5JDMA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 0.1mm sr2+
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
300
structure length
294
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIENPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium-calcium exchanger NCX_Mj
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 126
structure length 294
sequence length 300
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdmA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdmA02
5HXHA 5HWYA 5JDFA 3V5SA 3V5UA 5HXRA 5JDGA 5HXCA 5HWXA 5HXSA 5JDNA 5JDHA 5HXEA 5JDMA 5JDQA 5HYAA 5JDLA
chains in the Genus database with same CATH superfamily
2UUCT 3HR0A 3KV4A 4DV6T 4AKRB 3HKCE 4UV8B 2XSAA 2KZ7B 5LGTB 2W61A 3OYZA 5HCJA 5LB7B 1NENA 1UK5A 3GN5B 3LK2B 3C4WA 2CBJA 3ZYLA 5JREA 3K8PC 2EHOB 3AY5A 2FJEA 3P4SA 2UXCT 3UU5A 1SJ8A 4DV7T 2YEVC 3CX7B 3UFGA 1N34T 4IE5A 5JQGE 4KX6A 3N9MA 4JI1T 4X65T 1Y64B 3NZPA 4O4IE 2CXDA 4CI1B 3A7MA 2IIUA 5CJ5A 2V6YA 4Z91A 1J1JA 3AA1B 2PFVA 3CPZA 4JV5T 3P4PA 2D0UA 3VRBA 4HWFA 4EEDA 3O9XA 3RYHE 4L5GA 2XZEA 2UUBT 2ES0A 4JBWF 4NXNT 3ZCJA 3E0ZA 4LMJA 5CGMA 4HWIB 1IJ6A 3TLTA 4X20E 2X67A 3JC6C 4QKNA 4TV9E 5IYZE 4ILCA 5LCYA 4CQIA 3TKLB 2CLYB 2HPJA 5HAXA 4EEBA 1UX5A 1IZNB 1V9DA 4EB6E 3N9LA 4OHFA 3V5SA 4HWHA 2YU1A 4G2AA 5L3DB 3VKGA 3ZSSA 2K24A 2CPTA 2JQ9A 2CRBA 2I0MA 3FB2A 1I94T 4EZHA 4QH5A 3KBTA 3P50A 3PV0F 3RIUC 4DR7T 3AVRA 3CQCB 4IDNA 3A5XA 2C0SA 3N9NA 1UGOA 4ZOLE 3HKEE 3MA9A 5LOVE 3RHWA 1E7PA 4CN4A 5L3EB 4Q25A 5EK2A 3RYCE 4KHPT 3SFEA 5AFUL 2XASB 4O4HE 3C64A 3IEEA 2LEHA 3RIUA 2VB6A 3FZKB 5ABFA 4ISTA 2WZHA 3JAFA 1SHZC 3MKDA 1UCUA 4IE4A 4TWFA 1JNZA 3E08A 5GONE 2XQ7A 2W63A 2V6YB 3ESLA 2K48A 3ZMZB 4PW8A 2X9XA 4ZI3C 5AQHB 5LYJE 4WBOA 4Z90A 3PJAJ 2LSJA 1HX1B 2BKPA 4G63A 4LMKA 5AQRB 4ILBA 2QGSA 4P09A 3G06A 4HFDA 1R8IA 4UR9A 1AJ3A 4ZI2C 4CZZB 3AEGA 4JUYA 2W00A 4X62T 2VVSA 3RRCA 4E7ZA 2J4GA 4AKLA 5FVKA 5AQOB 1FIOA 3OKQA 4QX8B 2XTLA 2VL0A 1HNWT 1JNRA 4CN1A 4OYJA 1HTJF 3H3MA 5LBQB 2E8IA 5LGUB 1ZKEA 2KGXA 1ZHCA 3PUSA 1O3XA 2PG8A 1YD8G 4NUUA 5FMNA 5LHHB 4GK5E 2DCFA 3P4QA 2XQ3A 2WS3A 1MNEA 3AE4A 4ZEYA 5J2UE 4DV3T 3RC3A 3LBXA 2ZM8A 3B13A 5LBMA 4H9NC 2NW7A 1D0ZA 3O1IA 3IF8B 4UVCB 5J0ZA 2PJQA 2WWUA 3I9WA 5ABFB 3J9X1 2YKSA 4GYRA 2CWOA 2B1EA 5LG3A 5JRCA 5L47A 1XWMA 3JC6D 4J2CA 1UX4A 4PFOA 4YJ3E 4DIDB 3N9OA 3ZMUB 5DJQC 4EOZB 2X0LB 1LVKA 2JQHA 1DU2A 5LNKA 4WNKA 5FVLA 2V7KA 5FKYA 2M6BA 3CIRA 2DL1A 4U31A 5LHIB 3AE5A 3MACA 2UU9T 1CUNA 1UURA 5ABGA 3UTKA 3NZQA 1QSDA 5AQUB 3SRZA 4QWNB 2ODVA 2KSRA 3CWZB 4DV0T 3BQIA 4ECGA 4I4TE 2MAWA 5JDNA 4LFCT 3CMLA 5FZTA 5HCMA 2A3DA 2Q9QA 4BJMA 1YW0A 1FMWA 5HXEA 3UU8A 3I1AA 3EUHA 4YSYA 4U2ZA 5H6QB 2JMHA 2CA5A 2LSIA 2KLQA 1WYCA 2EHOC 1YQ3A 4BGOA 3ZT6A 1VRBA 5JTGA 4IDPA 3T1YT 2VWAA 4A5XA 2YINA 4DNDA 1VCTA 1LKXA 4ASKA 3AE9A 3M65A 3TLWA 5FXZA 3K3OA 2Y48B 1VOMA 1I6ZA 4ZZBA 2L8KA 1L0VA 4JI7T 4ZI3D 5HEJA 3E22E 1U5PA 4YXDA 3LBXB 2UXDT 3AE1A 2K5BB 3WAKA 4DUYT 5LGNB 2MYSA 3PUYF 3C4ZA 3GWHA 5ABEA 1HNZT 2IUBA 4LFBT 2VURA 2VQFT 5EK3A 5JH7E 2WDVA 3OBVE 2KBBA 4B3ST 3H37A 4ZI2D 5FNVE 5CFBA 4LF8T 4JLEA 5JRCB 2ACXA 4OK0A 2BKOA 1EZ3A 4UEMA 1WCRA 2NW8A 3RKOA 2I6HA 2CLYC 4JEHB 4IHJE 2J62A 4UXNB 4TNVA 4BJNA 3NBXX 4M1PA 4U2YA 1MMDA 2DWGA 1G73A 5F3JA 3B5MA 3RIAA 2FJBA 3FXDB 2DNXA 2NP9A 4W8PA 4NUVA 3ZMVB 1M7KA 2CXFA 1IBMT 3M1CA 4YTNA 5AQGB 2Q9QB 3N9PA 2WAUA 5CA0E 5KX5E 1YQ4A 4LF6T 4WW0A 3EVYA 4MHCA 3WAJA 2CCQA 2VL8A 2ODUA 2Z6EA 3PURA 5IUXA 4DMWA 4TWDA 2BS3A 2QYWA 4ZZCA 4FI5A 3RF1A 2I59A 2XAJB 4MALA 3UQ7A 2BKNA 3RGLA 4NIQA 2E5LT 5L2LA 2MOZA 5ETWA 4X1KE 3F2EA 2W2UA 2X66A 2CM0A 4QHOA 2VKHA 4HFBA 3SOLA 3P4WA 1KFYA 3OJAA 4ADZA 4YSZA 3AECA 4EIWA 3EABA 4IGUA 2DI4A 4B6XA 3UQ4A 4ZXLA 4AI6A 1SJ7A 1S94A 5LJMA 1ZP0A 2D2SA 2CE7A 3AAEB 3AE6A 2HHHT 5JDHA 3Q5XA 2FJDA 3ZMSB 3HI2A 3PUWF 4C91A 2J1DG 4UF0A 5HXSA 3P4RA 4DMVA 2CWYA 1MMNA 2XY8B 3AB3B 5JDGA 5AQFB 2LM2A 4TUYE 1MIVA 2EHOD 4DR1T 3P8CD 2V7IA 4EZ4A 3AVSA 3PDYA 4K0KT 3PE0A 3FXEB 5AQMB 4H9QC 5KXJA 4JI5T 2YN6A 2F4VT 4B3MT 1J5WA 4HE8A 3GMIA 4BAYB 1E2AA 4U7YA 4YY3T 1M62A 2V7LA 2XAFB 4YSXA 4AISA 2IMLA 2KNDA 2X9YA 4MLKA 2HH7A 3RQUA 3AAAB 5L4HA 2K3WA 3RC8A 2CMRA 2W67A 3KV9A 4PFPA 3DTOA 3LG7A 2LRKA 2C5IT 1SUMB 4DR6T 2BG9A 5EZYE 1KNRA 1WR0A 4U7IA 4YHJA 3OPCA 5AQQB 2ZM2A 4U74A 4QH1A 2NOXA 2XSBA 4IDOA 2HPLA 3UUXB 4U3CA 3KVAA 4H9PC 2LSGA 