5HXRA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 10mm ca2+
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
300
structure length
293
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 121
structure length 293
sequence length 300
ec nomenclature
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hxrA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hxrA02
5HXCA 5JDFA 5HYAA 5HXEA 5JDQA 5HXSA 3V5UA 5HWYA 3V5SA 5JDLA 5JDGA 5HXRA 5HXHA 5HWXA 5JDMA 5JDNA 5JDHA
chains in the Genus database with same CATH superfamily
2X9YA 4UF0B 4DIDB 3QUJA 4IDZA 1HCIA 3RKGA 3QB5A 2ZM6T 2BBJA 3LFMA 3P4WA 2BKOA 3QC9A 2XQ8A 4U72A 4TWHA 2QGSA 2Y6XA 3UUMA 3SS1A 5HWXA 4H63H 5DQVA 3ZYMA 2XQ4A 4O4HE 3AE5A 5JDQA 3KV4A 3IHRA 3HKCE 3PUAA 2UUCT 2E8IA 4KMCA 1LVFA 2NWBA 1G73A 2M6IA 5JR9B 1OEDC 1AJ3A 4IE4A 3PUYF 5FY7A 5L3EB 2VASA 2V8SV 5AQOB 3ZN0B 4O4LE 4DR6T 1H7CA 5FP3A 2KSRA 1ZEEA 5HXEA 3HKDE 4L5GA 3CK6A 1OEDA 4ZS3A 4EOZB 2L9QA 3AB3B 2BVLA 5BR8T 1B7TA 3FZMB 3AEGA 2D0TA 1YXRA 2VURA 4DBQA 2CM0A 2WSSV 4ZEYA 2LRKA 3EAMA 4QHOA 4JI7T 3B5MA 3UT5E 2XQ3A 3O9XA 2I0MA 4PW8A 5LG4A 2HHHT 2VL8A 4GYSA 2KNDA 4Z90A 1OEDE 3CVRA 5AQJB 4CXYA 5FXXA 1N36T 3C51A 4TUYE 2JMHA 1W9RA 4B3ST 2X9HA 2LHNA 4JI4T 3R84B 3NZPA 2W00A 2JRKA 3E0ZA 4B6XA 2N1GA 1HNZT 5JTGA 3OPCA 4DR5T 2W4XA 1MNEA 3ZC0A 5HXHA 2KT9A 2JIWA 2DCFA 3CPZA 1BR2A 3VHLA 5FXWA 3VKGA 5JRCA 1XMQT 4U3CA 4ZOLE 3RQWA 1S35A 3F2EA 5IWAT 3N2KE 1J1JA 2GK9A 2XUEA 1WR6A 2C5JA 4AQYT 3QB5K 3CX7B 2CRBA 4UELA 2NW7A 3ZMVB 1KFYA 4ILCA 3PF0A 3P7IA 1MIVA 1HTJF 5EK4A 1MMNA 1WCRA 4KI0F 2LOPA 1UX4A 5AQSB 4XBFB 3ZJ1A 4WZXA 2WU2A 1LKXA 4QXCB 3A5XA 1QUUA 4DO0A 3WURA 4X1KE 3PTRB 2WAUA 4U33A 4AIUA 4CXXA 5GONE 4O8SA 4IE0A 2QA7A 3TLUA 4BA9A 3RC8A 3ETUA 1IAPA 4O2AE 4PAGA 5JR9C 3AA1B 3CX8B 2FBWA 4GK5E 3VU7H 4IHJE 4P09A 2IIUA 3HKEE 1OWAA 2XQ5A 4OHFA 1ZHCA 2VL0A 1YD8G 4PFOA 5JR9A 2X9WA 2BBHA 4JUYA 5KMGP 3MK7C 2UXDT 2V5DA 2L10A 1I6ZA 2XY8B 3AAIA 2JQQA 2W67A 3C4XA 4K0KT 5KDMC 2UUBT 3AEAA 5L3FB 5ABFB 3CIRA 4YHHT 3KINB 3HKBE 2PJQA 4PK5A 4H9OC 4JI5T 5JDNA 4LFBT 3RYFE 3OTOT 4DBRA 3P4QA 2AE9A 3W15B 4IDQA 5A1LA 2I59A 4U7IA 4LMKA 1T8BA 3Q9DA 2V6XA 4TV9E 1MNDA 4HWFA 3AAAB 4MLKA 3E22E 3ZT7A 4CXWA 3PHF1 5LOVE 3K3NA 4WNKA 1IBMT 4LF8T 3ZMZB 3T1YT 2A9UA 1HX1B 2IHR1 4DR1T 3OYZA 4JYAT 4CQIA 3B13A 2MBGA 5JVDE 5F5WA 4X5TA 3BQKA 4I43B 4FJOA 2NTYA 3UU6A 4YJ3E 3HI2A 1WRDA 3OJAA 1IBKT 1Y01A 3T1HT 3RF1A 3P50A 3WAJA 1QSDA 1X9BA 4LMLA 4HE8A 2LT3A 2LSGA 1YW0A 4H9SE 1ZP0A 3HL6A 4JBWF 1V9DA 4GKKT 3FZFB 5AQMB 4B3RT 3AECA 5FZTA 3HA4A 5H6QB 4L0RA 4EZ4A 4M1PA 3H37A 1XDOA 3PUQA 4HWHA 1UURA 4OYJA 1W09A 2KWIB 5LHIB 3ZEFB 2K9AA 2A72A 5CA0E 3C98B 3SFEA 3AEDA 1N32T 4NUVA 3IEEA 4ANJA 4PJJA 4HWIB 3KDSE 2WY2A 2W66A 4JI2T 3EVYA 5LGTB 1IBLT 5CGMA 4QXHB 4C91A 1Y64B 3VRAA 2LRLA 4ADZA 3ZSTA 3JAFA 3RRCA 4DR7T 2V7KA 3ONJA 2QYWA 4EEBA 2QRXA 5LBQB 3RIFA 4ISSA 2LHRA 5AFUL 3L09A 4AISA 3AE8A 2UXXB 3N9PA 3L3PA 4AQFC 1LVKA 5EZYE 5ABFA 4H63V 5FY0A 1FMVA 4F6RC 5L3GB 3TLWA 2KXPB 4KBMB 4AKLA 3UUBA 5F8PA 3BQLA 2YN6A 2CBJA 1NAFA 3DP7A 2ODVA 2E5LT 3ZMUB 1T98A 5IUXA 1HG2A 5AQUB 3CMLA 4AQFA 4J2CA 2DNXA 5IHYA 4A98A 3IA3A 1T7SA 2W63A 2W62A 3AE3A 5DQWA 3EHZA 4UV8B 3LJCA 2KBBA 2B1EA 1WYCA 1KNRA 2LLYA 3N9MA 3RQUA 2ZM8A 4JI8T 2CE7A 3TLSA 5KXJA 2IUBA 3ZSSA 4DV3T 2IMLA 5HXRA 2K3WA 1HNXT 2XQ7A 3C4ZA 4U2ZA 5C3JA 5HEJA 2WB5A 2D9DA 2M67A 3AAEB 3NRXA 4ZI3C 3ZT6A 1YQ3A 4COFA 3UFGA 2CLYB 4KX6A 3NZQA 5JH7E 2X0LB 2KWHA 4QH5A 5AQVB 3RYCE 4X66T 2BKPA 2FUPA 4AKIA 1X79A 2Y48B 2CHNA 4I0UA 4CN4A 2W0GA 3RC3A 1FMWA 4I50E 2XJ7A 4TNWA 1NEKA 4EAHA 3PUZF 3V5SA 5AQRB 4X65T 4U2YA 4DNDA 3Q5DA 5JREA 4H9NC 3PURA 2DWKA 4HKAA 4WBOA 2VWAA 2VQFT 4DMVA 4EYYR 3PV0F 4Z8XA 2VKJA 2F4VT 4V1Av 3CX6B 4DV5T 3FZLB 2J4GA 2VKOA 3GMIA 3CQCB 4BGOA 3DTOA 3VRBA 3CWZB 4U74A 1S94A 3JADA 4LF4T 4MALA 4IDNA 4ISTA 2N9DA 5ABEA 3KBUA 5T1DA 1W0AA 2VK9A 5J0ZA 1NENA 1WFDA 4DUYT 3AVSA 4LF7T 3N9QA 4JEUB 4PFPA 3V5UA 2K24A 3U78A 2ACXA 3AE2A 1HNWT 2BZBA 2E5VA 2HPJA 1SA0E 1D1AA 3EUHA 3ZT5A 4ILUA 3WAKA 2K48A 5FXZA 3ZYLA 4QX7B 5FVLA 4NIQA 2C0SA 3C64A 4TWFA 3PUXF 4H9PC 3TLTA 1R8IA 2V6YB 4E7ZA 3CQXC 3I1AA 4ZI3D 2L3LA 3SRZA 3RIUC 5HCMA 2BS4A 1VCSA 2HN2A 4MHCA 1M62A 1VCTA 3O4XE 4IE5A 3VKHA 4ERRA 3LBXB 3ZMTB 4QKNA 4CZZB 5KX5E 2LM9A 3O1JA 2CLYC 3RPUA 3RIUA 2MOZA 2XQYA 3L8RA 4LF6T 4HFDA 4TX5A 5AQPB 4KHPT 1HX8A 