5JDMA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 0.1mm sr2+
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
300
structure length
294
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIENPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
molecule keywords sodium-calcium exchanger NCX_Mj
total genus 126
structure length 294
sequence length 300
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdmA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdmA02
5HXEA 5HYAA 5HXCA 5JDMA 5JDQA 5JDNA 3V5UA 5HWYA 5HXHA 5JDHA 5HXRA 5HWXA 5JDLA 3V5SA 5JDFA 5HXSA 5JDGA
chains in the Genus database with same CATH superfamily
1E1HB 3Q9DA 4L0RA 2QYWA 2IC6A 3ZMVB 2K5BB 4DR3T 3BK9A 1XMQT 4YLHA 3TLWA 2XPKA 3GN5A 2CLYC 2ACXA 3SFEA 1W09A 2BG9B 2A3DA 1OEDC 3ZYLA 4KP3C 5HEUA 2V6YB 3AAEB 4HWDA 4BGOA 5AQOB 3HKCE 3LDQB 3MJXA 3ZC1A 5HEGA 2YDSA 4YSXA 3K3OA 2BVMA 2UUCT 1WYBA 5T1DA 3C51A 4LF8T 2JQHA 1FEWA 4HFCA 3A5XA 3ZCJA 2L10A 5AQPB 4ZS3A 5FXWA 2X51A 2WB5A 5LGTB 3J9X1 3ZN1B 3UU4A 4X62T 1I94T 4JI0T 2XAQB 4QX8B 2WMOA 3UUNA 2WZHA 3JC6C 4JI5T 5AQGB 3CPZA 1VCSA 1X79A 3AAAB 2V5DA 4O4IE 4AKHA 4UV9B 1KFYA 4DV6T 4Z8XA 4X1KE 5AQKB 2KLQA 3E0ZA 3ABVA 4DR1T 2YK0A 3AT7A 1MNDA 2X0CA 2VWAA 1MMNA 4GOUA 4E7ZA 3UT5E 4HE8A 3PJAA 4IDOA 2N1GA 4IT4A 4KHZF 3H3MA 5HXRA 3P4RA 3PE0A 3QC9A 2E9XC 3EHZA 4DUYT 3OPCA 2DCFA 4PJNA 3KVAA 4YHJA 5HEHA 4U7IA 3RX6A 3WAJA 2N2NA 3I0QA 2XQ6A 4EYUA 4X5TA 1QLBA 5CB4E 4JEUB 3UU3A 3FZLB 3R6NA 3Q2MA 3NBXX 4OFZA 4P09A 1XMOT 3RI5A 3RYCE 3A8YC 3WAKA 2CMRA 2WZIA 1U5PA 3VHLA 1UX5A 4DUZT 4EYYR 1T98A 4XZCA 2BS3A 3CVRA 2M67A 2XQ5A 2LJLA 3BQKA 3GA8A 3DJBA 1R8IA 4WYVA 5FVLA 4LF4T 3CQGB 4U2YA 3LK42 3HR0A 5LG3A 1M62A 4EB6E 3K3QC 2WCAA 3PUAA 3KV9A 5GONE 3EDUA 2E8IA 3RPUA 1NEKA 4H63H 3TLVA 5JVDE 3AB3B 4GIWA 2MTCA 2W66A 1E7PA 2V7KA 2ZMAA 4U7YA 5HXSA 2LLYA 2L8KA 5EK3A 5AQHB 1T7SA 3HKEE 2LEHA 2OLTA 3RGLA 4WZXA 4GYSA 5L3BB 3T1YT 3O1HA 2BS4A 4UVBB 3AA1B 3P8CD 4IIJE 4JBWF 4TZ4C 4GKJT 4XAXB 2W0GA 2XAJB 4ZS2A 4DNDA 2XQ4A 3KVBA 2HPLA 2WQYA 4A98A 3E08A 1T72A 1KK7A 1MIYA 5JH7E 3FZKB 5AQNB 1BR0A 4O4LE 2I0MA 3PUYF 4DV7T 3M1CA 1KNPA 2XSAA 2D2SA 2DLRA 4FJOA 1YKHB 2KZ7B 4IE7A 3I9WA 4OK0A 4Q25A 1BR1A 1E2AA 2CBIA 4HKAA 4JI4T 4IL9A 2BG9C 4BAYB 4IE5A 3P7IA 2J62A 4TWFA 1HTJF 5EZYE 2UXNB 3RRWA 4AQFA 2PJQA 3C4ZA 4UVCB 4ZOLE 2BS2A 3SRZA 3N9NA 1HNWT 4ILBA 4WBOA 5LOVE 2WM9A 3ZMZB 4B3MT 2UXXB 2CEAA 3OTOT 4BJNA 3AEBA 3ZCIA 5F5WA 5LYJE 4ECGA 3N9MA 2H89A 4CN4A 4ONRA 3QK6A 5L3EB 5LJMA 4HFBA 4LMKA 4LFCT 1ZV4X 4GYRA 3ZEFB 5JR9C 4ISTA 1WR6A 5JDFA 3BQLA 3SWHA 5JQGE 4DV5T 2WMNA 2WSSV 5HXCA 4YY3T 1IBKT 2JQ9A 2J47A 3RIAA 2V6YA 5JDMA 4EZHA 5CGMA 3AA7B 1WCRA 2VASA 1ZEEA 1Y01A 1CUNA 3MACA 3NWIA 4HTEA 5CA1E 2XUEA 5JR9A 4K0KT 4IREA 1UGOA 5L4EA 4LF5T 2W67A 3NRXA 2GK9A 4HN9A 4C90A 2V5CA 4ZHQE 2CCQA 2WWUA 3HA4A 5HWYA 3ZJ1A 1NWMX 2KMFA 2VKOA 4L5GA 2LSGA 3AVSA 5L4HA 4WNKA 3RC3A 3RKOA 4P0AA 4QH4A 2V7MA 3ZSSA 4V1Av 5AQTB 1LRZA 2E9XB 4ISSA 3RKGA 2LM2A 3RH3A 2ZM8A 2JQQA 2KBBA 2A72A 2E5LT 3N9LA 3VU7H 3AE2A 3AXJB 3CQXC 4ADZA 2VVNA 4QHOA 5LBMA 4IDNA 5AQUB 4PK4A 1HFAA 3P4SA 1M7KA 4O4HE 4ZI3D 1HR0T 2FJBA 1IJ5A 2CLYB 2EHOC 2JMKA 4MBQA 2YU1A 3FYQA 2IAKA 1ZHCA 2X9HA 4P1NA 2CBJA 3N5LA 3V5SA 4ZI2D 1W0BA 2Z6EA 2WP9A 4EEDA 2LOSA 5ABEA 4UF0B 5J0ZA 3H37A 3FBLA 4HWHA 3HKBE 2Q9QA 5KXJA 2XJ7A 4LMLA 5L3DB 4CQIA 4TWDA 3EUHA 2LSYA 3OYZA 3F2EA 4HGAA 1B7TA 3ZT7A 4DVDA 3AAIA 3E22E 1CHUA 1O3XA 4HFHA 1YQ4A 1IBMT 2X67A 3WSCA 2WS3A 2NW8A 4BJMA 3UUXB 3U3IA 1FMVA 5AFUL 1SJ7A 3IEEA 3NVOA 4AKRB 2FBWA 4ANJA 2MOZA 1AJ3A 2VL8A 3B13A 3FXEB 2UXBT 2IHR1 4ZI2C 1SHZC 3ZMTB 2VVSA 3RIUA 3AEEA 2WWVA 2JQKA 5AQVB 2LSKA 1MIWA 3NZPA 5IUXA 1SE7A 3N9OA 5DQWA 2CXLA 4GKKT 2HH7A 2XAHB 5FXZA 3P4PA 4M1PA 4EZ4A 4OHFA 3RYFE 4NUVA 4EIWA 3S4UA 4EOZB 5JTGA 5FKYA 1Z8UA 3D0TA 4GK5E 4HFEA 2XQYA 1YXRA 2E9XA 1N36T 3A7MA 2XASB 2BG9E 3C4XA 3VR8A 3B5MA 5LHGB 2XY8B 3C64A 3AEFA 4KI0F 2JPFA 4X66T 3WURA 2BVLA 3EABA 5LNKA 5HCJA 5HWXA 2KNDA 2QVAA 2W2UA 2D9DA 4JI2T 4LF9T 4ZEYA 3FHNA 5KDMC 4AKLA 2W4XA 1OEDB 4G2AA 3EDVA 3GMIA 2YDQA 5DQVA 4ZZCA 5JDHA 5KMGP 2W00A 2W61A 2NR4A 4CI3B 3O9XA 4PJLA 2MPKA 2X66A 1I6ZA 3AY5A 5HEJA 3PUXF 5L3GB 3M3ZB 3UTKA 2CRBA 3LSVA 3J7Yq 4L9IA 4QH1A 4TX5A 3OYXA 3SOLA 3T8OA 1WR0A 2LHNA 4C91A 3FZHB 1UCUA 2WY2A 4ILCA 4ZI3C 1IZNB 2MBGA 3X1DA 5AQSB 2H3RA 4UR9A 3RF1A 1HNXT 3PUGA 5C8YE 2P9BA 