5HXRA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 10mm ca2+
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
300
structure length
293
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
total genus 121
structure length 293
sequence length 300
ec nomenclature
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hxrA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hxrA02
3V5SA 5HWYA 5JDMA 3V5UA 5HWXA 5JDGA 5JDFA 5HYAA 5JDHA 5HXRA 5JDNA 5HXEA 5JDLA 5HXHA 5HXCA 5HXSA 5JDQA
chains in the Genus database with same CATH superfamily
1HNXT 5ABHA 2WY2A 3H3AA 4YLHA 3F2EA 1HR0T 2BDEA 3ESLA 2XZEA 2M67A 4CXXA 1D1CA 4JV5T 1IJ6A 3UU8A 2LQUA 3PHF1 4DV7T 2ACXA 2WMOA 1LRZA 3K3QC 3K1SA 2JQQA 4B6XA 4O2BE 4GYSA 3LK42 3C50A 3ZCIA 3PU3A 2V5CA 2IMLA 2JPFA 5JR9B 2XQ9A 4IE0A 1KNPA 2CA5A 4DR5T 4UV8B 4HFCA 3CX7B 3DJBA 4P0BA 4I0UA 4ILAA 4JI3T 2DWKA 4ZOLE 3NWIA 5FXWA 3EDUA 5FXXA 2KINB 1WFDA 5AQQB 3NKZA 3W15B 2NW8A 1IAPA 3MXZA 2M6BA 4NUVA 3I1AA 2LOSA 1WLXA 1MIYA 1W0BA 2MTCA 3OTOT 4KHPT 4YHJA 4ERRA 2UXNB 2CWOA 4LMJA 4TWDA 4Z91A 3E0ZA 3Q5WA 2K48A 4QH5A 5L4HA 4MFRA 2FJBA 5HXSA 4HN9A 4UEMA 3T8OA 2B1EA 4ISTA 4XAXB 4HFBA 2P9BA 5L3DB 4P0AA 5HWYA 2WZIA 5HCJA 3AA6B 3CMLA 5HEHA 2YOEA 3FHNA 2KSRA 2WU2A 2IDOB 1WRDA 3UUNA 5AQNB 3RHWA 3O1JA 1H7CA 4EEBA 4QKNA 4ILUA 2WCAA 3JCFA 1MNDA 2XM2A 4PNIA 1NWMX 5FY0A 4AIUA 3ANWB 3I0OA 2KZ7B 3DTOA 3N5LA 3R6NA 1VCTA 4LF7T 3T1HT 3CK6A 3MA9A 3AEDA 5GONE 1KF6A 1OWAA 5FXVA 3RPUA 5LBMA 3VHLA 2K24A 5F5WA 4WNKA 3NRXA 2QA7A 2D0UA 3P7IA 2W0GA 5CA1E 2F4VT 1ZKEA 3KFWX 2LKGA 2KWIB 3BK9A 2CHNA 2DNXA 1QLBA 5LYJE 5FXZA 5AFUL 1WYCA 2H7VC 3KV4A 1MIWA 3NRYA 4B3MT 4YTMA 3CPZA 2WAUA 4EGWA 1NAFA 4B3RT 2ZM8A 4PK6A 1HFAA 2MOZA 1N32T 3SFDA 4Z90A 4UXNB 4CI1B 2JMKA 3CQGB 3EAMA 5LHHB 2XSBA 4IL9A 5BMVE 5HXHA 3UFEA 3RQWA 4YJ2E 4LFCT 4IE6A 2XASB 2W63A 1HX8A 4HFDA 4ZHQE 2VKDA 3JC6D 3ZCJA 2CLYC 3B5MA 3UU6A 1D0XA 3NZQA 3QK6A 5KX5E 3M65A 5AQMB 2E2AA 4JI7T 4I50E 3RYFE 4UVAB 2IUBA 2C5IT 3Q9DA 4LMKA 4DVDA 4U3CA 3O1HA 3VU7H 2CEAA 2CXDA 1B7TA 2XAHB 2EHOB 4EEDA 1HG2A 4TWFA 3AEBA 3TKLB 2CWYA 4CZZB 4IIJE 2KLQA 3HR0A 3L09A 4O4LE 1L0VA 1IBMT 2MYSA 4XBFB 1HNZT 4EYUA 3FBZA 1ZOYA 4DIDB 4PW8A 3M3ZB 3HKBE 1IJ5A 1BR2A 3IHRA 3JAEA 4AKRB 2VL8A 4OFZA 3QNUA 5LHIB 3M1CA 2UXDT 1MMNA 5ABFA 1X79A 2W66A 4KHZF 4DR7T 2V7MA 4NXMT 5FY7A 1HTJF 3I9YA 2HN2A 4DV2T 4CI2B 4DV6T 3R84B 3CQCB 5L3CB 5TAOA 3MJXA 4OYKA 5HEUA 5ADXL 2IAKA 5A1LA 3A5XA 3FB2A 4IE7A 1VCSA 3FZMB 5AQTB 3DYJA 4TNWA 4H9PC 4CN6A 2V7LA 2ZMAA 1KNZA 2WWVA 5CA0E 4DBQA 4QXHB 2BS3A 2BVLA 2IC9A 4MBQA 4GYRA 3UUMA 2VWAA 3O1IA 3D0TA 3ZMUB 3TLVA 4EOZB 1D0ZA 4IHJE 5LG4A 2VKHA 4DR2T 3UUXB 4DR4T 1Y64B 3N9QA 2CXFA 4HFVA 4H9RC 2D5UA 3RKGA 1D1AA 5L3EB 4KMCA 3T1YT 2XAJB 5JR9C 1W0AA 3AE5A 3AE1A 3N9MA 2C5KT 3RH3A 4UF0A 2W62A 5JDGA 4TN7B 2E9XA 3HA4A 4TV9E 1QSDA 2SPCA 2B76A 4WYVA 1N36T 4E7SA 2LE8A 5JDNA 2BG9B 2X67A 3PE0A 2H3RA 4BA9A 3AEAA 4A98A 4JI6T 5AQSB 2MPKA 4HWHA 4HWIB 2JRKA 5LCYA 2D2SA 2Q9QA 4UVBB 4BAYB 5IWAT 1YW0A 2CM0A 4X1KE 2MBGA 5KXJA 2YKSA 3V5UA 5HEJA 1D1BA 4PFPA 4X64T 3FXEB 3ETUA 4TUYE 2W2UA 2XQ5A 3N9NA 3SWHA 2WP9A 1SA0E 3RC3A 1MNEA 5LJNA 1T98A 3P4PA 2ES0A 4KX6A 4IE4A 3VRAA 1UGOA 3F31A 3ZKRA 3VKGA 2WB5A 4H9OC 4P1NA 1GQEA 1UX4A 3WAJA 4DR1T 2DWGA 3KBTA 3AY5A 3AXJA 1W09A 5CGMA 3CWZB 2Y8DA 5LB7B 3LDQB 5F3JA 3ZPOA 1MMGA 1NEKA 4QH1A 3VR9A 4K0UA 1KEYA 2VKOA 3CX8B 3LSVA 3B57A 2CBIA 1OEDA 4HEAA 4IT4A 2BZBA 4A5XA 3ONXA 3KDSE 1HCIA 2YEVC 3LBXA 5JRCA 4H63H 2A2FX 4Z8XA 2PBIA 5JDQA 4X20E 3UTKA 2RPAA 1US7B 3RIFA 5FP3A 2UUBT 2V6YB 2HPLA 2NWBA 5H6QB 4PJJA 1NENA 4B3TT 2NTYA 4CN1A 3EI0A 4ZI2D 2WZHA 4ASKA 2IHR1 4PK5A 4AQGA 2LLYA 2JJ9A 5DJQC 4OX9T 4GK0E 4YJ3E 5HEGA 4L0RA 3TLTA 4H9NC 1WR6A 2YDSA 3EVYA 4C90A 2OV9A 4CN4A 5JQGE 4X66T 5HXEA 2K9AA 2K5BB 2FJDA 4EAHA 3U78A 4EYYR 5AQGB 1SJ7A 5AQKB 5EK2A 2LJLA 3PF0A 1BR4A 5JREA 1FIOA 4YHHT 4QX7B 3AT7A 4DNDA 3KVBA 2DL1A 3ZMVB 1XMOT 2KBBA 5C8YE 5FMNA 1HX1B 5LMUT 4A56A 4WBNE 2XY8B 5AQUB 4U31A 4ANJA 5FNVE 4YSXA 3AE7A 1M62A 4DMWA 2VVSA 3PUWF 4J2CA 4CQIA 2XTLA 2KXPB 1G73A 1XMQT 5LBQB 2VKJA 4WBOA 4C91A 2EHOC 3JC6C 2BG9E 4HE8A 4KI0F 3ZC1A 3P4SA 4U2ZA 4JI4T 5KMGP 2N9DA 5LGTB 2BBHA 2XQ4A 4TZ4C 3H37A 5FZTA 4U7YA 3C4XA 2K3WA 3RRWA 3UUBA 4UIGA 3RI5A 5L3GB 1IZNB 4JI2T 1UCUA 5LHGB 3U3IA 4X1IE 1QUUA 2XJ7A 5JR9A 5LP6E 5AQJB 5HWXA 4TX5A 4JI0T 3RQUA 5F8PA 