4ASKA 4OFZA 2ZLYA 3A8YC 2C5KT 2IDOB 5JDFA 5HEHA 2AXDS 1HF8A 2V7LA 4DV4T 1E7PA 4TV8E 3P4PA 4TNVA 2KGXA 2LJLA 3VR8A 3AVRA 2ODUA 2VB6A 2XHEB 1L0VA 1E1HB 3QK6A 3Q5EA 2CXFA 3M65A 3RX6A 3ESLA 1YQ4A 2X68A 4YHJA 3M3ZB 5FL0A 4LF9T 4B3MT 3B57A 3GWHA 5DJQC 2MYSA 2MAWA 4QX8B 2UXCT 1YKEB 4Q25A 3MXZA 5F3JA 4WBNE 1UGOA 1EZ3A 3ZN1B 5IYZE 4H9QC 4ZZBA 4PJMA 4DV7T 4CI2B 1J5WA 1XWMA 1E2AA 5HEOA 4LF5T 5L4EA 2L7NA 5LJNA 4DR4T 4CN6A 4PJNA 5LBMA 3ZJ2A 5ABGA 4YJ2E 2L8KA 5AQTB 4WW0A 2BG9B 2M6BA 5M4YA 2XQAA 2OLTA 5AQHB 1BR4A 1WR0A 3ZPOA 3ANWB 5CA1E 1JNZA 5JDMA 5JDHA 3FBLA 2VVSA 3E08A 2WDRA 4GKJT 2KZ7B 2FJBA 2DI4A 1YKHB 3JAEA 1IZNB 2MPKA 3KVAA 3RI5A 2V6YA 1N33T 2BS3A 2YDQA 3FZKB 1UX5A 3IF8B 3OYXA 4OX9T 3NVOA 2JPFA 4FI5A 4AXPA 4DV0T 3VJZA 2Y8DA 4P0AA 2WWUA 5ADXL 3L39A 4EIWA 3P4RA 3CQGB 3UU5A 4CI1B 4JV5T 2XAJB 4OK0A 2CXLA 3LBXA 1U5PA 2PFVA 3RKOA 2CHOA 2E2AA 5DABA 3RYHE 2JQ9A 3KV9A 2BS2A 3RGLA 1NWMX 3NRYA 4DVDA 2IC9A 2HH7A 3UUXB 4X62T 2YEVC 4PJLA 3UUNA 4DUZT 1HG5A 3N9NA 3Q5WA 3SOLA 5LXTE 3AEBA 5L2LA 2V7MA 1G8XA 2H88A 3FXDB 2YK0A 5LNKA 3QNUA 4IL4A 1WLXA 4ZI2C 4YSYA 2NOXA 2IC6A 2PTFA 4E7SA 5ABHA 4L9IA 5FY1A 4DV1T 3KV5A 2CPTA 5AQFB 3RYIE 3PUWF 2SPCA 4UEMA 4JI1T 1KK7A 3BK9A 2LKHA 2UXBT 2HN1A 5BMVE 2FJDA 3HR0A 3J9X1 3MKDA 4LFCT 5L4HA 3N9OA 3N2GE 4YXDA 4NXNT 2XAQB 5H6RB 2LSYA 2EHOB 4HGAA 4JLEA 3AT7A 2UU9T 2KMFA 3SFDA 3TLVA 4TWDA 4A5XA 2NP9A 1IJ5A 3ONXA 5FXVA 3FXEB 4HEAA 2BG9C 1US7B 4OYKA 2XTLA 3PUGA 4IDPA 4A97A 3T8OA 4P0BA 4EGWA 5FKYA 2K5BB 4F7GB 2XAGB 2LOSA 3TKLB 2OV9A 4UR9A 5ETWA 4ONRA 2WP9A 2BG9A 4EZHA 2J1DG 1SE7A 2FJAA 2ZM2A 3ZCJA 1KNPA 5EK2A 3ANWA 2KINB 4NXMT 2X66A 2YDSA 3U3IA 1SJ7A 4ZHQE 4UXNB 2D2SA 2J47A 4EV6A 2H3RA 4UV9B 1XNRT 4X1IE 2BG9E 2MTCA 4K0UA 3PE0A 3NWIA 4MFRA 5LG3A 2XM2A 3AE1A 2WZHA 3UQ7A 2XAFB 2BDEA 2WDQA 3FBZA 4ZI2D 2BKNA 2G0UA 3UTKA 4AQGA 3LK2B 4IL9A 4N78D 4YFSA 4YY3T 1MMDA 4X1YE 5C8YE 2LSIA 2E9XB 3D0TA 2X0HA 2XASB 4O4JE 3ZC1A 4EXTA 3AXJA 2CWYA 2DWGA 3NBXX 3P8CD 1O3XA 4HFCA 3X1DA 5AQQB 4ZS2A 2XSAA 1T72A 4UVAB 1D0ZA 2NW8A 1VRBA 2V5CA 3GA8A 2EHOC 1D0XA 2XSBA 2W61A 1ZV4X 4A56A 2H7VC 4O4IE 2BVMA 3CKDA 5CJ5A 2EHOA 2H89A 4PK6A 3ZMSB 4DV2T 2YOEA 4TN7B 4F8HA 2X0CA 5HXCA 3ZKRA 2ES0A 2DL1A 3PJAJ 2HPLA 4IE7A 3I9YA 4JI3T 1ZOYA 1MMAA 5CB4E 5LB7B 3MA9A 3NKZA 5AQIB 1QLBA 4XAXB 2R6GF 3N5LA 1FJGT 4YTMA 4G2AA 5TAOA 4YT0A 2I6HA 5LHHB 2IAKA 4JI0T 3N2OA 5C2TA 3N9LA 3JCFA 3MZKB 1HS7A 3C4WA 1XNQT 2D0UA 3GN5B 4KUMB 3ZLIA 4GK0E 2WM9A 4GOUA 4AKGA 5J2TE 4IDOA 2Q9QB 2JMKA 2X51A 4P1NA 4B3TT 1XZYA 3AA0B 2WMNA 3QOFA 2UXNB 2E9XC 3R6NA 4GIWA 4PNIA 2DLRA 2NW9A 2VKDA 2LSJA 3UU8A 3F31A 5AQKB 2LSKA 3LK3B 2EHOD 4JEHB 1VOMA 4LFAT 4X64T 1KNZA 2E9XA 1D1CA 3FB2A 4YSZA 2H7OA 4HN9A 3I0OA 4H9RC 3FZHB 4HTEA 2N2NA 4I4TE 5CFBA 2YKSA 5L47A 2LM2A 3G06A 2X0YA 5HCJA 4UIGA 4PK4A 1GQEA 3K8PC 1UUSA 4U31A 2WBLA 3I0QA 5L3DB 3LSVA 3KV6A 3PUSA 5EK3A 1N34T 1FIOA 4MBQA 2NR4A 2X9XA 1Z8UA 4UF0A 4UVBB 1BR0A 3LG7A 2V1DB 3PU3A 4YTNA 3DYJA 4IT4A 3PUVF 3KBTA 4I55E 4IGUA 1HFAA 2WZIA 2CXDA 4HWCA 2CA5A 3Q5XA 2PG8A 2CEAA 2VVNA 4GYRA 2XAHB 3AEEA 4U7YA 5HAXA 1I94T 2B76A 1MIYA 2LKGA 1UK5A 3RIAA 3KFWX 1SUMB 1BR1A 4KP3C 4NUUA 5LGNB 5FMNA 2WMOA 2DHRA 2C5IT 2E9XD 3MACA 2Q9QC 5HYAA 4DR2T 3PU8A 2IW5B 3EI0A 4QH4A 4QH1A 4BJMA 3GN5A 3OBVE 1W0BA 2X67A 3PDYA 3FYQA 3EDVA 3P4SA 3EABA 5LMUT 2Q9QA 4ECGA 2FJEA 3H3AA 3WSCA 5LCYA 1M7KA 3DJBA 3SWHA 3ZCIA 4C90A 4DMWA 1D0YA 1CUNA 4EYUA 5JDLA 3RH3A 2ZM0A 5FYMA 2RP4A 4HWDA 2WDVA 4UVCB 5J1GA 2WQYA 1UCUA 2XQ6A 2V7IA 3MJXA 3AE4A 4HFIA 2JQKA 5FL1A 4X20E 2RPAA 5LJMA 3ETVA 3LK42 3Q2MA 3AXJB 4AKRB 3ONLC 5FVKA 4W8PA 4ILAA 1Z0PA 4AI6A 2WWVA 2WS3A 2WCAA 5AQNB 3IBPA 2LQUA 1DU2A 3UFEA 4LMJA 3RLFF 5AQLB 2J62A 2XM1A 3A7MA 1KEYA 1U4QA 2YINA 4DR3T 4JI6T 3AE7A 3FHNA 3JC6C 1SJ8A 4O2BE 1IJ6A 4BJNA 2LEHA 2W2UA 2CCQA 3AE6A 4IE6A 5LMNT 3I9WA 4HFVA 3F57A 4TZ4C 2RA1A 4EEDA 5FNVE 4YSXA 2V7JA 3UU4A 3KVBA 3H3MA 1SHZC 3K3OA 3K1SA 4DV6T 5LHGB 2V26A 3AA6B 2XQ9A 2YDRA 2ACZA 3AY5A 5HXSA 3OVUA 5AQGB 5J2UE 1MMGA 2YU2A 3AA7B 3AE9A 2UUAT 3O1IA 1D1BA 1J5ET 2Q9QD 4BAYB 2JQHA 4CN1A 4YTPA 2XPKA 4HFEA 4WYVA 5L3BB 2VKHA 3WI3A 2A2FX 3EDUA 2P9BA 4XZCA 5LYJE 2JJ9A 3VR9A 4QWNB 3O1HA 4KHZF 4YLHA 1OEDB 2CBIA 1CHUA 4CI3B 5E0OA 3AEFA 3C50A 2VQET 4IIJE 3LDQB 1JNRA 2A3DA 3BQIA 2QVAA 2PBIA 4NPPA 2Z6EA 3UQ4A 2WU5A 4ZZCA 5JDGA 1XDPA 4AKHA 2NTXA 4ILBA 2D5UA 3UULA 5HEUA 3S4UA 1FEWA 3OKQA 3RRWA 2CMRA 1LRZA 5JQGE 1WYBA 4Z91A 2KVPA 3PJAA 2ZMAA 5LP6E 1ZKEA 5JRCB 3JC6D 3K3QC 5HEGA 3ABVA 5LA6E 4EB6E 5HWYA 4HFBA 1MIWA 2OA5A 2KLQA 4QXBB 3M1CA 1HR0T 5LGUB 2CWOA 4HFHA 3J7Yq 2MTQA 4ZI7E 1OXZA 4ZXLA 3RHWA 3ZYKA 4IREA 4G63A 2LE8A 1XMOT 2YU1A 1KF6A 3UU3A 5L3CB 2XZEA
