5JDMA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 0.1mm sr2+
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
300
structure length
294
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIENPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords sodium-calcium exchanger NCX_Mj
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
total genus 126
structure length 294
sequence length 300
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdmA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdmA02
5JDFA 3V5SA 5HWYA 3V5UA 5HXHA 5HYAA 5HWXA 5JDGA 5JDHA 5HXRA 5JDQA 5HXCA 5HXSA 5JDMA 5JDLA 5JDNA 5HXEA
chains in the Genus database with same CATH superfamily
3OJAA 3JC6C 2JPFA 4E7ZA 4J2CA 1BR4A 1D0XA 2MPKA 4JEUB 1J5ET 1V9DA 3MXZA 5ABHA 5ADXL 2VURA 2X9WA 1IJ6A 3ZMZB 1QLBA 3OBVE 3MA9A 1J5WA 2X68A 1UX4A 1MMNA 4ZI3D 4PFOA 1ZHCA 3MACA 2WWVA 3J9X1 2DLRA 3F57A 3EHZA 1S35A 5HAXA 4HWIB 2X9HA 2YDSA 3V5SA 4IT4A 4JV5T 4NXNT 4HFDA 3AEFA 4DV6T 2WY2A 5FY7A 5LG4A 4PJMA 3OKQA 5EK4A 4OFZA 4UR9A 2IW5B 5L3BB 4UV8B 4JYAT 4HWFA 2XZEA 1KK7A 5JH7E 5AQGB 5HXHA 3RKGA 3O1JA 3FXEB 5HXSA 2XQ3A 3N9PA 1OWAA 3B5MA 2YDRA 3MJXA 3RC8A 1YXRA 3AAEB 2CXLA 5JQGE 4OHFA 2D0TA 4ADZA 3ZMUB 5L3GB 2YDQA 4O4HE 2VKOA 2RPAA 5LMUT 2JQ9A 5E0OA 3CX6B 2LHRA 5HYAA 2Q9QD 4LF6T 3CPZA 3N9OA 2LKHA 2XQ5A 4ANJA 1G8XA 1O3XA 4YY3T 3M65A 2C5JA 2KZ7B 1XWMA 4JEHB 3AAAB 1HX8A 2UXCT 4DR1T 3ZSSA 2K3WA 3QC9A 3KINB 5HXRA 2G0UA 4PK6A 5HEOA 3PTRB 4HN9A 4H9OC 3H37A 3F2EA 4JI8T 1CUNA 2DI4A 3RI5A 2UXNB 3AEEA 4CN1A 3AE2A 1HX1B 3PUZF 4JUYA 2JQHA 5AQNB 3AE1A 3RX6A 2LSJA 4JI7T 3OYZA 2BVMA 4DV3T 4IE0A 3FBZA 5DJQC 3Q5XA 2HPJA 5LGUB 4HFHA 1SJ7A 4IL9A 4XZCA 4O2AE 3RQUA 4U74A 3LSVA 4LMKA 4ONRA 4KUMB 1SUMB 3RKOA 4DR6T 3AE7A 3UUNA 2CHOA 4EYYR 1Y64B 1ZKEA 3TKLB 2PJQA 4EAHA 3L09A 5FMNA 1IJ5A 3CQCB 2E5VA 4JI2T 2NTYA 5AQOB 4CXWA 4DV7T 5JR9A 2E9XD 2V7JA 4AKLA 4BAYB 1T8BA 1U4QA 4DV0T 2Y6XA 2ZMAA 4IIJE 4DBQA 3NBXX 3C4XA 4CQIA 4L0RA 3DP7A 1MNEA 4JI6T 3P50A 5JDNA 3PV0F 4LFAT 1UX5A 2LSKA 4AQYT 2XQ4A 3ZCJA 5CA1E 3JADA 4ERRA 4ZHQE 1J1JA 3SFEA 2C0SA 4YTNA 4QXBB 2B1EA 2DHRA 3ANWB 3RRWA 3CX8B 1SHZC 3VRBA 5JREA 3UUBA 4GK0E 3MKDA 1SJ8A 5AQKB 2KINB 5FXVA 1HCIA 1D1BA 2X0CA 3AA7B 5F3JA 2WU2A 1JNZA 1SE7A 3SS1A 3RF1A 4X66T 3AA1B 3F31A 4YTPA 3ZMTB 4FI5A 4X1KE 1VRBA 2XSAA 3AB3B 4EZHA 2CE7A 2I6HA 4X20E 2KXPB 5AFUL 3P4RA 4TV9E 4O8SA 2VL0A 4QXHB 3G06A 2AXDS 3C4ZA 2FBWA 4OK0A 4UVCB 1KNRA 4G63A 2CLYC 3RIUA 5EK2A 3RC3A 2OA5A 1YQ3A 2WSSV 3KV4A 3DJBA 2D9DA 2JQQA 5CJ5A 3MK7C 3T8OA 5LNKA 2XAHB 4H9NC 1N33T 1KEYA 4I0UA 5AQSB 4EGWA 3TLSA 3FXDB 2E9XA 5HEGA 3ZYMA 4WNKA 5EZYE 2X9YA 3UFGA 1MIWA 4DMVA 4QKNA 3LDQB 1W09A 2W63A 4X65T 1N34T 2ZM2A 3K1SA 2WZIA 5AQIB 3GN5B 2ZLYA 5C8YE 1MIYA 4I4TE 1ZV4X 1L0VA 2K5BB 3PUVF 4IREA 3RYCE 4OX9T 3EVYA 2UUBT 3PUQA 2NTXA 4MALA 5HWYA 3PDYA 1OEDB 1OEDE 3GMIA 3NZQA 3HR0A 3AEBA 1B7TA 2X0YA 2J1DG 2K24A 3P7IA 3PUYF 2CBIA 4ZI2D 5FY0A 3ZYLA 1EZ3A 2BKOA 4H9QC 3LBXB 4IDPA 3SOLA 2DWKA 3I0QA 5ABGA 4LF7T 3RH3A 4MLKA 2BS4A 3HA4A 1XDPA 3X1DA 4GYSA 2ACZA 3NWIA 4DR5T 4YXDA 1KNZA 1WYCA 2L3LA 3KVAA 2H7VC 5JRCA 2PG8A 4AQFA 4DV5T 2C5IT 2W62A 3IEEA 4WW0A 4DMWA 3FZLB 2L10A 4AIUA 3A7MA 2QYWA 5FP3A 3C98B 4QH4A 3ABVA 3I9YA 4EEDA 4YTMA 3K3OA 5LBQB 2WU5A 3ZLIA 2CCQA 4YJ2E 1X9BA 1HFAA 3PE0A 4JLEA 4A56A 3N9LA 5DQWA 4I50E 5IHYA 2A2FX 5KMGP 3TLVA 2WM9A 2WWUA 2J47A 2XJ7A 3AAIA 5LOVE 3PJAJ 3LK3B 2XTLA 2JMKA 2VK9A 1XZYA 2FJEA 3P4WA 3GA8A 2V1DB 4DR2T 1KNPA 3ZT6A 2CWOA 4KHPT 1YKHB 3S4UA 2M67A 3KBTA 1D0ZA 4QH1A 1IBKT 5CGMA 4CI2B 3HL6A 4U2YA 4F6RC 2X67A 4HWHA 3Q5WA 2LM2A 3VU7H 2YU2A 5FVKA 3QK6A 3PUSA 1HG5A 3P4PA 4QX7B 5JDFA 5FL0A 1MMGA 2IUBA 3MZKB 4JI4T 4MBQA 1KF6A 3LG7A 3AA0B 3A8YC 2DWGA 3CIRA 3KV6A 2CMRA 4DUZT 5LHIB 3U78A 