3OBVE 3K3NA 3P8CD 4XZCA 3L39A 2J47A 4BGOA 3PUVF 2E5LT 3UU5A 2L9QA 1LVKA 2BBJA 2IC6A 2PFVA 1V9DA 3VRBA 3IEEA 4GKJT 3VJZA 2LSJA 2E5VA 3FZHB 5JTGA 2FJEA 4JEHB 2LSYA 3B13A 2LSIA 2X68A 4YTNA 4HTEA 4NUUA 4V1Av 3V5SA 2R6GF 2KVPA 2CRBA 5J2UE 3K8PC 1SHZC 4DO0A 4FJOA 4F7GB 3AE8A 3RYHE 2W00A 1BR0A 3QC9A 3KV9A 1YQ4A 2X9HA 2BS2A 4JI1T 2UU9T 4ADZA 3FYQA 5ABFB 3IA3A 2KWHA 3N2KE 4H9SE 5L2LA 2OLTA 4AI6A 1N34T 3P50A 3JAFA 2UXBT 3FZLB 3AEFA 1XDOA 4KUMB 1VRBA 5DQVA 5LJMA 3ZMZB 2BG9C 2JMHA 3AVRA 2WWUA 5LOVE 3KINB 4ZXLA 3ZMSB 4HWFA 3VKHA 4H63V 4U72A 4PJLA 4ZI3D 2CE7A 3ZEFB 1FMWA 4IL4A 3QUJA 4DV4T 5JDMA 2LRKA 4ZZCA 3RIUC 4AKIA 3LK2B 3HKEE 2E9XD 1T7SA 3AE9A 3AVSA 2X9WA 2LOPA 4OHFA 2X0CA 3QOFA 1J5WA 2HH7A 4IDZA 3RX6A 4O8SA 2YINA 3ZYKA 2LEHA 4EV6A 3RGLA 1KFYA 2Q9QD 2E9XB 2VASA 4PAGA 3RC8A 3GN5A 4AXPA 2VVNA 4PJMA 2WQYA 2XAFB 3TLWA 4ECGA 2UXXB 3CQXC 3UU4A 2W61A 4BJMA 4TWHA 2LT3A 4HFEA 2PJQA 5L4EA 3RIAA 2CPTA 2PG8A 4B3ST 2WSSV 3WURA 2Q9QB 3PUZF 2UUAT 3SS1A 3ETVA 4W8PA 2WS3A 1ZP0A 3WAKA 5L47A 4O4IE 3UULA 4ZS3A 5LNKA 4JEUB 4UR9A 3JADA 1S94A 2CCQA 5AQFB 5EZYE 2X0YA 2X0HA 2GK9A 4G63A 1R8IA 2H7OA 4MHCA 1ZV4X 3ZT6A 2EHOA 1SUMB 4FI5A 2IW5B 4GK5E 2M6IA 3AXJB 3OPCA 4IDOA 4DV3T 4OK0A 2XQ8A 2WBLA 3AAIA 4AISA 5IUXA 1YKHB 3PUSA 2QRXA 4EXTA 4EIWA 5HEOA 5IYZE 2NTXA 3PUQA 1WYBA 1X9BA 2CHOA 3ZC0A 1OEDB 2ZLYA 2NW9A 1UX5A 2HPJA 2L3LA 3PJAJ 2I59A 3LBXB 1CUNA 2I6HA 2XQAA 3X1DA 4U2YA 3SRZA 2LKHA 4YY3T 2FUPA 1Z8UA 5FVKA 3A7MA 5EK4A 4PFOA 5AQIB 1VOMA 2BVMA 2JQKA 3ZYLA 1YQ3A 3AE3A 2VURA 3QB5K 4AKLA 4G2AA 1WCRA 3RRCA 2G0UA 3ZLIA 5DABA 3LK3B 3K3OA 2KMFA 1HG5A 2KT9A 4JI5T 1HF8A 3J9X1 4UV9B 2MAWA 2YDQA 5C3JA 2H88A 3PV0F 1XNRT 2L10A 4MALA 4U33A 3LG7A 2WDRA 4NPPA 5BR8T 2BKPA 3AECA 3UQ7A 4GOUA 4QXCB 5AQOB 2N2NA 3Q5XA 5HXRA 3F57A 3GMIA 4ZEYA 2CXLA 2BS4A 3BQKA 1O3XA 3CVRA 3C98B 1IBLT 2XPKA 1D0YA 2W4XA 4AKHA 4JI8T 3UU3A 3P4WA 2XSAA 4X5TA 1T72A 3PTRB 5M4YA 4HFHA 3L3PA 4CI3B 2UXCT 2NW7A 2J62A 2XQYA 4ZZBA 4HGAA 3H3MA 2V7IA 1YKEB 2BG9A 4TNVA 5T1DA 4EZ4A 3EDVA 2YU2A 5HCMA 1SJ8A 1W9RA 3IF8B 2V8SV 3HL6A 1UURA 3SOLA 5JDHA 1E2AA 3HKDE 2NOXA 3FXDB 4IDPA 3C51A 4L9IA 3RIUA 4WZXA 1J5ET 4UELA 4EZHA 3ONLC 4KP3C 5JDFA 4ILBA 4JYAT 5CFBA 5JDLA 5JVDE 4CXYA 1U5PA 3E22E 4AQFC 3I9WA 4QX8B 2XAGB 5FYMA 4DV0T 4ZI7E 3Q2MA 3AA0B 1KNRA 5FL1A 4LFBT 4O4JE 2LSKA 3AAEB 3MACA 5HXCA 4O2AE 2LRLA 4M1PA 2XQ7A 4P09A 2VQET 2N1GA 3OJAA 1I6ZA 2RA1A 4DR6T 3GA8A 3N9LA 5LA6E 3EUHA 2LHNA 4OYJA 3AE2A 1OEDE 2C5JA 5KDMC 3ZSTA 4CXWA 2VL0A 4DMVA 3OYZA 2L7NA 3IBPA 2HHHT 1I94T 5FY1A 3DP7A 2V6YA 4HFIA 4ZI3C 1FJGT 1SE7A 1J1JA 4YSYA 3PUYF 3RYCE 1UK5A 4GKKT 2QYWA 1Y01A 2DHRA 3AE4A 5LMNT 5L3FB 2PTFA 2ZM0A 2V7JA 2E9XC 3PU8A 5AQLB 3C4WA 5LGNB 5FL0A 4L5GA 2FJAA 4EB6E 4QHOA 4QWNB 3AEEA 2DLRA 2V5DA 3RKOA 2VB6A 2Z6EA 5LXTE 5CJ5A 4LF5T 2BKNA 2ODVA 2Q9QC 4X65T 1MMAA 3EHZA 3N2GE 3UFGA 4I55E 3LJCA 5E0OA 2XQ3A 2KNDA 3AA7B 5HYAA 2C0SA 3Q5EA 4IGUA 4YSZA 4LF4T 1Z0PA 2V6XA 1DU2A 2CMRA 1CHUA 2X66A 3LFMA 3N9OA 3KV6A 2XAQB 3NVOA 2LM2A 3RYIE 4YT0A 2CBJA 3GN5B 3ZYMA 2KGXA 4HWDA 4LMLA 2HN1A 4QH4A 2WU5A 4PK4A 2D0TA 1S35A 2A72A 2YU1A 2A9UA 1MIVA 2AXDS 3KV5A 5IHYA 2WDVA 1OEDC 1XNQT 1YXRA 4DV5T 4U7IA 3MK7C 3QB5A 4ILCA 4YXDA 2FBWA 4Q25A 4AQYT 2NP9A 1FEWA 3J7Yq 3O4XE 1OXZA 3L8RA 2EHOD 3ANWA 3CIRA 3PUGA 2H89A 2A3DA 2J4GA 3TLUA 4DUYT 4IREA 3G06A 1HNWT 3ABVA 2LSGA 4IE5A 1ZEEA 3AB3B 3MKDA 3KBUA 1MMDA 3RF1A 1AJ3A 3E08A 2VQFT 3MZKB 3RLFF 3O9XA 2Y48B 4F6RC 2L8KA 4AKGA 2XQ6A 5J1GA 2YDRA 1JNRA 3KVAA 2NR4A 4A97A 1XWMA 4LF8T 2I0MA 4E7ZA 4UF0B 1HS7A 4JBWF 3ZJ2A 3HKCE 1FMVA 5AQPB 1ZHCA 1LKXA 3BQIA 3FZFB 2MTQA 3ZT5A 2ZM2A 5JH7E 3AEGA 1BR1A 4JLEA 4LF9T 4X1YE 1E7PA 3ZJ1A 3WSCA 5DQWA 1YD8G 5FKYA 5C2TA 3OYXA 5AQRB 4AQFA 5ABGA 5FVLA 5ABEA 3FZKB 2IIUA 4QXBB 3N2OA 2RP4A 2AE9A 3NBXX 2X9YA 3HI2A 5HAXA 4X62T 1N33T 3PUXF 1IBKT 2Y6XA 3WI3A 2ACZA 1KK7A 2LM9A 3P4QA 3AE6A 4DR3T 2XM1A 3OVUA 3OKQA 4YFSA 3UT5E 4K0KT 3BQLA 2BKOA 3ONJA 3PURA 2WDQA 4U74A 4H9QC 1EZ3A 1WR0A 5AQVB 2XHEB 4IDNA 4LFAT 4ISSA 2X0LB 4MLKA 5AQHB 3VR8A 2E8IA 1U4QA 2D9DA 4ZI2C 5H6RB 3Q5DA 1M7KA 3TLSA 4NIQA 1JNZA 4HKAA 2X9XA 5JRCB 5ETWA 4F8HA 1G8XA 2CLYB 5LGUB 4I4TE 4N78D 1XZYA 1E1HB 4UVCB 4LF6T 3SFEA 3ZN0B 4IDQA 3CKDA 3P4RA 2J1DG 4NXNT 5EK3A 4DBRA 3NZPA 3ZSSA 3AA1B 4WW0A 4KBMB 5L3BB 5LG3A 2YK0A 4JUYA 4ZS2A 4DUZT 2V7KA 2QGSA 4COFA 4HWCA 2XUEA 3PJAA 1XDPA 3ZT7A 3C64A 5J0ZA 2W67A 4DV1T 4I43B 3EABA 4PJNA 2QVAA 2DI4A 2JIWA 4GIWA 2DCFA 1LVFA 1UUSA 2V26A 5J2TE 2LHRA 4ONRA 1T8BA 4TV8E 3FBLA 2WM9A 4O4HE 3PUAA 2ZM6T 3N9PA 3AAAB 2ODUA 3ZN1B 3I0QA 3GWHA 3S4UA 3A8YC 3CX6B 4YTPA 2WMNA 3ZMTB 3UQ4A 3PDYA 2YN6A 2VK9A 2JQ9A 2X51A 3C4ZA 2V1DB 5CB4E 2JQHA 2OA5A 2UUCT 4BJNA