chains in the Genus database with same CATH topology
2X9YA 5LBQB 4ISSA 2LHRA 4UF0B 3QUJA 2LSKA 3LK3B 2EHOD 4IDZA 1VOMA 4JEHB 5AFUL 1KNZA 2E9XA 1HCIA 1D1CA 3FB2A 2H7OA 1UX5A 3L09A 4HN9A 3I0OA 3IF8B 4H9RC 3OYXA 2UXXB 2JPFA 3N9PA 4FI5A 4AXPA 3LFMA 3VJZA 2Y8DA 3L3PA 3QC9A 4HTEA 2N2NA 4I4TE 4P0AA 4U72A 4AQFC 2QGSA 1LVKA 5EZYE 4H63V 2WWUA 5FY0A 2Y6XA 5ADXL 1FMVA 3UUMA 3SS1A 4EIWA 4F6RC 5HWXA 5L3GB 2KXPB 4H63H 4KBMB 5DQVA 3ZYMA 3CQGB 4AKLA 4CI1B 4UIGA 2XAJB 4OK0A 4O4HE 5F8PA 2CXLA 3BQLA 4PK4A 3LBXA 5JDQA 1U5PA 3KV4A 2PFVA 3HKCE 1NAFA 3DP7A 2ODVA 3IHRA 3K8PC 3PUAA 3RKOA 2E8IA 3ZMUB 1T98A 1HG2A 2WBLA 3I0QA 4KMCA 1LVFA 2NWBA 5DABA 3RYHE 5L3DB 3KV6A 1G73A 3CMLA 3KV9A 3PUSA 5EK3A 5JR9B 4AQFA 1AJ3A 4IE4A 4J2CA 2DNXA 5IHYA 1FIOA 1NWMX 3NRYA 4DVDA 2IC9A 4MBQA 5FY7A 5L3EB 2HH7A 3UUXB 2VASA 3ZN0B 2YEVC 2W63A 2W62A 4PJLA 4O4LE 3UUNA 1H7CA 1HG5A 2X9XA 3N9NA 3Q5WA 4UF0A 4UVBB 5FP3A 3SOLA 5LXTE 1ZEEA 5HXEA 3HKDE 2V7MA 3LG7A 4L5GA 5DQWA 5L2LA 1BR0A 2V1DB 1G8XA 3FXDB 3PU3A 2YK0A 4ZS3A 4EOZB 4UV8B 5LNKA 3LJCA 2L9QA 1WLXA 4ZI2C 3AB3B 2BVLA 3KBTA 2B1EA 4I55E 1B7TA 1WYCA 2NOXA 3N9MA 2D0TA 4IGUA 2IC6A 1HFAA 4DBQA 2ZM8A 4E7SA 2CM0A 2WSSV 4L9IA 2CXDA 5FY1A 2CE7A 2CA5A 3Q5XA 2PG8A 2CEAA 3KV5A 5HXRA 3C4ZA 3RYIE 2SPCA 4QHOA 4UEMA 1KK7A 3BK9A 4GYRA 3UT5E 2M67A 2XAHB 5BMVE 3AAEB 3NRXA 3HR0A 4ZI3C 3J9X1 3MKDA 3O9XA 4PW8A 5HAXA 5LG4A 2VL8A 4GYSA 2KNDA 2CLYB 3N9OA 3NZQA 5JH7E 2X0LB 1MIYA 2KWHA 3N2GE 3CVRA 4CXYA 5FXXA 3RYCE 2XAQB 3C51A 5H6RB 3KFWX 2LSYA 2EHOB 1BR1A 4HGAA 4TUYE 4KP3C 4NUUA 4AKIA 5LGNB 2JMHA 5FMNA 2WMOA 4JLEA 3AT7A 1X79A 2X9HA 2LHNA 2KMFA 3R84B 3NZPA 2W00A 2JRKA 2NP9A 1IJ5A 2DHRA 3E0ZA 4B6XA 2C5IT 3ONXA 5FXVA 2E9XD 2N1GA 3FXEB 2Q9QC 3MACA 2Y48B 4HEAA 5HYAA 3PU8A 2IW5B 1MNEA 3ZC0A 5HXHA 1US7B 2W0GA 4OYKA 3RC3A 2KT9A 1FMWA 4BJMA 2DCFA 2XTLA 3GN5A 3OBVE 4I50E 2X67A 3PDYA 3PUGA 3EDVA 3CPZA 3T8OA 1BR2A 4EAHA 4P0BA 3VHLA 5FXWA 3VKGA 5JRCA 2K5BB 2XAGB 2LOSA 3TKLB 2Q9QA 4ECGA 4ZOLE 3H3AA 3V5SA 3WSCA 5LCYA 1S35A 5ETWA 4ONRA 3DJBA 3SWHA 4DNDA 5JREA 4H9NC 3ZCIA 4EZHA 2J1DG 3PURA 3F2EA 2DWKA 4HKAA 4WBOA 3N2KE 4C90A 2VWAA 2ZM2A 4DMWA 1D0YA 2GK9A 2XUEA 1WR6A 2C5JA 4DMVA 4EYYR 3ZCJA 1CUNA 4EYUA 3CX7B 4Z8XA 5JDLA 2VKJA 3RH3A 4V1Av 2ZM0A 5FYMA 4UELA 2RP4A 3ANWA 3CX6B 5EK2A 2KINB 2NW7A 3ZMVB 2VKOA 3PF0A 4UVCB 3GMIA 3P7IA 1MIVA 1HTJF 5EK4A 3CQCB 5J1GA 4BGOA 2X66A 1UCUA 1MMNA 3U3IA 2V7IA 3DTOA 4ZHQE 3MJXA 3CWZB 4U74A 1S94A 1UX4A 2LOPA 4XBFB 4UXNB 3ZJ1A 4MALA 1LKXA 4ISTA 4QXCB 3A5XA 2D2SA 1QUUA 2N9DA 4DO0A 3KBUA 5T1DA 3WURA 4X1KE 2H3RA 2VK9A 3PTRB 4X20E 2WAUA 5LJMA 4UV9B 4CXXA 3ETVA 5GONE 3LK42 3Q2MA 4X1IE 4O8SA 4IE0A 2QA7A 3AVSA 4BA9A 3RC8A 2MTCA 4AKRB 3N9QA 4K0UA 3PE0A 3ETUA 4MFRA 4JEUB 1IAPA 4PFPA 4O2AE 3V5UA 2K24A 4PAGA 3U78A 2ACXA 5JR9C 3AA1B 3CX8B 4GK5E 1Z0PA 3VU7H 2XAFB 4IHJE 4AI6A 2BZBA 2HPJA 4P09A 1SA0E 1D1AA 2BDEA 3HKEE 3EUHA 1OWAA 4ILUA 3FBZA 2K48A 3WAKA 4ZI2D 3IBPA 2LQUA 2G0UA 3UFEA 5FXZA 4OHFA 3ZYLA 4QX7B 3UTKA 4AQGA 3LK2B 1ZHCA 4N78D 4YFSA 2C0SA 3C64A 1YD8G 4PFOA 1U4QA 5JR9A 2X9WA 2YINA 1MMDA 4X1YE 4H9PC 4JUYA 5KMGP 5C8YE 3MK7C 2LSIA 4E7ZA 3CQXC 2E9XB 3D0TA 3FHNA 3JC6C 2XASB 1IJ6A 4O2BE 4BJNA 2LEHA 3I1AA 4O4JE 2CCQA 3ZC1A 3AAIA 4ZI3D 2JQQA 2L3LA 4IE6A 3SRZA 3I9WA 4EXTA 3C4XA 4HFVA 3F57A 4TZ4C 5KDMC 2RA1A 5L3FB 5FNVE 2V7JA 3KVBA 2CWYA 4MHCA 3KINB 1SHZC 3K3OA 2V26A 2PJQA 3HKBE 2DWGA 3AA6B 3NBXX 3O4XE 3P8CD 4IE5A 5LHGB 4PK5A 4H9OC 5JDNA 1O3XA 3VKHA 3RYFE 4ERRA 5HXSA 4ZS2A 3LBXB 5J2UE 3AA7B 2YU2A 1MMGA 3ZMTB 4QKNA 4CZZB 4DBRA 5KX5E 2LM9A 3O1JA 2CLYC 4UVAB 1D0ZA 3RPUA 2NW8A 3O1IA 1D1BA 2Q9QD 2MOZA 1VRBA 2XQYA 3W15B 4BAYB 5A1LA 3GA8A 2EHOC 4TX5A 2I59A 1D0XA 1HX8A 2W61A 4ASKA 3Q9DA 1ZV4X 4OFZA 2ZLYA 4TV9E 1MNDA 2C5KT 5L3BB 2VKHA 3AAAB 3WI3A 4MLKA 2A2FX 5JDFA 3E22E 3EDUA 2P9BA 4A56A 4CXWA 2H7VC 3PHF1 5LOVE 4XZCA 1HF8A 5LYJE 2V7LA 2JJ9A 3K3NA 4WNKA 4QWNB 3O1HA 4O4IE 2BVMA 4YLHA 3CKDA 4TV8E 2EHOA 4PK6A 3ZMZB 3ZMSB 4CI3B 4TN7B 5E0OA 5HXCA 3OYZA 3C50A 4CQIA 2LJLA 3B13A 2MBGA 2ES0A 3AVRA 2ODUA 2VB6A 2XHEB 4IIJE 