4LFBT 2WQYA 4EIWA 2V7LA 3ANWA 2N9DA 5AQUB 3CKDA 1JNRA 3L39A 3ZMVB 2C5KT 5LP6E 1IBMT 4ISSA 4ZEYA 4AKGA 4V1Av 4B3ST 2LSIA 2N1GA 3ZC0A 5HXEA 4H63H 4IDOA 3FZHB 1XMOT 2XQ6A 4DVDA 2XAQB 4HE8A 3HKCE 5LB7B 3TLWA 4IL4A 4ZI3C 4EEBA 4QXCB 1IAPA 3RGLA 3AE8A 3UTKA 4EXTA 3B13A 3KVBA 2CPTA 3C4WA 4U7IA 3RLFF 5J2UE 4DO0A 4JI3T 5FYMA 1W9RA 3D0TA 2WS3A 4IDQA 4UF0B 5KDMC 2MYSA 2FUPA 3EUHA 1MMAA 4WBNE 4TNWA 3SWHA 4B3MT 3AXJB 3HKBE 2BG9B 2BG9E 3AE6A 2CLYB 5TAOA 2KVPA 2WBLA 3PJAA 4NXMT 1WCRA 2QGSA 4ASKA 2R6GF 3WI3A 3CMLA 3V5UA 5JR9C 2W61A 4XBFB 3RIFA 3GN5A 2YU1A 3ONXA 2LSGA 1I94T 4DR7T 3SFDA 3Q5EA 1Z8UA 1UURA 2X51A 2H3RA 2K9AA 4JI5T 2Q9QC 3AE4A 3ZPOA 4DV2T 3I0OA 4ZZBA 1OEDA 3BK9A 2VASA 4Z91A 1XNQT 3QB5K 4JBWF 4TZ4C 3UU8A 3JCFA 3O4XE 3FZMB 1G73A 1BR0A 5JDGA 1U5PA 1YQ4A 1WYBA 4ZOLE 1UGOA 3ZN1B 4DV4T 1MNDA 3C51A 3VRAA 3AY5A 3CX7B 2VWAA 2SPCA 3OPCA 5LHGB 4AXPA 4EZ4A 2BS2A 4YT0A 2J4GA 4C90A 4NPPA 3VKHA 1HNZT 4LF9T 5LA6E 5JDLA 3ZMSB 3CQXC 2I0MA 3E08A 3TLTA 4KHZF 2HHHT 2XAFB 4WZXA 5C3JA 3NVOA 4O4JE 4YHJA 4DUYT 5A1LA 2V7KA 2WB5A 1NWMX 2D0UA 3KBUA 4A98A 3ONJA 3RIUC 2E2AA 3KV9A 3RQWA 1YW0A 4JI1T 2WP9A 3OYXA 4PJJA 3H3AA 1S94A 2CEAA 3OTOT 2H7OA 3P4QA 4HFVA 3ONLC 3AECA 2E9XC 2WAUA 3QNUA 3ZJ1A 4Z90A 1MIVA 2EHOB 1LKXA 2NOXA 2Y8DA 2W0GA 3AE3A 5L3EB 2YEVC 3Q9DA 3FZKB 5J1GA 5H6QB 2A3DA 5HEHA 2YN6A 4P0BA 2XUEA 2XY8B 3UU3A 4PK5A 2RA1A 3EDVA 3UUXB 3KDSE 1M7KA 4I55E 1WR6A 1UCUA 3NKZA 2NR4A 3ZSTA 4QWNB 5F5WA 2XASB 1XMQT 3B57A 5ABEA 2XM1A 1HR0T 2UXBT 1T7SA 2QVAA 3LK42 2CM0A 4I43B 5HXCA 2GK9A 5JDQA 5FXZA 2ODVA 3N9QA 3RRCA 4E7SA 3UQ7A 5L2LA 5J2TE 4PFPA 1OXZA 4DNDA 3DTOA 4U72A 4M1PA 4X1YE 2MOZA 2LHNA 4NIQA 4PJNA 2WZHA 2BS3A 1UK5A 5EK3A 4LMJA 3ZEFB 4AQFC 3PF0A 3RHWA 3ETVA 2LE8A 3FB2A 5LXTE 2OLTA 1SA0E 4CI1B 5JTGA 3E22E 3LFMA 3P4SA 3UT5E 5LBMA 5ABFB 2IDOB 2PBIA 2VB6A 2L8KA 4LF8T 3W15B 2XPKA 2LLYA 2KWHA 2UUCT 4F7GB 2KWIB 3PU8A 4GKJT 3GWHA 2HPLA 4YSXA 2XQ9A 4GK5E 4IE4A 3VR9A 3EI0A 2H88A 2UXDT 2KLQA 1HNWT 2I59A 3NRYA 4UF0A 3PURA 4O4IE 4PAGA 2BVLA 3A5XA 1FIOA 2YKSA 3HKDE 4YJ3E 4WYVA 2IIUA 3KFWX 5L4HA 3AXJA 3ZT5A 4LFCT 5AQPB 2BG9A 2NW9A 4CN6A 2YOEA 4UELA 2MAWA 3FHNA 3LK2B 2VL8A 2M6IA 2F4VT 2NW8A 2BKPA 4ILBA 4IE7A 4MFRA 2H89A 2QA7A 5LYJE 5FXWA 2LM9A 2CXDA 4DR3T 2KBBA 2BZBA 2NP9A 3Q2MA 5FY1A 4Z8XA 4B6XA 5AQVB 2Y48B 4DBRA 3AA6B 4O2BE 4QHOA 2VVSA 3N5LA 4ZI2C 2ACXA 4B3RT 2ZM0A 2MTQA 1UUSA 3QB5A 4UEMA 1E1HB 2WCAA 3JC6D 3K8PC 2CA5A 1FMWA 2MBGA 4EOZB 3DYJA 2Q9QB 5AQFB 2XAGB 3QUJA 4YLHA 3CWZB 5L47A 4HKAA 3R84B 4UXNB 5M4YA 3N2KE 3UFEA 2KGXA 4EYUA 4TN7B 4IE6A 4HFEA 2CHNA 3IA3A 2V6XA 2W00A 3N9MA 2WDRA 2BKNA 3ZC1A 2LJLA 4LMLA 2XQYA 4YFSA 5LHHB 3PUAA 2CBJA 2A72A 3M3ZB 2N2NA 5IYZE 3N2GE 2V6YB 3AE9A 4ZI7E 2JIWA 4AKHA 4PNIA 5LG3A 4KMCA 2W67A 3ESLA 5LGNB 2VQFT 1HF8A 5T1DA 5F8PA 3JAFA 4UV9B 2V5CA 2VKDA 1I6ZA 4LF4T 1LVFA 1QSDA 2VKHA 4ZS2A 2KSRA 4H63V 3VR8A 4U2ZA 3CK6A 2FJDA 2CXFA 2E5LT 1XDOA 3CQGB 1IZNB 5AQTB 3N2OA 5DABA 5CA0E 4PJLA 1IBLT 4JI0T 2WMNA 2DL1A 2W2UA 4IHJE 4N78D 1YKEB 4CZZB 1WR0A 3C50A 1BR2A 2KNDA 4CI3B 2DCFA 3FYQA 2A9UA 3E0ZA 2EHOA 3L8RA 4A97A 3O9XA 2X9XA 5H6RB 4CXYA 2KMFA 5JDHA 1NAFA 3PHF1 2E9XB 2YINA 3IF8B 5L4EA 2K48A 2W4XA 1T72A 4KX6A 3SRZA 3RYFE 4F8HA 3ZKRA 2M6BA 3O1HA 4AISA 4H9SE 2V7MA 2B76A 1OEDC 3C64A 4KI0F 5C2TA 1HG2A 1YD8G 2L7NA 3OVUA 4AKRB 2LQUA 3J7Yq 1FMVA 3JAEA 3PUGA 3I9WA 4YSZA 4IDNA 4NUUA 4DV1T 2HN2A 4X64T 4K0UA 2J62A 4X62T 4ECGA 3N9NA 4K0KT 4ZXLA 3ZCIA 5CB4E 2MTCA 4BGOA 4O4LE 1Y01A 4TWDA 1H7CA 1ZEEA 4H9RC 2LRLA 1M62A 4IDZA 1NEKA 1E2AA 4GIWA 2P9BA 2JMHA 3WAKA 4QX8B 1N32T 3RYHE 4P09A 4HFBA 4HTEA 4PW8A 5AQHB 5JRCB 2IMLA 3WSCA 2ODUA 5ABFA 4IGUA 3RYIE 3AVRA 5HCMA 3IBPA 4CN4A 4YHHT 3NZPA 2UXXB 4UVAB 4AI6A 2XQ8A 4GOUA 2LEHA 2ZM8A 5FNVE 2KT9A 3K3QC 4KBMB 2NW7A 4UVBB 