2XHEB 2CXLA 4NXMT 3TLVA 2H7VC 2DLRA 2B76A 2RP4A 2WCAA 5L4EA 3Q9DA 4B3TT 2XUEA 3ANWA 3CX8B 3RRWA 4DR2T 4UVAB 4DBRA 4KHZF 2WDRA 3KVBA 1MMAA 5BMVE 5AQIB 4HFVA 3AE3A 4HN9A 4HKAA 3ZMTB 2BVMA 3LFMA 4GKJT 3CX6B 2PTFA 4UVBB 4UF0B 2VK9A 5F8PA 2VKOA 4HFHA 1XZYA 3ZN0B 1LRZA 5T1DA 5BR8T 4P1NA 2KT9A 2JPFA 2JJ9A 5HEUA 2AXDS 3R84B 2VKJA 1ZEEA 4X1IE 4ONRA 2FBWA 3NVOA 2FUPA 3EDVA 5JDMA 1HS7A 2BS4A 4EV6A 4EYUA 1NAFA 1D1CA 1WYBA 4O2BE 2WZIA 4KP3C 4DR4T 4YHHT 5LHGB 5L3CB 4GOUA 1KNZA 3ZN1B 2JRKA 2DWKA 5HXHA 5F5WA 2Y8DA 2W62A 2BG9B 3SWHA 4EGWA 2GK9A 3FYQA 2VASA 4YFSA 2XPKA 4ILUA 1MMGA 2QA7A 2C5JA 3CVRA 3S4UA 2LT3A 1YKEB 3UUBA 2JIWA 2CHOA 3L39A 3RX6A 3A8YC 2ZLYA 4H9SE 5FXWA 5AQNB 3RLFF 1BR1A 4JI6T 1HCIA 3ANWB 3PUXF 2KWHA 2NWBA 3QC9A 5HYAA 2FJAA 3RIFA 4TN7B 2V6XA 1IBKT 4H9OC 2LSKA 2X51A 1OXZA 2BZBA 2Q9QC 3DJBA 4MFRA 3C50A 2Y6XA 3T8OA 3ZYKA 3AA7B 4HFCA 3QUJA 2V5CA 2ZM6T 2D5UA 4IT4A 3HKBE 2X68A 4CXXA 4K0UA 2JQQA 2WU2A 2W66A 3ZJ2A 5TAOA 1E1HB 3CKDA 4C90A 1Y01A 2LM9A 3WSCA 5HXCA 5E0OA 2ACZA 3UT5E 1SA0E 1IJ5A 2KVPA 3RH3A 2WDQA 4F7GB 3PUZF 4DV5T 5FYMA 3AEAA 2XAHB 4GKKT 4AQYT 1HG2A 3PTRB 2IDOB 4OYKA 1D0XA 5LG4A 2WP9A 2WU5A 4ANJA 3AEFA 1H7CA 2KWIB 3UUNA 2LKGA 2YDQA 4QXHB 5HXRA 2XQ4A 4BA9A 4IE6A 4PK6A 3RI5A 4WZXA 1UUSA 2LOPA 4AKGA 4HFEA 5LXTE 2XQ6A 1D0YA 1Z8UA 4HGAA 4EAHA 3AT7A 3L8RA 2BBJA 1T7SA 4U72A 4QX7B 2X0CA 3ZT7A 4HWDA 3KBUA 4V1Av 3ABVA 2YOEA 5ABHA 5L3BB 4I0UA 4ILAA 3FZFB 4YJ2E 3RPUA 5JR9B 5HEGA 2VKDA 3VU7H 1QUUA 2WB5A 2BDEA 3O4XE 1N32T 1LVFA 2CHNA 3VR9A 2OLTA 3PJAA 3Q5EA 1HFAA 3UUMA 4XZCA 4O8SA 2RA1A 4LMLA 2VVNA 4LFAT 4GYSA 4HFIA 4HEAA 2XAGB 4OX9T 4I43B 3JADA 3C51A 4YT0A 3U3IA 3HA4A 3N9QA 1IAPA 3AA6B 3PU8A 4A98A 4JYAT 3GA8A 2L3LA 3BQKA 4KMCA 4TZ4C 3VR8A 3PUQA 5JDQA 3PUGA 2LHRA 2M6IA 1HX8A 2YK0A 1D1BA 3WI3A 4O4LE 4PJJA 1W0AA 4ZS3A 5FY0A 2P9BA 5L3FB 2OV9A 4QH4A 3U78A 4ERRA 3SFDA 4CI3B 4P0BA 5FXVA 4IL4A 4JI2T 2WBLA 3N5LA 4I50E 3MK7C 1XNQT 2W0GA 3UULA 1ZV4X 3FZMB 3L3PA 4LF5T 3ZC0A 2QVAA 3ZEFB 1OEDB 1SE7A 3IBPA 3D0TA 2Q9QD 4TX5A 3NKZA 4IDQA 2LHNA 4X5TA 2XQAA 1MIWA 4JI4T 2V26A 3I9YA 3KV6A 2BS2A 4PK5A 3O1HA 2QRXA 5FP3A 5AQJB 3NRXA 3FBLA 2M67A 1XDPA 1HF8A 4E7SA 4DV2T 1US7B 3PUAA 3C4XA 3NRYA 2NW9A 4GK0E 2LJLA 4AXPA 2NTYA 2V1DB 3R6NA 4LF9T 3JAEA 5FY1A 5JDFA 3UU3A 4IREA 4X64T 3ZKRA 3SS1A 4ZHQE 3ZC1A 4WYVA 1XMQT 4DV4T 3TLSA 4HTEA 2XQ8A 2X9WA 5A1LA 1HNXT 1XDOA 4TV8E 1G8XA 2OA5A 3LJCA 3OYXA 2X0HA 2BG9E 4ZS2A 1X9BA 4H63V 4YTMA 2BG9C 1B7TA 3V5UA 2XQYA 5AQTB 4JEUB 3AE7A 2L9QA 3AE2A 4X1YE 1WRDA 3ZSTA 2H88A 4ZI7E 1FMVA 3RYFE 4NPPA 2L7NA 3N2GE 3ETUA 3WURA 1VCSA 2CBIA 1U4QA 3PHF1 5CB4E 2L10A 4B3RT 5IWAT 3K3NA 2UUAT 1WFDA 1BR0A 4IE0A 3KINB 4U33A 2J47A 2NR4A 5LMUT 2YU2A 5KDMC 4PJLA 2C5KT 4AQFC 1T98A 3JCFA 4GIWA 3PU3A 2LSYA 2X9HA 2ZMAA 3FZLB 1KK7A 3K1SA 2IHR1 1IBLT 2IAKA 4UIGA 5M4YA 1WR6A 2HN2A 3QB5K 4AKIA 4AQFA 4DUZT 3FBZA 1GQEA 1W09A 2N1GA 2XM1A 4IDZA 1ZOYA 3I0QA 4QXCB 2JMKA 4HWCA 2JQKA 2UXBT 1NEKA 5AQSB 4DV1T 5AQKB 5LMNT 5FY7A 1N36T 3FHNA 2IW5B 1MIYA 3AE8A 2D0TA 1NWMX 3DYJA 4MBQA 4N78D 2XM2A 3I0OA 4EYYR 4CN6A 2MTQA 5ADXL 5LJNA 3QK6A 2DHRA 2VQET 2A72A 5FXXA 2AE9A 3KV5A 4L0RA 2E9XC 4JI3T 4KUMB 5AQVB 3ONLC 3TLUA 2WY2A 2ZM0A 4KBMB 3F31A 2XQ9A 4IL9A 2E5VA 2WSSV 3EHZA 5J1GA 3AAIA 3KFWX 4ISSA 2LQUA 4I55E 5AQPB 3DP7A 2UXNB 4A97A 3BK9A 3QNUA 2E9XA 1T72A 3IHRA 5LP6E 4UELA 4IE7A 2BVLA 3Q5WA 4DR3T 3UU6A 5JR9C 3FZHB 1T8BA 2LOSA 2LLYA 3H3AA 2PBIA 3UFEA 3K3QC 3OVUA 3VHLA 3X1DA 3P7IA 5JDLA 2R6GF 3L09A 3RKGA 4FJOA 5H6RB 2CEAA 5FL1A 5HEOA 5C3JA 3LDQB 1BR2A 5JR9A 1J5ET 1XNRT 2WQYA 4O4JE 1N33T 1D1AA 4PJMA 2WMOA 2KXPB 3ZCIA 5AQLB 3CQGB 2V8SV 3J7Yq 1WLXA 2IC9A 1W0BA 1CHUA 3B57A 3ZLIA 4X66T 3T1HT 3AA0B 3EAMA 5LA6E 1BR4A 3W15B 2WM9A 3AEEA 3MZKB 1MNDA 3O1JA 1OWAA 4H9RC 1Z0PA 2XAQB 4LF7T 4YTPA 3PUVF 5JVDE 3NWIA 3F57A 5HWXA 3ONXA 4L9IA 3ZT5A 1KEYA 1OEDE 3MXZA 4KI0F 3LK3B 3M3ZB 3PF0A 3ONJA 3EDUA 1OEDC 2N2NA 2H89A 3AXJA 4P0AA 2H7OA 3AEBA 2G0UA 2UXXB 2NTXA 5HEHA 3N2KE 3EI0A 3ZPOA 4O2AE 2V7JA 2E9XB 2V7MA 2A9UA 2YDRA 3N2OA 2LKHA 3CK6A 4DO0A 3OTOT 1YXRA 2WWVA 4UV9B 1OEDA 2KINB 5DABA 2KMFA 1HR0T 1QLBA 2E2AA 3LSVA 5IHYA 5DQWA 2MPKA 4CI2B 4F8HA 5KMGP 3Q2MA 3HL6A 2N9DA 2HN1A 4QXBB 3ZJ1A 3GN5A 4IIJE 2W4XA 4AKHA 1XMOT 1YKHB 2YDSA 3KDSE 2EHOA 2LE8A 4H63H 4WBNE 2E9XD 3IA3A 4DR5T 4AIUA 4XBFB 3CQXC 1KF6A 4Z8XA 2BBHA 1X79A 3HKDE 4XAXB 3Q5DA 1FEWA 5EK4A 1HG5A 4A56A 3ZYMA 4JI8T 4DVDA 2H3RA 4OFZA 2IC6A 2K9AA 3QB5A 5DQVA 4F6RC 4DBQA 3MJXA 5C8YE 3UU4A 2X0YA 2D9DA 2WMNA 4JI0T 4PNIA 3RYIE 3AEDA 4LF4T 4CXWA 5CA1E 4PJNA 2MBGA 1KNPA 3ETVA 2SPCA 2XQ5A 3AXJB 3BQLA 2MTCA 4CXYA 2V5DA 3LK42 4PAGA 2LRLA 4TNWA 5HWYA 3VJZA 2XJ7A 1FJGT 4COFA 2RPAA 1S35A 4TWHA 5C2TA 3RQWA 4EXTA 3C98B 1W9RA 5J2TE 5FL0A 2A2FX 5L3GB 4PK4A 3VKHA 4AQGA 3VRAA 4YLHA 3QOFA