5JVDE 4I43B 3BQKA 1E1HB 2HPLA 4IE7A 3I9YA 3QK6A 4FJOA 1MMAA 2A3DA 2NTYA 3BQIA 5CB4E 2CXFA 3MA9A 2PBIA 3M65A 4XAXB 3N5LA 2Z6EA 3RX6A 3ESLA 5JDGA 2X68A 4G2AA 4YJ3E 4YHJA 3HI2A 1WRDA 5TAOA 4AKHA 3OJAA 2NTXA 5LHHB 2IAKA 2D5UA 3B57A 3N2OA 3GWHA 3UULA 5DJQC 3WAJA 2MYSA 1QSDA 4QX8B 4HE8A 3S4UA 2LT3A 2LSGA 1YKEB 1YW0A 4H9SE 3HL6A 3N9LA 1FEWA 3OKQA 3MXZA 1V9DA 3MZKB 5F3JA 4WBNE 3RRWA 1EZ3A 3ZN1B 5IYZE 2CMRA 4H9QC 3HA4A 1LRZA 4PJMA 1HS7A 3C4WA 5H6QB 4L0RA 4CI2B 5JQGE 4EZ4A 4M1PA 1WYBA 2D0UA 3GN5B 3H37A 3PUQA 4KUMB 2ZMAA 3ZLIA 4GK0E 2WM9A 4GOUA 4OYJA 5LP6E 2KWIB 5LHIB 1ZKEA 5LJNA 4AKGA 3ZEFB 5J2TE 5JRCB 2K9AA 4PJNA 5LBMA 2A72A 3ZJ2A 3C98B 4YJ2E 5CA0E 3JC6D 3K3QC 2Q9QB 2L8KA 5LA6E 4EB6E 4WW0A 5HWYA 2JMKA 4NUVA 1MIWA 2X51A 2KLQA 2OA5A 3IEEA 4QXBB 3M1CA 4ANJA 5LGUB 4PJJA 2CWOA 5M4YA 3J7Yq 3KDSE 3AA0B 2MTQA 1BR4A 4ZI7E 2WMNA 1OXZA 3EVYA 5LGTB 3ZPOA 2UXNB 3ANWB 2E9XC 4QXHB 5CA1E 4C91A 5JDMA 5JDHA 3FBLA 3R6NA 1Y64B 3E08A 4GIWA 3ZYKA 4ADZA 2KZ7B 4PNIA 4G63A 2LE8A 2DLRA 3RRCA 2DI4A 2YU1A 2V7KA 1YKHB 2NW9A 2VKDA 5L3CB 2LSJA 1IZNB 3KVAA 3F31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXC A;  5JDF A;  5HYA A;  5HXE A;  5JDQ A;  5HXS A;  3V5U A;  5HWY A;  3V5S A;  5JDL A;  5JDG A;  5HXR A;  5HXH A;  5HWX A;  5JDM A;  5JDN A;  5JDH A; 
#chains in the Genus database with same CATH topology
 2X9Y A;  4UF0 B;  4DID B;  3QUJ A;  4IDZ A;  1HCI A;  3RKG A;  3QB5 A;  2ZM6 T;  2BBJ A;  3LFM A;  3P4W A;  2BKO A;  3QC9 A;  2XQ8 A;  4U72 A;  4TWH A;  2QGS A;  2Y6X A;  3UUM A;  3SS1 A;  5HWX A;  4H63 H;  5DQV A;  3ZYM A;  2XQ4 A;  4O4H E;  3AE5 A;  5JDQ A;  3KV4 A;  3IHR A;  3HKC E;  3PUA A;  2UUC T;  2E8I A;  4KMC A;  1LVF A;  2NWB A;  1G73 A;  2M6I A;  5JR9 B;  1OED C;  1AJ3 A;  4IE4 A;  3PUY F;  5FY7 A;  5L3E B;  2VAS A;  2V8S V;  5AQO B;  3ZN0 B;  4O4L E;  4DR6 T;  1H7C A;  5FP3 A;  2KSR A;  1ZEE A;  5HXE A;  3HKD E;  4L5G A;  3CK6 A;  1OED A;  4ZS3 A;  4EOZ B;  2L9Q A;  3AB3 B;  2BVL A;  5BR8 T;  1B7T A;  3FZM B;  3AEG A;  2D0T A;  1YXR A;  2VUR A;  4DBQ A;  2CM0 A;  2WSS V;  4ZEY A;  2LRK A;  3EAM A;  4QHO A;  4JI7 T;  3B5M A;  3UT5 E;  2XQ3 A;  3O9X A;  2I0M A;  4PW8 A;  5LG4 A;  2HHH T;  2VL8 A;  4GYS A;  2KND A;  4Z90 A;  1OED E;  3CVR A;  5AQJ B;  4CXY A;  5FXX A;  1N36 T;  3C51 A;  4TUY E;  2JMH A;  1W9R A;  4B3S T;  2X9H A;  2LHN A;  4JI4 T;  3R84 B;  3NZP A;  2W00 A;  2JRK A;  3E0Z A;  4B6X A;  2N1G A;  1HNZ T;  5JTG A;  3OPC A;  4DR5 T;  2W4X A;  1MNE A;  3ZC0 A;  5HXH A;  2KT9 A;  2JIW A;  2DCF A;  3CPZ A;  1BR2 A;  3VHL A;  5FXW A;  3VKG A;  5JRC A;  1XMQ T;  4U3C A;  4ZOL E;  3RQW A;  1S35 A;  3F2E A;  5IWA T;  3N2K E;  1J1J A;  2GK9 A;  2XUE A;  1WR6 A;  2C5J A;  4AQY T;  3QB5 K;  3CX7 B;  2CRB A;  4UEL A;  2NW7 A;  3ZMV B;  1KFY A;  4ILC A;  3PF0 A;  3P7I A;  1MIV A;  1HTJ F;  5EK4 A;  1MMN A;  1WCR A;  4KI0 F;  2LOP A;  1UX4 A;  5AQS B;  4XBF B;  3ZJ1 A;  4WZX A;  2WU2 A;  1LKX A;  4QXC B;  3A5X A;  1QUU A;  4DO0 A;  3WUR A;  4X1K E;  3PTR B;  2WAU A;  4U33 A;  4AIU A;  4CXX A;  5GON E;  4O8S A;  4IE0 A;  2QA7 A;  3TLU A;  4BA9 A;  3RC8 A;  3ETU A;  1IAP A;  4O2A E;  4PAG A;  5JR9 C;  3AA1 B;  3CX8 B;  2FBW A;  4GK5 E;  3VU7 H;  4IHJ E;  4P09 A;  2IIU A;  3HKE E;  1OWA A;  2XQ5 A;  4OHF A;  1ZHC A;  2VL0 A;  1YD8 G;  4PFO A;  5JR9 A;  2X9W A;  2BBH A;  4JUY A;  5KMG P;  3MK7 C;  2UXD T;  2V5D A;  2L10 A;  1I6Z A;  2XY8 B;  3AAI A;  2JQQ A;  2W67 A;  3C4X A;  4K0K T;  5KDM C;  2UUB T;  3AEA A;  5L3F B;  5ABF B;  3CIR A;  4YHH T;  3KIN B;  3HKB E;  2PJQ A;  4PK5 A;  4H9O C;  4JI5 T;  5JDN A;  4LFB T;  3RYF E;  3OTO T;  4DBR A;  3P4Q A;  2AE9 A;  3W15 B;  4IDQ A;  5A1L A;  2I59 A;  4U7I A;  4LMK A;  1T8B A;  3Q9D A;  2V6X A;  4TV9 E;  1MND A;  4HWF A;  3AAA B;  4MLK A;  3E22 E;  3ZT7 A;  4CXW A;  3PHF 1;  5LOV E;  3K3N A;  4WNK A;  1IBM T;  4LF8 T;  3ZMZ B;  3T1Y T;  2A9U A;  1HX1 B;  2IHR 1;  4DR1 T;  3OYZ A;  4JYA T;  4CQI A;  3B13 A;  2MBG A;  5JVD E;  5F5W A;  4X5T A;  3BQK A;  4I43 B;  4FJO A;  2NTY A;  3UU6 A;  4YJ3 E;  3HI2 A;  1WRD A;  3OJA A;  1IBK T;  1Y01 A;  3T1H T;  3RF1 A;  3P50 A;  3WAJ A;  1QSD A;  1X9B A;  4LML A;  4HE8 A;  2LT3 A;  2LSG A;  1YW0 A;  4H9S E;  1ZP0 A;  3HL6 A;  4JBW F;  1V9D A;  4GKK T;  3FZF B;  5AQM B;  4B3R T;  3AEC A;  5FZT A;  