chains in the Genus database with same CATH topology
4H63V 2XAJB 5JR9C 4U72A 2DHRA 4PJLA 4ZI3D 3H3AA 3N9MA 4YLHA 5L3FB 3F2EA 2C5KT 2BDEA 2CE7A 2ZM0A 3RH3A 1FMWA 3ZEFB 2V7JA 3ESLA 2E9XC 3QUJA 2M67A 4CXXA 4UF0A 2W62A 1D1CA 5JDMA 5JDGA 3PU8A 1IJ6A 2LQUA 3C4WA 3PHF1 5LGNB 4TN7B 2ACXA 4AKIA 2E9XA 3LK2B 4L5GA 2WMOA 1LRZA 3HA4A 3HKEE 4TV9E 3K3QC 4EB6E 4QHOA 1QSDA 2E9XD 2SPCA 3AVSA 2X9WA 2LOPA 2JQQA 4OHFA 4E7SA 4QWNB 4B6XA 2LE8A 5JDNA 2DLRA 2X67A 3PE0A 2H3RA 3RKOA 4O2BE 2VB6A 2Z6EA 4GYSA 5LXTE 3LK42 4BA9A 3C50A 3ZCIA 3PU3A 2ODVA 2Q9QC 2HH7A 2JPFA 5JR9B 4IDZA 4IE0A 1MMAA 2CA5A 3RX6A 4O8SA 2YINA 2JRKA 5LCYA 3ZYKA 2LEHA 2D2SA 2Q9QA 3N2GE 4UVBB 4BAYB 4I55E 1YW0A 3LJCA 4UV8B 5E0OA 2CM0A 4X1KE 2MBGA 2Q9QD 3V5UA 2E9XB 2VASA 2KNDA 3AA7B 3CX7B 5HYAA 1D1BA 3DJBA 4PFPA 3FXEB 4PAGA 3ETUA 3RC8A 4P0BA 3GN5A 2C0SA 4TUYE 4AXPA 4IGUA 3N9NA 3SWHA 1Z0PA 4PJMA 2XAFB 4ECGA 2DWKA 4ZOLE 2UXXB 2CMRA 1SA0E 3RC3A 3CQXC 2W61A 5FXWA 2X66A 4BJMA 3EDUA 1MNEA 5LJNA 1T98A 2LT3A 3LFMA 5FXXA 2PJQA 2KINB 3N9OA 2PG8A 2ES0A 3KV6A 2WSSV 3WURA 2Q9QB 3W15B 4IE4A 2NW8A 1IAPA 2XAQB 3MXZA 3F31A 3VKGA 4NUVA 3I1AA 2LOSA 1WLXA 3ETVA 4H9OC 3SS1A 1MIYA 3RYIE 2MTCA 1UX4A 3WAJA 3GN5B 4YHJA 4ERRA 2UXNB 3ZYMA 2CWOA 2DWGA 3WAKA 3KBTA 3E0ZA 4O4IE 3Q5WA 2K48A 4ZS3A 3UULA 5LNKA 4JEUB 4MFRA 4PK4A 5HXSA 3CWZB 2Y8DA 4HN9A 2D0TA 1S94A 1S35A 2A72A 2YU1A 4UEMA 2CCQA 3T8OA 5F3JA 1MIVA 3ZPOA 3KV5A 1MMGA 5EZYE 2B1EA 4ISTA 4XAXB 5IHYA 2GK9A 4G63A 3MK7C 2P9BA 2H7OA 4MHCA 5L3DB 1ZV4X 4K0UA 2VKOA 4P0AA 3CX8B 5HWYA 3B57A 2EHOA 2NP9A 1FEWA 4HEAA 4FI5A 2IW5B 3O4XE 2BZBA 3J7Yq 4GK5E 1OXZA 3AA6B 3CMLA 2EHOD 3ANWA 3ONXA 3PUGA 3KDSE 1HCIA 2A3DA 2YEVC 3FHNA 3LBXA 5JRCA 4H63H 4OK0A 1WRDA 2A2FX 4Z8XA 2PBIA 3UUNA 5JDQA 2LSGA 2WBLA 3AAIA 4X20E 4IE5A 1ZEEA 3UTKA 1US7B 1YKHB 3AB3B 3MKDA 3PUSA 5FP3A 3KBUA 3O1JA 1H7CA 4EXTA 4QKNA 4ILUA 4EIWA 1MNDA 5IYZE 2NTXA 3PUQA 1MMDA 2HPLA 1AJ3A 1WYBA 3E08A 4PNIA 1NWMX 3ZC0A 5FY0A 2NWBA 5H6QB 3MZKB 2NW9A 2ZLYA 4PJJA 1UX5A 2NTYA 2HPJA 3O9XA 2Y48B 2L3LA 4F6RC 3ANWB 3I0OA 2L8KA 2KZ7B 3DTOA 4AKGA 5J1GA 3N5LA 2I59A 4ZI2D 3LBXB 3KVAA 4ASKA 1CUNA 4PK5A 3R6NA 4AQGA 3SRZA 2JJ9A 4E7ZA 3MA9A 4UF0B 5DJQC 4GK0E 1HS7A 5GONE 4YJ3E 3ZJ2A 3HKCE 1FMVA 4PFOA 5EK4A 1ZHCA 1LKXA 3BQIA 4L0RA 1VOMA 2MTQA 1OWAA 4H9NC 5FXVA 3RPUA 5LBMA 1WR6A 2BVMA 3EVYA 3ZYLA 4C90A 3VHLA 2K24A 5JQGE 2ZM2A 5HXEA 4WNKA 2K9AA 2K5BB 3NRXA 2QA7A 4EAHA 5JH7E 3U78A 4EYYR 2D0UA 1BR1A 4AKLA 4G2AA 4JLEA 3P7IA 3RRCA 2W0GA 5CA1E 2G0UA 1ZKEA 4X1YE 2LJLA 3KFWX 5EK2A 3PF0A 3ZJ1A 1BR4A 2KWIB 3BK9A 5DABA 1YD8G 5DQWA 1FIOA 3LK3B 3ZLIA 5JREA 3WSCA 2DNXA 3K3OA 5LYJE 5FXZA 2KMFA 5AFUL 1WYCA 2H7VC 3OYXA 4QX7B 3KV4A 4AQFA 1MIWA 1HG5A 3NRYA 3AT7A 4DNDA 2KT9A 3KVBA 3ZMVB 3CPZA 1HF8A 2WAUA 4QXBB 3J9X1 4UV9B 3N2OA 2RP4A 1NAFA 5C8YE 5FMNA 3NBXX 2ZM8A 2X9YA 4MALA 4PK6A 3HI2A 1HFAA 3LG7A 5HAXA 4A56A 2MOZA 4WBNE 4ANJA 5FNVE 2Y6XA 3WI3A 4DMWA 4GOUA 4UXNB 4QXCB 4CI1B 2JMKA 3CQGB 2N2NA 3Q5XA 5HXRA 1KK7A 2LM9A 3F57A 3GMIA 4J2CA 4CQIA 2XTLA 5LHHB 2CXLA 3BQKA 5BMVE 1O3XA 2KXPB 3CVRA 3C98B 3UFEA 5HXHA 1G73A 5LBQB 2VKJA 4IE6A 4YJ2E 4WBOA 4C91A 2EHOC 3JC6C 1D0YA 2XASB 2W63A 4AKHA 1HX8A 3OKQA 4ZHQE 4HE8A 3ZC1A 4YFSA 3UT5E 5KMGP 2N9DA 3PTRB 3BQLA 5LGTB 5M4YA 2VKDA 3JC6D 4TZ4C 3ZCJA 3H37A 2CLYC 3L3PA 1D0XA 3NZQA 3PURA 3QK6A 4CI3B 5KX5E 2NW7A 3M65A 4U74A 4H9QC 1EZ3A 3C4XA 3RRWA 4I50E 4UIGA 2XHEB 3RYFE 2XQYA 4HGAA 5L3GB 4UVAB 1IZNB 4ISSA 2X0LB 2C5IT 4MLKA 3Q9DA 2V7IA 1YKEB 2E8IA 1U4QA 1UCUA 5LHGB 4DVDA 3U3IA 5T1DA 3O1HA 4ZI2C 4EZ4A 3VU7H 5H6RB 4X1IE 1QUUA 2YU2A 2CEAA 2CXDA 3EDVA 1B7TA 2XAHB 2EHOB 3IF8B 3HL6A 5JR9A 5LP6E 3SOLA 5JDHA 1HG2A 3HKDE 4HKAA 3TKLB 2X9XA 5HWXA 4TX5A 2NOXA 5F8PA 5JRCB 5ETWA 3FXDB 3K3NA 3OBVE 3P8CD 2CWYA 4CZZB 4IIJE 2KLQA 4XZCA 3C51A 1G8XA 3HR0A 4L9IA 2CLYB 4BGOA 2L9QA 3L09A 2PFVA 1LVKA 2IC6A 4O4LE 1V9DA 5LGUB 2MYSA 4I4TE 4XBFB 3IEEA 4EYUA 3FBZA 3VJZA 4UELA 4N78D 4EZHA 2LSJA 1E1HB 4UVCB 4KP3C 3ZN0B 4PW8A 5JDFA 3HKBE 1IJ5A 1BR2A 3CKDA 3IHRA 4JEHB 5JDLA 2LSYA 5JVDE 2J1DG 4CXYA 1U5PA 