chains in the Genus database with same CATH topology
4YFSA 4GIWA 3PU3A 2LSYA 1LKXA 2X9HA 4ASKA 3HR0A 4ILUA 3KV4A 1MMGA 2QA7A 3M65A 5FXZA 3K3OA 2C5JA 3HKCE 4AKRB 2Y48B 3CVRA 2ZMAA 1VOMA 4UV8B 3S4UA 2KZ7B 2L8KA 5LGTB 2W61A 3OYZA 1KK7A 4ZI3D 3GN5B 2LT3A 1YKEB 2IAKA 3E22E 4UIGA 3LK2B 1U5PA 3C4WA 5M4YA 1WR6A 3RX6A 3ZYLA 3LBXB 2K5BB 2ZLYA 4H9SE 5FXWA 5JREA 3K8PC 2EHOB 3WAKA 1BR1A 5LGNB 1HCIA 2MYSA 3C4ZA 3ANWB 4AKIA 3GWHA 4AQFA 2KWHA 3FBZA 2NWBA 3QC9A 2N1GA 5HYAA 2YEVC 3CX7B 5EK3A 4IDZA 5JH7E 4TN7B 3OBVE 4IE5A 5JQGE 3I0QA 3H37A 4ZI2D 4QXCB 5FNVE 2JMKA 3N9MA 4JLEA 5JRCB 2ACXA 2LSKA 4H9OC 4OK0A 2X51A 1OXZA 2BZBA 1EZ3A 1Y64B 2Q9QC 3NZPA 3FHNA 2CXDA 3DJBA 4O4IE 5FY7A 4CI1B 2IW5B 4UEMA 1MIYA 3C50A 4MFRA 2NW8A 2D0TA 1NWMX 3RKOA 2Y6XA 4MBQA 4N78D 3T8OA 3ZYKA 3AA7B 3I0OA 4EYYR 2CLYC 3QUJA 2MTQA 4IHJE 4JEHB 3AA1B 2D5UA 5ADXL 5LJNA 3QK6A 2DHRA 4UXNB 2PFVA 3CPZA 4BJNA 2A72A 2D0UA 5FXXA 3HKBE 3NBXX 3O9XA 3KV5A 2X68A 4M1PA 3RYHE 4CXXA 4K0UA 4L5GA 1MMDA 4L0RA 2E9XC 2JQQA 2DWGA 1G73A 4KUMB 5F3JA 3ZJ2A 5TAOA 2ES0A 1E1HB 3CKDA 4C90A 3FXDB 2DNXA 2NP9A 2LM9A 2ZM0A 3WSCA 4KBMB 4NUVA 5HXCA 3ZCJA 5E0OA 3ZMVB 3UT5E 1SA0E 1IJ5A 2CXFA 3E0ZA 3F31A 3RH3A 3M1CA 1IJ6A 4X20E 2Q9QB 2X67A 3N9PA 3JC6C 2WAUA 5FYMA 2WSSV 4QKNA 4TV9E 5CA0E 5KX5E 5IYZE 5J1GA 2XAHB 3AAIA 5LCYA 3KFWX 4ISSA 1HG2A 4WW0A 4CQIA 3TKLB 2LQUA 3PTRB 2CLYB 3EVYA 4I55E 4OYKA 4MHCA 3WAJA 1D0XA 2CCQA 2HPJA 5HAXA 2VL8A 1UX5A 3DP7A 5LG4A 1IZNB 2ODUA 2UXNB 3BK9A 1V9DA 4EB6E 2E9XA 2Z6EA 3IHRA 3N9LA 3PURA 4OHFA 4ANJA 3V5SA 4DMWA 1H7CA 2YU1A 4G2AA 2KWIB 3UUNA 4FI5A 5L3DB 3VKGA 5LP6E 2K24A 4UELA 4IE7A 2BVLA 4QXHB 3Q5WA 5HXRA 2I59A 4BA9A 4IE6A 5JR9C 4PK6A 3FB2A 2XAJB 4MALA 2LOSA 4EZHA 3KBTA 2LOPA 5L2LA 3H3AA 2MOZA 3AVRA 2PBIA 3UFEA 3CQCB 3K3QC 5ETWA 3VHLA 4X1KE 3A5XA 3F2EA 2C0SA 4AKGA 3P7IA 5LXTE 5JDLA 1D0YA 2X66A 3N9NA 2CM0A 4QHOA 2VKHA 4HGAA 4ZOLE 3HKEE 3MA9A 5LOVE 4EAHA 3AT7A 3L09A 3SOLA 3OJAA 4ADZA 4FJOA 5L3EB 4U72A 5H6RB 4QX7B 2CEAA 4EIWA 5EK2A 3RYCE 3KBUA 4V1Av 4IGUA 2DI4A 4B6XA 5AFUL 2XASB 4O4HE 1BR2A 5JR9A 4AI6A 3C64A 5L3BB 3IEEA 4O4JE 1D1AA 4PJMA 1S94A 2LEHA 4YJ2E 2VB6A 3RPUA 2WMOA 5JR9B 5LJMA 2KXPB 3ZCIA 2D2SA 4ISTA 2VKDA 3CQGB 3VU7H 2CE7A 1QUUA 3J7Yq 3AAEB 1WLXA 2BDEA 2IC9A 5JDHA 3O4XE 3Q5XA 3B57A 1LVFA 3ZLIA 3ZMSB 3HI2A 1SHZC 3MKDA 4C91A 1UCUA 2J1DG 4IE4A 3AA0B 4UF0A 5HXSA 1HFAA 5LA6E 4DMVA 3UUMA 2CWYA 1MMNA 3E08A 1BR4A 4O8SA 4XZCA 5GONE 3W15B 2RA1A 2WM9A 3AB3B 2W63A 3ESLA 5JDGA 2K48A 4GYSA 3ZMZB 4PW8A 2X9XA 4HEAA 2XAGB 4ZI3C 3MZKB 4I43B 1MNDA 3O1JA 4TUYE 5LYJE 1OWAA 3C51A 1MIVA 4H9RC 2EHOD 1Z0PA 4WBOA 3P8CD 2V7IA 2LSJA 2XAQB 4EZ4A 3U3IA 3HA4A 3AVSA 3PDYA 3PE0A 3N9QA 1IAPA 3FXEB 4G63A 3AA6B 5JVDE 3F57A 4H9QC 5HWXA 3PU8A 3ONXA 2QGSA 4L9IA 3GA8A 4P09A 2L3LA 3BQKA 4KMCA 4TZ4C 4HE8A 3GMIA 3PUQA 1AJ3A 4BAYB 3MXZA 3PF0A 3LK3B 4ZI2C 3EDUA 5JDQA 3PUGA 2LHRA 2V7LA 4CZZB 2XAFB 1HX8A 2YK0A 2N2NA 1D1BA 3WI3A 2KNDA 2X9YA 4JUYA 4MLKA 2W00A 2HH7A 4O4LE 4PJJA 4P0AA 3RRCA 2H7OA 4E7ZA 4AKLA 4ZS3A 3AAAB 5FY0A 2P9BA 5L3FB 1FIOA 3U78A 3RC8A 2G0UA 2CMRA 3KV9A 4ERRA 2UXXB 3OKQA 4CI3B 2NTXA 4PFPA 4QX8B 2XTLA 4P0BA 3N2KE 5FXVA 3ZPOA 3DTOA 4O2AE 2V7JA 3LG7A 2WBLA 4OYJA 2E9XB 1HTJF 2V7MA 5LBQB 2E8IA 2C5IT 5LGUB 1ZKEA 3N5LA 3N2OA 4I50E 5EZYE 3MK7C 4DO0A 2W0GA 1ZHCA 4YHJA 3UULA 1ZV4X 3PUSA 1O3XA 4UV9B 2PG8A 2KINB 2ZM2A 1YD8G 4U74A 5DABA 4NUUA 2KMFA 5FMNA 5LHHB 4GK5E 2NOXA 2DCFA 3L3PA 3ZC0A 3ZEFB 3IBPA 3D0TA 2Q9QD 4TX5A 2HPLA 2LHNA 5IHYA 3UUXB 5DQWA 1MIWA 4CI2B 5KMGP 2V26A 3Q2MA 3I9YA 1MNEA 3KV6A 3HL6A 3KVAA 4H9PC 2N9DA 4PK5A 2LSGA 2XHEB 4QXBB 5J2UE 3ZJ1A 3O1HA 3GN5A 2CXLA 3RC3A 2H7VC 2DLRA 2RP4A 4IIJE 5FP3A 4AKHA 3NRXA 3FBLA 3LBXA 1YKHB 2M67A 2ZM8A 3B13A 5LBMA 1HF8A 3KDSE 4H9NC 4E7SA 2EHOA 3Q9DA 1US7B 2LE8A 3PUAA 3C4XA 2XUEA 3NRYA 2NW9A 2NW7A 1D0ZA 4H63H 3ANWA 4GK0E 4WBNE 2LJLA 2E9XD 3IF8B 3O1IA 3CX8B 4UVCB 4AXPA 3RRWA 2NTYA 2PJQA 2V1DB 2WWUA 4UVAB 3R6NA 3I9WA 4DBRA 5FY1A 5JDFA 4XBFB 3CQXC 4Z8XA 