3HA4 A;  5H6Q B;  4L0R A;  4EZ4 A;  4M1P A;  3H37 A;  1XDO A;  3PUQ A;  4HWH A;  1UUR A;  4OYJ A;  1W09 A;  2KWI B;  5LHI B;  3ZEF B;  2K9A A;  2A72 A;  5CA0 E;  3C98 B;  3SFE A;  3AED A;  1N32 T;  4NUV A;  3IEE A;  4ANJ A;  4PJJ A;  4HWI B;  3KDS E;  2WY2 A;  2W66 A;  4JI2 T;  3EVY A;  5LGT B;  1IBL T;  5CGM A;  4QXH B;  4C91 A;  1Y64 B;  3VRA A;  2LRL A;  4ADZ A;  3ZST A;  3JAF A;  3RRC A;  4DR7 T;  2V7K A;  3ONJ A;  2QYW A;  4EEB A;  2QRX A;  5LBQ B;  3RIF A;  4ISS A;  2LHR A;  5AFU L;  3L09 A;  4AIS A;  3AE8 A;  2UXX B;  3N9P A;  3L3P A;  4AQF C;  1LVK A;  5EZY E;  5ABF A;  4H63 V;  5FY0 A;  1FMV A;  4F6R C;  5L3G B;  3TLW A;  2KXP B;  4KBM B;  4AKL A;  3UUB A;  5F8P A;  3BQL A;  2YN6 A;  2CBJ A;  1NAF A;  3DP7 A;  2ODV A;  2E5L T;  3ZMU B;  1T98 A;  5IUX A;  1HG2 A;  5AQU B;  3CML A;  4AQF A;  4J2C A;  2DNX A;  5IHY A;  4A98 A;  3IA3 A;  1T7S A;  2W63 A;  2W62 A;  3AE3 A;  5DQW A;  3EHZ A;  4UV8 B;  3LJC A;  2KBB A;  2B1E A;  1WYC A;  1KNR A;  2LLY A;  3N9M A;  3RQU A;  2ZM8 A;  4JI8 T;  2CE7 A;  3TLS A;  5KXJ A;  2IUB A;  3ZSS A;  4DV3 T;  2IML A;  5HXR A;  2K3W A;  1HNX T;  2XQ7 A;  3C4Z A;  4U2Z A;  5C3J A;  5HEJ A;  2WB5 A;  2D9D A;  2M67 A;  3AAE B;  3NRX A;  4ZI3 C;  3ZT6 A;  1YQ3 A;  4COF A;  3UFG A;  2CLY B;  4KX6 A;  3NZQ A;  5JH7 E;  2X0L B;  2KWH A;  4QH5 A;  5AQV B;  3RYC E;  4X66 T;  2BKP A;  2FUP A;  4AKI A;  1X79 A;  2Y48 B;  2CHN A;  4I0U A;  4CN4 A;  2W0G A;  3RC3 A;  1FMW A;  4I50 E;  2XJ7 A;  4TNW A;  1NEK A;  4EAH A;  3PUZ F;  3V5S A;  5AQR B;  4X65 T;  4U2Y A;  4DND A;  3Q5D A;  5JRE A;  4H9N C;  3PUR A;  2DWK A;  4HKA A;  4WBO A;  2VWA A;  2VQF T;  4DMV A;  4EYY R;  3PV0 F;  4Z8X A;  2VKJ A;  2F4V T;  4V1A v;  3CX6 B;  4DV5 T;  3FZL B;  2J4G A;  2VKO A;  3GMI A;  3CQC B;  4BGO A;  3DTO A;  3VRB A;  3CWZ B;  4U74 A;  1S94 A;  3JAD A;  4LF4 T;  4MAL A;  4IDN A;  4IST A;  2N9D A;  5ABE A;  3KBU A;  5T1D A;  1W0A A;  2VK9 A;  5J0Z A;  1NEN A;  1WFD A;  4DUY T;  3AVS A;  4LF7 T;  3N9Q A;  4JEU B;  4PFP A;  3V5U A;  2K24 A;  3U78 A;  2ACX A;  3AE2 A;  1HNW T;  2BZB A;  2E5V A;  2HPJ A;  1SA0 E;  1D1A A;  3EUH A;  3ZT5 A;  4ILU A;  3WAK A;  2K48 A;  5FXZ A;  3ZYL A;  4QX7 B;  5FVL A;  4NIQ A;  2C0S A;  3C64 A;  4TWF A;  3PUX F;  4H9P C;  3TLT A;  1R8I A;  2V6Y B;  4E7Z A;  3CQX C;  3I1A A;  4ZI3 D;  2L3L A;  3SRZ A;  3RIU C;  5HCM A;  2BS4 A;  1VCS A;  2HN2 A;  4MHC A;  1M62 A;  1VCT A;  3O4X E;  4IE5 A;  3VKH A;  4ERR A;  3LBX B;  3ZMT B;  4QKN A;  4CZZ B;  5KX5 E;  2LM9 A;  3O1J A;  2CLY C;  3RPU A;  3RIU A;  2MOZ A;  2XQY A;  3L8R A;  4LF6 T;  4HFD A;  4TX5 A;  5AQP B;  4KHP T;  1HX8 A;  4ASK A;  4OFZ A;  2ZLY A;  3A8Y C;  2C5K T;  2IDO B;  5JDF A;  5HEH A;  2AXD S;  1HF8 A;  2V7L A;  4DV4 T;  1E7P A;  4TV8 E;  3P4P A;  4TNV A;  2KGX A;  2LJL A;  3VR8 A;  3AVR A;  2ODU A;  2VB6 A;  2XHE B;  1L0V A;  1E1H B;  3QK6 A;  3Q5E A;  2CXF A;  3M65 A;  3RX6 A;  3ESL A;  1YQ4 A;  2X68 A;  4YHJ A;  3M3Z B;  5FL0 A;  4LF9 T;  4B3M T;  3B57 A;  3GWH A;  5DJQ C;  2MYS A;  2MAW A;  4QX8 B;  2UXC T;  1YKE B;  4Q25 A;  3MXZ A;  5F3J A;  4WBN E;  1UGO A;  1EZ3 A;  3ZN1 B;  5IYZ E;  4H9Q C;  4ZZB A;  4PJM A;  4DV7 T;  4CI2 B;  1J5W A;  1XWM A;  1E2A A;  5HEO A;  4LF5 T;  5L4E A;  2L7N A;  5LJN A;  4DR4 T;  4CN6 A;  4PJN A;  5LBM A;  3ZJ2 A;  5ABG A;  4YJ2 E;  2L8K A;  5AQT B;  4WW0 A;  2BG9 B;  2M6B A;  5M4Y A;  2XQA A;  2OLT A;  5AQH B;  1BR4 A;  1WR0 A;  3ZPO A;  3ANW B;  5CA1 E;  1JNZ A;  5JDM A;  5JDH A;  3FBL A;  2VVS A;  3E08 A;  2WDR A;  4GKJ T;  2KZ7 B;  2FJB A;  2DI4 A;  1YKH B;  3JAE A;  1IZN B;  2MPK A;  3KVA A;  3RI5 A;  2V6Y A;  1N33 T;  2BS3 A;  2YDQ A;  3FZK B;  1UX5 A;  3IF8 B;  3OYX A;  4OX9 T;  3NVO A;  2JPF A;  4FI5 A;  4AXP A;  4DV0 T;  3VJZ A;  2Y8D A;  4P0A A;  2WWU A;  5ADX L;  3L39 A;  4EIW A;  3P4R A;  3CQG B;  3UU5 A;  4CI1 B;  4JV5 T;  2XAJ B;  4OK0 A;  2CXL A;  3LBX A;  1U5P A;  2PFV A;  3RKO A;  2CHO A;  2E2A A;  5DAB A;  3RYH E;  2JQ9 A;  3KV9 A;  2BS2 A;  3RGL A;  1NWM X;  3NRY A;  4DVD A;  2IC9 A;  2HH7 A;  3UUX B;  4X62 T;  2YEV C;  4PJL A;  3UUN A;  4DUZ T;  1HG5 A;  3N9N A;  3Q5W A;  3SOL A;  5LXT E;  3AEB A;  5L2L A;  2V7M A;  1G8X A;  2H88 A;  3FXD B;  2YK0 A;  5LNK A;  3QNU A;  4IL4 A;  1WLX A;  4ZI2 C;  4YSY A;  