4ILAA 4HFIA 4PNIA 2J4GA 4YSZA 2D0TA 2LT3A 4TV9E 2LSJA 2OV9A 3AE6A 4PJJA 4JI8T 3OVUA 2RP4A 4AQGA 3M65A 3AVRA 1G73A 4X20E 4U31A 2CE7A 4H9SE 5L3CB 2EHOA 4DMWA 5JREA 1YQ3A 4LF7T 2UU9T 3GN5B 3KV4A 3ONJA 2CHNA 4IL4A 3PU3A 3SS1A 5A1LA 3UQ4A 1BR2A 2KWIB 5L3FB 2YU2A 3AE8A 2R6GF 4IE0A 1W9RA 1QUUA 4I50E 2XAFB 3ZT5A 1IJ6A 2B76A 2W63A 3CIRA 3UQ7A 2ES0A 1VOMA 1XWMA 2HPJA 3ESLA 3IA3A 2NP9A 5IHYA 3R84B 4AISA 5IWAT 5LJNA 2FJDA 2PBIA 2X0LB 3N2GE 4I4TE 4UF0A 5LHIB 1JNRA 4O2BE 2WBLA 5DJQC 2KWHA 1SUMB 1ZP0A 2DI4A 4DMVA 1LKXA 3DYJA 5AQQB 3JCFA 3HL6A 4IDPA 2A2FX 5JDGA 2NW9A 5J2UE 5M4YA 4DR4T 4TNWA 2CPTA 1YD8G 2I59A 2VURA 3ZMUB 5LA6E 2V7JA 1HG2A 3ZN0B 5ADXL 3F57A 5JRCA 1KNRA 1UUSA 2FJEA 2XTLA 3QNUA 4YJ3E 2RPAA 4LFBT 3MZKB 3ANWB 2VKDA 5AQJB 4NXMT 3RYIE 2B1EA 1N33T 1KEYA 3MA9A 2AE9A 4UV8B 3UU6A 2JIWA 5BMVE 5H6QB 2RA1A 1MNEA 4YSYA 3KDSE 5E0OA 4EEBA 1D1BA 2XQ7A 1V9DA 2H88A 3F31A 2UUAT 2F4VT 4HWCA 3LBXB 5JR9B 2NOXA 5HCMA 4TWHA 5DABA 3KBTA 5ABHA 4JEHB 2SPCA 2E9XD 5LCYA 4NPPA 5LP6E 4B3ST 5F8PA 3KV5A 2DNXA 4CN6A 1W0AA 2C5JA 2VKJA 4QXBB 2IIUA 4YHHT 1D1CA 3OKQA 3CWZB 4DV3T 1US7B 3RC8A 4AKIA 2VL0A 4MALA 3JADA 4W8PA 3TKLB 1JNZA 2LKHA 2XQ9A 4U3CA 5EK2A 4JI6T 4QKNA 4DO0A 1KNZA 4TN7B 1OXZA 2V8SV 4HEAA 4X1IE 5CFBA 1N34T 1HS7A 3V5UA 2HN2A 2Y6XA 4UEMA 4UELA 4UVAB 3MKDA 4YXDA 2D0UA 2XHEB 1FIOA 2C5KT 4HFDA 4U2ZA 5CJ5A 3FZMB 5FZTA 2CWYA 2LKGA 2UXDT 1LVKA 2Y48B 2IC9A 3T1HT 2MAWA 3HI2A 2IMLA 2XSBA 3ZT6A 3DP7A 4PK5A 1D0ZA 2X0YA 4N78D 4AKGA 1HX8A 4I55E 2NWBA 4YJ2E 4X65T 4UXNB 2VK9A 3PTRB 1UX4A 2QA7A 3RHWA 2Q9QD 4NUUA 5FYMA 4F6RC 2C0SA 4OX9T 3CX8B 4H9QC 3LK3B 2BBHA 3H3AA 3AEAA 3B57A 4IGUA 3RYHE 4DV2T 1SA0E 2WU2A 4U72A 2BG9A 3G06A 2UUBT 2ODVA 3N2KE 5FL1A 2V7IA 3ZPOA 4WBNE 2XM2A 3VJZA 3AECA 2L9QA 4IDQA 2VKHA 2JRKA 3P4QA 3MK7C 3TLUA 3AE4A 3AA6B 3PU8A 3AE5A 3JAEA 5IYZE 4KBMB 5AQMB 1XNQT 1H7CA 1YKEB 3KINB 3L3PA 4H9PC 4OYJA 1UURA 2YINA 4A97A 3L09A 2CHOA 3P50A 3W15B 3UULA 3O1JA 4JV5T 2KSRA 1IAPA 3UU5A 3PUQA 5LMUT 3PURA 1XNRT 2KGXA 4DR7T 3ZYMA 3ZLIA 4AI6A 2XAGB 1HX1B 1D0XA 3MXZA 3PUSA 2OA5A 4PK6A 4CXYA 1XZYA 4YTPA 2KINB 4G63A 2YN6A 1NAFA 3PUWF 4IE6A 3NKZA 3N2OA 2BBJA 4LF6T 2NTYA 3AA0B 2WAUA 4WW0A 1WFDA 3OBVE 5ETWA 3UUBA 2HHHT 4E7SA 3CK6A 2NW7A 4JI3T 3N9PA 5FXVA 2D5UA 1S94A 2I6HA 4Z91A 4QXHB 5AQLB 3U78A 2MYSA 2DL1A 4PJMA 4DV1T 4NXNT 5ABGA 3ETUA 2YDRA 1OWAA 3FB2A 3I1AA 3DTOA 2XQAA 3ZJ2A 5FNVE 3CQCB 3ZC0A 3CX7B 2YEVC 3ANWA 4I43B 3L39A 3NZQA 3O4XE 2ODUA 1ZKEA 4YTMA 4GK0E 5FVKA 3NRYA 3ONLC 3FXDB 5J1GA 5JDLA 5JDQA 3CKDA 3VKGA 2LM9A 5AQRB 5C3JA 2LRKA 2XZEA 4QX7B 2LRLA 2KXPB 4ZI7E 2J1DG 4A56A 1L0VA 2L3LA 2IDOB 1UK5A 2LQUA 2V26A 2JJ9A 2AXDS 2YKSA 5LBQB 3IHRA 3AEGA 4IHJE 3VR9A 1D1AA 4JI1T 2BKNA 4EAHA 4CI2B 3UFEA 2NTXA 3KBUA 1OEDE 4MLKA 3LK2B 3QB5K 2CXFA 4AIUA 4DR6T 3PHF1 2ACZA 3I9YA 4MFRA 3Q5XA 5LMNT 2DWKA 4H9NC 1QSDA 4O4JE 2V1DB 3EAMA 5HAXA 4HWFA 2X9YA 2V7LA 3GWHA 4HFVA 5CA0E 4U33A 1N32T 5LB7B 2WDQA 2XM1A 3AE1A 3K3NA 4X1YE 3LBXA 4DBRA 4CI1B 4UIGA 4CXXA 2LHRA 3Q5WA 2EHOD 4OYKA 2IW5B 2CM0A 3PV0F 5ABFB 2Y8DA 4DR5T 2N9DA 3O1IA 4ERRA 2FUPA 2PFVA 4QH5A 5AQIB 3ZKRA 1VCTA 2BZBA 5LHHB 2UXCT 1EZ3A 1MMGA 3AE3A 4DBQA 3AXJA 4DIDB 3FBZA 3Q5EA 1Y64B 4AQYT 2G0UA 3ZSTA 1GQEA 2BDEA 2E2AA 2VB6A 2WDVA 5FMNA 5FY7A 1MIVA 3AE9A 2FJAA 1WYCA 3CX6B 5JDNA 5L2LA 2IUBA 3VRAA 1DU2A 2K48A 4PFPA 4F8HA 3EI0A 3VKHA 4X64T 1X9BA 4B6XA 4YTNA 1FJGT 1S35A 3RQWA 3K1SA 1OEDA 3K8PC 3AE7A 3QB5A 3C4WA 3QOFA 1J5WA 4TNVA 4DV0T 1T8BA 5J2TE 1U4QA 2Q9QC 4ILUA 2VQFT 3EVYA 4IE4A 5FXXA 3TLTA 4EXTA 3WI3A 1D0YA 1Z0PA 2DWGA 4COFA 4J2CA 1WLXA 4MHCA 2LSIA 2X0HA 4QWNB 4H9RC 3RQUA 3CMLA 3LG7A 4U74A 3JAFA 4AXPA 2W62A 5EK4A 1HCIA 1LVFA 1FMWA 4ZZBA 4BA9A 3JC6D 3PF0A 2WDRA 3RLFF 4DV4T 4O2AE 1HF8A 3KFWX 3P4WA 3PJAJ 3OJAA 3QUJA 5FL0A 5C2TA 2ZLYA 3AEDA 5F3JA 4I0UA 2CWOA 3IF8B 3UUMA 4XBFB 5LG4A 5BR8T 5JRCB 4QXCB 4AQFC 4P0BA 5LXTE 2DHRA 4HWIB 2V6XA 3RRCA 1XDPA 2X68A 3BQIA 3L8RA 2M6BA 2KT9A 2E5VA 3IBPA 4PFOA 5ABFA 5L47A 1KF6A 1IBLT 4A5XA 3UU8A 5HEOA 3N9QA 5LGUB 1ZOYA 2MTQA 4TUYE 5HXEA 2ZM6T 1BR4A 1G8XA 4DR2T 3LFMA 3PUZF 3ETVA 4TV8E 3FZFB 3SFDA 3TLSA 2C5IT 2X9XA 3HKDE 3KV6A 2QGSA 1J1JA 4K0UA 4KMCA 5FP3A 4KUMB 5KX5E 1J5ET 1HNZT 2VQET 5AQFB 2BKOA 2X9WA 1MMAA 2Q9QB 2YOEA 3PDYA 4KX6A 2PG8A 1SJ8A 4KHPT 4F7GB 5FY0A 1VRBA 2A9UA 4B3RT 4CXWA 2KVPA 4JLEA 5H6RB 4EGWA 1XDOA 4B3TT 2BKPA 3C50A 3VRBA 2EHOB 2WU5A 4PW8A 4YT0A 4JYAT 2CXDA 4NIQA 5HXHA 3I0OA 2L7NA 5LGNB 4CN1A 1MMDA 2LOPA 4FI5A 3UFGA 3RIFA 2K9AA 3LJCA 3PUVF 4ZXLA 4EV6A 5FY1A 3RIUC 3ZMSB 4YFSA 2K3WA 2JMHA 4JUYA 2HN1A 3C98B 4ASKA 5TAOA 4LFAT 4IDZA 2H7OA 4H63V 5HYAA 2H7VC 1NENA 2XQ3A 4CZZB 4JI7T 4O8SA 1HG5A 2CA5A 4PAGA 2M6IA 2PTFA 2XQ8A 2LE8A 2ZM2A 3ONXA 4H9OC 4LMJA 1YW0A 2ZM0A 4Z90A 3ZYKA 2QRXA 3Q5DA 1WRDA 2K24A