4AKRB 5EK3A 2VL8A 3E22E 4OFZA 5LHIB 3M1CA 4AQFC 3B13A 3I9WA 4DBRA 2LSIA 2X68A 3NZPA 3AA1B 4WW0A 1MMNA 4KBMB 4QX8B 5L3BB 1X79A 4HTEA 4NUUA 4V1Av 2XAGB 2YK0A 5FYMA 3V5SA 4JUYA 4ZS2A 2V7KA 2QGSA 4ZI7E 2V7MA 3Q2MA 3AA0B 2XUEA 5FY7A 1HTJF 3K8PC 1SHZC 4DO0A 5J2UE 4FJOA 3I9YA 3C64A 4CI2B 4O4JE 2LSKA 3AAEB 3R84B 4I43B 3CQCB 3RYHE 3MACA 5HXCA 2W00A 5L3CB 4O2AE 5TAOA 3MJXA 4OYKA 4M1PA 4PJNA 1BR0A 5ADXL 3QC9A 2IAKA 4P09A 3KV9A 5A1LA 3A5XA 2N1GA 2X9HA 2DI4A 3FB2A 4IE7A 3OJAA 4ADZA 4GIWA 2DCFA 2RA1A 1LVFA 4H9PC 3GA8A 3N9LA 5LA6E 2V26A 2KWHA 3EUHA 2LHNA 4OYJA 5J2TE 2LHRA 2V7LA 3N2KE 4H9SE 4ONRA 5L2LA 2ZMAA 1KNZA 2C5JA 4TV8E 5KDMC 4AI6A 5CA0E 4DBQA 4QXHB 3FBLA 4CXWA 2BVLA 2WM9A 2IC9A 4O4HE 3PUAA 4MBQA 3N9PA 4GYRA 3AAAB 2ODUA 3UUMA 4DMVA 2VWAA 3ZN1B 3I0QA 3O1IA 3GWHA 3S4UA 3D0TA 3OYZA 3ZMUB 4EOZB 3CX6B 3IBPA 4KUMB 5FY1A 2WMNA 1D0ZA 1VRBA 3ZMTB 3PDYA 5DQVA 3DP7A 4IHJE 3ZMZB 5LJMA 5LG4A 2VKHA 4ZI3C 2JMHA 3AVRA 3UUXB 2VK9A 2WWUA 5LOVE 1Y64B 3N9QA 2X51A 2CXFA 3C4ZA 2V1DB 4HFVA 5CB4E 3KINB 4H9RC 2D5UA 2OA5A 3ZMSB 3RYCE 3VKHA 1D1AA 4BJNA 5L3EB 4KMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5S A;  5HWY A;  5JDM A;  3V5U A;  5HWX A;  5JDG A;  5JDF A;  5HYA A;  5JDH A;  5HXR A;  5JDN A;  5HXE A;  5JDL A;  5HXH A;  5HXC A;  5HXS A;  5JDQ A; 
#chains in the Genus database with same CATH topology
 1HNX T;  5ABH A;  2WY2 A;  3H3A A;  4YLH A;  3F2E A;  1HR0 T;  2BDE A;  3ESL A;  2XZE A;  2M67 A;  4CXX A;  1D1C A;  4JV5 T;  1IJ6 A;  3UU8 A;  2LQU A;  3PHF 1;  4DV7 T;  2ACX A;  2WMO A;  1LRZ A;  3K3Q C;  3K1S A;  2JQQ A;  4B6X A;  4O2B E;  4GYS A;  3LK4 2;  3C50 A;  3ZCI A;  3PU3 A;  2V5C A;  2IML A;  2JPF A;  5JR9 B;  2XQ9 A;  4IE0 A;  1KNP A;  2CA5 A;  4DR5 T;  4UV8 B;  4HFC A;  3CX7 B;  3DJB A;  4P0B A;  4I0U A;  4ILA A;  4JI3 T;  2DWK A;  4ZOL E;  3NWI A;  5FXW A;  3EDU A;  5FXX A;  2KIN B;  1WFD A;  5AQQ B;  3NKZ A;  3W15 B;  2NW8 A;  1IAP A;  3MXZ A;  2M6B A;  4NUV A;  3I1A A;  2LOS A;  1WLX A;  1MIY A;  1W0B A;  2MTC A;  3OTO T;  4KHP T;  4YHJ A;  4ERR A;  2UXN B;  2CWO A;  4LMJ A;  4TWD A;  4Z91 A;  3E0Z A;  3Q5W A;  2K48 A;  4QH5 A;  5L4H A;  4MFR A;  2FJB A;  5HXS A;  4HN9 A;  4UEM A;  3T8O A;  2B1E A;  4IST A;  4XAX B;  4HFB A;  2P9B A;  5L3D B;  4P0A A;  5HWY A;  2WZI A;  5HCJ A;  3AA6 B;  3CML A;  5HEH A;  2YOE A;  3FHN A;  2KSR A;  2WU2 A;  2IDO B;  1WRD A;  3UUN A;  5AQN B;  3RHW A;  3O1J A;  1H7C A;  4EEB A;  4QKN A;  4ILU A;  2WCA A;  3JCF A;  1MND A;  2XM2 A;  4PNI A;  1NWM X;  5FY0 A;  4AIU A;  3ANW B;  3I0O A;  2KZ7 B;  3DTO A;  3N5L A;  3R6N A;  1VCT A;  4LF7 T;  3T1H T;  3CK6 A;  3MA9 A;  3AED A;  5GON E;  1KF6 A;  1OWA A;  5FXV A;  3RPU A;  5LBM A;  3VHL A;  2K24 A;  5F5W A;  4WNK A;  3NRX A;  2QA7 A;  2D0U A;  3P7I A;  2W0G A;  5CA1 E;  2F4V T;  1ZKE A;  3KFW X;  2LKG A;  2KWI B;  3BK9 A;  2CHN A;  2DNX A;  1QLB A;  5LYJ E;  5FXZ A;  5AFU L;  1WYC A;  2H7V C;  3KV4 A;  1MIW A;  3NRY A;  4B3M T;  4YTM A;  3CPZ A;  2WAU A;  4EGW A;  1NAF A;  4B3R T;  2ZM8 A;  4PK6 A;  1HFA A;  2MOZ A;  1N32 T;  3SFD A;  4Z90 A;  4UXN B;  4CI1 B;  2JMK A;  3CQG B;  3EAM A;  5LHH B;  2XSB A;  4IL9 A;  5BMV E;  5HXH A;  3UFE A;  3RQW A;  4YJ2 E;  4LFC T;  4IE6 A;  2XAS B;  2W63 A;  1HX8 A;  4HFD A;  4ZHQ E;  2VKD A;  3JC6 D;  3ZCJ A;  2CLY C;  3B5M A;  3UU6 A;  1D0X A;  3NZQ A;  3QK6 A;  5KX5 E;  3M65 A;  5AQM B;  2E2A A;  4JI7 T;  4I50 E;  3RYF E;  4UVA B;  2IUB A;  2C5I T;  3Q9D A;  4LMK A;  4DVD A;  4U3C A;  3O1H A;  3VU7 H;  2CEA A;  2CXD A;  1B7T A;  2XAH B;  2EHO B;  4EED A;  1HG2 A;  4TWF A;  3AEB A;  3TKL B;  2CWY A;  4CZZ B;  4IIJ E;  2KLQ A;  3HR0 A;  3L09 A;  4O4L E;  1L0V A;  1IBM T;  2MYS A;  4XBF B;  1HNZ T;  4EYU A;  3FBZ A;  1ZOY A;  4DID B;  4PW8 A;  3M3Z B;  3HKB E;  1IJ5 A;  1BR2 A;  3IHR A;  3JAE A;  4AKR B;  2VL8 A;  4OFZ A;  3QNU A;  5LHI B;  3M1C A;  2UXD T;  1MMN A;  5ABF A;  1X79 A;  2W66 A;  4KHZ F;  4DR7 T;  2V7M A;  4NXM T;  5FY7 A;  1HTJ F;  3I9Y A;  2HN2 A;  4DV2 T;  4CI2 B;  4DV6 T;  3R84 B;  3CQC B;  5L3C B;  5TAO A;  3MJX A;  4OYK A;  5HEU A;  5ADX L;  2IAK A;  5A1L A;  3A5X A;  3FB2 A;  4IE7 A;  1VCS A;  3FZM B;  5AQT B;  3DYJ A;  4TNW A;  4H9P C;  4CN6 A;  2V7L A;  2ZMA A;  1KNZ A;  2WWV A;  5CA0 E;  4DBQ A;  4QXH B;  2BS3 A;  2BVL A;  2IC9 