3J9X1 4GYRA 3SS1A 3KVBA 2CWOA 1MMAA 5BMVE 1X79A 3HKDE 4ZHQE 2B1EA 4HFVA 4XAXB 5JRCA 3ZC1A 3JC6D 4HN9A 4HKAA 4J2CA 1UX4A 4PFOA 4YJ3E 2BVMA 3LFMA 3N9OA 3ZMUB 3ZMTB 5DJQC 4EOZB 2X0LB 3CX6B 4UVBB 1LVKA 4HTEA 4UF0B 2VK9A 2X9WA 5LNKA 4WNKA 5A1LA 2V7KA 5F8PA 1FEWA 2VKOA 5EK4A 4TV8E 1HG5A 1G8XA 2OA5A 4A56A 3LJCA 3ZYMA 5LHIB 3OYXA 4DVDA 3MACA 1CUNA 2H3RA 3ZN0B 3UTKA 1LRZA 3NZQA 5T1DA 1QSDA 4OFZA 3SRZA 2KT9A 4ZS2A 2IC6A 2K9AA 4H63V 4QWNB 2ODVA 5DQVA 2JPFA 2JJ9A 4F6RC 1B7TA 3CWZB 3V5UA 4DBQA 3R84B 2VKJA 2XQYA 1ZEEA 3MJXA 5C8YE 4JEUB 3BQIA 4X1IE 2L9QA 4ONRA 4ECGA 4I4TE 4X1YE 1WRDA 2WMNA 5JDNA 3EDVA 4ZI7E 5JDMA 1FMVA 3CMLA 1HS7A 3RYFE 4PNIA 3RYIE 4CXWA 2A3DA 3ETUA 3N2GE 5CA1E 3WURA 4PJNA 2MBGA 4EYUA 1NAFA 3ETVA 2SPCA 2Q9QA 4BJMA 1YW0A 1FMWA 5HXEA 3BQLA 1D1CA 1U4QA 1WYBA 4CXYA 3I1AA 5CB4E 4O2BE 2MTCA 3PHF1 4KP3C 3EUHA 3LK42 4PAGA 5L3CB 5LHGB 5HWYA 4GOUA 1KNZA 3VJZA 3ZN1B 2JRKA 3K3NA 2JMHA 5H6QB 2CA5A 2DWKA 2LSIA 2KLQA 1BR0A 5HXHA 4IE0A 1WYCA 1S35A 2Y8DA 2EHOC 2W62A 3KINB 4EXTA 4BGOA 3C98B 2YU2A 3SWHA 2GK9A 1VRBA 5J2TE 2A2FX 5L3GB 4PK4A 5KDMC 4PJLA 2C5KT 4AQFC 3VKHA 2VWAA 4AQGA 4YLHA 2YINA 1T98A 4DNDA 2VASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXH A;  5HWY A;  5JDF A;  3V5S A;  3V5U A;  5HXR A;  5JDG A;  5HXC A;  5HWX A;  5HXS A;  5JDN A;  5JDH A;  5HXE A;  5JDM A;  5JDQ A;  5HYA A;  5JDL A; 
#chains in the Genus database with same CATH topology
 2UUC T;  3HR0 A;  3KV4 A;  4DV6 T;  4AKR B;  3HKC E;  4UV8 B;  2XSA A;  2KZ7 B;  5LGT B;  2W61 A;  3OYZ A;  5HCJ A;  5LB7 B;  1NEN A;  1UK5 A;  3GN5 B;  3LK2 B;  3C4W A;  2CBJ A;  3ZYL A;  5JRE A;  3K8P C;  2EHO B;  3AY5 A;  2FJE A;  3P4S A;  2UXC T;  3UU5 A;  1SJ8 A;  4DV7 T;  2YEV C;  3CX7 B;  3UFG A;  1N34 T;  4IE5 A;  5JQG E;  4KX6 A;  3N9M A;  4JI1 T;  4X65 T;  1Y64 B;  3NZP A;  4O4I E;  2CXD A;  4CI1 B;  3A7M A;  2IIU A;  5CJ5 A;  2V6Y A;  4Z91 A;  1J1J A;  3AA1 B;  2PFV A;  3CPZ A;  4JV5 T;  3P4P A;  2D0U A;  3VRB A;  4HWF A;  4EED A;  3O9X A;  3RYH E;  4L5G A;  2XZE A;  2UUB T;  2ES0 A;  4JBW F;  4NXN T;  3ZCJ A;  3E0Z A;  4LMJ A;  5CGM A;  4HWI B;  1IJ6 A;  3TLT A;  4X20 E;  2X67 A;  3JC6 C;  4QKN A;  4TV9 E;  5IYZ E;  4ILC A;  5LCY A;  4CQI A;  3TKL B;  2CLY B;  2HPJ A;  5HAX A;  4EEB A;  1UX5 A;  1IZN B;  1V9D A;  4EB6 E;  3N9L A;  4OHF A;  3V5S A;  4HWH A;  2YU1 A;  4G2A A;  5L3D B;  3VKG A;  3ZSS A;  2K24 A;  2CPT A;  2JQ9 A;  2CRB A;  2I0M A;  3FB2 A;  1I94 T;  4EZH A;  4QH5 A;  3KBT A;  3P50 A;  3PV0 F;  3RIU C;  4DR7 T;  3AVR A;  3CQC B;  4IDN A;  3A5X A;  2C0S A;  3N9N A;  1UGO A;  4ZOL E;  3HKE E;  3MA9 A;  5LOV E;  3RHW A;  1E7P A;  4CN4 A;  5L3E B;  4Q25 A;  5EK2 A;  3RYC E;  4KHP T;  3SFE A;  5AFU L;  2XAS B;  4O4H E;  3C64 A;  3IEE A;  2LEH A;  3RIU A;  2VB6 A;  3FZK B;  5ABF A;  4IST A;  2WZH A;  3JAF A;  1SHZ C;  3MKD A;  1UCU A;  4IE4 A;  4TWF A;  1JNZ A;  3E08 A;  5GON E;  2XQ7 A;  2W63 A;  2V6Y B;  3ESL A;  2K48 A;  3ZMZ B;  4PW8 A;  2X9X A;  4ZI3 C;  5AQH B;  5LYJ E;  4WBO A;  4Z90 A;  3PJA J;  2LSJ A;  1HX1 B;  2BKP A;  4G63 A;  4LMK A;  5AQR B;  4ILB A;  2QGS A;  4P09 A;  3G06 A;  4HFD A;  1R8I A;  4UR9 A;  1AJ3 A;  4ZI2 C;  4CZZ B;  3AEG A;  4JUY A;  2W00 A;  4X62 T;  2VVS A;  3RRC A;  4E7Z A;  2J4G A;  4AKL A;  5FVK A;  5AQO B;  1FIO A;  3OKQ A;  4QX8 B;  2XTL A;  2VL0 A;  1HNW T;  1JNR A;  4CN1 A;  4OYJ A;  1HTJ F;  3H3M A;  5LBQ B;  2E8I A;  5LGU B;  1ZKE A;  2KGX A;  1ZHC A;  3PUS A;  1O3X A;  2PG8 A;  1YD8 G;  4NUU A;  5FMN A;  5LHH B;  4GK5 E;  2DCF A;  3P4Q A;  2XQ3 A;  2WS3 A;  1MNE A;  3AE4 A;  4ZEY A;  5J2U E;  4DV3 T;  3RC3 A;  3LBX A;  2ZM8 A;  3B13 A;  5LBM A;  4H9N C;  2NW7 A;  1D0Z A;  3O1I A;  3IF8 B;  4UVC B;  5J0Z A;  2PJQ A;  2WWU A;  3I9W A;  5ABF B;  3J9X 1;  2YKS A;  4GYR A;  2CWO A;  2B1E A;  5LG3 A;  5JRC A;  5L47 A;  1XWM A;  3JC6 D;  4J2C A;  1UX4 A;  4PFO A;  4YJ3 E;  4DID B;  3N9O A;  3ZMU B;  5DJQ C;  4EOZ B;  2X0L B;  1LVK A;  2JQH A;  1DU2 A;  5LNK A;  4WNK A;  5FVL A;  2V7K A;  5FKY A;  2M6B A;  3CIR A;  2DL1 A;  4U31 A;  5LHI B;  3AE5 A;  3MAC A;  2UU9 T;  1CUN A;  1UUR A;  5ABG A;  3UTK A;  3NZQ A;  1QSD A;  5AQU B;  3SRZ A;  4QWN B;  2ODV A;  2KSR A;  3CWZ B;  4DV0 T;  3BQI A;  4ECG A;  4I4T E;  2MAW A;  5JDN A;  4LFC T;  3CML A;  5FZT A;  5HCM A;  2A3D A;  2Q9Q