chains in the Genus database with same CATH topology
1E1HB 3Q9DA 4L0RA 2IC6A 3ZMVB 2K5BB 3BK9A 4YLHA 3GN5A 2CLYC 2ACXA 2A3DA 3ZYLA 4KP3C 3AAEB 4BGOA 3HKCE 3MJXA 3ZC1A 5T1DA 3K3OA 2BVMA 1WYBA 3C51A 1FEWA 3A5XA 3ZCJA 4ZS3A 5FXWA 2X51A 5LGTB 3J9X1 3ZN1B 2XAQB 4QX8B 2WMOA 3UUNA 3JC6C 3CPZA 1X79A 3AAAB 4O4IE 4AKHA 4UV9B 4Z8XA 4X1KE 2KLQA 3E0ZA 2YK0A 3AT7A 1MNDA 2VWAA 1MMNA 4GOUA 4E7ZA 3UT5E 4HE8A 2N1GA 5HXRA 3PE0A 3QC9A 2E9XC 2DCFA 4PJNA 3KVAA 4YHJA 3RX6A 3WAJA 2N2NA 3I0QA 4EYUA 5CB4E 4JEUB 3R6NA 3Q2MA 3NBXX 4OFZA 4P09A 3RYCE 3WAKA 2CMRA 1U5PA 3VHLA 1UX5A 4EYYR 1T98A 4XZCA 3CVRA 2M67A 2LJLA 3BQKA 3GA8A 3DJBA 3CQGB 3LK42 3HR0A 4EB6E 3K3QC 3PUAA 5GONE 3KV9A 3EDUA 2E8IA 3RPUA 2MTCA 4H63H 5JVDE 3AB3B 4GIWA 5HXSA 2V7KA 2ZMAA 2L8KA 5EK3A 3HKEE 2LEHA 4GYSA 5L3BB 3O1HA 4UVBB 3AA1B 3P8CD 4IIJE 4TZ4C 4XAXB 2W0GA 2XAJB 4ZS2A 4DNDA 3KVBA 2HPLA 3E08A 1KK7A 1MIYA 5JH7E 1BR0A 4O4LE 4IE7A 2D2SA 2DLRA 4FJOA 1YKHB 2KZ7B 4OK0A 3I9WA 1BR1A 4HKAA 4BAYB 4IE5A 3P7IA 1HTJF 5EZYE 2UXNB 3RRWA 4AQFA 2PJQA 3C4ZA 4UVCB 4ZOLE 3SRZA 3N9NA 4WBOA 5LOVE 2WM9A 3ZMZB 2UXXB 2CEAA 4BJNA 3ZCIA 5LYJE 4ECGA 3N9MA 4ONRA 3QK6A 5L3EB 5LJMA 1ZV4X 4GYRA 3ZEFB 5JR9C 4ISTA 1WR6A 5JDFA 3BQLA 3SWHA 5JQGE 2WMNA 2WSSV 5HXCA 5JDMA 4EZHA 3AA7B 2VASA 1ZEEA 1CUNA 3MACA 4HTEA 5CA1E 2XUEA 5JR9A 4HN9A 3NRXA 2GK9A 4C90A 4ZHQE 2CCQA 2WWUA 3HA4A 5HWYA 3ZJ1A 1NWMX 2KMFA 2VKOA 4L5GA 2LSGA 3AVSA 3RC3A 4WNKA 3RKOA 4P0AA 2V7MA 4V1Av 1LRZA 2E9XB 4ISSA 3RH3A 2ZM8A 2JQQA 2A72A 3N9LA 3VU7H 3CQXC 4ADZA 4QHOA 5LBMA 4PK4A 1HFAA 4O4HE 4ZI3D 1IJ5A 2CLYB 2EHOC 2JMKA 4MBQA 2YU1A 2IAKA 1ZHCA 2X9HA 3V5SA 3N5LA 4ZI2D 2Z6EA 2LOSA 4UF0B 3H37A 3FBLA 3HKBE 2Q9QA 5L3DB 4CQIA 3EUHA 2LSYA 3OYZA 3F2EA 4HGAA 1B7TA 4DVDA 3AAIA 3E22E 1O3XA 2X67A 3WSCA 2NW8A 4BJMA 3UUXB 3U3IA 1FMVA 5AFUL 3IEEA 4AKRB 4ANJA 2MOZA 1AJ3A 2VL8A 3B13A 3FXEB 4ZI2C 1SHZC 3ZMTB 2LSKA 1MIWA 3NZPA 3N9OA 5DQWA 2CXLA 2HH7A 2XAHB 5FXZA 4M1PA 4EZ4A 4OHFA 3RYFE 4NUVA 4EIWA 3S4UA 4EOZB 3D0TA 4GK5E 2XQYA 2E9XA 2XASB 3C4XA 5LHGB 3C64A 2JPFA 2BVLA 5LNKA 5HWXA 2KNDA 3FHNA 5KDMC 4AKLA 4G2AA 5DQVA 3EDVA 3GMIA 5JDHA 5KMGP 2W00A 2W61A 4CI3B 3O9XA 4PJLA 2X66A 5L3GB 3UTKA 3J7Yq 4L9IA 4TX5A 3SOLA 3OYXA 3T8OA 2LHNA 4C91A 1UCUA 4ZI3C 1IZNB 2MBGA 2H3RA 3PUGA 5C8YE 2P9BA 4PNIA 2D0TA 2LT3A 4TV9E 2LSJA 4PJJA 4AQGA 2RP4A 3M65A 3AVRA 1G73A 4X20E 5L3CB 2CE7A 4H9SE 5JREA 2EHOA 4DMWA 3GN5B 3KV4A 5A1LA 3SS1A 3PU3A 5L3FB 1BR2A 2KWIB 3WURA 2YU2A 4IE0A 1QUUA 4I50E 2XAFB 1IJ6A 2W63A 2ES0A 1VOMA 3ESLA 2HPJA 5IHYA 2NP9A 3R84B 5LJNA 2PBIA 2X0LB 3N2GE 4I4TE 5LHIB 4UF0A 4O2BE 2WBLA 5DJQC 2KWHA 2DI4A 4DMVA 1LKXA 3HL6A 2A2FX 5JDGA 2NW9A 5J2UE 5M4YA 2I59A 1YD8G 3ZMUB 5LA6E 2V7JA 1HG2A 3ZN0B 5ADXL 3F57A 5JRCA 2XTLA 4YJ3E 3MZKB 3ANWB 2VKDA 3RYIE 2B1EA 3MA9A 4UV8B 5BMVE 5H6QB 2RA1A 1MNEA 3KDSE 5E0OA 4AKGA 1D1BA 1V9DA 3F31A 3LBXB 5JR9B 2NOXA 5DABA 3KBTA 2SPCA 2E9XD 5LCYA 5LP6E 5F8PA 3KV5A 2DNXA 2C5JA 2VKJA 4QXBB 1D1CA 3OKQA 3CWZB 3RC8A 1US7B 4AKIA 4MALA 3TKLB 5EK2A 4QKNA 4DO0A 1KNZA 4TN7B 1OXZA 4HEAA 4X1IE 1HS7A 3V5UA 2Y6XA 4UEMA 4UELA 4UVAB 3MKDA 2D0UA 2XHEB 1FIOA 2C5KT 2CWYA 1LVKA 2Y48B 2IC9A 3HI2A 3DP7A 4PK5A 1D0ZA 4N78D 1HX8A 4I55E 2NWBA 4YJ2E 4UXNB 2VK9A 3PTRB 1UX4A 2QA7A 2Q9QD 4NUUA 5FYMA 4F6RC 2C0SA 3CX8B 4H9QC 3LK3B 3H3AA 3B57A 3RYHE 4IGUA 1SA0E 4U72A 2ODVA 3N2KE 2V7IA 3ZPOA 4WBNE 3VJZA 2L9QA 2VKHA 2JRKA 3MK7C 3PU8A 3AA6B 5IYZE 4KBMB 1H7CA 1YKEB 3KINB 3L3PA 4H9PC 4OYJA 2YINA 3L09A 3W15B 3UULA 3O1JA 1IAPA 3PUQA 3PURA 3ZYMA 3ZLIA 4AI6A 2XAGB 3MXZA 1D0XA 3PUSA 2OA5A 4PK6A 4CXYA 2KINB 4G63A 1NAFA 4IE6A 3N2OA 2NTYA 3AA0B 2WAUA 4WW0A 5ETWA 3OBVE 4E7SA 2NW7A 3N9PA 5FXVA 2D5UA 1S94A 3M1CA 3PHF1 4QXHB 3U78A 2MYSA 4PJMA 3ETUA 3ZC0A 1OWAA 3FB2A 3I1AA 3DTOA 3ZJ2A 5FNVE 3CQCB 3CX7B 2YEVC 3ANWA 4I43B 3NZQA 3O4XE 2ODUA 1ZKEA 5J1GA 4GK0E 3NRYA 3FXDB 5JDLA 5JDQA 3CKDA 3VKGA 2LM9A 4QX7B 4ZI7E 2KXPB 2J1DG 4A56A 2L3LA 2LQUA 2V26A 2JJ9A 5LBQB 3IHRA 4IHJE 1D1AA 4EAHA 4CI2B 3UFEA 2NTXA 3KBUA 