A;  4MBQ A;  4GYR A;  3UUM A;  2VWA A;  3O1I A;  3D0T A;  3ZMU B;  3TLV A;  4EOZ B;  1D0Z A;  4IHJ E;  5LG4 A;  2VKH A;  4DR2 T;  3UUX B;  4DR4 T;  1Y64 B;  3N9Q A;  2CXF A;  4HFV A;  4H9R C;  2D5U A;  3RKG A;  1D1A A;  5L3E B;  4KMC A;  3T1Y T;  2XAJ B;  5JR9 C;  1W0A A;  3AE5 A;  3AE1 A;  3N9M A;  2C5K T;  3RH3 A;  4UF0 A;  2W62 A;  5JDG A;  4TN7 B;  2E9X A;  3HA4 A;  4TV9 E;  1QSD A;  2SPC A;  2B76 A;  4WYV A;  1N36 T;  4E7S A;  2LE8 A;  5JDN A;  2BG9 B;  2X67 A;  3PE0 A;  2H3R A;  4BA9 A;  3AEA A;  4A98 A;  4JI6 T;  5AQS B;  2MPK A;  4HWH A;  4HWI B;  2JRK A;  5LCY A;  2D2S A;  2Q9Q A;  4UVB B;  4BAY B;  5IWA T;  1YW0 A;  2CM0 A;  4X1K E;  2MBG A;  5KXJ A;  2YKS A;  3V5U A;  5HEJ A;  1D1B A;  4PFP A;  4X64 T;  3FXE B;  3ETU A;  4TUY E;  2W2U A;  2XQ5 A;  3N9N A;  3SWH A;  2WP9 A;  1SA0 E;  3RC3 A;  1MNE A;  5LJN A;  1T98 A;  3P4P A;  2ES0 A;  4KX6 A;  4IE4 A;  3VRA A;  1UGO A;  3F31 A;  3ZKR A;  3VKG A;  2WB5 A;  4H9O C;  4P1N A;  1GQE A;  1UX4 A;  3WAJ A;  4DR1 T;  2DWG A;  3KBT A;  3AY5 A;  3AXJ A;  1W09 A;  5CGM A;  3CWZ B;  2Y8D A;  5LB7 B;  3LDQ B;  5F3J A;  3ZPO A;  1MMG A;  1NEK A;  4QH1 A;  3VR9 A;  4K0U A;  1KEY A;  2VKO A;  3CX8 B;  3LSV A;  3B57 A;  2CBI A;  1OED A;  4HEA A;  4IT4 A;  2BZB A;  4A5X A;  3ONX A;  3KDS E;  1HCI A;  2YEV C;  3LBX A;  5JRC A;  4H63 H;  2A2F X;  4Z8X A;  2PBI A;  5JDQ A;  4X20 E;  3UTK A;  2RPA A;  1US7 B;  3RIF A;  5FP3 A;  2UUB T;  2V6Y B;  2HPL A;  2NWB A;  5H6Q B;  4PJJ A;  1NEN A;  4B3T T;  2NTY A;  4CN1 A;  3EI0 A;  4ZI2 D;  2WZH A;  4ASK A;  2IHR 1;  4PK5 A;  4AQG A;  2LLY A;  2JJ9 A;  5DJQ C;  4OX9 T;  4GK0 E;  4YJ3 E;  5HEG A;  4L0R A;  3TLT A;  4H9N C;  1WR6 A;  2YDS A;  3EVY A;  4C90 A;  2OV9 A;  4CN4 A;  5JQG E;  4X66 T;  5HXE A;  2K9A A;  2K5B B;  2FJD A;  4EAH A;  3U78 A;  4EYY R;  5AQG B;  1SJ7 A;  5AQK B;  5EK2 A;  2LJL A;  3PF0 A;  1BR4 A;  5JRE A;  1FIO A;  4YHH T;  4QX7 B;  3AT7 A;  4DND A;  3KVB A;  2DL1 A;  3ZMV B;  1XMO T;  2KBB A;  5C8Y E;  5FMN A;  1HX1 B;  5LMU T;  4A56 A;  4WBN E;  2XY8 B;  5AQU B;  4U31 A;  4ANJ A;  5FNV E;  4YSX A;  3AE7 A;  1M62 A;  4DMW A;  2VVS A;  3PUW F;  4J2C A;  4CQI A;  2XTL A;  2KXP B;  1G73 A;  1XMQ T;  5LBQ B;  2VKJ A;  4WBO A;  4C91 A;  2EHO C;  3JC6 C;  2BG9 E;  4HE8 A;  4KI0 F;  3ZC1 A;  3P4S A;  4U2Z A;  4JI4 T;  5KMG P;  2N9D A;  5LGT B;  2BBH A;  2XQ4 A;  4TZ4 C;  3H37 A;  5FZT A;  4U7Y A;  3C4X A;  2K3W A;  3RRW A;  3UUB A;  4UIG A;  3RI5 A;  5L3G B;  1IZN B;  4JI2 T;  1UCU A;  5LHG B;  3U3I A;  4X1I E;  1QUU A;  2XJ7 A;  5JR9 A;  5LP6 E;  5AQJ B;  5HWX A;  4TX5 A;  4JI0 T;  3RQU A;  5F8P A;  3OBV E;  3K3N A;  3P8C D;  4XZC A;  3L39 A;  2J47 A;  4BGO A;  3PUV F;  2E5L T;  3UU5 A;  2L9Q A;  1LVK A;  2BBJ A;  2IC6 A;  2PFV A;  1V9D A;  3VRB A;  3IEE A;  4GKJ T;  3VJZ A;  2LSJ A;  2E5V A;  3FZH B;  5JTG A;  2FJE A;  4JEH B;  2LSY A;  3B13 A;  2LSI A;  2X68 A;  4YTN A;  4HTE A;  4NUU A;  4V1A v;  3V5S A;  2R6G F;  2KVP A;  2CRB A;  5J2U E;  3K8P C;  1SHZ C;  4DO0 A;  4FJO A;  4F7G B;  3AE8 A;  3RYH E;  2W00 A;  1BR0 A;  3QC9 A;  3KV9 A;  1YQ4 A;  2X9H A;  2BS2 A;  4JI1 T;  2UU9 T;  4ADZ A;  3FYQ A;  5ABF B;  3IA3 A;  2KWH A;  3N2K E;  4H9S E;  5L2L A;  2OLT A;  4AI6 A;  1N34 T;  3P50 A;  3JAF A;  2UXB T;  3FZL B;  3AEF A;  1XDO A;  4KUM B;  1VRB A;  5DQV A;  5LJM A;  3ZMZ B;  2BG9 C;  2JMH A;  3AVR A;  2WWU A;  5LOV E;  3KIN B;  4ZXL A;  3ZMS B;  4HWF A;  3VKH A;  4H63 V;  4U72 A;  4PJL A;  4ZI3 D;  2CE7 A;  3ZEF B;  1FMW A;  4IL4 A;  3QUJ A;  4DV4 T;  5JDM A;  2LRK A;  4ZZC A;  3RIU C;  4AKI A;  3LK2 B;  3HKE E;  2E9X D;  1T7S A;  3AE9 A;  3AVS A;  2X9W A;  2LOP A;  4OHF A;  2X0C A;  3QOF A;  1J5W A;  2HH7 A;  4IDZ A;  3RX6 A;  4O8S A;  2YIN A;  3ZYK A;  2LEH A;  4EV6 A;  3RGL A;  1KFY A;  2Q9Q D;  2E9X B;  2VAS A;  4PAG A;  3RC8 A;  3GN5 A;  4AXP A;  2VVN A;  4PJM A;  2WQY A;  2XAF B;  3TLW A;  4ECG A;  2UXX B;  3CQX C;  3UU4 A;  2W61 A;  4BJM A;  4TWH A;  2LT3 A;  4HFE A;  2PJQ A;  5L4E A;  3RIA A;  2CPT A;  2PG8 A;  4B3S T;  2WSS V;  3WUR A;  2Q9Q B;  3PUZ F;  2UUA T;  3SS1 A;  3ETV A;  4W8P A;  2WS3 A;  1ZP0 A;  3WAK A;  5L47 A;  4O4I E;  3UUL A;  4ZS3 A;  5LNK A;  4JEU B;  4UR9 A;  3JAD A;  1S94 A;  2CCQ A;  5AQF B;  5EZY E;  2X0Y A;  2X0H A;  2GK9 