2BBHA 5BMVE 3BQIA 4IE5A 5LJMA 2XM2A 1W0AA 2JRKA 3AT7A 3LBXA 4TUYE 2V7IA 3VJZA 1CHUA 2VQET 5AQQB 3P8CD 1D1AA 4L9IA 1KFYA 4QH5A 5KXJA 5FZTA 4BA9A 1VOMA 4BJMA 3T1YT 3EDUA 3EAMA 3H3MA 1Z0PA 3BQLA 4TWFA 2V26A 2CWYA 5L3FB 4A5XA 1LVKA 3AEDA 4ZS3A 2PTFA 5GONE 4U3CA 4CXXA 2LKGA 3ZYKA 2E8IA 2D5UA 2IHR1 3UU4A 4AKIA 2YK0A 5KX5E 3PUWF 4TWHA 4X5TA 2Q9QA 4MHCA 2L9QA 3EABA 1W0BA 3ETUA 4C91A 1MMDA 2IC6A 1AJ3A 2RP4A 3UUMA 5LMNT 4FJOA 1VCSA 5BR8T 2XHEB 4HFCA 4U31A 4Q25A 2XQAA 2X66A 3Q5DA 2V6YA 2Z6EA 4L5GA 3R6NA 4YSYA 2V8SV 3AEAA 2D2SA 1QUUA 2NWBA 4XAXB 3M1CA 2OV9A 2XSBA 2DNXA 4OYKA 4EV6A 2JQKA 2LOSA 1D0YA 1LRZA 5CFBA 4ILUA 2UU9T 1FEWA 4DR4T 5IWAT 3AVSA 4ZZCA 4U33A 2JJ9A 4WBOA 2QRXA 2VKJA 4H9PC 5LGTB 5AQMB 1ZOYA 5JDMA 5HCJA 2BG9C 3NRXA 3BQKA 2W66A 5FVLA 4HWDA 3TLUA 3WURA 5JVDE 4HEAA 4W8PA 2PFVA 4TNVA 3UU5A 4NUVA 3VKGA 1HTJF 4X1IE 2CRBA 5HEUA 2LRKA 4LF5T 2FJAA 2IAKA 3UQ4A 4ILCA 4BJNA 3L3PA 4COFA 4HWCA 1WFDA 5J0ZA 3ZN0B 2LSYA 3T1HT 3O1IA 4TX5A 5HWXA 5IUXA 2ZM6T 3HKEE 2HN1A 4ILAA 3I1AA 4UIGA 3IHRA 2WMOA 2XQ7A 3CVRA 3FZFB 5AQJB 1VCTA 4AQGA 5DQVA 2IC9A 3AE5A 2WDQA 4P1NA 5FL1A 3U3IA 5AQLB 5L3CB 1T98A 3RPUA 3K3NA 4ISTA 3VHLA 2LOPA 3AEGA 1HS7A 1N36T 2LT3A 1ZP0A 2EHOD 3QOFA 1US7B 4PK4A 5JR9B 3PUXF 5FXXA 4OYJA 1DU2A 5FKYA 4P0AA 4TV8E 2X0HA 5AQRB 1WRDA 4U7YA 1NENA 5ETWA 2WDVA 2XAJB 4EB6E 4HFIA 3RIAA 3HI2A 3LJCA 2X0LB 1HNXT 2VVNA 2HH7A 2V5DA 4GKKT 1WLXA 1FJGT 1X79A 2BBJA 3UULA 4HGAA 1GQEA 4G2AA 4DIDB 1XNRT 1E7PA 3UU6A 2UUAT 4KP3C 5L3DB 2EHOC 4B3TT 5LJNA 2BDEA 3PU3A 1R8IA 2FJBA 2AE9A 4GYRA 3FBLA 2ES0A 3WAJA 1D1CA 5LCYA 1BR1A 3KV5A 3ZJ2A 3ZT7A 5HEJA
chains in the Genus database with same CATH topology
3KBUA 3OJAA 2K5BB 3ZCIA 3JC6C 3KV9A 5CB4E 3RYCE 2MTCA 2JPFA 3EVYA 1YW0A 4E7ZA 4BGOA 4O4LE 3OYXA 4J2CA 4PJJA 3H3AA 3PUQA 1BR4A 1D0XA 1S94A 2CEAA 2NTXA 1H7CA 1ZEEA 4H9RC 4JEUB 3PDYA 4MALA 2H7OA 5HWYA 3GMIA 4HFVA 1V9DA 3NZQA 4IDZA 4GIWA 3HR0A 2P9BA 1B7TA 2JMHA 3MXZA 3WAKA 4QX8B 2J1DG 2K24A 2E9XC 3P7IA 3RYHE 2WAUA 4P09A 5ADXL 4ZI2D 5FY0A 3ZYLA 3ZJ1A 2X9WA 1IJ6A 1EZ3A 3ZMZB 4HTEA 4PW8A 4H9QC 5JRCB 1MIVA 2EHOB 1LKXA 2NOXA 3OBVE 3MA9A 2Y8DA 2X68A 3WSCA 1UX4A 2W0GA 3LBXB 1MMNA 2ODUA 4IGUA 3RYIE 4PFOA 4ZI3D 3SOLA 3AVRA 2DWKA 3I0QA 5L3EB 3IBPA 2YEVC 3Q9DA 5J1GA 1ZHCA 3MACA 4MLKA 3RH3A 3HA4A 3J9X1 2DLRA 3F57A 4GYSA 1S35A 2A3DA 3NZPA 5H6QB 2UXXB 4UVAB 4AI6A 4P0BA 2XUEA 4PK5A 4GOUA 2LEHA 2RA1A 2ZM8A 5FNVE 2KT9A 3EDVA 1KNZA 5HAXA 1WYCA 3K3QC 4KBMB 3UUXB 2X9HA 3KDSE 2NW7A 3V5SA 2L3LA 3KVAA 4I55E 4UVBB 1WR6A 5BMVE 1UCUA 2H7VC 3BQIA 4IE5A 5JRCA 4QWNB 2PG8A 2XASB 4AQFA 5LJMA 3B57A 2JRKA 3AT7A 3LBXA 5FY7A 5LG4A 4TUYE 2C5IT 2V7IA 4PJMA 2W62A 3LK42 3OKQA 2CM0A 3IEEA 4WW0A 4DMWA 5EK4A 4OFZA 3VJZA 2IW5B 5FP3A 4I43B 3C98B 3P8CD 5L3BB 1D1AA 4UV8B 4L9IA 5HXCA 2GK9A 3I9YA 1KK7A 5JH7E 3K3OA 5HXHA 5JDQA 5LBQB 4BA9A 5FXZA 2ODVA 3ZLIA 3N9QA 2CCQA 1VOMA 3RRCA 4BJMA 4YJ2E 4E7SA 1HFAA 3PE0A 3O1JA 4JLEA 4A56A 3FXEB 3N9LA 5HXSA 3EDUA 3N9PA 5J2TE 1OWAA 4PFPA 5L2LA 1OXZA 5DQWA 1Z0PA 4I50E 5IHYA 3DTOA 3MJXA 4DNDA 3RC8A 3BQLA 4U72A 2A2FX 4M1PA 2V26A 4X1YE 2CWYA 5L3FB 5KMGP 3AAEB 2MOZA 1LVKA 2LHNA 4PJNA 2WM9A 2CXLA 5JQGE 4ZS3A 5EK3A 2WWUA 4OHFA 2D0TA 5GONE 4ADZA 3AAIA 5LOVE 3ZMUB 4AQFC 4CXXA 3ZEFB 3ZYKA 3PF0A 5L3GB 4O4HE 3ETVA 3LK3B 2LE8A 3FB2A 5LXTE 2XTLA 2E8IA 2JMKA 2VKOA 2VK9A 2D5UA 1SA0E 4AKIA 4CI1B 3GA8A 2V1DB 3E22E 5E0OA 2CWOA 2LHRA 2YK0A 1YKHB 2Q9QD 3CX6B 3LFMA 3UT5E 5HYAA 5KX5E 3S4UA 3CPZA 2M67A 3KBTA 3N9OA 5LBMA 2PBIA 2VB6A 2L8KA 3W15B 1D0ZA 2Q9QA 4MHCA 2KWHA 4ANJA 4CI2B 3HL6A 4F6RC 1G8XA 2KWIB 2X67A 3PU8A 3GWHA 2HPLA 2L9QA 1O3XA 4GK5E 4IE4A 3M65A 3Q5WA 2C5JA 3ETUA 2KZ7B 3VU7H 2YU2A 4JEHB 2KLQA 4C91A 1MMDA 2IC6A 3AAAB 1HX8A 3QK6A 3PUSA 1AJ3A 2RP4A 3UUMA 1HG5A 2I59A 3QC9A 