4MLKA 3LK2B 2CXFA 3I9YA 4MFRA 3Q5XA 2DWKA 4H9NC 1QSDA 4O4JE 2V1DB 5HAXA 2X9YA 2V7LA 3GWHA 4HFVA 5CA0E 3K3NA 4DBRA 4CI1B 4X1YE 3LBXA 4UIGA 4CXXA 2LHRA 3Q5WA 2EHOD 4OYKA 2IW5B 2CM0A 2Y8DA 2N9DA 3O1IA 4ERRA 2PFVA 2BZBA 5LHHB 1EZ3A 1MMGA 4DBQA 3FBZA 1Y64B 2G0UA 5FY7A 2BDEA 5FMNA 2VB6A 1MIVA 1WYCA 3CX6B 5JDNA 5L2LA 2K48A 4PFPA 3VKHA 4B6XA 1S35A 3K8PC 3C4WA 5J2TE 1U4QA 2Q9QC 4ILUA 3EVYA 4IE4A 5FXXA 4EXTA 3WI3A 1D0YA 1Z0PA 2DWGA 4J2CA 1WLXA 4MHCA 2LSIA 4QWNB 4H9RC 3CMLA 3LG7A 4U74A 4AXPA 2W62A 5EK4A 1HCIA 1LVFA 1FMWA 4BA9A 3JC6D 3PF0A 4O2AE 1HF8A 3KFWX 3OJAA 3QUJA 2ZLYA 5F3JA 2CWOA 3IF8B 3UUMA 4XBFB 5LG4A 5JRCB 4QXCB 4AQFC 4P0BA 5LXTE 2DHRA 3RRCA 2X68A 3BQIA 2KT9A 3IBPA 4PFOA 5LGUB 3N9QA 2MTQA 4TUYE 5HXEA 1BR4A 1G8XA 3LFMA 3ETVA 4TV8E 2C5IT 2X9XA 3HKDE 3KV6A 2QGSA 4K0UA 4KMCA 5FP3A 4KUMB 5KX5E 2X9WA 1MMAA 2Q9QB 3PDYA 2PG8A 5FY0A 1VRBA 4CXWA 4JLEA 5H6RB 3C50A 2EHOB 4PW8A 2CXDA 5HXHA 3I0OA 5LGNB 1MMDA 2LOPA 4FI5A 2K9AA 3LJCA 5FY1A 3ZMSB 4YFSA 2JMHA 4JUYA 4ASKA 3C98B 5TAOA 4IDZA 2H7OA 4H63V 5HYAA 2H7VC 4CZZB 4O8SA 1HG5A 2CA5A 4PAGA 2LE8A 2ZM2A 3ONXA 4H9OC 3ZYKA 1YW0A 2ZM0A 4JEHB 1WRDA 2K24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXE A;  5HYA A;  5HXC A;  5JDM A;  5JDQ A;  5JDN A;  3V5U A;  5HWY A;  5HXH A;  5JDH A;  5HXR A;  5HWX A;  5JDL A;  3V5S A;  5JDF A;  5HXS A;  5JDG A; 
#chains in the Genus database with same CATH topology
 1E1H B;  3Q9D A;  4L0R A;  2QYW A;  2IC6 A;  3ZMV B;  2K5B B;  4DR3 T;  3BK9 A;  1XMQ T;  4YLH A;  3TLW A;  2XPK A;  3GN5 A;  2CLY C;  2ACX A;  3SFE A;  1W09 A;  2BG9 B;  2A3D A;  1OED C;  3ZYL A;  4KP3 C;  5HEU A;  2V6Y B;  3AAE B;  4HWD A;  4BGO A;  5AQO B;  3HKC E;  3LDQ B;  3MJX A;  3ZC1 A;  5HEG A;  2YDS A;  4YSX A;  3K3O A;  2BVM A;  2UUC T;  1WYB A;  5T1D A;  3C51 A;  4LF8 T;  2JQH A;  1FEW A;  4HFC A;  3A5X A;  3ZCJ A;  2L10 A;  5AQP B;  4ZS3 A;  5FXW A;  2X51 A;  2WB5 A;  5LGT B;  3J9X 1;  3ZN1 B;  3UU4 A;  4X62 T;  1I94 T;  4JI0 T;  2XAQ B;  4QX8 B;  2WMO A;  3UUN A;  2WZH A;  3JC6 C;  4JI5 T;  5AQG B;  3CPZ A;  1VCS A;  1X79 A;  3AAA B;  2V5D A;  4O4I E;  4AKH A;  4UV9 B;  1KFY A;  4DV6 T;  4Z8X A;  4X1K E;  5AQK B;  2KLQ A;  3E0Z A;  3ABV A;  4DR1 T;  2YK0 A;  3AT7 A;  1MND A;  2X0C A;  2VWA A;  1MMN A;  4GOU A;  4E7Z A;  3UT5 E;  4HE8 A;  3PJA A;  4IDO A;  2N1G A;  4IT4 A;  4KHZ F;  3H3M A;  5HXR A;  3P4R A;  3PE0 A;  3QC9 A;  2E9X C;  3EHZ A;  4DUY T;  3OPC A;  2DCF A;  4PJN A;  3KVA A;  4YHJ A;  5HEH A;  4U7I A;  3RX6 A;  3WAJ A;  2N2N A;  3I0Q A;  2XQ6 A;  4EYU A;  4X5T A;  1QLB A;  5CB4 E;  4JEU B;  3UU3 A;  3FZL B;  3R6N A;  3Q2M A;  3NBX X;  4OFZ A;  4P09 A;  1XMO T;  3RI5 A;  3RYC E;  3A8Y C;  3WAK A;  2CMR A;  2WZI A;  1U5P A;  3VHL A;  1UX5 A;  4DUZ T;  4EYY R;  1T98 A;  4XZC A;  2BS3 A;  3CVR A;  2M67 A;  2XQ5 A;  2LJL A;  3BQK A;  3GA8 A;  3DJB A;  1R8I A;  4WYV A;  5FVL A;  4LF4 T;  3CQG B;  4U2Y A;  3LK4 2;  3HR0 A;  5LG3 A;  1M62 A;  4EB6 E;  3K3Q C;  2WCA A;  3PUA A;  3KV9 A;  5GON E;  3EDU A;  2E8I A;  3RPU A;  1NEK A;  4H63 H;  3TLV A;  5JVD E;  3AB3 B;  4GIW A;  2MTC A;  2W66 A;  1E7P A;  2V7K A;  2ZMA A;  4U7Y A;  5HXS A;  2LLY A;  2L8K A;  5EK3 A;  5AQH B;  1T7S A;  3HKE E;  2LEH A;  2OLT A;  3RGL A;  4WZX A;  4GYS A;  5L3B B;  3T1Y T;  3O1H A;  2BS4 A;  4UVB B;  3AA1 B;  3P8C D;  4IIJ E;  4JBW F;  4TZ4 C;  4GKJ T;  4XAX B;  2W0G A;  2XAJ B;  4ZS2 A;  4DND A;  2XQ4 A;  3KVB A;  2HPL A;  2WQY A;  4A98 A;  3E08 A;  1T72 A;  1KK7 A;  1MIY A;  5JH7 E;  3FZK B;  5AQN B;  1BR0 A;  4O4L E;  2I0M A;  3PUY F;  4DV7 T;  3M1C A;  1KNP A;  2XSA A;  2D2S A;  2DLR A;  4FJO A;  1YKH B;  2KZ7 B;  4IE7 A;  3I9W A;  4OK0 A;  4Q25 A;  1BR1 A;  1E2A A;  2CBI A;  4HKA A;  4JI4 T;  4IL9 A;  2BG9 C;  4BAY B;  4IE5 A;  3P7I A;  2J62 A;  4TWF A;  1HTJ F;  5EZY E;  2UXN B;  3RRW A;  4AQF A;  2PJQ A;  3C4Z A;  4UVC B;  4ZOL E;  2BS2 A;  3SRZ A;  3N9N A;  1HNW T;  4ILB A;  4WBO A;  5LOV E;  2WM9 A;  3ZMZ B;  4B3M T;  2UXX B;  2CEA A;  3OTO T;  4BJN A;  3AEB A;  3ZCI A;  5F5W A;  5LYJ E;  4ECG A;  3N9M A;  2H89 A;  4CN4 A;  4ONR A;  3QK6 A;  5L3E B;  5LJM A;  4HFB A;  4LMK A;  4LFC T;  1ZV4 X;  4GYR A;  3ZEF B;  5JR9 C;  4IST A;  1WR6 A;  5JDF A;  3BQL A;  3SWH A;  5JQG E;  4DV5 T;  2WMN A;  2WSS V;  5HXC A;  4YY3 T;  1IBK T;  2JQ9 