A;  4G63 A;  1R8I A;  2H7O A;  4MHC A;  1ZV4 X;  3ZT6 A;  2EHO A;  1SUM B;  4FI5 A;  2IW5 B;  4GK5 E;  2M6I A;  3AXJ B;  3OPC A;  4IDO A;  4DV3 T;  4OK0 A;  2XQ8 A;  2WBL A;  3AAI A;  4AIS A;  5IUX A;  1YKH B;  3PUS A;  2QRX A;  4EXT A;  4EIW A;  5HEO A;  5IYZ E;  2NTX A;  3PUQ A;  1WYB A;  1X9B A;  2CHO A;  3ZC0 A;  1OED B;  2ZLY A;  2NW9 A;  1UX5 A;  2HPJ A;  2L3L A;  3PJA J;  2I59 A;  3LBX B;  1CUN A;  2I6H A;  2XQA A;  3X1D A;  4U2Y A;  3SRZ A;  2LKH A;  4YY3 T;  2FUP A;  1Z8U A;  5FVK A;  3A7M A;  5EK4 A;  4PFO A;  5AQI B;  1VOM A;  2BVM A;  2JQK A;  3ZYL A;  1YQ3 A;  3AE3 A;  2VUR A;  3QB5 K;  4AKL A;  4G2A A;  1WCR A;  3RRC A;  2G0U A;  3ZLI A;  5DAB A;  3LK3 B;  3K3O A;  2KMF A;  1HG5 A;  2KT9 A;  4JI5 T;  1HF8 A;  3J9X 1;  4UV9 B;  2MAW A;  2YDQ A;  5C3J A;  2H88 A;  3PV0 F;  1XNR T;  2L10 A;  4MAL A;  4U33 A;  3LG7 A;  2WDR A;  4NPP A;  5BR8 T;  2BKP A;  3AEC A;  3UQ7 A;  4GOU A;  4QXC B;  5AQO B;  2N2N A;  3Q5X A;  5HXR A;  3F57 A;  3GMI A;  4ZEY A;  2CXL A;  2BS4 A;  3BQK A;  1O3X A;  3CVR A;  3C98 B;  1IBL T;  2XPK A;  1D0Y A;  2W4X A;  4AKH A;  4JI8 T;  3UU3 A;  3P4W A;  2XSA A;  4X5T A;  1T72 A;  3PTR B;  5M4Y A;  4HFH A;  3L3P A;  4CI3 B;  2UXC T;  2NW7 A;  2J62 A;  2XQY A;  4ZZB A;  4HGA A;  3H3M A;  2V7I A;  1YKE B;  2BG9 A;  4TNV A;  5T1D A;  4EZ4 A;  3EDV A;  2YU2 A;  5HCM A;  1SJ8 A;  1W9R A;  3IF8 B;  2V8S V;  3HL6 A;  1UUR A;  3SOL A;  5JDH A;  1E2A A;  3HKD E;  2NOX A;  3FXD B;  4IDP A;  3C51 A;  4L9I A;  3RIU A;  4WZX A;  1J5E T;  4UEL A;  4EZH A;  3ONL C;  4KP3 C;  5JDF A;  4ILB A;  4JYA T;  5CFB A;  5JDL A;  5JVD E;  4CXY A;  1U5P A;  3E22 E;  4AQF C;  3I9W A;  4QX8 B;  2XAG B;  5FYM A;  4DV0 T;  4ZI7 E;  3Q2M A;  3AA0 B;  1KNR A;  5FL1 A;  4LFB T;  4O4J E;  2LSK A;  3AAE B;  3MAC A;  5HXC A;  4O2A E;  2LRL A;  4M1P A;  2XQ7 A;  4P09 A;  2VQE T;  2N1G A;  3OJA A;  1I6Z A;  2RA1 A;  4DR6 T;  3GA8 A;  3N9L A;  5LA6 E;  3EUH A;  2LHN A;  4OYJ A;  3AE2 A;  1OED E;  2C5J A;  5KDM C;  3ZST A;  4CXW A;  2VL0 A;  4DMV A;  3OYZ A;  2L7N A;  3IBP A;  2HHH T;  1I94 T;  5FY1 A;  3DP7 A;  2V6Y A;  4HFI A;  4ZI3 C;  1FJG T;  1SE7 A;  1J1J A;  4YSY A;  3PUY F;  3RYC E;  1UK5 A;  4GKK T;  2QYW A;  1Y01 A;  2DHR A;  3AE4 A;  5LMN T;  5L3F B;  2PTF A;  2ZM0 A;  2V7J A;  2E9X C;  3PU8 A;  5AQL B;  3C4W A;  5LGN B;  5FL0 A;  4L5G A;  2FJA A;  4EB6 E;  4QHO A;  4QWN B;  3AEE A;  2DLR A;  2V5D A;  3RKO A;  2VB6 A;  2Z6E A;  5LXT E;  5CJ5 A;  4LF5 T;  2BKN A;  2ODV A;  2Q9Q C;  4X65 T;  1MMA A;  3EHZ A;  3N2G E;  3UFG A;  4I55 E;  3LJC A;  5E0O A;  2XQ3 A;  2KND A;  3AA7 B;  5HYA A;  2C0S A;  3Q5E A;  4IGU A;  4YSZ A;  4LF4 T;  1Z0P A;  2V6X A;  1DU2 A;  2CMR A;  1CHU A;  2X66 A;  3LFM A;  3N9O A;  3KV6 A;  2XAQ B;  3NVO A;  2LM2 A;  3RYI E;  4YT0 A;  2CBJ A;  3GN5 B;  3ZYM A;  2KGX A;  4HWD A;  4LML A;  2HN1 A;  4QH4 A;  2WU5 A;  4PK4 A;  2D0T A;  1S35 A;  2A72 A;  2YU1 A;  2A9U A;  1MIV A;  2AXD S;  3KV5 A;  5IHY A;  2WDV A;  1OED C;  1XNQ T;  1YXR A;  4DV5 T;  4U7I A;  3MK7 C;  3QB5 A;  4ILC A;  4YXD A;  2FBW A;  4Q25 A;  4AQY T;  2NP9 A;  1FEW A;  3J7Y q;  3O4X E;  1OXZ A;  3L8R A;  2EHO D;  3ANW A;  3CIR A;  3PUG A;  2H89 A;  2A3D A;  2J4G A;  3TLU A;  4DUY T;  4IRE A;  3G06 A;  1HNW T;  3ABV A;  2LSG A;  4IE5 A;  1ZEE A;  3AB3 B;  3MKD A;  3KBU A;  1MMD A;  3RF1 A;  1AJ3 A;  3E08 A;  2VQF T;  3MZK B;  3RLF F;  3O9X A;  2Y48 B;  4F6R C;  2L8K A;  4AKG A;  2XQ6 A;  5J1G A;  2YDR A;  1JNR A;  3KVA A;  2NR4 A;  4A97 A;  1XWM A;  4LF8 T;  2I0M A;  4E7Z A;  4UF0 B;  1HS7 A;  4JBW F;  3ZJ2 A;  3HKC E;  1FMV A;  5AQP B;  1ZHC A;  1LKX A;  3BQI A;  3FZF B;  2MTQ A;  3ZT5 A;  2ZM2 A;  5JH7 E;  3AEG A;  1BR1 A;  4JLE A;  4LF9 T;  4X1Y E;  1E7P A;  3ZJ1 A;  3WSC A;  5DQW A;  1YD8 G;  5FKY A;  5C2T A;  3OYX A;  5AQR B;  4AQF A;  5ABG A;  5FVL A;  5ABE A;  3FZK B;  2IIU A;  4QXB B;  3N2O A;  2RP4 A;  2AE9 A;  3NBX X;  2X9Y A;  3HI2 A;  5HAX A;  4X62 T;  1N33 T;  3PUX F;  1IBK T;  2Y6X A;  3WI3 A;  2ACZ A;  1KK7 A;  2LM9 A;  3P4Q A;  3AE6 A;  4DR3 T;  2XM1 A;  3OVU A;  3OKQ A;  4YFS A;  3UT5 E;  4K0K T;  3BQL A;  2BKO A;  3ONJ A;  3PUR A;  2WDQ A;  4U74 A;  4H9Q C;  1EZ3 A;  1WR0 A;  5AQV B;  2XHE B;  4IDN A;  4LFA T;  4ISS A;  2X0L B;  4MLK A;  5AQH B;  3VR8 