2NOX A;  2IC6 A;  2PTF A;  4E7S A;  5ABH A;  4L9I A;  5FY1 A;  4DV1 T;  3KV5 A;  2CPT A;  5AQF B;  3RYI E;  3PUW F;  2SPC A;  4UEM A;  4JI1 T;  1KK7 A;  3BK9 A;  2LKH A;  2UXB T;  2HN1 A;  5BMV E;  2FJD A;  3HR0 A;  3J9X 1;  3MKD A;  4LFC T;  5L4H A;  3N9O A;  3N2G E;  4YXD A;  4NXN T;  2XAQ B;  5H6R B;  2LSY A;  2EHO B;  4HGA A;  4JLE A;  3AT7 A;  2UU9 T;  2KMF A;  3SFD A;  3TLV A;  4TWD A;  4A5X A;  2NP9 A;  1IJ5 A;  3ONX A;  5FXV A;  3FXE B;  4HEA A;  2BG9 C;  1US7 B;  4OYK A;  2XTL A;  3PUG A;  4IDP A;  4A97 A;  3T8O A;  4P0B A;  4EGW A;  5FKY A;  2K5B B;  4F7G B;  2XAG B;  2LOS A;  3TKL B;  2OV9 A;  4UR9 A;  5ETW A;  4ONR A;  2WP9 A;  2BG9 A;  4EZH A;  2J1D G;  1SE7 A;  2FJA A;  2ZM2 A;  3ZCJ A;  1KNP A;  5EK2 A;  3ANW A;  2KIN B;  4NXM T;  2X66 A;  2YDS A;  3U3I A;  1SJ7 A;  4ZHQ E;  4UXN B;  2D2S A;  2J47 A;  4EV6 A;  2H3R A;  4UV9 B;  1XNR T;  4X1I E;  2BG9 E;  2MTC A;  4K0U A;  3PE0 A;  3NWI A;  4MFR A;  5LG3 A;  2XM2 A;  3AE1 A;  2WZH A;  3UQ7 A;  2XAF B;  2BDE A;  2WDQ A;  3FBZ A;  4ZI2 D;  2BKN A;  2G0U A;  3UTK A;  4AQG A;  3LK2 B;  4IL9 A;  4N78 D;  4YFS A;  4YY3 T;  1MMD A;  4X1Y E;  5C8Y E;  2LSI A;  2E9X B;  3D0T A;  2X0H A;  2XAS B;  4O4J E;  3ZC1 A;  4EXT A;  3AXJ A;  2CWY A;  2DWG A;  3NBX X;  3P8C D;  1O3X A;  4HFC A;  3X1D A;  5AQQ B;  4ZS2 A;  2XSA A;  1T72 A;  4UVA B;  1D0Z A;  2NW8 A;  1VRB A;  2V5C A;  3GA8 A;  2EHO C;  1D0X A;  2XSB A;  2W61 A;  1ZV4 X;  4A56 A;  2H7V C;  4O4I E;  2BVM A;  3CKD A;  5CJ5 A;  2EHO A;  2H89 A;  4PK6 A;  3ZMS B;  4DV2 T;  2YOE A;  4TN7 B;  4F8H A;  2X0C A;  5HXC A;  3ZKR A;  2ES0 A;  2DL1 A;  3PJA J;  2HPL A;  4IE7 A;  3I9Y A;  4JI3 T;  1ZOY A;  1MMA A;  5CB4 E;  5LB7 B;  3MA9 A;  3NKZ A;  5AQI B;  1QLB A;  4XAX B;  2R6G F;  3N5L A;  1FJG T;  4YTM A;  4G2A A;  5TAO A;  4YT0 A;  2I6H A;  5LHH B;  2IAK A;  4JI0 T;  3N2O A;  5C2T A;  3N9L A;  3JCF A;  3MZK B;  1HS7 A;  3C4W A;  1XNQ T;  2D0U A;  3GN5 B;  4KUM B;  3ZLI A;  4GK0 E;  2WM9 A;  4GOU A;  4AKG A;  5J2T E;  4IDO A;  2Q9Q B;  2JMK A;  2X51 A;  4P1N A;  4B3T T;  1XZY A;  3AA0 B;  2WMN A;  3QOF A;  2UXN B;  2E9X C;  3R6N A;  4GIW A;  4PNI A;  2DLR A;  2NW9 A;  2VKD A;  2LSJ A;  3UU8 A;  3F31 A;  5AQK B;  2LSK A;  3LK3 B;  2EHO D;  4JEH B;  1VOM A;  4LFA T;  4X64 T;  1KNZ A;  2E9X A;  1D1C A;  3FB2 A;  4YSZ A;  2H7O A;  4HN9 A;  3I0O A;  4H9R C;  3FZH B;  4HTE A;  2N2N A;  4I4T E;  5CFB A;  2YKS A;  5L47 A;  2LM2 A;  3G06 A;  2X0Y A;  5HCJ A;  4UIG A;  4PK4 A;  1GQE A;  3K8P C;  1UUS A;  4U31 A;  2WBL A;  3I0Q A;  5L3D B;  3LSV A;  3KV6 A;  3PUS A;  5EK3 A;  1N34 T;  1FIO A;  4MBQ A;  2NR4 A;  2X9X A;  1Z8U A;  4UF0 A;  4UVB B;  1BR0 A;  3LG7 A;  2V1D B;  3PU3 A;  4YTN A;  3DYJ A;  4IT4 A;  3PUV F;  3KBT A;  4I55 E;  4IGU A;  1HFA A;  2WZI A;  2CXD A;  4HWC A;  2CA5 A;  3Q5X A;  2PG8 A;  2CEA A;  2VVN A;  4GYR A;  2XAH B;  3AEE A;  4U7Y A;  5HAX A;  1I94 T;  2B76 A;  1MIY A;  2LKG A;  1UK5 A;  3RIA A;  3KFW X;  1SUM B;  1BR1 A;  4KP3 C;  4NUU A;  5LGN B;  5FMN A;  2WMO A;  2DHR A;  2C5I T;  2E9X D;  3MAC A;  2Q9Q C;  5HYA A;  4DR2 T;  3PU8 A;  2IW5 B;  3EI0 A;  4QH4 A;  4QH1 A;  4BJM A;  3GN5 A;  3OBV E;  1W0B A;  2X67 A;  3PDY A;  3FYQ A;  3EDV A;  3P4S A;  3EAB A;  5LMU T;  2Q9Q A;  4ECG A;  2FJE A;  3H3A A;  3WSC A;  5LCY A;  1M7K A;  3DJB A;  3SWH A;  3ZCI A;  4C90 A;  4DMW A;  1D0Y A;  1CUN A;  4EYU A;  5JDL A;  3RH3 A;  2ZM0 A;  5FYM A;  2RP4 A;  4HWD A;  2WDV A;  4UVC B;  5J1G A;  2WQY A;  1UCU A;  2XQ6 A;  2V7I A;  3MJX A;  3AE4 A;  4HFI A;  2JQK A;  5FL1 A;  4X20 E;  2RPA A;  5LJM A;  3ETV A;  3LK4 2;  3Q2M A;  3AXJ B;  4AKR B;  3ONL C;  5FVK A;  4W8P A;  4ILA A;  1Z0P A;  4AI6 A;  2WWV A;  2WS3 A;  2WCA A;  5AQN B;  3IBP A;  2LQU A;  1DU2 A;  3UFE A;  4LMJ A;  3RLF F;  5AQL B;  2J62 A;  2XM1 A;  3A7M A;  1KEY A;  1U4Q A;  2YIN A;  4DR3 T;  4JI6 T;  3AE7 A;  3FHN A;  3JC6 C;  1SJ8 A;  4O2B E;  1IJ6 A;  4BJN A;  2LEH A;  2W2U A;  2CCQ A;  3AE6 A;  4IE6 A;  5LMN T;  3I9W A;  4HFV A;  3F57 A;  4TZ4 C;  2RA1 A;  4EED A;  5FNV E;  4YSX A;  2V7J A;  3UU4 A;  3KVB A;  3H3M A;  1SHZ C;  3K3O A;  3K1S A;  4DV6 T;  5LHG B;  2V26 A;  3AA6 B;  2XQ9 A;  2YDR A;  2ACZ A;  3AY5 A;  5HXS A;  3OVU A;  5AQG B;  5J2U E;  1MMG A;  2YU2 A;  3AA7 B;  3AE9 A;  