A;  2J47 A;  3RIA A;  2V6Y A;  5JDM A;  4EZH A;  5CGM A;  3AA7 B;  1WCR A;  2VAS A;  1ZEE A;  1Y01 A;  1CUN A;  3MAC A;  3NWI A;  4HTE A;  5CA1 E;  2XUE A;  5JR9 A;  4K0K T;  4IRE A;  1UGO A;  5L4E A;  4LF5 T;  2W67 A;  3NRX A;  2GK9 A;  4HN9 A;  4C90 A;  2V5C A;  4ZHQ E;  2CCQ A;  2WWU A;  3HA4 A;  5HWY A;  3ZJ1 A;  1NWM X;  2KMF A;  2VKO A;  4L5G A;  2LSG A;  3AVS A;  5L4H A;  4WNK A;  3RC3 A;  3RKO A;  4P0A A;  4QH4 A;  2V7M A;  3ZSS A;  4V1A v;  5AQT B;  1LRZ A;  2E9X B;  4ISS A;  3RKG A;  2LM2 A;  3RH3 A;  2ZM8 A;  2JQQ A;  2KBB A;  2A72 A;  2E5L T;  3N9L A;  3VU7 H;  3AE2 A;  3AXJ B;  3CQX C;  4ADZ A;  2VVN A;  4QHO A;  5LBM A;  4IDN A;  5AQU B;  4PK4 A;  1HFA A;  3P4S A;  1M7K A;  4O4H E;  4ZI3 D;  1HR0 T;  2FJB A;  1IJ5 A;  2CLY B;  2EHO C;  2JMK A;  4MBQ A;  2YU1 A;  3FYQ A;  2IAK A;  1ZHC A;  2X9H A;  4P1N A;  2CBJ A;  3N5L A;  3V5S A;  4ZI2 D;  1W0B A;  2Z6E A;  2WP9 A;  4EED A;  2LOS A;  5ABE A;  4UF0 B;  5J0Z A;  3H37 A;  3FBL A;  4HWH A;  3HKB E;  2Q9Q A;  5KXJ A;  2XJ7 A;  4LML A;  5L3D B;  4CQI A;  4TWD A;  3EUH A;  2LSY A;  3OYZ A;  3F2E A;  4HGA A;  1B7T A;  3ZT7 A;  4DVD A;  3AAI A;  3E22 E;  1CHU A;  1O3X A;  4HFH A;  1YQ4 A;  1IBM T;  2X67 A;  3WSC A;  2WS3 A;  2NW8 A;  4BJM A;  3UUX B;  3U3I A;  1FMV A;  5AFU L;  1SJ7 A;  3IEE A;  3NVO A;  4AKR B;  2FBW A;  4ANJ A;  2MOZ A;  1AJ3 A;  2VL8 A;  3B13 A;  3FXE B;  2UXB T;  2IHR 1;  4ZI2 C;  1SHZ C;  3ZMT B;  2VVS A;  3RIU A;  3AEE A;  2WWV A;  2JQK A;  5AQV B;  2LSK A;  1MIW A;  3NZP A;  5IUX A;  1SE7 A;  3N9O A;  5DQW A;  2CXL A;  4GKK T;  2HH7 A;  2XAH B;  5FXZ A;  3P4P A;  4M1P A;  4EZ4 A;  4OHF A;  3RYF E;  4NUV A;  4EIW A;  3S4U A;  4EOZ B;  5JTG A;  5FKY A;  1Z8U A;  3D0T A;  4GK5 E;  4HFE A;  2XQY A;  1YXR A;  2E9X A;  1N36 T;  3A7M A;  2XAS B;  2BG9 E;  3C4X A;  3VR8 A;  3B5M A;  5LHG B;  2XY8 B;  3C64 A;  3AEF A;  4KI0 F;  2JPF A;  4X66 T;  3WUR A;  2BVL A;  3EAB A;  5LNK A;  5HCJ A;  5HWX A;  2KND A;  2QVA A;  2W2U A;  2D9D A;  4JI2 T;  4LF9 T;  4ZEY A;  3FHN A;  5KDM C;  4AKL A;  2W4X A;  1OED B;  4G2A A;  3EDV A;  3GMI A;  2YDQ A;  5DQV A;  4ZZC A;  5JDH A;  5KMG P;  2W00 A;  2W61 A;  2NR4 A;  4CI3 B;  3O9X A;  4PJL A;  2MPK A;  2X66 A;  1I6Z A;  3AY5 A;  5HEJ A;  3PUX F;  5L3G B;  3M3Z B;  3UTK A;  2CRB A;  3LSV A;  3J7Y q;  4L9I A;  4QH1 A;  4TX5 A;  3OYX A;  3SOL A;  3T8O A;  1WR0 A;  2LHN A;  4C91 A;  3FZH B;  1UCU A;  2WY2 A;  4ILC A;  4ZI3 C;  1IZN B;  2MBG A;  3X1D A;  5AQS B;  2H3R A;  4UR9 A;  3RF1 A;  1HNX T;  3PUG A;  5C8Y E;  2P9B A;  4ILA A;  4HFI A;  4PNI A;  2J4G A;  4YSZ A;  2D0T A;  2LT3 A;  4TV9 E;  2LSJ A;  2OV9 A;  3AE6 A;  4PJJ A;  4JI8 T;  3OVU A;  2RP4 A;  4AQG A;  3M65 A;  3AVR A;  1G73 A;  4X20 E;  4U31 A;  2CE7 A;  4H9S E;  5L3C B;  2EHO A;  4DMW A;  5JRE A;  1YQ3 A;  4LF7 T;  2UU9 T;  3GN5 B;  3KV4 A;  3ONJ A;  2CHN A;  4IL4 A;  3PU3 A;  3SS1 A;  5A1L A;  3UQ4 A;  1BR2 A;  2KWI B;  5L3F B;  2YU2 A;  3AE8 A;  2R6G F;  4IE0 A;  1W9R A;  1QUU A;  4I50 E;  2XAF B;  3ZT5 A;  1IJ6 A;  2B76 A;  2W63 A;  3CIR A;  3UQ7 A;  2ES0 A;  1VOM A;  1XWM A;  2HPJ A;  3ESL A;  3IA3 A;  2NP9 A;  5IHY A;  3R84 B;  4AIS A;  5IWA T;  5LJN A;  2FJD A;  2PBI A;  2X0L B;  3N2G E;  4I4T E;  4UF0 A;  5LHI B;  1JNR A;  4O2B E;  2WBL A;  5DJQ C;  2KWH A;  1SUM B;  1ZP0 A;  2DI4 A;  4DMV A;  1LKX A;  3DYJ A;  5AQQ B;  3JCF A;  3HL6 A;  4IDP A;  2A2F X;  5JDG A;  2NW9 A;  5J2U E;  5M4Y A;  4DR4 T;  4TNW A;  2CPT A;  1YD8 G;  2I59 A;  2VUR A;  3ZMU B;  5LA6 E;  2V7J A;  1HG2 A;  3ZN0 B;  5ADX L;  3F57 A;  5JRC A;  1KNR A;  1UUS A;  2FJE A;  2XTL A;  3QNU A;  4YJ3 E;  2RPA A;  4LFB T;  3MZK B;  3ANW B;  2VKD A;  5AQJ B;  4NXM T;  3RYI E;  2B1E A;  1N33 T;  1KEY A;  3MA9 A;  2AE9 A;  4UV8 B;  3UU6 A;  2JIW A;  5BMV E;  5H6Q B;  2RA1 A;  1MNE A;  4YSY A;  3KDS E;  5E0O A;  4EEB A;  1D1B A;  2XQ7 A;  1V9D A;  2H88 A;  3F31 A;  2UUA T;  2F4V T;  4HWC A;  3LBX B;  5JR9 B;  2NOX A;  5HCM A;  4TWH A;  5DAB A;  3KBT A;  5ABH A;  4JEH B;  2SPC A;  2E9X D;  5LCY A;  4NPP A;  5LP6 E;  4B3S T;  5F8P A;  3KV5 A;  2DNX A;  4CN6 A;  1W0A A;  2C5J A;  2VKJ A;  4QXB B;  2IIU A;  4YHH T;  1D1C A;  3OKQ A;  3CWZ B;  4DV3 T;  1US7 B;  3RC8 A;  4AKI A;  2VL0 A;  4MAL A;  3JAD A;  4W8P A;  3TKL B;  1JNZ A;  2LKH A;  