A;  4BJM A;  1YW0 A;  1FMW A;  5HXE A;  3UU8 A;  3I1A A;  3EUH A;  4YSY A;  4U2Z A;  5H6Q B;  2JMH A;  2CA5 A;  2LSI A;  2KLQ A;  1WYC A;  2EHO C;  1YQ3 A;  4BGO A;  3ZT6 A;  1VRB A;  5JTG A;  4IDP A;  3T1Y T;  2VWA A;  4A5X A;  2YIN A;  4DND A;  1VCT A;  1LKX A;  4ASK A;  3AE9 A;  3M65 A;  3TLW A;  5FXZ A;  3K3O A;  2Y48 B;  1VOM A;  1I6Z A;  4ZZB A;  2L8K A;  1L0V A;  4JI7 T;  4ZI3 D;  5HEJ A;  3E22 E;  1U5P A;  4YXD A;  3LBX B;  2UXD T;  3AE1 A;  2K5B B;  3WAK A;  4DUY T;  5LGN B;  2MYS A;  3PUY F;  3C4Z A;  3GWH A;  5ABE A;  1HNZ T;  2IUB A;  4LFB T;  2VUR A;  2VQF T;  5EK3 A;  5JH7 E;  2WDV A;  3OBV E;  2KBB A;  4B3S T;  3H37 A;  4ZI2 D;  5FNV E;  5CFB A;  4LF8 T;  4JLE A;  5JRC B;  2ACX A;  4OK0 A;  2BKO A;  1EZ3 A;  4UEM A;  1WCR A;  2NW8 A;  3RKO A;  2I6H A;  2CLY C;  4JEH B;  4IHJ E;  2J62 A;  4UXN B;  4TNV A;  4BJN A;  3NBX X;  4M1P A;  4U2Y A;  1MMD A;  2DWG A;  1G73 A;  5F3J A;  3B5M A;  3RIA A;  2FJB A;  3FXD B;  2DNX A;  2NP9 A;  4W8P A;  4NUV A;  3ZMV B;  1M7K A;  2CXF A;  1IBM T;  3M1C A;  4YTN A;  5AQG B;  2Q9Q B;  3N9P A;  2WAU A;  5CA0 E;  5KX5 E;  1YQ4 A;  4LF6 T;  4WW0 A;  3EVY A;  4MHC A;  3WAJ A;  2CCQ A;  2VL8 A;  2ODU A;  2Z6E A;  3PUR A;  5IUX A;  4DMW A;  4TWD A;  2BS3 A;  2QYW A;  4ZZC A;  4FI5 A;  3RF1 A;  2I59 A;  2XAJ B;  4MAL A;  3UQ7 A;  2BKN A;  3RGL A;  4NIQ A;  2E5L T;  5L2L A;  2MOZ A;  5ETW A;  4X1K E;  3F2E A;  2W2U A;  2X66 A;  2CM0 A;  4QHO A;  2VKH A;  4HFB A;  3SOL A;  3P4W A;  1KFY A;  3OJA A;  4ADZ A;  4YSZ A;  3AEC A;  4EIW A;  3EAB A;  4IGU A;  2DI4 A;  4B6X A;  3UQ4 A;  4ZXL A;  4AI6 A;  1SJ7 A;  1S94 A;  5LJM A;  1ZP0 A;  2D2S A;  2CE7 A;  3AAE B;  3AE6 A;  2HHH T;  5JDH A;  3Q5X A;  2FJD A;  3ZMS B;  3HI2 A;  3PUW F;  4C91 A;  2J1D G;  4UF0 A;  5HXS A;  3P4R A;  4DMV A;  2CWY A;  1MMN A;  2XY8 B;  3AB3 B;  5JDG A;  5AQF B;  2LM2 A;  4TUY E;  1MIV A;  2EHO D;  4DR1 T;  3P8C D;  2V7I A;  4EZ4 A;  3AVS A;  3PDY A;  4K0K T;  3PE0 A;  3FXE B;  5AQM B;  4H9Q C;  5KXJ A;  4JI5 T;  2YN6 A;  2F4V T;  4B3M T;  1J5W A;  4HE8 A;  3GMI A;  4BAY B;  1E2A A;  4U7Y A;  4YY3 T;  1M62 A;  2V7L A;  2XAF B;  4YSX A;  4AIS A;  2IML A;  2KND A;  2X9Y A;  4MLK A;  2HH7 A;  3RQU A;  3AAA B;  5L4H A;  2K3W A;  3RC8 A;  2CMR A;  2W67 A;  3KV9 A;  4PFP A;  3DTO A;  3LG7 A;  2LRK A;  2C5I T;  1SUM B;  4DR6 T;  2BG9 A;  5EZY E;  1KNR A;  1WR0 A;  4U7I A;  4YHJ A;  3OPC A;  5AQQ B;  2ZM2 A;  4U74 A;  4QH1 A;  2NOX A;  2XSB A;  4IDO A;  2HPL A;  3UUX B;  4U3C A;  3KVA A;  4H9P C;  2LSG A;  2XHE B;  2CXL A;  4NXM T;  3TLV A;  2H7V C;  2DLR A;  2B76 A;  2RP4 A;  2WCA A;  5L4E A;  3Q9D A;  4B3T T;  2XUE A;  3ANW A;  3CX8 B;  3RRW A;  4DR2 T;  4UVA B;  4DBR A;  4KHZ F;  2WDR A;  3KVB A;  1MMA A;  5BMV E;  5AQI B;  4HFV A;  3AE3 A;  4HN9 A;  4HKA A;  3ZMT B;  2BVM A;  3LFM A;  4GKJ T;  3CX6 B;  2PTF A;  4UVB B;  4UF0 B;  2VK9 A;  5F8P A;  2VKO A;  4HFH A;  1XZY A;  3ZN0 B;  1LRZ A;  5T1D A;  5BR8 T;  4P1N A;  2KT9 A;  2JPF A;  2JJ9 A;  5HEU A;  2AXD S;  3R84 B;  2VKJ A;  1ZEE A;  4X1I E;  4ONR A;  2FBW A;  3NVO A;  2FUP A;  3EDV A;  5JDM A;  1HS7 A;  2BS4 A;  4EV6 A;  4EYU A;  1NAF A;  1D1C A;  1WYB A;  4O2B E;  2WZI A;  4KP3 C;  4DR4 T;  4YHH T;  5LHG B;  5L3C B;  4GOU A;  1KNZ A;  3ZN1 B;  2JRK A;  2DWK A;  5HXH A;  5F5W A;  2Y8D A;  2W62 A;  2BG9 B;  3SWH A;  4EGW A;  2GK9 A;  3FYQ A;  2VAS A;  4YFS A;  2XPK A;  4ILU A;  1MMG A;  2QA7 A;  2C5J A;  3CVR A;  3S4U A;  2LT3 A;  1YKE B;  3UUB A;  2JIW A;  2CHO A;  3L39 A;  3RX6 A;  3A8Y C;  2ZLY A;  4H9S E;  5FXW A;  5AQN B;  3RLF F;  1BR1 A;  4JI6 T;  1HCI A;  3ANW B;  3PUX F;  2KWH A;  2NWB A;  3QC9 A;  5HYA A;  2FJA A;  3RIF A;  4TN7 B;  2V6X A;  1IBK T;  4H9O C;  2LSK A;  2X51 A;  1OXZ A;  2BZB A;  2Q9Q C;  3DJB A;  4MFR A;  3C50 A;  2Y6X A;  3T8O A;  3ZYK A;  3AA7 B;  4HFC A;  3QUJ A;  2V5C A;  2ZM6 T;  2D5U A;  4IT4 A;  3HKB E;  2X68 A;  4CXX A;  4K0U A;  2JQQ A;  2WU2 A;  2W66 A;  3ZJ2 A;  5TAO A;  1E1H B;  3CKD A;  4C90 A;  1Y01 A;  2LM9 A;  3WSC A;  5HXC A;  5E0O A;  2ACZ A;  3UT5 E;  1SA0 E;  1IJ5 A;  2KVP A;  3RH3 A;  2WDQ A;  4F7G B;  3PUZ F;  4DV5 T;  5FYM A;  3AEA A;  2XAH B;  4GKK T;  4AQY T;  1HG2 A;  3PTR B;  2IDO B;  4OYK A;  1D0X A;  5LG4 A;  2WP9 A;  2WU5 A;  4ANJ A;  3AEF A;  1H7C A;  