3KINB 4FJOA 5HXRA 2G0UA 3NRYA 4QX7B 4UF0A 5JDFA 2XHEB 4PK6A 1MMGA 3MZKB 3PURA 4O4IE 4MBQA 3PTRB 4PAGA 4HN9A 2BVLA 3A5XA 4H9OC 1FIOA 3H37A 2X66A 3LG7A 3HKDE 3F2EA 4YJ3E 3AA0B 1CUNA 3KFWX 2DI4A 2UXNB 2Z6EA 4L5GA 2DWGA 3R6NA 3KV6A 2NW9A 2CMRA 5LHIB 3U78A 4UELA 4JUYA 3FHNA 3LK2B 3RX6A 2VL8A 2LSJA 2D2SA 2NW8A 4EIWA 4MFRA 4IE7A 1QUUA 2V7LA 2QA7A 3ANWA 5LYJE 2NWBA 3OYZA 2N9DA 5FXWA 2LM9A 2CXDA 2BVMA 4XAXB 3CKDA 2BZBA 4IE0A 3M1CA 3FBZA 5DJQC 2NP9A 2HPJA 3Q5XA 3ZMVB 2C5KT 5LGUB 3Q2MA 5LP6E 2DNXA 4OYKA 5FY1A 4ISSA 4Z8XA 4B6XA 4AKGA 4XZCA 2LOSA 4O2AE 4V1Av 1D0YA 1LRZA 2Y48B 4DBRA 2LSIA 2N1GA 4ILUA 3AA6B 3ZC0A 1FEWA 5HXEA 4O2BE 4QHOA 4U74A 3N5LA 4ZI2C 2ACXA 4H63H 3AVSA 4DVDA 4ONRA 4KUMB 3RKOA 2JJ9A 4WBOA 2ZM0A 2MTQA 2XAQB 4HE8A 3HKCE 3UUNA 2VKJA 4UEMA 1E1HB 4ZI3C 4H9PC 5LGTB 4QXCB 1IAPA 3JC6D 3K8PC 5JDMA 3NRXA 2CA5A 1FMWA 3BQKA 2MBGA 4EOZB 4EYYR 3UTKA 1Y64B 1ZKEA 2Q9QB 3TKLB 2PJQA 2XAGB 4EAHA 3L09A 3QUJA 4YLHA 5FMNA 3CWZB 1IJ5A 4EXTA 3CQCB 4HKAA 3R84B 2NTYA 4UXNB 3B13A 3KVBA 3N2KE 3C4WA 4CXWA 5M4YA 3UFEA 5J2UE 4DO0A 4EYUA 4TN7B 5JR9A 4IE6A 2E9XD 2V7JA 4AKLA 5FYMA 4BAYB 3WURA 3D0TA 5JVDE 4HEAA 1U4QA 2Y6XA 2ZMAA 2PFVA 4IIJE 4DBQA 2W00A 3N9MA 4NUVA 3ZC1A 4UF0B 5KDMC 3NBXX 3C4XA 2LJLA 4CQIA 3VKGA 2XQYA 4L0RA 4YFSA 1HTJF 3PUAA 5LHHB 4X1IE 2A72A 2MYSA 2N2NA 3DP7A 3EUHA 5IYZE 1MMAA 4WBNE 1MNEA 3N2GE 2IAKA 5JDNA 3SWHA 4BJNA 1UX5A 2LSKA 3L3PA 4ZI7E 3HKBE 3ZCJA 4AKHA 2CLYB 5CA1E 5TAOA 3ZN0B 2LSYA 4PNIA 4ERRA 2WBLA 4ZHQE 4KMCA 3ESLA 5LGNB 2C0SA 4QXBB 2B1EA 2DHRA 3ANWB 3O1IA 1HF8A 3RRWA 4TX5A 5HWXA 5T1DA 3CX8B 1SHZC 5F8PA 5JREA 2QGSA 4ASKA 4UV9B 2VKDA 3HKEE 3CMLA 3V5UA 1LVFA 1QSDA 3WI3A 2VKHA 5JR9C 4ZS2A 4H63V 2W61A 4GK0E 3MKDA 3I1AA 4XBFB 3GN5A 4UIGA 2YU1A 3IHRA 2WMOA 3ONXA 3CVRA 2LSGA 2KINB 2CXFA 5FXVA 2X51A 4AQGA 1HCIA 5DQVA 3CQGB 1D1BA 2IC9A 1IZNB 2H3RA 2K9AA 2Q9QC 3N2OA 5DABA 5CA0E 3AA7B 3ZPOA 4PJLA 5F3JA 3U3IA 5L3CB 2WMNA 1T98A 3SS1A 3I0OA 3AA1B 3RPUA 3F31A 3BK9A 3K3NA 2VASA 4IHJE 4N78D 4ISTA 3VHLA 1YKEB 4CZZB 3ZMTB 3C50A 2LOPA 4FI5A 4TZ4C 1HS7A 4X1KE 2LT3A 1VRBA 2EHOD 1BR2A 3AB3B 2KNDA 4CI3B 2DCFA 1US7B 3O4XE 4PK4A 5JR9B 5FXXA 3E0ZA 2EHOA 4EZHA 4OYJA 3O9XA 1G73A 1BR0A 2CE7A 2X9XA 5H6RB 4CXYA 2KMFA 4X20E 5JDGA 1U5PA 2KXPB 5AFUL 5JDHA 1NAFA 3PHF1 1WYBA 2E9XB 2YINA 4ZOLE 4P0AA 4TV9E 4O8SA 4QXHB 3ZN1B 3IF8B 4TV8E 2K48A 1MNDA 3C51A 3C4ZA 1WRDA 3SRZA 3RYFE 4OK0A 4UVCB 4G63A 5ETWA 2CLYC 5EK2A 3CX7B 2VWAA 3RC3A 2OA5A 2XAJB 2SPCA 2WSSV 3KV4A 3O1HA 4EB6E 3DJBA 2JQQA 3HI2A 4H9SE 5LHGB 3LJCA 3MK7C 2X0LB 3T8OA 4AXPA 4EZ4A 5LNKA 2V7MA 2XAHB 2HH7A 4H9NC 4C90A 1WLXA 3C64A 3VKHA 1X79A 3UULA 4HGAA 3FXDB 1HG2A 1YD8G 2E9XA 4G2AA 4WNKA 5EZYE 5LA6E 3ZYMA 3ZMSB 5JDLA 2X9YA 3CQXC 1MIWA 4DMVA 4QKNA 2W63A 4AKRB 2LQUA 3E08A 3J7Yq 1FMVA 4KP3C 5L3DB 2EHOC 2XAFB 3PUGA 3I9WA 2ZM2A 5LJNA 2BDEA 4NUUA 3PU3A 4O4JE 3GN5B 2ZLYA 4YHJA 4GYRA 3FBLA 2ES0A 4K0UA 5A1LA 3WAJA 1D1CA 2V7KA 1NWMX 5LCYA 1BR1A 3KV5A 5C8YE 3ZJ2A 4ECGA 1MIYA 2D0UA 3N9NA 4I4TE 1ZV4X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDF A;  3V5S A;  5HWY A;  3V5U A;  5HXH A;  5HYA A;  5HWX A;  5JDG A;  5JDH A;  5HXR A;  5JDQ A;  5HXC A;  5HXS A;  5JDM A;  5JDL A;  5JDN A;  5HXE A; 
#chains in the Genus database with same CATH topology