2XQ9 A;  4U3C A;  5EK2 A;  4JI6 T;  4QKN A;  4DO0 A;  1KNZ A;  4TN7 B;  1OXZ A;  2V8S V;  4HEA A;  4X1I E;  5CFB A;  1N34 T;  1HS7 A;  3V5U A;  2HN2 A;  2Y6X A;  4UEM A;  4UEL A;  4UVA B;  3MKD A;  4YXD A;  2D0U A;  2XHE B;  1FIO A;  2C5K T;  4HFD A;  4U2Z A;  5CJ5 A;  3FZM B;  5FZT A;  2CWY A;  2LKG A;  2UXD T;  1LVK A;  2Y48 B;  2IC9 A;  3T1H T;  2MAW A;  3HI2 A;  2IML A;  2XSB A;  3ZT6 A;  3DP7 A;  4PK5 A;  1D0Z A;  2X0Y A;  4N78 D;  4AKG A;  1HX8 A;  4I55 E;  2NWB A;  4YJ2 E;  4X65 T;  4UXN B;  2VK9 A;  3PTR B;  1UX4 A;  2QA7 A;  3RHW A;  2Q9Q D;  4NUU A;  5FYM A;  4F6R C;  2C0S A;  4OX9 T;  3CX8 B;  4H9Q C;  3LK3 B;  2BBH A;  3H3A A;  3AEA A;  3B57 A;  4IGU A;  3RYH E;  4DV2 T;  1SA0 E;  2WU2 A;  4U72 A;  2BG9 A;  3G06 A;  2UUB T;  2ODV A;  3N2K E;  5FL1 A;  2V7I A;  3ZPO A;  4WBN E;  2XM2 A;  3VJZ A;  3AEC A;  2L9Q A;  4IDQ A;  2VKH A;  2JRK A;  3P4Q A;  3MK7 C;  3TLU A;  3AE4 A;  3AA6 B;  3PU8 A;  3AE5 A;  3JAE A;  5IYZ E;  4KBM B;  5AQM B;  1XNQ T;  1H7C A;  1YKE B;  3KIN B;  3L3P A;  4H9P C;  4OYJ A;  1UUR A;  2YIN A;  4A97 A;  3L09 A;  2CHO A;  3P50 A;  3W15 B;  3UUL A;  3O1J A;  4JV5 T;  2KSR A;  1IAP A;  3UU5 A;  3PUQ A;  5LMU T;  3PUR A;  1XNR T;  2KGX A;  4DR7 T;  3ZYM A;  3ZLI A;  4AI6 A;  2XAG B;  1HX1 B;  1D0X A;  3MXZ A;  3PUS A;  2OA5 A;  4PK6 A;  4CXY A;  1XZY A;  4YTP A;  2KIN B;  4G63 A;  2YN6 A;  1NAF A;  3PUW F;  4IE6 A;  3NKZ A;  3N2O A;  2BBJ A;  4LF6 T;  2NTY A;  3AA0 B;  2WAU A;  4WW0 A;  1WFD A;  3OBV E;  5ETW A;  3UUB A;  2HHH T;  4E7S A;  3CK6 A;  2NW7 A;  4JI3 T;  3N9P A;  5FXV A;  2D5U A;  1S94 A;  2I6H A;  4Z91 A;  4QXH B;  5AQL B;  3U78 A;  2MYS A;  2DL1 A;  4PJM A;  4DV1 T;  4NXN T;  5ABG A;  3ETU A;  2YDR A;  1OWA A;  3FB2 A;  3I1A A;  3DTO A;  2XQA A;  3ZJ2 A;  5FNV E;  3CQC B;  3ZC0 A;  3CX7 B;  2YEV C;  3ANW A;  4I43 B;  3L39 A;  3NZQ A;  3O4X E;  2ODU A;  1ZKE A;  4YTM A;  4GK0 E;  5FVK A;  3NRY A;  3ONL C;  3FXD B;  5J1G A;  5JDL A;  5JDQ A;  3CKD A;  3VKG A;  2LM9 A;  5AQR B;  5C3J A;  2LRK A;  2XZE A;  4QX7 B;  2LRL A;  2KXP B;  4ZI7 E;  2J1D G;  4A56 A;  1L0V A;  2L3L A;  2IDO B;  1UK5 A;  2LQU A;  2V26 A;  2JJ9 A;  2AXD S;  2YKS A;  5LBQ B;  3IHR A;  3AEG A;  4IHJ E;  3VR9 A;  1D1A A;  4JI1 T;  2BKN A;  4EAH A;  4CI2 B;  3UFE A;  2NTX A;  3KBU A;  1OED E;  4MLK A;  3LK2 B;  3QB5 K;  2CXF A;  4AIU A;  4DR6 T;  3PHF 1;  2ACZ A;  3I9Y A;  4MFR A;  3Q5X A;  5LMN T;  2DWK A;  4H9N C;  1QSD A;  4O4J E;  2V1D B;  3EAM A;  5HAX A;  4HWF A;  2X9Y A;  2V7L A;  3GWH A;  4HFV A;  5CA0 E;  4U33 A;  1N32 T;  5LB7 B;  2WDQ A;  2XM1 A;  3AE1 A;  3K3N A;  4X1Y E;  3LBX A;  4DBR A;  4CI1 B;  4UIG A;  4CXX A;  2LHR A;  3Q5W A;  2EHO D;  4OYK A;  2IW5 B;  2CM0 A;  3PV0 F;  5ABF B;  2Y8D A;  4DR5 T;  2N9D A;  3O1I A;  4ERR A;  2FUP A;  2PFV A;  4QH5 A;  5AQI B;  3ZKR A;  1VCT A;  2BZB A;  5LHH B;  2UXC T;  1EZ3 A;  1MMG A;  3AE3 A;  4DBQ A;  3AXJ A;  4DID B;  3FBZ A;  3Q5E A;  1Y64 B;  4AQY T;  2G0U A;  3ZST A;  1GQE A;  2BDE A;  2E2A A;  2VB6 A;  2WDV A;  5FMN A;  5FY7 A;  1MIV A;  3AE9 A;  2FJA A;  1WYC A;  3CX6 B;  5JDN A;  5L2L A;  2IUB A;  3VRA A;  1DU2 A;  2K48 A;  4PFP A;  4F8H A;  3EI0 A;  3VKH A;  4X64 T;  1X9B A;  4B6X A;  4YTN A;  1FJG T;  1S35 A;  3RQW A;  3K1S A;  1OED A;  3K8P C;  3AE7 A;  3QB5 A;  3C4W A;  3QOF A;  1J5W A;  4TNV A;  4DV0 T;  1T8B A;  5J2T E;  1U4Q A;  2Q9Q C;  4ILU A;  2VQF T;  3EVY A;  4IE4 A;  5FXX A;  3TLT A;  4EXT A;  3WI3 A;  1D0Y A;  1Z0P A;  2DWG A;  4COF A;  4J2C A;  1WLX A;  4MHC A;  2LSI A;  2X0H A;  4QWN B;  4H9R C;  3RQU A;  3CML A;  3LG7 A;  4U74 A;  3JAF A;  4AXP A;  2W62 A;  5EK4 A;  1HCI A;  1LVF A;  1FMW A;  4ZZB A;  4BA9 A;  3JC6 D;  3PF0 A;  2WDR A;  3RLF F;  4DV4 T;  4O2A E;  1HF8 A;  3KFW X;  3P4W A;  3PJA J;  3OJA A;  3QUJ A;  5FL0 A;  5C2T A;  2ZLY A;  3AED A;  5F3J A;  4I0U A;  2CWO A;  3IF8 B;  3UUM A;  4XBF B;  5LG4 A;  5BR8 T;  5JRC B;  4QXC B;  4AQF C;  4P0B A;  5LXT E;  2DHR A;  4HWI B;  2V6X A;  3RRC A;  1XDP A;  2X68 A;  3BQI A;  3L8R A;  2M6B A;  2KT9 A;  2E5V A;  3IBP A;  4PFO A;  5ABF A;  5L47 A;  1KF6 A;  1IBL T;  4A5X A;  3UU8 A;  5HEO A;  3N9Q A;  5LGU B;  1ZOY A;  2MTQ A;  4TUY E;  5HXE A;  2ZM6 T;  1BR4 A;  1G8X A;  4DR2 T;  3LFM A;  3PUZ F;  3ETV A;  4TV8 E;  3FZF B;  