2KWI B;  3UUN A;  2LKG A;  2YDQ A;  4QXH B;  5HXR A;  2XQ4 A;  4BA9 A;  4IE6 A;  4PK6 A;  3RI5 A;  4WZX A;  1UUS A;  2LOP A;  4AKG A;  4HFE A;  5LXT E;  2XQ6 A;  1D0Y A;  1Z8U A;  4HGA A;  4EAH A;  3AT7 A;  3L8R A;  2BBJ A;  1T7S A;  4U72 A;  4QX7 B;  2X0C A;  3ZT7 A;  4HWD A;  3KBU A;  4V1A v;  3ABV A;  2YOE A;  5ABH A;  5L3B B;  4I0U A;  4ILA A;  3FZF B;  4YJ2 E;  3RPU A;  5JR9 B;  5HEG A;  2VKD A;  3VU7 H;  1QUU A;  2WB5 A;  2BDE A;  3O4X E;  1N32 T;  1LVF A;  2CHN A;  3VR9 A;  2OLT A;  3PJA A;  3Q5E A;  1HFA A;  3UUM A;  4XZC A;  4O8S A;  2RA1 A;  4LML A;  2VVN A;  4LFA T;  4GYS A;  4HFI A;  4HEA A;  2XAG B;  4OX9 T;  4I43 B;  3JAD A;  3C51 A;  4YT0 A;  3U3I A;  3HA4 A;  3N9Q A;  1IAP A;  3AA6 B;  3PU8 A;  4A98 A;  4JYA T;  3GA8 A;  2L3L A;  3BQK A;  4KMC A;  4TZ4 C;  3VR8 A;  3PUQ A;  5JDQ A;  3PUG A;  2LHR A;  2M6I A;  1HX8 A;  2YK0 A;  1D1B A;  3WI3 A;  4O4L E;  4PJJ A;  1W0A A;  4ZS3 A;  5FY0 A;  2P9B A;  5L3F B;  2OV9 A;  4QH4 A;  3U78 A;  4ERR A;  3SFD A;  4CI3 B;  4P0B A;  5FXV A;  4IL4 A;  4JI2 T;  2WBL A;  3N5L A;  4I50 E;  3MK7 C;  1XNQ T;  2W0G A;  3UUL A;  1ZV4 X;  3FZM B;  3L3P A;  4LF5 T;  3ZC0 A;  2QVA A;  3ZEF B;  1OED B;  1SE7 A;  3IBP A;  3D0T A;  2Q9Q D;  4TX5 A;  3NKZ A;  4IDQ A;  2LHN A;  4X5T A;  2XQA A;  1MIW A;  4JI4 T;  2V26 A;  3I9Y A;  3KV6 A;  2BS2 A;  4PK5 A;  3O1H A;  2QRX A;  5FP3 A;  5AQJ B;  3NRX A;  3FBL A;  2M67 A;  1XDP A;  1HF8 A;  4E7S A;  4DV2 T;  1US7 B;  3PUA A;  3C4X A;  3NRY A;  2NW9 A;  4GK0 E;  2LJL A;  4AXP A;  2NTY A;  2V1D B;  3R6N A;  4LF9 T;  3JAE A;  5FY1 A;  5JDF A;  3UU3 A;  4IRE A;  4X64 T;  3ZKR A;  3SS1 A;  4ZHQ E;  3ZC1 A;  4WYV A;  1XMQ T;  4DV4 T;  3TLS A;  4HTE A;  2XQ8 A;  2X9W A;  5A1L A;  1HNX T;  1XDO A;  4TV8 E;  1G8X A;  2OA5 A;  3LJC A;  3OYX A;  2X0H A;  2BG9 E;  4ZS2 A;  1X9B A;  4H63 V;  4YTM A;  2BG9 C;  1B7T A;  3V5U A;  2XQY A;  5AQT B;  4JEU B;  3AE7 A;  2L9Q A;  3AE2 A;  4X1Y E;  1WRD A;  3ZST A;  2H88 A;  4ZI7 E;  1FMV A;  3RYF E;  4NPP A;  2L7N A;  3N2G E;  3ETU A;  3WUR A;  1VCS A;  2CBI A;  1U4Q A;  3PHF 1;  5CB4 E;  2L10 A;  4B3R T;  5IWA T;  3K3N A;  2UUA T;  1WFD A;  1BR0 A;  4IE0 A;  3KIN B;  4U33 A;  2J47 A;  2NR4 A;  5LMU T;  2YU2 A;  5KDM C;  4PJL A;  2C5K T;  4AQF C;  1T98 A;  3JCF A;  4GIW A;  3PU3 A;  2LSY A;  2X9H A;  2ZMA A;  3FZL B;  1KK7 A;  3K1S A;  2IHR 1;  1IBL T;  2IAK A;  4UIG A;  5M4Y A;  1WR6 A;  2HN2 A;  3QB5 K;  4AKI A;  4AQF A;  4DUZ T;  3FBZ A;  1GQE A;  1W09 A;  2N1G A;  2XM1 A;  4IDZ A;  1ZOY A;  3I0Q A;  4QXC B;  2JMK A;  4HWC A;  2JQK A;  2UXB T;  1NEK A;  5AQS B;  4DV1 T;  5AQK B;  5LMN T;  5FY7 A;  1N36 T;  3FHN A;  2IW5 B;  1MIY A;  3AE8 A;  2D0T A;  1NWM X;  3DYJ A;  4MBQ A;  4N78 D;  2XM2 A;  3I0O A;  4EYY R;  4CN6 A;  2MTQ A;  5ADX L;  5LJN A;  3QK6 A;  2DHR A;  2VQE T;  2A72 A;  5FXX A;  2AE9 A;  3KV5 A;  4L0R A;  2E9X C;  4JI3 T;  4KUM B;  5AQV B;  3ONL C;  3TLU A;  2WY2 A;  2ZM0 A;  4KBM B;  3F31 A;  2XQ9 A;  4IL9 A;  2E5V A;  2WSS V;  3EHZ A;  5J1G A;  3AAI A;  3KFW X;  4ISS A;  2LQU A;  4I55 E;  5AQP B;  3DP7 A;  2UXN B;  4A97 A;  3BK9 A;  3QNU A;  2E9X A;  1T72 A;  3IHR A;  5LP6 E;  4UEL A;  4IE7 A;  2BVL A;  3Q5W A;  4DR3 T;  3UU6 A;  5JR9 C;  3FZH B;  1T8B A;  2LOS A;  2LLY A;  3H3A A;  2PBI A;  3UFE A;  3K3Q C;  3OVU A;  3VHL A;  3X1D A;  3P7I A;  5JDL A;  2R6G F;  3L09 A;  3RKG A;  4FJO A;  5H6R B;  2CEA A;  5FL1 A;  5HEO A;  5C3J A;  3LDQ B;  1BR2 A;  5JR9 A;  1J5E T;  1XNR T;  2WQY A;  4O4J E;  1N33 T;  1D1A A;  4PJM A;  2WMO A;  2KXP B;  3ZCI A;  5AQL B;  3CQG B;  2V8S V;  3J7Y q;  1WLX A;  2IC9 A;  1W0B A;  1CHU A;  3B57 A;  3ZLI A;  4X66 T;  3T1H T;  3AA0 B;  3EAM A;  5LA6 E;  1BR4 A;  3W15 B;  2WM9 A;  3AEE A;  3MZK B;  1MND A;  3O1J A;  1OWA A;  4H9R C;  1Z0P A;  2XAQ B;  4LF7 T;  4YTP A;  3PUV F;  5JVD E;  3NWI A;  3F57 A;  5HWX A;  3ONX A;  4L9I A;  3ZT5 A;  1KEY A;  1OED E;  3MXZ A;  4KI0 F;  3LK3 B;  3M3Z B;  3PF0 A;  3ONJ A;  3EDU A;  1OED C;  2N2N A;  2H89 A;  3AXJ A;  4P0A A;  2H7O A;  3AEB A;  2G0U A;  2UXX B;  2NTX A;  5HEH A;  3N2K E;  3EI0 A;  3ZPO A;  4O2A E;  2V7J A;  2E9X B;  2V7M A;  2A9U A;  2YDR A;  3N2O A;  2LKH A;  3CK6 A;  4DO0 A;  3OTO T;  1YXR A;  2WWV A;  4UV9 B;  1OED A;  2KIN B;  5DAB A;  2KMF A;  1HR0 T;  1QLB