 3OJA A;  3JC6 C;  2JPF A;  4E7Z A;  4J2C A;  1BR4 A;  1D0X A;  2MPK A;  4JEU B;  1J5E T;  1V9D A;  3MXZ A;  5ABH A;  5ADX L;  2VUR A;  2X9W A;  1IJ6 A;  3ZMZ B;  1QLB A;  3OBV E;  3MA9 A;  1J5W A;  2X68 A;  1UX4 A;  1MMN A;  4ZI3 D;  4PFO A;  1ZHC A;  3MAC A;  2WWV A;  3J9X 1;  2DLR A;  3F57 A;  3EHZ A;  1S35 A;  5HAX A;  4HWI B;  2X9H A;  2YDS A;  3V5S A;  4IT4 A;  4JV5 T;  4NXN T;  4HFD A;  3AEF A;  4DV6 T;  2WY2 A;  5FY7 A;  5LG4 A;  4PJM A;  3OKQ A;  5EK4 A;  4OFZ A;  4UR9 A;  2IW5 B;  5L3B B;  4UV8 B;  4JYA T;  4HWF A;  2XZE A;  1KK7 A;  5JH7 E;  5AQG B;  5HXH A;  3RKG A;  3O1J A;  3FXE B;  5HXS A;  2XQ3 A;  3N9P A;  1OWA A;  3B5M A;  2YDR A;  3MJX A;  3RC8 A;  1YXR A;  3AAE B;  2CXL A;  5JQG E;  4OHF A;  2D0T A;  4ADZ A;  3ZMU B;  5L3G B;  2YDQ A;  4O4H E;  2VKO A;  2RPA A;  5LMU T;  2JQ9 A;  5E0O A;  3CX6 B;  2LHR A;  5HYA A;  2Q9Q D;  4LF6 T;  3CPZ A;  3N9O A;  2LKH A;  2XQ5 A;  4ANJ A;  1G8X A;  1O3X A;  4YY3 T;  3M65 A;  2C5J A;  2KZ7 B;  1XWM A;  4JEH B;  3AAA B;  1HX8 A;  2UXC T;  4DR1 T;  3ZSS A;  2K3W A;  3QC9 A;  3KIN B;  5HXR A;  2G0U A;  4PK6 A;  5HEO A;  3PTR B;  4HN9 A;  4H9O C;  3H37 A;  3F2E A;  4JI8 T;  1CUN A;  2DI4 A;  3RI5 A;  2UXN B;  3AEE A;  4CN1 A;  3AE2 A;  1HX1 B;  3PUZ F;  4JUY A;  2JQH A;  5AQN B;  3AE1 A;  3RX6 A;  2LSJ A;  4JI7 T;  3OYZ A;  2BVM A;  4DV3 T;  4IE0 A;  3FBZ A;  5DJQ C;  3Q5X A;  2HPJ A;  5LGU B;  4HFH A;  1SJ7 A;  4IL9 A;  4XZC A;  4O2A E;  3RQU A;  4U74 A;  3LSV A;  4LMK A;  4ONR A;  4KUM B;  1SUM B;  3RKO A;  4DR6 T;  3AE7 A;  3UUN A;  2CHO A;  4EYY R;  1Y64 B;  1ZKE A;  3TKL B;  2PJQ A;  4EAH A;  3L09 A;  5FMN A;  1IJ5 A;  3CQC B;  2E5V A;  4JI2 T;  2NTY A;  5AQO B;  4CXW A;  4DV7 T;  5JR9 A;  2E9X D;  2V7J A;  4AKL A;  4BAY B;  1T8B A;  1U4Q A;  4DV0 T;  2Y6X A;  2ZMA A;  4IIJ E;  4DBQ A;  3NBX X;  3C4X A;  4CQI A;  4L0R A;  3DP7 A;  1MNE A;  4JI6 T;  3P50 A;  5JDN A;  3PV0 F;  4LFA T;  1UX5 A;  2LSK A;  4AQY T;  2XQ4 A;  3ZCJ A;  5CA1 E;  3JAD A;  4ERR A;  4ZHQ E;  1J1J A;  3SFE A;  2C0S A;  4YTN A;  4QXB B;  2B1E A;  2DHR A;  3ANW B;  3RRW A;  3CX8 B;  1SHZ C;  3VRB A;  5JRE A;  3UUB A;  4GK0 E;  3MKD A;  1SJ8 A;  5AQK B;  2KIN B;  5FXV A;  1HCI A;  1D1B A;  2X0C A;  3AA7 B;  5F3J A;  2WU2 A;  1JNZ A;  1SE7 A;  3SS1 A;  3RF1 A;  4X66 T;  3AA1 B;  3F31 A;  4YTP A;  3ZMT B;  4FI5 A;  4X1K E;  1VRB A;  2XSA A;  3AB3 B;  4EZH A;  2CE7 A;  2I6H A;  4X20 E;  2KXP B;  5AFU L;  3P4R A;  4TV9 E;  4O8S A;  2VL0 A;  4QXH B;  3G06 A;  2AXD S;  3C4Z A;  2FBW A;  4OK0 A;  4UVC B;  1KNR A;  4G63 A;  2CLY C;  3RIU A;  5EK2 A;  3RC3 A;  2OA5 A;  1YQ3 A;  2WSS V;  3KV4 A;  3DJB A;  2D9D A;  2JQQ A;  5CJ5 A;  3MK7 C;  3T8O A;  5LNK A;  2XAH B;  4H9N C;  1N33 T;  1KEY A;  4I0U A;  5AQS B;  4EGW A;  3TLS A;  3FXD B;  2E9X A;  5HEG A;  3ZYM A;  4WNK A;  5EZY E;  2X9Y A;  3UFG A;  1MIW A;  4DMV A;  4QKN A;  3LDQ B;  1W09 A;  2W63 A;  4X65 T;  1N34 T;  2ZM2 A;  3K1S A;  2WZI A;  5AQI B;  3GN5 B;  2ZLY A;  5C8Y E;  1MIY A;  4I4T E;  1ZV4 X;  1L0V A;  2K5B B;  3PUV F;  4IRE A;  3RYC E;  4OX9 T;  3EVY A;  2UUB T;  3PUQ A;  2NTX A;  4MAL A;  5HWY A;  3PDY A;  1OED B;  1OED E;  3GMI A;  3NZQ A;  3HR0 A;  3AEB A;  1B7T A;  2X0Y A;  2J1D G;  2K24 A;  3P7I A;  3PUY F;  2CBI A;  4ZI2 D;  5FY0 A;  3ZYL A;  1EZ3 A;  2BKO A;  4H9Q C;  3LBX B;  4IDP A;  3SOL A;  2DWK A;  3I0Q A;  5ABG A;  4LF7 T;  3RH3 A;  4MLK A;  2BS4 A;  3HA4 A;  1XDP A;  3X1D A;  4GYS A;  2ACZ A;  3NWI A;  4DR5 T;  4YXD A;  1KNZ A;  1WYC A;  2L3L A;  3KVA A;  2H7V C;  5JRC A;  2PG8 A;  4AQF A;  4DV5 T;  2C5I T;  2W62 A;  3IEE A;  4WW0 A;  4DMW A;  3FZL B;  2L10 A;  4AIU A;  3A7M A;  2QYW A;  5FP3 A;  3C98 B;  4QH4 A;  3ABV A;  3I9Y A;  4EED A;  4YTM A;  3K3O A;  5LBQ B;  2WU5 A;  3ZLI A;  2CCQ A;  4YJ2 E;  1X9B A;  1HFA A;  3PE0 A;  4JLE A;  4A56 A;  3N9L A;  5DQW A;  4I50 E;  5IHY A;  2A2F X;  5KMG P;  3TLV A;  2WM9 A;  2WWU A;  2J47 A;  2XJ7 A;  3AAI A;  5LOV E;  3PJA J;  3LK3 B;  2XTL A;  2JMK A;  2VK9 A;  1XZY A;  2FJE A;  3P4W A;  3GA8 A;  2V1D B;  4DR2 T;  1KNP A;  3ZT6 A;  2CWO A;  4KHP T;  1YKH B;  3S4U A;  2M67 A;  3KBT A;  1D0Z A;  4QH1 A;  1IBK T;  5CGM A;  4CI2 