A;  2E8I A;  1U4Q A;  2D9D A;  4ZI2 C;  5H6R B;  3Q5D A;  1M7K A;  3TLS A;  4NIQ A;  1JNZ A;  4HKA A;  2X9X A;  5JRC B;  5ETW A;  4F8H A;  1G8X A;  2CLY B;  5LGU B;  4I4T E;  4N78 D;  1XZY A;  1E1H B;  4UVC B;  4LF6 T;  3SFE A;  3ZN0 B;  4IDQ A;  3CKD A;  3P4R A;  2J1D G;  4NXN T;  5EK3 A;  4DBR A;  3NZP A;  3ZSS A;  3AA1 B;  4WW0 A;  4KBM B;  5L3B B;  5LG3 A;  2YK0 A;  4JUY A;  4ZS2 A;  4DUZ T;  2V7K A;  2QGS A;  4COF A;  4HWC A;  2XUE A;  3PJA A;  1XDP A;  3ZT7 A;  3C64 A;  5J0Z A;  2W67 A;  4DV1 T;  4I43 B;  3EAB A;  4PJN A;  2QVA A;  2DI4 A;  2JIW A;  4GIW A;  2DCF A;  1LVF A;  1UUS A;  2V26 A;  5J2T E;  2LHR A;  4ONR A;  1T8B A;  4TV8 E;  3FBL A;  2WM9 A;  4O4H E;  3PUA A;  2ZM6 T;  3N9P A;  3AAA B;  2ODU A;  3ZN1 B;  3I0Q A;  3GWH A;  3S4U A;  3A8Y C;  3CX6 B;  4YTP A;  2WMN A;  3ZMT B;  3UQ4 A;  3PDY A;  2YN6 A;  2VK9 A;  2JQ9 A;  2X51 A;  3C4Z A;  2V1D B;  5CB4 E;  2JQH A;  2OA5 A;  2UUC T;  4BJN A; 
#chains in the Genus database with same CATH homology
 4H63 V;  2XAJ B;  5JR9 C;  4U72 A;  2DHR A;  4PJL A;  4ZI3 D;  3H3A A;  3N9M A;  4YLH A;  5L3F B;  3F2E A;  2C5K T;  2BDE A;  2CE7 A;  2ZM0 A;  3RH3 A;  1FMW A;  3ZEF B;  2V7J A;  3ESL A;  2E9X C;  3QUJ A;  2M67 A;  4CXX A;  4UF0 A;  2W62 A;  1D1C A;  5JDM A;  5JDG A;  3PU8 A;  1IJ6 A;  2LQU A;  3C4W A;  3PHF 1;  5LGN B;  4TN7 B;  2ACX A;  4AKI A;  2E9X A;  3LK2 B;  4L5G A;  2WMO A;  1LRZ A;  3HA4 A;  3HKE E;  4TV9 E;  3K3Q C;  4EB6 E;  4QHO A;  1QSD A;  2E9X D;  2SPC A;  3AVS A;  2X9W A;  2LOP A;  2JQQ A;  4OHF A;  4E7S A;  4QWN B;  4B6X A;  2LE8 A;  5JDN A;  2DLR A;  2X67 A;  3PE0 A;  2H3R A;  3RKO A;  4O2B E;  2VB6 A;  2Z6E A;  4GYS A;  5LXT E;  3LK4 2;  4BA9 A;  3C50 A;  3ZCI A;  3PU3 A;  2ODV A;  2Q9Q C;  2HH7 A;  2JPF A;  5JR9 B;  4IDZ A;  4IE0 A;  1MMA A;  2CA5 A;  3RX6 A;  4O8S A;  2YIN A;  2JRK A;  5LCY A;  3ZYK A;  2LEH A;  2D2S A;  2Q9Q A;  3N2G E;  4UVB B;  4BAY B;  4I55 E;  1YW0 A;  3LJC A;  4UV8 B;  5E0O A;  2CM0 A;  4X1K E;  2MBG A;  2Q9Q D;  3V5U A;  2E9X B;  2VAS A;  2KND A;  3AA7 B;  3CX7 B;  5HYA A;  1D1B A;  3DJB A;  4PFP A;  3FXE B;  4PAG A;  3ETU A;  3RC8 A;  4P0B A;  3GN5 A;  2C0S A;  4TUY E;  4AXP A;  4IGU A;  3N9N A;  3SWH A;  1Z0P A;  4PJM A;  2XAF B;  4ECG A;  2DWK A;  4ZOL E;  2UXX B;  2CMR A;  1SA0 E;  3RC3 A;  3CQX C;  2W61 A;  5FXW A;  2X66 A;  4BJM A;  3EDU A;  1MNE A;  5LJN A;  1T98 A;  2LT3 A;  3LFM A;  5FXX A;  2PJQ A;  2KIN B;  3N9O A;  2PG8 A;  2ES0 A;  3KV6 A;  2WSS V;  3WUR A;  2Q9Q B;  3W15 B;  4IE4 A;  2NW8 A;  1IAP A;  2XAQ B;  3MXZ A;  3F31 A;  3VKG A;  4NUV A;  3I1A A;  2LOS A;  1WLX A;  3ETV A;  4H9O C;  3SS1 A;  1MIY A;  3RYI E;  2MTC A;  1UX4 A;  3WAJ A;  3GN5 B;  4YHJ A;  4ERR A;  2UXN B;  3ZYM A;  2CWO A;  2DWG A;  3WAK A;  3KBT A;  3E0Z A;  4O4I E;  3Q5W A;  2K48 A;  4ZS3 A;  3UUL A;  5LNK A;  4JEU B;  4MFR A;  4PK4 A;  5HXS A;  3CWZ B;  2Y8D A;  4HN9 A;  2D0T A;  1S94 A;  1S35 A;  2A72 A;  2YU1 A;  4UEM A;  2CCQ A;  3T8O A;  5F3J A;  1MIV A;  3ZPO A;  3KV5 A;  1MMG A;  5EZY E;  2B1E A;  4IST A;  4XAX B;  5IHY A;  2GK9 A;  4G63 A;  3MK7 C;  2P9B A;  2H7O A;  4MHC A;  5L3D B;  1ZV4 X;  4K0U A;  2VKO A;  4P0A A;  3CX8 B;  5HWY A;  3B57 A;  2EHO A;  2NP9 A;  1FEW A;  4HEA A;  4FI5 A;  2IW5 B;  3O4X E;  2BZB A;  3J7Y q;  4GK5 E;  1OXZ A;  3AA6 B;  3CML A;  2EHO D;  3ANW A;  3ONX A;  3PUG A;  3KDS E;  1HCI A;  2A3D A;  2YEV C;  3FHN A;  3LBX A;  5JRC A;  4H63 H;  4OK0 A;  1WRD A;  2A2F X;  4Z8X A;  2PBI A;  3UUN A;  5JDQ A;  2LSG A;  2WBL A;  3AAI A;  4X20 E;  4IE5 A;  1ZEE A;  3UTK A;  1US7 B;  1YKH B;  3AB3 B;  3MKD A;  3PUS A;  5FP3 A;  3KBU A;  3O1J A;  1H7C A;  4EXT A;  4QKN A;  4ILU A;  4EIW A;  1MND A;  5IYZ E;  2NTX A;  3PUQ A;  1MMD A;  2HPL A;  1AJ3 A;  1WYB A;  3E08 A;  4PNI A;  1NWM X;  3ZC0 A;  5FY0 A;  2NWB A;  5H6Q B;  3MZK B;  2NW9 A;  2ZLY A;  4PJJ A;  1UX5 A;  2NTY A;  2HPJ A;  3O9X A;  2Y48 B;  2L3L A;  4F6R C;  3ANW B;  3I0O A;  2L8K A;  2KZ7 B;  3DTO A;  4AKG A;  5J1G A;  3N5L A;  2I59 A;  4ZI2 D;  3LBX B;  3KVA A;  4ASK A;  1CUN A;  4PK5 A;  3R6N A;  4AQG A;  3SRZ A;  2JJ9 A;  4E7Z A;  3MA9 A;  4UF0 B;  5DJQ C;  4GK0 E;  1HS7 A;  5GON E;  4YJ3 E;  3ZJ2 A;  3HKC E;  1FMV A;  4PFO A;  5EK4 A;  1ZHC A;  1LKX A;  3BQI A;  4L0R A;  1VOM