3SFD A;  3TLS A;  2C5I T;  2X9X A;  3HKD E;  3KV6 A;  2QGS A;  1J1J A;  4K0U A;  4KMC A;  5FP3 A;  4KUM B;  5KX5 E;  1J5E T;  1HNZ T;  2VQE T;  5AQF B;  2BKO A;  2X9W A;  1MMA A;  2Q9Q B;  2YOE A;  3PDY A;  4KX6 A;  2PG8 A;  1SJ8 A;  4KHP T;  4F7G B;  5FY0 A;  1VRB A;  2A9U A;  4B3R T;  4CXW A;  2KVP A;  4JLE A;  5H6R B;  4EGW A;  1XDO A;  4B3T T;  2BKP A;  3C50 A;  3VRB A;  2EHO B;  2WU5 A;  4PW8 A;  4YT0 A;  4JYA T;  2CXD A;  4NIQ A;  5HXH A;  3I0O A;  2L7N A;  5LGN B;  4CN1 A;  1MMD A;  2LOP A;  4FI5 A;  3UFG A;  3RIF A;  2K9A A;  3LJC A;  3PUV F;  4ZXL A;  4EV6 A;  5FY1 A;  3RIU C;  3ZMS B;  4YFS A;  2K3W A;  2JMH A;  4JUY A;  2HN1 A;  3C98 B;  4ASK A;  5TAO A;  4LFA T;  4IDZ A;  2H7O A;  4H63 V;  5HYA A;  2H7V C;  1NEN A;  2XQ3 A;  4CZZ B;  4JI7 T;  4O8S A;  1HG5 A;  2CA5 A;  4PAG A;  2M6I A;  2PTF A;  2XQ8 A;  2LE8 A;  2ZM2 A;  3ONX A;  4H9O C;  4LMJ A;  1YW0 A;  2ZM0 A;  4Z90 A;  3ZYK A;  2QRX A;  3Q5D A;  1WRD A;  2K24 A; 
#chains in the Genus database with same CATH homology
 1E1H B;  3Q9D A;  4L0R A;  2IC6 A;  3ZMV B;  2K5B B;  3BK9 A;  4YLH A;  3GN5 A;  2CLY C;  2ACX A;  2A3D A;  3ZYL A;  4KP3 C;  3AAE B;  4BGO A;  3HKC E;  3MJX A;  3ZC1 A;  5T1D A;  3K3O A;  2BVM A;  1WYB A;  3C51 A;  1FEW A;  3A5X A;  3ZCJ A;  4ZS3 A;  5FXW A;  2X51 A;  5LGT B;  3J9X 1;  3ZN1 B;  2XAQ B;  4QX8 B;  2WMO A;  3UUN A;  3JC6 C;  3CPZ A;  1X79 A;  3AAA B;  4O4I E;  4AKH A;  4UV9 B;  4Z8X A;  4X1K E;  2KLQ A;  3E0Z A;  2YK0 A;  3AT7 A;  1MND A;  2VWA A;  1MMN A;  4GOU A;  4E7Z A;  3UT5 E;  4HE8 A;  2N1G A;  5HXR A;  3PE0 A;  3QC9 A;  2E9X C;  2DCF A;  4PJN A;  3KVA A;  4YHJ A;  3RX6 A;  3WAJ A;  2N2N A;  3I0Q A;  4EYU A;  5CB4 E;  4JEU B;  3R6N A;  3Q2M A;  3NBX X;  4OFZ A;  4P09 A;  3RYC E;  3WAK A;  2CMR A;  1U5P A;  3VHL A;  1UX5 A;  4EYY R;  1T98 A;  4XZC A;  3CVR A;  2M67 A;  2LJL A;  3BQK A;  3GA8 A;  3DJB A;  3CQG B;  3LK4 2;  3HR0 A;  4EB6 E;  3K3Q C;  3PUA A;  5GON E;  3KV9 A;  3EDU A;  2E8I A;  3RPU A;  2MTC A;  4H63 H;  5JVD E;  3AB3 B;  4GIW A;  5HXS A;  2V7K A;  2ZMA A;  2L8K A;  5EK3 A;  3HKE E;  2LEH A;  4GYS A;  5L3B B;  3O1H A;  4UVB B;  3AA1 B;  3P8C D;  4IIJ E;  4TZ4 C;  4XAX B;  2W0G A;  2XAJ B;  4ZS2 A;  4DND A;  3KVB A;  2HPL A;  3E08 A;  1KK7 A;  1MIY A;  5JH7 E;  1BR0 A;  4O4L E;  4IE7 A;  2D2S A;  2DLR A;  4FJO A;  1YKH B;  2KZ7 B;  4OK0 A;  3I9W A;  1BR1 A;  4HKA A;  4BAY B;  4IE5 A;  3P7I A;  1HTJ F;  5EZY E;  2UXN B;  3RRW A;  4AQF A;  2PJQ A;  3C4Z A;  4UVC B;  4ZOL E;  3SRZ A;  3N9N A;  4WBO A;  5LOV E;  2WM9 A;  3ZMZ B;  2UXX B;  2CEA A;  4BJN A;  3ZCI A;  5LYJ E;  4ECG A;  3N9M A;  4ONR A;  3QK6 A;  5L3E B;  5LJM A;  1ZV4 X;  4GYR A;  3ZEF B;  5JR9 C;  4IST A;  1WR6 A;  5JDF A;  3BQL A;  3SWH A;  5JQG E;  2WMN A;  2WSS V;  5HXC A;  5JDM A;  4EZH A;  3AA7 B;  2VAS A;  1ZEE A;  1CUN A;  3MAC A;  4HTE A;  5CA1 E;  2XUE A;  5JR9 A;  4HN9 A;  3NRX A;  2GK9 A;  4C90 A;  4ZHQ E;  2CCQ A;  2WWU A;  3HA4 A;  5HWY A;  3ZJ1 A;  1NWM X;  2KMF A;  2VKO A;  4L5G A;  2LSG A;  3AVS A;  3RC3 A;  4WNK A;  3RKO A;  4P0A A;  2V7M A;  4V1A v;  1LRZ A;  2E9X B;  4ISS A;  3RH3 A;  2ZM8 A;  2JQQ A;  2A72 A;  3N9L A;  3VU7 H;  3CQX C;  4ADZ A;  4QHO A;  5LBM A;  4PK4 A;  1HFA A;  4O4H E;  4ZI3 D;  1IJ5 A;  2CLY B;  2EHO C;  2JMK A;  4MBQ A;  2YU1 A;  2IAK A;  1ZHC A;  2X9H A;  3V5S A;  3N5L A;  4ZI2 D;  2Z6E A;  2LOS A;  4UF0 B;  3H37 A;  3FBL A;  3HKB E;  2Q9Q A;  5L3D B;  4CQI A;  3EUH A;  2LSY A;  3OYZ A;  3F2E A;  4HGA A;  1B7T A;  4DVD A;  3AAI A;  3E22 E;  1O3X A;  2X67 A;  3WSC A;  2NW8 A;  4BJM A;  3UUX B;  3U3I A;  1FMV A;  5AFU L;  3IEE A;  4AKR B;  4ANJ A;  2MOZ A;  1AJ3 A;  2VL8 A;  3B13 A;  3FXE B;  4ZI2 C;  1SHZ C;  3ZMT B;  2LSK A;  1MIW A;  3NZP A;  3N9O A;  5DQW A;  2CXL A;  2HH7 A;  2XAH B;  5FXZ A;  4M1P A;  4EZ4 A;  4OHF A;  3RYF E;  4NUV A;  4EIW A;  3S4U A;  4EOZ B;  3D0T A;  4GK5 E;  2XQY A;  2E9X A;  2XAS B;  3C4X A;  5LHG B;  3C64 A;  2JPF A;  2BVL A;  5LNK A;  5HWX A;  2KND A;  3FHN A;  5KDM C;  4AKL A;  4G2A A;  5DQV A;  3EDV A;  3GMI A;  5JDH A;  5KMG P;  2W00 A;  2W61 A;  4CI3 B;  3O9X A;  4PJL A;  2X66 A;  5L3G B;  3UTK A;  3J7Y q;  4L9I A;  4TX5 A;  3SOL A;  3OYX A;  3T8O A;  2LHN A;  4C91 A;  1UCU A;  4ZI3 C;  1IZN B;  2MBG A;  2H3R A;  3PUG