B;  3HL6 A;  4U2Y A;  4F6R C;  2X67 A;  4HWH A;  3Q5W A;  2LM2 A;  3VU7 H;  2YU2 A;  5FVK A;  3QK6 A;  3PUS A;  1HG5 A;  3P4P A;  4QX7 B;  5JDF A;  5FL0 A;  1MMG A;  2IUB A;  3MZK B;  4JI4 T;  4MBQ A;  1KF6 A;  3LG7 A;  3AA0 B;  3A8Y C;  2DWG A;  3CIR A;  3KV6 A;  2CMR A;  4DUZ T;  5LHI B;  3U78 A;  4LFB T;  2WQY A;  4EIW A;  2V7L A;  3ANW A;  2N9D A;  5AQU B;  3CKD A;  1JNR A;  3L39 A;  3ZMV B;  2C5K T;  5LP6 E;  1IBM T;  4ISS A;  4ZEY A;  4AKG A;  4V1A v;  4B3S T;  2LSI A;  2N1G A;  3ZC0 A;  5HXE A;  4H63 H;  4IDO A;  3FZH B;  1XMO T;  2XQ6 A;  4DVD A;  2XAQ B;  4HE8 A;  3HKC E;  5LB7 B;  3TLW A;  4IL4 A;  4ZI3 C;  4EEB A;  4QXC B;  1IAP A;  3RGL A;  3AE8 A;  3UTK A;  4EXT A;  3B13 A;  3KVB A;  2CPT A;  3C4W A;  4U7I A;  3RLF F;  5J2U E;  4DO0 A;  4JI3 T;  5FYM A;  1W9R A;  3D0T A;  2WS3 A;  4IDQ A;  4UF0 B;  5KDM C;  2MYS A;  2FUP A;  3EUH A;  1MMA A;  4WBN E;  4TNW A;  3SWH A;  4B3M T;  3AXJ B;  3HKB E;  2BG9 B;  2BG9 E;  3AE6 A;  2CLY B;  5TAO A;  2KVP A;  2WBL A;  3PJA A;  4NXM T;  1WCR A;  2QGS A;  4ASK A;  2R6G F;  3WI3 A;  3CML A;  3V5U A;  5JR9 C;  2W61 A;  4XBF B;  3RIF A;  3GN5 A;  2YU1 A;  3ONX A;  2LSG A;  1I94 T;  4DR7 T;  3SFD A;  3Q5E A;  1Z8U A;  1UUR A;  2X51 A;  2H3R A;  2K9A A;  4JI5 T;  2Q9Q C;  3AE4 A;  3ZPO A;  4DV2 T;  3I0O A;  4ZZB A;  1OED A;  3BK9 A;  2VAS A;  4Z91 A;  1XNQ T;  3QB5 K;  4JBW F;  4TZ4 C;  3UU8 A;  3JCF A;  3O4X E;  3FZM B;  1G73 A;  1BR0 A;  5JDG A;  1U5P A;  1YQ4 A;  1WYB A;  4ZOL E;  1UGO A;  3ZN1 B;  4DV4 T;  1MND A;  3C51 A;  3VRA A;  3AY5 A;  3CX7 B;  2VWA A;  2SPC A;  3OPC A;  5LHG B;  4AXP A;  4EZ4 A;  2BS2 A;  4YT0 A;  2J4G A;  4C90 A;  4NPP A;  3VKH A;  1HNZ T;  4LF9 T;  5LA6 E;  5JDL A;  3ZMS B;  3CQX C;  2I0M A;  3E08 A;  3TLT A;  4KHZ F;  2HHH T;  2XAF B;  4WZX A;  5C3J A;  3NVO A;  4O4J E;  4YHJ A;  4DUY T;  5A1L A;  2V7K A;  2WB5 A;  1NWM X;  2D0U A;  3KBU A;  4A98 A;  3ONJ A;  3RIU C;  2E2A A;  3KV9 A;  3RQW A;  1YW0 A;  4JI1 T;  2WP9 A;  3OYX A;  4PJJ A;  3H3A A;  1S94 A;  2CEA A;  3OTO T;  2H7O A;  3P4Q A;  4HFV A;  3ONL C;  3AEC A;  2E9X C;  2WAU A;  3QNU A;  3ZJ1 A;  4Z90 A;  1MIV A;  2EHO B;  1LKX A;  2NOX A;  2Y8D A;  2W0G A;  3AE3 A;  5L3E B;  2YEV C;  3Q9D A;  3FZK B;  5J1G A;  5H6Q B;  2A3D A;  5HEH A;  2YN6 A;  4P0B A;  2XUE A;  2XY8 B;  3UU3 A;  4PK5 A;  2RA1 A;  3EDV A;  3UUX B;  3KDS E;  1M7K A;  4I55 E;  1WR6 A;  1UCU A;  3NKZ A;  2NR4 A;  3ZST A;  4QWN B;  5F5W A;  2XAS B;  1XMQ T;  3B57 A;  5ABE A;  2XM1 A;  1HR0 T;  2UXB T;  1T7S A;  2QVA A;  3LK4 2;  2CM0 A;  4I43 B;  5HXC A;  2GK9 A;  5JDQ A;  5FXZ A;  2ODV A;  3N9Q A;  3RRC A;  4E7S A;  3UQ7 A;  5L2L A;  5J2T E;  4PFP A;  1OXZ A;  4DND A;  3DTO A;  4U72 A;  4M1P A;  4X1Y E;  2MOZ A;  2LHN A;  4NIQ A;  4PJN A;  2WZH A;  2BS3 A;  1UK5 A;  5EK3 A;  4LMJ A;  3ZEF B;  4AQF C;  3PF0 A;  3RHW A;  3ETV A;  2LE8 A;  3FB2 A;  5LXT E;  2OLT A;  1SA0 E;  4CI1 B;  5JTG A;  3E22 E;  3LFM A;  3P4S A;  3UT5 E;  5LBM A;  5ABF B;  2IDO B;  2PBI A;  2VB6 A;  2L8K A;  4LF8 T;  3W15 B;  2XPK A;  2LLY A;  2KWH A;  2UUC T;  4F7G B;  2KWI B;  3PU8 A;  4GKJ T;  3GWH A;  2HPL A;  4YSX A;  2XQ9 A;  4GK5 E;  4IE4 A;  3VR9 A;  3EI0 A;  2H88 A;  2UXD T;  2KLQ A;  1HNW T;  2I59 A;  3NRY A;  4UF0 A;  3PUR A;  4O4I E;  4PAG A;  2BVL A;  3A5X A;  1FIO A;  2YKS A;  3HKD E;  4YJ3 E;  4WYV A;  2IIU A;  3KFW X;  5L4H A;  3AXJ A;  3ZT5 A;  4LFC T;  5AQP B;  2BG9 A;  2NW9 A;  4CN6 A;  2YOE A;  4UEL A;  2MAW A;  3FHN A;  3LK2 B;  2VL8 A;  2M6I A;  2F4V T;  2NW8 A;  2BKP A;  4ILB A;  4IE7 A;  4MFR A;  2H89 A;  2QA7 A;  5LYJ E;  5FXW A;  2LM9 A;  2CXD A;  4DR3 T;  2KBB A;  2BZB A;  2NP9 A;  3Q2M A;  5FY1 A;  4Z8X A;  4B6X