A;  2E2A A;  3LSV A;  5IHY A;  5DQW A;  2MPK A;  4CI2 B;  4F8H A;  5KMG P;  3Q2M A;  3HL6 A;  2N9D A;  2HN1 A;  4QXB B;  3ZJ1 A;  3GN5 A;  4IIJ E;  2W4X A;  4AKH A;  1XMO T;  1YKH B;  2YDS A;  3KDS E;  2EHO A;  2LE8 A;  4H63 H;  4WBN E;  2E9X D;  3IA3 A;  4DR5 T;  4AIU A;  4XBF B;  3CQX C;  1KF6 A;  4Z8X A;  2BBH A;  1X79 A;  3HKD E;  4XAX B;  3Q5D A;  1FEW A;  5EK4 A;  1HG5 A;  4A56 A;  3ZYM A;  4JI8 T;  4DVD A;  2H3R A;  4OFZ A;  2IC6 A;  2K9A A;  3QB5 A;  5DQV A;  4F6R C;  4DBQ A;  3MJX A;  5C8Y E;  3UU4 A;  2X0Y A;  2D9D A;  2WMN A;  4JI0 T;  4PNI A;  3RYI E;  3AED A;  4LF4 T;  4CXW A;  5CA1 E;  4PJN A;  2MBG A;  1KNP A;  3ETV A;  2SPC A;  2XQ5 A;  3AXJ B;  3BQL A;  2MTC A;  4CXY A;  2V5D A;  3LK4 2;  4PAG A;  2LRL A;  4TNW A;  5HWY A;  3VJZ A;  2XJ7 A;  1FJG T;  4COF A;  2RPA A;  1S35 A;  4TWH A;  5C2T A;  3RQW A;  4EXT A;  3C98 B;  1W9R A;  5J2T E;  5FL0 A;  2A2F X;  5L3G B;  4PK4 A;  3VKH A;  4AQG A;  3VRA A;  4YLH A;  3QOF A; 
#chains in the Genus database with same CATH homology
 4YFS A;  4GIW A;  3PU3 A;  2LSY A;  1LKX A;  2X9H A;  4ASK A;  3HR0 A;  4ILU A;  3KV4 A;  1MMG A;  2QA7 A;  3M65 A;  5FXZ A;  3K3O A;  2C5J A;  3HKC E;  4AKR B;  2Y48 B;  3CVR A;  2ZMA A;  1VOM A;  4UV8 B;  3S4U A;  2KZ7 B;  2L8K A;  5LGT B;  2W61 A;  3OYZ A;  1KK7 A;  4ZI3 D;  3GN5 B;  2LT3 A;  1YKE B;  2IAK A;  3E22 E;  4UIG A;  3LK2 B;  1U5P A;  3C4W A;  5M4Y A;  1WR6 A;  3RX6 A;  3ZYL A;  3LBX B;  2K5B B;  2ZLY A;  4H9S E;  5FXW A;  5JRE A;  3K8P C;  2EHO B;  3WAK A;  1BR1 A;  5LGN B;  1HCI A;  2MYS A;  3C4Z A;  3ANW B;  4AKI A;  3GWH A;  4AQF A;  2KWH A;  3FBZ A;  2NWB A;  3QC9 A;  2N1G A;  5HYA A;  2YEV C;  3CX7 B;  5EK3 A;  4IDZ A;  5JH7 E;  4TN7 B;  3OBV E;  4IE5 A;  5JQG E;  3I0Q A;  3H37 A;  4ZI2 D;  4QXC B;  5FNV E;  2JMK A;  3N9M A;  4JLE A;  5JRC B;  2ACX A;  2LSK A;  4H9O C;  4OK0 A;  2X51 A;  1OXZ A;  2BZB A;  1EZ3 A;  1Y64 B;  2Q9Q C;  3NZP A;  3FHN A;  2CXD A;  3DJB A;  4O4I E;  5FY7 A;  4CI1 B;  2IW5 B;  4UEM A;  1MIY A;  3C50 A;  4MFR A;  2NW8 A;  2D0T A;  1NWM X;  3RKO A;  2Y6X A;  4MBQ A;  4N78 D;  3T8O A;  3ZYK A;  3AA7 B;  3I0O A;  4EYY R;  2CLY C;  3QUJ A;  2MTQ A;  4IHJ E;  4JEH B;  3AA1 B;  2D5U A;  5ADX L;  5LJN A;  3QK6 A;  2DHR A;  4UXN B;  2PFV A;  3CPZ A;  4BJN A;  2A72 A;  2D0U A;  5FXX A;  3HKB E;  3NBX X;  3O9X A;  3KV5 A;  2X68 A;  4M1P A;  3RYH E;  4CXX A;  4K0U A;  4L5G A;  1MMD A;  4L0R A;  2E9X C;  2JQQ A;  2DWG A;  1G73 A;  4KUM B;  5F3J A;  3ZJ2 A;  5TAO A;  2ES0 A;  1E1H B;  3CKD A;  4C90 A;  3FXD B;  2DNX A;  2NP9 A;  2LM9 A;  2ZM0 A;  3WSC A;  4KBM B;  4NUV A;  5HXC A;  3ZCJ A;  5E0O A;  3ZMV B;  3UT5 E;  1SA0 E;  1IJ5 A;  2CXF A;  3E0Z A;  3F31 A;  3RH3 A;  3M1C A;  1IJ6 A;  4X20 E;  2Q9Q B;  2X67 A;  3N9P A;  3JC6 C;  2WAU A;  5FYM A;  2WSS V;  4QKN A;  4TV9 E;  5CA0 E;  5KX5 E;  5IYZ E;  5J1G A;  2XAH B;  3AAI A;  5LCY A;  3KFW X;  4ISS A;  1HG2 A;  4WW0 A;  4CQI A;  3TKL B;  2LQU A;  3PTR B;  2CLY B;  3EVY A;  4I55 E;  4OYK A;  4MHC A;  3WAJ A;  1D0X A;  2CCQ A;  2HPJ A;  5HAX A;  2VL8 A;  1UX5 A;  3DP7 A;  5LG4 A;  1IZN B;  2ODU A;  2UXN B;  3BK9 A;  1V9D A;  4EB6 E;  2E9X A;  2Z6E A;  3IHR A;  3N9L A;  3PUR A;  4OHF A;  4ANJ A;  3V5S A;  4DMW A;  1H7C A;  2YU1 A;  4G2A A;  2KWI B;  3UUN A;  4FI5 A;  5L3D B;  3VKG A;  5LP6 E;  2K24 A;  4UEL A;  4IE7 A;  2BVL A;  4QXH B;  3Q5W A;  5HXR A;  2I59 A;  4BA9 A;  4IE6 A;  5JR9 C;  4PK6 A;  3FB2 A;  2XAJ B;  4MAL A;  2LOS A;  4EZH A;  3KBT A;  2LOP A;  5L2L A;  3H3A A;  2MOZ A;  3AVR A;  2PBI A;  3UFE A;  3CQC B;  3K3Q C;  5ETW A;  3VHL A;  4X1K E;  3A5X A;  3F2E A;  2C0S A;  4AKG A;  3P7I A;  5LXT E;  5JDL A;  1D0Y A;  2X66 A;  3N9N A;  2CM0 A;  4QHO A;  2VKH A;  4HGA A;  4ZOL E;  3HKE E;  3MA9 A;  5LOV E;  4EAH A;  3AT7 A;  3L09 A;  3SOL A;  3OJA A;  4ADZ A;  4FJO A;  5L3E B;  4U72 A;  5H6R B;  4QX7 B;  2CEA A;  4EIW A;  5EK2 A;  3RYC E;  3KBU A;  4V1A v;  4IGU A;  2DI4 A;  4B6X A;  5AFU L;  2XAS B;  4O4H E;  1BR2 A;  5JR9 A;  4AI6 A;  3C64 A;  5L3B B;  3IEE A;  4O4J E;  1D1A A;  4PJM A;  1S94 A;  2LEH A;  4YJ2 E;  2VB6 A;  3RPU A;  2WMO A;  5JR9 B;  5LJM A;  2KXP B;  3ZCI A;  2D2S A;  4IST A;  2VKD A;  3CQG B;  3VU7 H;  2CE7 A;  1QUU A;  3J7Y q;  3AAE B;  1WLX A;  2BDE A;  2IC9 A;  5JDH A;  