A;  2MTQ A;  1OWA A;  4H9N C;  5FXV A;  3RPU A;  5LBM A;  1WR6 A;  2BVM A;  3EVY A;  3ZYL A;  4C90 A;  3VHL A;  2K24 A;  5JQG E;  2ZM2 A;  5HXE A;  4WNK A;  2K9A A;  2K5B B;  3NRX A;  2QA7 A;  4EAH A;  5JH7 E;  3U78 A;  4EYY R;  2D0U A;  1BR1 A;  4AKL A;  4G2A A;  4JLE A;  3P7I A;  3RRC A;  2W0G A;  5CA1 E;  2G0U A;  1ZKE A;  4X1Y E;  2LJL A;  3KFW X;  5EK2 A;  3PF0 A;  3ZJ1 A;  1BR4 A;  2KWI B;  3BK9 A;  5DAB A;  1YD8 G;  5DQW A;  1FIO A;  3LK3 B;  3ZLI A;  5JRE A;  3WSC A;  2DNX A;  3K3O A;  5LYJ E;  5FXZ A;  2KMF A;  5AFU L;  1WYC A;  2H7V C;  3OYX A;  4QX7 B;  3KV4 A;  4AQF A;  1MIW A;  1HG5 A;  3NRY A;  3AT7 A;  4DND A;  2KT9 A;  3KVB A;  3ZMV B;  3CPZ A;  1HF8 A;  2WAU A;  4QXB B;  3J9X 1;  4UV9 B;  3N2O A;  2RP4 A;  1NAF A;  5C8Y E;  5FMN A;  3NBX X;  2ZM8 A;  2X9Y A;  4MAL A;  4PK6 A;  3HI2 A;  1HFA A;  3LG7 A;  5HAX A;  4A56 A;  2MOZ A;  4WBN E;  4ANJ A;  5FNV E;  2Y6X A;  3WI3 A;  4DMW A;  4GOU A;  4UXN B;  4QXC B;  4CI1 B;  2JMK A;  3CQG B;  2N2N A;  3Q5X A;  5HXR A;  1KK7 A;  2LM9 A;  3F57 A;  3GMI A;  4J2C A;  4CQI A;  2XTL A;  5LHH B;  2CXL A;  3BQK A;  5BMV E;  1O3X A;  2KXP B;  3CVR A;  3C98 B;  3UFE A;  5HXH A;  1G73 A;  5LBQ B;  2VKJ A;  4IE6 A;  4YJ2 E;  4WBO A;  4C91 A;  2EHO C;  3JC6 C;  1D0Y A;  2XAS B;  2W63 A;  4AKH A;  1HX8 A;  3OKQ A;  4ZHQ E;  4HE8 A;  3ZC1 A;  4YFS A;  3UT5 E;  5KMG P;  2N9D A;  3PTR B;  3BQL A;  5LGT B;  5M4Y A;  2VKD A;  3JC6 D;  4TZ4 C;  3ZCJ A;  3H37 A;  2CLY C;  3L3P A;  1D0X A;  3NZQ A;  3PUR A;  3QK6 A;  4CI3 B;  5KX5 E;  2NW7 A;  3M65 A;  4U74 A;  4H9Q C;  1EZ3 A;  3C4X A;  3RRW A;  4I50 E;  4UIG A;  2XHE B;  3RYF E;  2XQY A;  4HGA A;  5L3G B;  4UVA B;  1IZN B;  4ISS A;  2X0L B;  2C5I T;  4MLK A;  3Q9D A;  2V7I A;  1YKE B;  2E8I A;  1U4Q A;  1UCU A;  5LHG B;  4DVD A;  3U3I A;  5T1D A;  3O1H A;  4ZI2 C;  4EZ4 A;  3VU7 H;  5H6R B;  4X1I E;  1QUU A;  2YU2 A;  2CEA A;  2CXD A;  3EDV A;  1B7T A;  2XAH B;  2EHO B;  3IF8 B;  3HL6 A;  5JR9 A;  5LP6 E;  3SOL A;  5JDH A;  1HG2 A;  3HKD E;  4HKA A;  3TKL B;  2X9X A;  5HWX A;  4TX5 A;  2NOX A;  5F8P A;  5JRC B;  5ETW A;  3FXD B;  3K3N A;  3OBV E;  3P8C D;  2CWY A;  4CZZ B;  4IIJ E;  2KLQ A;  4XZC A;  3C51 A;  1G8X A;  3HR0 A;  4L9I A;  2CLY B;  4BGO A;  2L9Q A;  3L09 A;  2PFV A;  1LVK A;  2IC6 A;  4O4L E;  1V9D A;  5LGU B;  2MYS A;  4I4T E;  4XBF B;  3IEE A;  4EYU A;  3FBZ A;  3VJZ A;  4UEL A;  4N78 D;  4EZH A;  2LSJ A;  1E1H B;  4UVC B;  4KP3 C;  3ZN0 B;  4PW8 A;  5JDF A;  3HKB E;  1IJ5 A;  1BR2 A;  3CKD A;  3IHR A;  4JEH B;  5JDL A;  2LSY A;  5JVD E;  2J1D G;  4CXY A;  1U5P A;  4AKR B;  5EK3 A;  2VL8 A;  3E22 E;  4OFZ A;  5LHI B;  3M1C A;  4AQF C;  3B13 A;  3I9W A;  4DBR A;  2LSI A;  2X68 A;  3NZP A;  3AA1 B;  4WW0 A;  1MMN A;  4KBM B;  4QX8 B;  5L3B B;  1X79 A;  4HTE A;  4NUU A;  4V1A v;  2XAG B;  2YK0 A;  5FYM A;  3V5S A;  4JUY A;  4ZS2 A;  2V7K A;  2QGS A;  4ZI7 E;  2V7M A;  3Q2M A;  3AA0 B;  2XUE A;  5FY7 A;  1HTJ F;  3K8P C;  1SHZ C;  4DO0 A;  5J2U E;  4FJO A;  3I9Y A;  3C64 A;  4CI2 B;  4O4J E;  2LSK A;  3AAE B;  3R84 B;  4I43 B;  3CQC B;  3RYH E;  3MAC A;  5HXC A;  2W00 A;  5L3C B;  4O2A E;  5TAO A;  3MJX A;  4OYK A;  4M1P A;  4PJN A;  1BR0 A;  5ADX L;  3QC9 A;  2IAK A;  4P09 A;  3KV9 A;  5A1L A;  3A5X A;  2N1G A;  2X9H A;  2DI4 A;  3FB2 A;  4IE7 A;  3OJA A;  4ADZ A;  4GIW A;  2DCF A;  2RA1 A;  1LVF A;  4H9P C;  3GA8 A;  3N9L A;  5LA6 E;  2V26 A;  2KWH A;  3EUH A;  2LHN A;  4OYJ A;  5J2T E;  2LHR A;  2V7L A;  3N2K E;  4H9S E;  4ONR A;  5L2L A;  2ZMA A;  1KNZ A;  2C5J A;  4TV8 E;  5KDM C;  4AI6 A;  5CA0 E;  4DBQ A;  4QXH B;  3FBL A;  4CXW A;  2BVL A;  2WM9 A;  2IC9 A;  4O4H E;  3PUA A;  4MBQ A;  3N9P A;  4GYR A;  3AAA B;  2ODU A;  3UUM A;  4DMV A;  2VWA A;  3ZN1 B;  3I0Q A;  3O1I A;  3GWH A;  3S4U A;  3D0T A;  3OYZ A;  3ZMU B;  4EOZ B;  3CX6 B;  3IBP A;  4KUM B;  5FY1 A;  2WMN A;  1D0Z A;  1VRB A;  3ZMT B;  3PDY A;  5DQV A;  3DP7 A;  4IHJ E;  3ZMZ B;  5LJM A;  5LG4 A;  2VKH A;  4ZI3 C;  2JMH A;  3AVR A;  3UUX B;  2VK9 A;  2WWU A;  5LOV E;  1Y64 B;  3N9Q A;  2X51 A;  2CXF A;  3C4Z A;  2V1D B;  4HFV A;  5CB4 E;  3KIN B;  4H9R C;  2D5U A;  2OA5 A;  3ZMS B;  3RYC E;  3VKH A;  1D1A A;  4BJN A;  5L3E B;  4KMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...