A;  4QXC B;  5H6Q B;  2XHE B;  5LBM A;  4DO0 A;  5JVD E;  4ZOL E;  4PK5 A;  3K3Q C;  2JJ9 A;  2NWB A;  4HFV A;  2LHR A;  2W0G A;  4CXY A;  3NRY A;  4JEU B;  4ZI2 D;  4UF0 B;  4CZZ B;  2CM0 A;  3I9W A;  2V1D B;  4ERR A;  4NUV A;  3ZC1 A;  1FIO A;  2QGS A;  5LJN A;  3ZMV B;  1D1C A;  5J2T E;  3N2O A;  2NOX A;  4BA9 A;  2BZB A;  5HXH A;  2GK9 A;  1WYB A;  4ZS3 A;  2A72 A;  2IAK A;  2VL8 A;  3WAK A;  3RYF E;  3AA6 B;  2SPC A;  3RC3 A;  4I4T E;  2HPJ A;  4PJJ A;  5JRE A;  2X66 A;  2X9H A;  3GN5 A;  4JLE A;  3UTK A;  3N9P A;  1MND A;  2LJL A;  2LSY A;  3BQL A;  5L3B B;  3I0O A;  4L9I A;  3Q5W A;  3CQC B;  3IHR A;  2CXF A;  3AB3 B;  2EHO A;  5JR9 B;  4IE5 A;  4IST A;  4AKG A;  3ZMU B;  4BAY B;  3KBU A;  2MYS A;  4E7S A;  4DMV A;  2NW7 A;  3FXE B;  2ODU A;  5JDN A;  2P9B A;  2H3R A;  4O4J E;  2LSI A;  3N2G E;  4G63 A;  1HFA A;  2WM9 A;  2H7O A;  3EDU A;  3OKQ A;  2E9X B;  2X9Y A;  4EYU A;  4ZI2 C;  5J2U E;  3BQI A;  2X0L B;  2VKH A;  3RYI E;  1WYC A;  2E9X D;  2KWI B;  2L3L A;  3ONX A;  4ECG A;  2XAH B;  4UVA B;  2JPF A;  2KZ7 B;  2LSJ A;  3AAA B;  3C4Z A;  3D0T A;  3I1A A;  4CQI A;  3V5U A;  1B7T A;  5F8P A;  1D0Z A;  4M1P A;  1D0X A;  1MIW A;  4J2C A;  4EAH A;  3ZN0 B;  3RYH E;  2KXP B;  2XUE A;  3NZQ A;  5LA6 E;  2PFV A;  3VKG A;  4HN9 A;  2L8K A;  4FJO A;  3U78 A;  5FP3 A;  5F3J A;  5JRC B;  2HPL A;  3NBX X;  3BK9 A;  3MZK B;  4WBN E;  5DAB A;  2XAQ B;  1LKX A;  3N9Q A;  3WI3 A;  3E08 A;  2D0U A;  2D2S A;  3LK2 B;  1E1H B;  3N9L A;  3PHF 1;  5ADX L;  2CEA A;  3AT7 A;  3PUQ A;  1O3X A;  4H9P C;  3O4X E;  3R6N A;  5HXR A;  3CX8 B;  3M1C A;  4UIG A;  4PK6 A;  4TUY E;  5HXE A;  1QSD A;  5FY1 A;  3Q2M A;  3CQG B;  2DWG A;  2EHO D;  2CCQ A;  3N9M A;  2Y8D A;  4UEL A;  1YKE B;  5FXX A;  1D1A A;  2E9X C;  4I50 E;  2Q9Q D;  3V5S A;  2MTQ A;  3GWH A;  2LSG A;  3RX6 A;  2VKD A;  4PW8 A;  5ETW A;  2ACX A;  4X20 E;  5LG4 A;  1S35 A;  3PF0 A;  1WRD A;  2JMH A;  3CKD A;  3LK4 2;  3N5L A;  3K3O A;  3RPU A;  4NUU A;  1T98 A;  2Y6X A;  3KV6 A;  2MTC A;  5KDM C;  2XAF B;  1UCU A;  1HCI A;  3QC9 A;  5LYJ E;  4AKH A;  4E7Z A;  4A56 A;  2A2F X;  3AA1 B;  3E0Z A;  5LBQ B;  3HA4 A;  4ZI7 E;  5LOV E;  3B13 A;  1OWA A;  2LT3 A;  3MK7 C;  2MBG A;  3ZYL A;  3RC8 A;  2VKJ A;  4U72 A;  3ZEF B;  3M65 A;  3S4U A;  2V26 A;  5EK3 A;  4UVC B;  3CVR A;  4MHC A;  4PK4 A;  2CWO A;  5JDM A;  2VK9 A;  3AAE B;  3ANW A;  1US7 B;  3H37 A;  1HX8 A;  2M67 A;  3FXD B;  3PU8 A;  3UFE A;  3KIN B;  3KV5 A;  2KMF A;  4H9R C;  3I0Q A;  1IJ5 A;  4O4L E;  3VU7 H;  5JDH A;  2KWH A;  4I43 B;  4YHJ A;  3PUR A;  2X68 A;  5GON E;  2CE7 A;  2H7V C;  3C4W A;  4P0A A;  1ZEE A;  5FXV A;  2WAU A;  4O4H E;  4H9O C;  2WBL A;  1U5P A;  3JC6 D;  3CML A;  4AKR B;  1VRB A;  5JDG A;  4IE7 A;  2V7L A;  2ZLY A;  1NWM X;  3ZC0 A;  5JH7 E;  4KP3 C;  1Z0P A;  1BR2 A;  3HI2 A;  5L3F B;  2XAS B;  2UXN B;  3CPZ A;  3FBZ A;  4DBQ A;  4MBQ A;  5T1D A;  4BJM A;  3KBT A;  3O9X A;  4JUY A;  4B6X A;  3H3A A;  4ONR A;  4IE0 A;  1X79 A;  2D5U A;  4ISS A;  2DLR A;  2NW8 A;  4H63 V;  3UT5 E;  2WMN A;  2YK0 A;  4MAL A;  4DVD A;  1UX5 A;  1HG2 A;  2EHO C;  5LJM A;  2ZMA A;  4O4I E;  2A3D A;  1MMD A;  3OJA A;  2JMK A;  1IJ6 A;  2PG8 A;  5FNV E;  2NTY A;  3LJC A;  4UXN B;  2Q9Q C;  5M4Y A;  2E9X A;  4AKI A;  3LFM A;  3PTR B;  3O1J A;  3RH3 A;  1IAP A;  4CXW A;  2DHR A;  1CUN A;  3AA7 B;  3CWZ B;  4TV8 E;  2CXD A;  4WBO A;  5LGN B;  2KT9 A;  3VKH A;  3ANW B;  1VOM A;  1MIV A;  4TN7 B;  4GYS A;  3E22 E;  3SS1 A;  2K24 A;  3QK6 A;  3JC6 C;  5DQV A;  4FI5 A;  4PJN A;  3FB2 A;  2K5B B;  3MAC A;  4ZHQ E;  3DJB A;  4QX8 B;  1ZKE A;  5TAO A;  1YD8 G;  3UUN A;  2W00 A;  5FY0 A;  3ZMT B;  2WSS V;  2PBI A;  3UUM A;  4JEH B;  5FMN A;  3TKL B;  2W62 A;  4X1Y E;  2K48 A;  4ZS2 A;  1BR4 A;  3FHN A;  2Q9Q B;  3EUH A;  3PUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...