3O4X E;  3Q5X A;  3B57 A;  1LVF A;  3ZLI A;  3ZMS B;  3HI2 A;  1SHZ C;  3MKD A;  4C91 A;  1UCU A;  2J1D G;  4IE4 A;  3AA0 B;  4UF0 A;  5HXS A;  1HFA A;  5LA6 E;  4DMV A;  3UUM A;  2CWY A;  1MMN A;  3E08 A;  1BR4 A;  4O8S A;  4XZC A;  5GON E;  3W15 B;  2RA1 A;  2WM9 A;  3AB3 B;  2W63 A;  3ESL A;  5JDG A;  2K48 A;  4GYS A;  3ZMZ B;  4PW8 A;  2X9X A;  4HEA A;  2XAG B;  4ZI3 C;  3MZK B;  4I43 B;  1MND A;  3O1J A;  4TUY E;  5LYJ E;  1OWA A;  3C51 A;  1MIV A;  4H9R C;  2EHO D;  1Z0P A;  4WBO A;  3P8C D;  2V7I A;  2LSJ A;  2XAQ B;  4EZ4 A;  3U3I A;  3HA4 A;  3AVS A;  3PDY A;  3PE0 A;  3N9Q A;  1IAP A;  3FXE B;  4G63 A;  3AA6 B;  5JVD E;  3F57 A;  4H9Q C;  5HWX A;  3PU8 A;  3ONX A;  2QGS A;  4L9I A;  3GA8 A;  4P09 A;  2L3L A;  3BQK A;  4KMC A;  4TZ4 C;  4HE8 A;  3GMI A;  3PUQ A;  1AJ3 A;  4BAY B;  3MXZ A;  3PF0 A;  3LK3 B;  4ZI2 C;  3EDU A;  5JDQ A;  3PUG A;  2LHR A;  2V7L A;  4CZZ B;  2XAF B;  1HX8 A;  2YK0 A;  2N2N A;  1D1B A;  3WI3 A;  2KND A;  2X9Y A;  4JUY A;  4MLK A;  2W00 A;  2HH7 A;  4O4L E;  4PJJ A;  4P0A A;  3RRC A;  2H7O A;  4E7Z A;  4AKL A;  4ZS3 A;  3AAA B;  5FY0 A;  2P9B A;  5L3F B;  1FIO A;  3U78 A;  3RC8 A;  2G0U A;  2CMR A;  3KV9 A;  4ERR A;  2UXX B;  3OKQ A;  4CI3 B;  2NTX A;  4PFP A;  4QX8 B;  2XTL A;  4P0B A;  3N2K E;  5FXV A;  3ZPO A;  3DTO A;  4O2A E;  2V7J A;  3LG7 A;  2WBL A;  4OYJ A;  2E9X B;  1HTJ F;  2V7M A;  5LBQ B;  2E8I A;  2C5I T;  5LGU B;  1ZKE A;  3N5L A;  3N2O A;  4I50 E;  5EZY E;  3MK7 C;  4DO0 A;  2W0G A;  1ZHC A;  4YHJ A;  3UUL A;  1ZV4 X;  3PUS A;  1O3X A;  4UV9 B;  2PG8 A;  2KIN B;  2ZM2 A;  1YD8 G;  4U74 A;  5DAB A;  4NUU A;  2KMF A;  5FMN A;  5LHH B;  4GK5 E;  2NOX A;  2DCF A;  3L3P A;  3ZC0 A;  3ZEF B;  3IBP A;  3D0T A;  2Q9Q D;  4TX5 A;  2HPL A;  2LHN A;  5IHY A;  3UUX B;  5DQW A;  1MIW A;  4CI2 B;  5KMG P;  2V26 A;  3Q2M A;  3I9Y A;  1MNE A;  3KV6 A;  3HL6 A;  3KVA A;  4H9P C;  2N9D A;  4PK5 A;  2LSG A;  2XHE B;  4QXB B;  5J2U E;  3ZJ1 A;  3O1H A;  3GN5 A;  2CXL A;  3RC3 A;  2H7V C;  2DLR A;  2RP4 A;  4IIJ E;  5FP3 A;  4AKH A;  3NRX A;  3FBL A;  3LBX A;  1YKH B;  2M67 A;  2ZM8 A;  3B13 A;  5LBM A;  1HF8 A;  3KDS E;  4H9N C;  4E7S A;  2EHO A;  3Q9D A;  1US7 B;  2LE8 A;  3PUA A;  3C4X A;  2XUE A;  3NRY A;  2NW9 A;  2NW7 A;  1D0Z A;  4H63 H;  3ANW A;  4GK0 E;  4WBN E;  2LJL A;  2E9X D;  3IF8 B;  3O1I A;  3CX8 B;  4UVC B;  4AXP A;  3RRW A;  2NTY A;  2PJQ A;  2V1D B;  2WWU A;  4UVA B;  3R6N A;  3I9W A;  4DBR A;  5FY1 A;  5JDF A;  4XBF B;  3CQX C;  4Z8X A;  3J9X 1;  4GYR A;  3SS1 A;  3KVB A;  2CWO A;  1MMA A;  5BMV E;  1X79 A;  3HKD E;  4ZHQ E;  2B1E A;  4HFV A;  4XAX B;  5JRC A;  3ZC1 A;  3JC6 D;  4HN9 A;  4HKA A;  4J2C A;  1UX4 A;  4PFO A;  4YJ3 E;  2BVM A;  3LFM A;  3N9O A;  3ZMU B;  3ZMT B;  5DJQ C;  4EOZ B;  2X0L B;  3CX6 B;  4UVB B;  1LVK A;  4HTE A;  4UF0 B;  2VK9 A;  2X9W A;  5LNK A;  4WNK A;  5A1L A;  2V7K A;  5F8P A;  1FEW A;  2VKO A;  5EK4 A;  4TV8 E;  1HG5 A;  1G8X A;  2OA5 A;  4A56 A;  3LJC A;  3ZYM A;  5LHI B;  3OYX A;  4DVD A;  3MAC A;  1CUN A;  2H3R A;  3ZN0 B;  3UTK A;  1LRZ A;  3NZQ A;  5T1D A;  1QSD A;  4OFZ A;  3SRZ A;  2KT9 A;  4ZS2 A;  2IC6 A;  2K9A A;  4H63 V;  4QWN B;  2ODV A;  5DQV A;  2JPF A;  2JJ9 A;  4F6R C;  1B7T A;  3CWZ B;  3V5U A;  4DBQ A;  3R84 B;  2VKJ A;  2XQY A;  1ZEE A;  3MJX A;  5C8Y E;  4JEU B;  3BQI A;  4X1I E;  2L9Q A;  4ONR A;  4ECG A;  4I4T E;  4X1Y E;  1WRD A;  2WMN A;  5JDN A;  3EDV A;  4ZI7 E;  5JDM A;  1FMV A;  3CML A;  1HS7 A;  3RYF E;  4PNI A;  3RYI E;  4CXW A;  2A3D A;  3ETU A;  3N2G E;  5CA1 E;  3WUR A;  4PJN A;  2MBG A;  4EYU A;  1NAF A;  3ETV A;  2SPC A;  2Q9Q A;  4BJM A;  1YW0 A;  1FMW A;  5HXE A;  3BQL A;  1D1C A;  1U4Q A;  1WYB A;  4CXY A;  3I1A A;  5CB4 E;  4O2B E;  2MTC A;  3PHF 1;  4KP3 C;  3EUH A;  3LK4 2;  4PAG A;  5L3C B;  5LHG B;  5HWY A;  4GOU A;  1KNZ A;  3VJZ A;  3ZN1 B;  2JRK A;  3K3N A;  2JMH A;  5H6Q B;  2CA5 A;  2DWK A;  2LSI A;  2KLQ A;  1BR0 A;  5HXH A;  4IE0 A;  1WYC A;  1S35 A;  2Y8D A;  2EHO C;  2W62 A;  3KIN B;  4EXT A;  4BGO A;  3C98 B;  2YU2 A;  3SWH A;  2GK9 A;  1VRB A;  5J2T E;  2A2F X;  5L3G B;  4PK4 A;  5KDM C;  4PJL A;  2C5K T;  4AQF C;  3VKH A;  2VWA A;  4AQG A;  4YLH A;  2YIN A;  1T98 A;  4DND A;  2VAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...