A;  5AQV B;  2Y48 B;  4DBR A;  3AA6 B;  4O2B E;  4QHO A;  2VVS A;  3N5L A;  4ZI2 C;  2ACX A;  4B3R T;  2ZM0 A;  2MTQ A;  1UUS A;  3QB5 A;  4UEM A;  1E1H B;  2WCA A;  3JC6 D;  3K8P C;  2CA5 A;  1FMW A;  2MBG A;  4EOZ B;  3DYJ A;  2Q9Q B;  5AQF B;  2XAG B;  3QUJ A;  4YLH A;  3CWZ B;  5L47 A;  4HKA A;  3R84 B;  4UXN B;  5M4Y A;  3N2K E;  3UFE A;  2KGX A;  4EYU A;  4TN7 B;  4IE6 A;  4HFE A;  2CHN A;  3IA3 A;  2V6X A;  2W00 A;  3N9M A;  2WDR A;  2BKN A;  3ZC1 A;  2LJL A;  4LML A;  2XQY A;  4YFS A;  5LHH B;  3PUA A;  2CBJ A;  2A72 A;  3M3Z B;  2N2N A;  5IYZ E;  3N2G E;  2V6Y B;  3AE9 A;  4ZI7 E;  2JIW A;  4AKH A;  4PNI A;  5LG3 A;  4KMC A;  2W67 A;  3ESL A;  5LGN B;  2VQF T;  1HF8 A;  5T1D A;  5F8P A;  3JAF A;  4UV9 B;  2V5C A;  2VKD A;  1I6Z A;  4LF4 T;  1LVF A;  1QSD A;  2VKH A;  4ZS2 A;  2KSR A;  4H63 V;  3VR8 A;  4U2Z A;  3CK6 A;  2FJD A;  2CXF A;  2E5L T;  1XDO A;  3CQG B;  1IZN B;  5AQT B;  3N2O A;  5DAB A;  5CA0 E;  4PJL A;  1IBL T;  4JI0 T;  2WMN A;  2DL1 A;  2W2U A;  4IHJ E;  4N78 D;  1YKE B;  4CZZ B;  1WR0 A;  3C50 A;  1BR2 A;  2KND A;  4CI3 B;  2DCF A;  3FYQ A;  2A9U A;  3E0Z A;  2EHO A;  3L8R A;  4A97 A;  3O9X A;  2X9X A;  5H6R B;  4CXY A;  2KMF A;  5JDH A;  1NAF A;  3PHF 1;  2E9X B;  2YIN A;  3IF8 B;  5L4E A;  2K48 A;  2W4X A;  1T72 A;  4KX6 A;  3SRZ A;  3RYF E;  4F8H A;  3ZKR A;  2M6B A;  3O1H A;  4AIS A;  4H9S E;  2V7M A;  2B76 A;  1OED C;  3C64 A;  4KI0 F;  5C2T A;  1HG2 A;  1YD8 G;  2L7N A;  3OVU A;  4AKR B;  2LQU A;  3J7Y q;  1FMV A;  3JAE A;  3PUG A;  3I9W A;  4YSZ A;  4IDN A;  4NUU A;  4DV1 T;  2HN2 A;  4X64 T;  4K0U A;  2J62 A;  4X62 T;  4ECG A;  3N9N A;  4K0K T;  4ZXL A;  3ZCI A;  5CB4 E;  2MTC A;  4BGO A;  4O4L E;  1Y01 A;  4TWD A;  1H7C A;  1ZEE A;  4H9R C;  2LRL A;  1M62 A;  4IDZ A;  1NEK A;  1E2A A;  4GIW A;  2P9B A;  2JMH A;  3WAK A;  4QX8 B;  1N32 T;  3RYH E;  4P09 A;  4HFB A;  4HTE A;  4PW8 A;  5AQH B;  5JRC B;  2IML A;  3WSC A;  2ODU A;  5ABF A;  4IGU A;  3RYI E;  3AVR A;  5HCM A;  3IBP A;  4CN4 A;  4YHH T;  3NZP A;  2UXX B;  4UVA B;  4AI6 A;  2XQ8 A;  4GOU A;  2LEH A;  2ZM8 A;  5FNV E;  2KT9 A;  3K3Q C;  4KBM B;  2NW7 A;  4UVB B;  2BBH A;  5BMV E;  3BQI A;  4IE5 A;  5LJM A;  2XM2 A;  1W0A A;  2JRK A;  3AT7 A;  3LBX A;  4TUY E;  2V7I A;  3VJZ A;  1CHU A;  2VQE T;  5AQQ B;  3P8C D;  1D1A A;  4L9I A;  1KFY A;  4QH5 A;  5KXJ A;  5FZT A;  4BA9 A;  1VOM A;  4BJM A;  3T1Y T;  3EDU A;  3EAM A;  3H3M A;  1Z0P A;  3BQL A;  4TWF A;  2V26 A;  2CWY A;  5L3F B;  4A5X A;  1LVK A;  3AED A;  4ZS3 A;  2PTF A;  5GON E;  4U3C A;  4CXX A;  2LKG A;  3ZYK A;  2E8I A;  2D5U A;  2IHR 1;  3UU4 A;  4AKI A;  2YK0 A;  5KX5 E;  3PUW F;  4TWH A;  4X5T A;  2Q9Q A;  4MHC A;  2L9Q A;  3EAB A;  1W0B A;  3ETU A;  4C91 A;  1MMD A;  2IC6 A;  1AJ3 A;  2RP4 A;  3UUM A;  5LMN T;  4FJO A;  1VCS A;  5BR8 T;  2XHE B;  4HFC A;  4U31 A;  4Q25 A;  2XQA A;  2X66 A;  3Q5D A;  2V6Y A;  2Z6E A;  4L5G A;  3R6N A;  4YSY A;  2V8S V;  3AEA A;  2D2S A;  1QUU A;  2NWB A;  4XAX B;  3M1C A;  2OV9 A;  2XSB A;  2DNX A;  4OYK A;  4EV6 A;  2JQK A;  2LOS A;  1D0Y A;  1LRZ A;  5CFB A;  4ILU A;  2UU9 T;  1FEW A;  4DR4 T;  5IWA T;  3AVS A;  4ZZC A;  4U33 A;  2JJ9 A;  4WBO A;  2QRX A;  2VKJ A;  4H9P C;  5LGT B;  5AQM B;  1ZOY A;  5JDM A;  5HCJ A;  2BG9 C;  3NRX A;  3BQK A;  2W66 A;  5FVL A;  4HWD A;  3TLU A;  3WUR A;  5JVD E;  4HEA A;  4W8P A;  2PFV A;  4TNV A;  3UU5 A;  4NUV A;  3VKG A;  1HTJ F;  4X1I E;  2CRB A;  5HEU A;  2LRK A;  4LF5 T;  2FJA A;  2IAK A;  3UQ4 A;  4ILC A;  4BJN A;  3L3P A;  4COF A;  4HWC A;  1WFD A;  5J0Z A;  3ZN0 B;  2LSY A;  3T1H T;  3O1I A;  4TX5 A;  5HWX A;  5IUX A;  2ZM6 T;  3HKE E;  2HN1 A;  4ILA A;  3I1A A;  4UIG A;  3IHR