A;  5C8Y E;  2P9B A;  4PNI A;  2D0T A;  2LT3 A;  4TV9 E;  2LSJ A;  4PJJ A;  4AQG A;  2RP4 A;  3M65 A;  3AVR A;  1G73 A;  4X20 E;  5L3C B;  2CE7 A;  4H9S E;  5JRE A;  2EHO A;  4DMW A;  3GN5 B;  3KV4 A;  5A1L A;  3SS1 A;  3PU3 A;  5L3F B;  1BR2 A;  2KWI B;  3WUR A;  2YU2 A;  4IE0 A;  1QUU A;  4I50 E;  2XAF B;  1IJ6 A;  2W63 A;  2ES0 A;  1VOM A;  3ESL A;  2HPJ A;  5IHY A;  2NP9 A;  3R84 B;  5LJN A;  2PBI A;  2X0L B;  3N2G E;  4I4T E;  5LHI B;  4UF0 A;  4O2B E;  2WBL A;  5DJQ C;  2KWH A;  2DI4 A;  4DMV A;  1LKX A;  3HL6 A;  2A2F X;  5JDG A;  2NW9 A;  5J2U E;  5M4Y A;  2I59 A;  1YD8 G;  3ZMU B;  5LA6 E;  2V7J A;  1HG2 A;  3ZN0 B;  5ADX L;  3F57 A;  5JRC A;  2XTL A;  4YJ3 E;  3MZK B;  3ANW B;  2VKD A;  3RYI E;  2B1E A;  3MA9 A;  4UV8 B;  5BMV E;  5H6Q B;  2RA1 A;  1MNE A;  3KDS E;  5E0O A;  4AKG A;  1D1B A;  1V9D A;  3F31 A;  3LBX B;  5JR9 B;  2NOX A;  5DAB A;  3KBT A;  2SPC A;  2E9X D;  5LCY A;  5LP6 E;  5F8P A;  3KV5 A;  2DNX A;  2C5J A;  2VKJ A;  4QXB B;  1D1C A;  3OKQ A;  3CWZ B;  3RC8 A;  1US7 B;  4AKI A;  4MAL A;  3TKL B;  5EK2 A;  4QKN A;  4DO0 A;  1KNZ A;  4TN7 B;  1OXZ A;  4HEA A;  4X1I E;  1HS7 A;  3V5U A;  2Y6X A;  4UEM A;  4UEL A;  4UVA B;  3MKD A;  2D0U A;  2XHE B;  1FIO A;  2C5K T;  2CWY A;  1LVK A;  2Y48 B;  2IC9 A;  3HI2 A;  3DP7 A;  4PK5 A;  1D0Z A;  4N78 D;  1HX8 A;  4I55 E;  2NWB A;  4YJ2 E;  4UXN B;  2VK9 A;  3PTR B;  1UX4 A;  2QA7 A;  2Q9Q D;  4NUU A;  5FYM A;  4F6R C;  2C0S A;  3CX8 B;  4H9Q C;  3LK3 B;  3H3A A;  3B57 A;  3RYH E;  4IGU A;  1SA0 E;  4U72 A;  2ODV A;  3N2K E;  2V7I A;  3ZPO A;  4WBN E;  3VJZ A;  2L9Q A;  2VKH A;  2JRK A;  3MK7 C;  3PU8 A;  3AA6 B;  5IYZ E;  4KBM B;  1H7C A;  1YKE B;  3KIN B;  3L3P A;  4H9P C;  4OYJ A;  2YIN A;  3L09 A;  3W15 B;  3UUL A;  3O1J A;  1IAP A;  3PUQ A;  3PUR A;  3ZYM A;  3ZLI A;  4AI6 A;  2XAG B;  3MXZ A;  1D0X A;  3PUS A;  2OA5 A;  4PK6 A;  4CXY A;  2KIN B;  4G63 A;  1NAF A;  4IE6 A;  3N2O A;  2NTY A;  3AA0 B;  2WAU A;  4WW0 A;  5ETW A;  3OBV E;  4E7S A;  2NW7 A;  3N9P A;  5FXV A;  2D5U A;  1S94 A;  3M1C A;  3PHF 1;  4QXH B;  3U78 A;  2MYS A;  4PJM A;  3ETU A;  3ZC0 A;  1OWA A;  3FB2 A;  3I1A A;  3DTO A;  3ZJ2 A;  5FNV E;  3CQC B;  3CX7 B;  2YEV C;  3ANW A;  4I43 B;  3NZQ A;  3O4X E;  2ODU A;  1ZKE A;  5J1G A;  4GK0 E;  3NRY A;  3FXD B;  5JDL A;  5JDQ A;  3CKD A;  3VKG A;  2LM9 A;  4QX7 B;  4ZI7 E;  2KXP B;  2J1D G;  4A56 A;  2L3L A;  2LQU A;  2V26 A;  2JJ9 A;  5LBQ B;  3IHR A;  4IHJ E;  1D1A A;  4EAH A;  4CI2 B;  3UFE A;  2NTX A;  3KBU A;  4MLK A;  3LK2 B;  2CXF A;  3I9Y A;  4MFR A;  3Q5X A;  2DWK A;  4H9N C;  1QSD A;  4O4J E;  2V1D B;  5HAX A;  2X9Y A;  2V7L A;  3GWH A;  4HFV A;  5CA0 E;  3K3N A;  4DBR A;  4CI1 B;  4X1Y E;  3LBX A;  4UIG A;  4CXX A;  2LHR A;  3Q5W A;  2EHO D;  4OYK A;  2IW5 B;  2CM0 A;  2Y8D A;  2N9D A;  3O1I A;  4ERR A;  2PFV A;  2BZB A;  5LHH B;  1EZ3 A;  1MMG A;  4DBQ A;  3FBZ A;  1Y64 B;  2G0U A;  5FY7 A;  2BDE A;  5FMN A;  2VB6 A;  1MIV A;  1WYC A;  3CX6 B;  5JDN A;  5L2L A;  2K48 A;  4PFP A;  3VKH A;  4B6X A;  1S35 A;  3K8P C;  3C4W A;  5J2T E;  1U4Q A;  2Q9Q C;  4ILU A;  3EVY A;  4IE4 A;  5FXX A;  4EXT A;  3WI3 A;  1D0Y A;  1Z0P A;  2DWG A;  4J2C A;  1WLX A;  4MHC A;  2LSI A;  4QWN B;  4H9R C;  3CML A;  3LG7 A;  4U74 A;  4AXP A;  2W62 A;  5EK4 A;  1HCI A;  1LVF A;  1FMW A;  4BA9 A;  3JC6 D;  3PF0 A;  4O2A E;  1HF8 A;  3KFW X;  3OJA A;  3QUJ A;  2ZLY A;  5F3J A;  2CWO A;  3IF8 B;  3UUM A;  4XBF B;  5LG4 A;  5JRC B;  4QXC B;  4AQF C;  4P0B A;  5LXT E;  2DHR A;  3RRC A;  2X68 A;  3BQI A;  2KT9 A;  3IBP A;  4PFO A;  5LGU B;  3N9Q A;  2MTQ A;  4TUY E;  5HXE A;  1BR4 A;  1G8X A;  3LFM A;  3ETV A;  4TV8 E;  2C5I T;  2X9X A;  3HKD E;  3KV6 A;  2QGS A;  4K0U A;  4KMC A;  5FP3 A;  4KUM B;  5KX5 E;  2X9W A;  1MMA A;  2Q9Q B;  3PDY A;  2PG8 A;  5FY0 A;  1VRB A;  4CXW A;  4JLE A;  5H6R B;  3C50 A;  2EHO B;  4PW8 A;  2CXD A;  5HXH A;  3I0O A;  5LGN B;  1MMD A;  2LOP A;  4FI5 A;  2K9A A;  3LJC A;  5FY1 A;  3ZMS B;  4YFS A;  2JMH A;  4JUY A;  4ASK A;  3C98 B;  5TAO A;  4IDZ A;  2H7O A;  4H63 V;  5HYA A;  2H7V C;  4CZZ B;  4O8S A;  1HG5 A;  2CA5 A;  4PAG A;  2LE8 A;  2ZM2 A;  3ONX A;  4H9O C;  3ZYK A;  1YW0 A;  2ZM0 A;  4JEH B;  1WRD A;  2K24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...