2UUA T;  3O1I A;  1D1B A;  1J5E T;  2Q9Q D;  4BAY B;  2JQH A;  4CN1 A;  4YTP A;  2XPK A;  4HFE A;  4WYV A;  5L3B B;  2VKH A;  3WI3 A;  2A2F X;  3EDU A;  2P9B A;  4XZC A;  5LYJ E;  2JJ9 A;  3VR9 A;  4QWN B;  3O1H A;  4KHZ F;  4YLH A;  1OED B;  2CBI A;  1CHU A;  4CI3 B;  5E0O A;  3AEF A;  3C50 A;  2VQE T;  4IIJ E;  3LDQ B;  1JNR A;  2A3D A;  3BQI A;  2QVA A;  2PBI A;  4NPP A;  2Z6E A;  3UQ4 A;  2WU5 A;  4ZZC A;  5JDG A;  1XDP A;  4AKH A;  2NTX A;  4ILB A;  2D5U A;  3UUL A;  5HEU A;  3S4U A;  1FEW A;  3OKQ A;  3RRW A;  2CMR A;  1LRZ A;  5JQG E;  1WYB A;  4Z91 A;  2KVP A;  3PJA A;  2ZMA A;  5LP6 E;  1ZKE A;  5JRC B;  3JC6 D;  3K3Q C;  5HEG A;  3ABV A;  5LA6 E;  4EB6 E;  5HWY A;  4HFB A;  1MIW A;  2OA5 A;  2KLQ A;  4QXB B;  3M1C A;  1HR0 T;  5LGU B;  2CWO A;  4HFH A;  3J7Y q;  2MTQ A;  4ZI7 E;  1OXZ A;  4ZXL A;  3RHW A;  3ZYK A;  4IRE A;  4G63 A;  2LE8 A;  1XMO T;  2YU1 A;  1KF6 A;  3UU3 A;  5L3C B;  2XZE A; 
#chains in the Genus database with same CATH homology
 2X9Y A;  5LBQ B;  4ISS A;  2LHR A;  4UF0 B;  3QUJ A;  2LSK A;  3LK3 B;  2EHO D;  4IDZ A;  1VOM A;  4JEH B;  5AFU L;  1KNZ A;  2E9X A;  1HCI A;  1D1C A;  3FB2 A;  2H7O A;  1UX5 A;  3L09 A;  4HN9 A;  3I0O A;  3IF8 B;  4H9R C;  3OYX A;  2UXX B;  2JPF A;  3N9P A;  4FI5 A;  4AXP A;  3LFM A;  3VJZ A;  2Y8D A;  3L3P A;  3QC9 A;  4HTE A;  2N2N A;  4I4T E;  4P0A A;  4U72 A;  4AQF C;  2QGS A;  1LVK A;  5EZY E;  4H63 V;  2WWU A;  5FY0 A;  2Y6X A;  5ADX L;  1FMV A;  3UUM A;  3SS1 A;  4EIW A;  4F6R C;  5HWX A;  5L3G B;  2KXP B;  4H63 H;  4KBM B;  5DQV A;  3ZYM A;  3CQG B;  4AKL A;  4CI1 B;  4UIG A;  2XAJ B;  4OK0 A;  4O4H E;  5F8P A;  2CXL A;  3BQL A;  4PK4 A;  3LBX A;  5JDQ A;  1U5P A;  3KV4 A;  2PFV A;  3HKC E;  1NAF A;  3DP7 A;  2ODV A;  3IHR A;  3K8P C;  3PUA A;  3RKO A;  2E8I A;  3ZMU B;  1T98 A;  1HG2 A;  2WBL A;  3I0Q A;  4KMC A;  1LVF A;  2NWB A;  5DAB A;  3RYH E;  5L3D B;  3KV6 A;  1G73 A;  3CML A;  3KV9 A;  3PUS A;  5EK3 A;  5JR9 B;  4AQF A;  1AJ3 A;  4IE4 A;  4J2C A;  2DNX A;  5IHY A;  1FIO A;  1NWM X;  3NRY A;  4DVD A;  2IC9 A;  4MBQ A;  5FY7 A;  5L3E B;  2HH7 A;  3UUX B;  2VAS A;  3ZN0 B;  2YEV C;  2W63 A;  2W62 A;  4PJL A;  4O4L E;  3UUN A;  1H7C A;  1HG5 A;  2X9X A;  3N9N A;  3Q5W A;  4UF0 A;  4UVB B;  5FP3 A;  3SOL A;  5LXT E;  1ZEE A;  5HXE A;  3HKD E;  2V7M A;  3LG7 A;  4L5G A;  5DQW A;  5L2L A;  1BR0 A;  2V1D B;  1G8X A;  3FXD B;  3PU3 A;  2YK0 A;  4ZS3 A;  4EOZ B;  4UV8 B;  5LNK A;  3LJC A;  2L9Q A;  1WLX A;  4ZI2 C;  3AB3 B;  2BVL A;  3KBT A;  2B1E A;  4I55 E;  1B7T A;  1WYC A;  2NOX A;  3N9M A;  2D0T A;  4IGU A;  2IC6 A;  1HFA A;  4DBQ A;  2ZM8 A;  4E7S A;  2CM0 A;  2WSS V;  4L9I A;  2CXD A;  5FY1 A;  2CE7 A;  2CA5 A;  3Q5X A;  2PG8 A;  2CEA A;  3KV5 A;  5HXR A;  3C4Z A;  3RYI E;  2SPC A;  4QHO A;  4UEM A;  1KK7 A;  3BK9 A;  4GYR A;  3UT5 E;  2M67 A;  2XAH B;  5BMV E;  3AAE B;  3NRX A;  3HR0 A;  4ZI3 C;  3J9X 1;  3MKD A;  3O9X A;  4PW8 A;  5HAX A;  5LG4 A;  2VL8 A;  4GYS A;  2KND A;  2CLY B;  3N9O A;  3NZQ A;  5JH7 E;  2X0L B;  1MIY A;  2KWH A;  3N2G E;  3CVR A;  4CXY A;  5FXX A;  3RYC E;  2XAQ B;  3C51 A;  5H6R B;  3KFW X;  2LSY A;  2EHO B;  1BR1 A;  4HGA A;  4TUY E;  4KP3 C;  4NUU A;  4AKI A;  5LGN B;  2JMH A;  5FMN A;  2WMO A;  4JLE A;  3AT7 A;  1X79 A;  2X9H A;  2LHN A;  2KMF A;  3R84 B;  3NZP A;  2W00 A;  2JRK A;  2NP9 A;  1IJ5 A;  2DHR A;  3E0Z A;  4B6X A;  2C5I T;  3ONX A;  5FXV A;  2E9X D;  2N1G A;  3FXE B;  2Q9Q C;  3MAC A;  2Y48 B;  4HEA A;  5HYA A;  3PU8 A;  2IW5 B;  1MNE A;  3ZC0 A;  5HXH A;  1US7 B;  2W0G A;  4OYK A;  3RC3 A;  2KT9 A;  1FMW A;  4BJM A;  2DCF A;  2XTL A;  3GN5 A;  3OBV E;  4I50 E;  2X67 A;  3PDY A;  3PUG A;  3EDV A;  3CPZ A;  3T8O A;  1BR2 A;  4EAH A;  4P0B A;  3VHL A;  5FXW A;  3VKG A;  5JRC A;  2K5B B;  2XAG B;  2LOS A;  3TKL B;  2Q9Q A;  4ECG A;  4ZOL E;  3H3A A;  3V5S A;  3WSC A;  5LCY A;  1S35 A;  5ETW A;  4ONR A;  3DJB A;  3SWH A;  4DND A;  5JRE A;  4H9N C;  3ZCI A;  4EZH A;  2J1D G;  3PUR A;  3F2E A;  2DWK A;  4HKA A;  4WBO A;  3N2K E;  4C90 A;  2VWA A;  2ZM2 A;  4DMW A;  1D0Y A;  2GK9 A;  2XUE A;  1WR6 A;  2C5J A;  4DMV A;  4EYY R;  3ZCJ A;  1CUN A;  4EYU A;  3CX7 B;  4Z8X A;  5JDL A;  2VKJ A;  3RH3 A;  4V1A v;  2ZM0 A;  5FYM A;  4UEL A;  2RP4 A;  3ANW A;  3CX6 B;  5EK2 A;  2KIN B;  2NW7 A;  3ZMV B;  2VKO A;  3PF0 A;  4UVC B;  3GMI A;  3P7I A;  1MIV A;  1HTJ F;  5EK4 A;  3CQC B;  5J1G A;  4BGO A;  2X66 A;  1UCU A;  1MMN A;  3U3I A;  2V7I A;  3DTO A;  4ZHQ E;  3MJX A;  3CWZ B;  4U74 A;  1S94 A;  1UX4 A;  2LOP A;  4XBF B;  4UXN B;  3ZJ1 A;  4MAL A;  1LKX A;  4IST A;  4QXC B;  3A5X A;  2D2S A;  1QUU A;  2N9D A;  4DO0 A;  3KBU A;  5T1D A;  3WUR A;  4X1K E;  2H3R A;  2VK9 A;  3PTR B;  4X20 E;  2WAU A;  5LJM A;  4UV9 B;  4CXX A;  3ETV A;  5GON E;  3LK4 2;  3Q2M A;  4X1I E;  4O8S A;  4IE0 A;  2QA7 A;  3AVS A;  4BA9 A;  3RC8 A;  2MTC A;  4AKR B;  3N9Q A;  4K0U A;  3PE0 A;  3ETU A;  4MFR A;  4JEU B;  1IAP A;  4PFP A;  4O2A E;  3V5U A;  2K24 A;  4PAG A;  3U78 A;  2ACX A;  5JR9 C;  3AA1 B;  3CX8 B;  4GK5 E;  1Z0P A;  3VU7 H;  2XAF B;  4IHJ E;  4AI6 A;  2BZB A;  2HPJ A;  4P09 A;  1SA0 E;  1D1A A;  2BDE A;  3HKE E;  3EUH A;  1OWA A;  4ILU A;  3FBZ A;  2K48 A;  3WAK A;  4ZI2 D;  3IBP A;  2LQU A;  2G0U A;  3UFE A;  5FXZ A;  4OHF A;  3ZYL A;  4QX7 B;  3UTK A;  4AQG A;  3LK2 B;  1ZHC A;  4N78 D;  4YFS A;  2C0S A;  3C64 A;  1YD8 G;  4PFO A;  1U4Q A;  5JR9 A;  2X9W A;  2YIN A;  1MMD A;  4X1Y E;  4H9P C;  4JUY A;  5KMG P;  5C8Y E;  3MK7 C;  2LSI A;  4E7Z A;  3CQX C;  2E9X B;  3D0T A;  3FHN A;  3JC6 C;  2XAS B;  1IJ6 A;  4O2B E;  4BJN A;  2LEH A;  3I1A A;  4O4J E;  2CCQ A;  3ZC1 A;  3AAI A;  4ZI3 D;  2JQQ A;  2L3L A;  4IE6 A;  3SRZ A;  3I9W A;  4EXT A;  3C4X A;  4HFV A;  3F57 A;  4TZ4 C;  5KDM C;  2RA1 A;  5L3F B;  5FNV E;  2V7J A;  3KVB A;  2CWY A;  4MHC A;  3KIN B;  1SHZ C;  3K3O A;  2V26 A;  2PJQ A;  3HKB E;  2DWG A;  3AA6 B;  3NBX X;  3O4X E;  3P8C D;  4IE5 A;  5LHG B;  4PK5 A;  4H9O C;  5JDN A;  1O3X A;  3VKH A;  3RYF E;  4ERR A;  5HXS A;  4ZS2 A;  3LBX B;  5J2U E;  3AA7 B;  2YU2 A;  1MMG A;  3ZMT B;  4QKN A;  4CZZ B;  4DBR A;  5KX5 E;  2LM9 A;  3O1J A;  2CLY C;  4UVA B;  1D0Z A;  3RPU A;  2NW8 A;  3O1I A;  1D1B A;  2Q9Q D;  2MOZ A;  1VRB A;  2XQY A;  3W15 B;  4BAY B;  5A1L A;  3GA8 A;  2EHO C;  4TX5 A;  2I59 A;  1D0X A;  1HX8 A;  2W61 A;  4ASK A;  3Q9D A;  1ZV4 X;  4OFZ A;  2ZLY A;  4TV9 E;  1MND A;  2C5K T;  5L3B B;  2VKH A;  3AAA B;  3WI3 A;  4MLK A;  2A2F X;  5JDF A;  3E22 E;  3EDU A;  2P9B A;  4A56 A;  4CXW A;  2H7V C;  3PHF 1;  5LOV E;  4XZC A;  1HF8 A;  5LYJ E;  2V7L A;  2JJ9 A;  3K3N A;  4WNK A;  4QWN B;  3O1H A;  4O4I E;  2BVM A;  4YLH A;  3CKD A;  4TV8 E;  2EHO A;  4PK6 A;  3ZMZ B;  3ZMS B;  4CI3 B;  4TN7 B;  5E0O A;  5HXC A;  3OYZ A;  3C50 A;  4CQI A;  2LJL A;  3B13 A;  2MBG A;  2ES0 A;  3AVR A;  2ODU A;  2VB6 A;  2XHE B;  4IIJ E;  5JVD E;  4I43 B;  3BQK A;  1E1H B;  2HPL A;  4IE7 A;  3I9Y A;  3QK6 A;  4FJO A;  1MMA A;  2A3D A;  2NTY A;  3BQI A;  5CB4 E;  2CXF A;  3MA9 A;  2PBI A;  3M65 A;  4XAX B;  3N5L A;  2Z6E A;  3RX6 A;  3ESL A;  5JDG A;  2X68 A;  4G2A A;  4YJ3 E;  4YHJ A;  3HI2 A;  1WRD A;  5TAO A;  4AKH A;  3OJA A;  2NTX A;  5LHH B;  2IAK A;  2D5U A;  3B57 A;  3N2O A;  3GWH A;  3UUL A;  5DJQ C;  3WAJ A;  2MYS A;  1QSD A;  4QX8 B;  4HE8 A;  3S4U A;  2LT3 A;  2LSG A;  1YKE B;  1YW0 A;  4H9S E;  3HL6 A;  3N9L A;  1FEW A;  3OKQ A;  3MXZ A;  1V9D A;  3MZK B;  5F3J A;  4WBN E;  3RRW A;  1EZ3 A;  3ZN1 B;  5IYZ E;  2CMR A;  4H9Q C;  3HA4 A;  1LRZ A;  4PJM A;  1HS7 A;  3C4W A;  5H6Q B;  4L0R A;  4CI2 B;  5JQG E;  4EZ4 A;  4M1P A;  1WYB A;  2D0U A;  3GN5 B;  3H37 A;  3PUQ A;  4KUM B;  2ZMA A;  3ZLI A;  4GK0 E;  2WM9 A;  4GOU A;  4OYJ A;  5LP6 E;  2KWI B;  5LHI B;  1ZKE A;  5LJN A;  4AKG A;  3ZEF B;  5J2T E;  5JRC B;  2K9A A;  4PJN A;  5LBM A;  2A72 A;  3ZJ2 A;  3C98 B;  4YJ2 E;  5CA0 E;  3JC6 D;  3K3Q C;  2Q9Q B;  2L8K A;  5LA6 E;  4EB6 E;  4WW0 A;  5HWY A;  2JMK A;  4NUV A;  1MIW A;  2X51 A;  2KLQ A;  2OA5 A;  3IEE A;  4QXB B;  3M1C A;  4ANJ A;  5LGU B;  4PJJ A;  2CWO A;  5M4Y A;  3J7Y q;  3KDS E;  3AA0 B;  2MTQ A;  1BR4 A;  4ZI7 E;  2WMN A;  1OXZ A;  3EVY A;  5LGT B;  3ZPO A;  2UXN B;  3ANW B;  2E9X C;  4QXH B;  5CA1 E;  4C91 A;  5JDM A;  5JDH A;  3FBL A;  3R6N A;  1Y64 B;  3E08 A;  4GIW A;  3ZYK A;  4ADZ A;  2KZ7 B;  4PNI A;  4G63 A;  2LE8 A;  2DLR A;  3RRC A;  2DI4 A;  2YU1 A;  2V7K A;  1YKH B;  2NW9 A;  2VKD A;  5L3C B;  2LSJ A;  1IZN B;  3KVA A;  3F31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...