A;  2WMO A;  2XQ7 A;  3CVR A;  3FZF B;  5AQJ B;  1VCT A;  4AQG A;  5DQV A;  2IC9 A;  3AE5 A;  2WDQ A;  4P1N A;  5FL1 A;  3U3I A;  5AQL B;  5L3C B;  1T98 A;  3RPU A;  3K3N A;  4IST A;  3VHL A;  2LOP A;  3AEG A;  1HS7 A;  1N36 T;  2LT3 A;  1ZP0 A;  2EHO D;  3QOF A;  1US7 B;  4PK4 A;  5JR9 B;  3PUX F;  5FXX A;  4OYJ A;  1DU2 A;  5FKY A;  4P0A A;  4TV8 E;  2X0H A;  5AQR B;  1WRD A;  4U7Y A;  1NEN A;  5ETW A;  2WDV A;  2XAJ B;  4EB6 E;  4HFI A;  3RIA A;  3HI2 A;  3LJC A;  2X0L B;  1HNX T;  2VVN A;  2HH7 A;  2V5D A;  4GKK T;  1WLX A;  1FJG T;  1X79 A;  2BBJ A;  3UUL A;  4HGA A;  1GQE A;  4G2A A;  4DID B;  1XNR T;  1E7P A;  3UU6 A;  2UUA T;  4KP3 C;  5L3D B;  2EHO C;  4B3T T;  5LJN A;  2BDE A;  3PU3 A;  1R8I A;  2FJB A;  2AE9 A;  4GYR A;  3FBL A;  2ES0 A;  3WAJ A;  1D1C A;  5LCY A;  1BR1 A;  3KV5 A;  3ZJ2 A;  3ZT7 A;  5HEJ A; 
#chains in the Genus database with same CATH homology
 3KBU A;  3OJA A;  2K5B B;  3ZCI A;  3JC6 C;  3KV9 A;  5CB4 E;  3RYC E;  2MTC A;  2JPF A;  3EVY A;  1YW0 A;  4E7Z A;  4BGO A;  4O4L E;  3OYX A;  4J2C A;  4PJJ A;  3H3A A;  3PUQ A;  1BR4 A;  1D0X A;  1S94 A;  2CEA A;  2NTX A;  1H7C A;  1ZEE A;  4H9R C;  4JEU B;  3PDY A;  4MAL A;  2H7O A;  5HWY A;  3GMI A;  4HFV A;  1V9D A;  3NZQ A;  4IDZ A;  4GIW A;  3HR0 A;  2P9B A;  1B7T A;  2JMH A;  3MXZ A;  3WAK A;  4QX8 B;  2J1D G;  2K24 A;  2E9X C;  3P7I A;  3RYH E;  2WAU A;  4P09 A;  5ADX L;  4ZI2 D;  5FY0 A;  3ZYL A;  3ZJ1 A;  2X9W A;  1IJ6 A;  1EZ3 A;  3ZMZ B;  4HTE A;  4PW8 A;  4H9Q C;  5JRC B;  1MIV A;  2EHO B;  1LKX A;  2NOX A;  3OBV E;  3MA9 A;  2Y8D A;  2X68 A;  3WSC A;  1UX4 A;  2W0G A;  3LBX B;  1MMN A;  2ODU A;  4IGU A;  3RYI E;  4PFO A;  4ZI3 D;  3SOL A;  3AVR A;  2DWK A;  3I0Q A;  5L3E B;  3IBP A;  2YEV C;  3Q9D A;  5J1G A;  1ZHC A;  3MAC A;  4MLK A;  3RH3 A;  3HA4 A;  3J9X 1;  2DLR A;  3F57 A;  4GYS A;  1S35 A;  2A3D A;  3NZP A;  5H6Q B;  2UXX B;  4UVA B;  4AI6 A;  4P0B A;  2XUE A;  4PK5 A;  4GOU A;  2LEH A;  2RA1 A;  2ZM8 A;  5FNV E;  2KT9 A;  3EDV A;  1KNZ A;  5HAX A;  1WYC A;  3K3Q C;  4KBM B;  3UUX B;  2X9H A;  3KDS E;  2NW7 A;  3V5S A;  2L3L A;  3KVA A;  4I55 E;  4UVB B;  1WR6 A;  5BMV E;  1UCU A;  2H7V C;  3BQI A;  4IE5 A;  5JRC A;  4QWN B;  2PG8 A;  2XAS B;  4AQF A;  5LJM A;  3B57 A;  2JRK A;  3AT7 A;  3LBX A;  5FY7 A;  5LG4 A;  4TUY E;  2C5I T;  2V7I A;  4PJM A;  2W62 A;  3LK4 2;  3OKQ A;  2CM0 A;  3IEE A;  4WW0 A;  4DMW A;  5EK4 A;  4OFZ A;  3VJZ A;  2IW5 B;  5FP3 A;  4I43 B;  3C98 B;  3P8C D;  5L3B B;  1D1A A;  4UV8 B;  4L9I A;  5HXC A;  2GK9 A;  3I9Y A;  1KK7 A;  5JH7 E;  3K3O A;  5HXH A;  5JDQ A;  5LBQ B;  4BA9 A;  5FXZ A;  2ODV A;  3ZLI A;  3N9Q A;  2CCQ A;  1VOM A;  3RRC A;  4BJM A;  4YJ2 E;  4E7S A;  1HFA A;  3PE0 A;  3O1J A;  4JLE A;  4A56 A;  3FXE B;  3N9L A;  5HXS A;  3EDU A;  3N9P A;  5J2T E;  1OWA A;  4PFP A;  5L2L A;  1OXZ A;  5DQW A;  1Z0P A;  4I50 E;  5IHY A;  3DTO A;  3MJX A;  4DND A;  3RC8 A;  3BQL A;  4U72 A;  2A2F X;  4M1P A;  2V26 A;  4X1Y E;  2CWY A;  5L3F B;  5KMG P;  3AAE B;  2MOZ A;  1LVK A;  2LHN A;  4PJN A;  2WM9 A;  2CXL A;  5JQG E;  4ZS3 A;  5EK3 A;  2WWU A;  4OHF A;  2D0T A;  5GON E;  4ADZ A;  3AAI A;  5LOV E;  3ZMU B;  4AQF C;  4CXX A;  3ZEF B;  3ZYK A;  3PF0 A;  5L3G B;  4O4H E;  3ETV A;  3LK3 B;  2LE8 A;  3FB2 A;  5LXT E;  2XTL A;  2E8I A;  2JMK A;  2VKO A;  2VK9 A;  2D5U A;  1SA0 E;  4AKI A;  4CI1 B;  3GA8 A;  2V1D B;  3E22 E;  5E0O A;  2CWO A;  2LHR A;  2YK0 A;  1YKH B;  2Q9Q D;  3CX6 B;  3LFM A;  3UT5 E;  5HYA A;  5KX5 E;  3S4U A;  3CPZ A;  2M67 A;  3KBT A;  3N9O A;  5LBM A;  2PBI A;  2VB6 A;  2L8K A;  3W15 B;  1D0Z A;  2Q9Q A;  4MHC A;  2KWH A;  4ANJ A;  4CI2 B;  3HL6 A;  4F6R C;  1G8X A;  2KWI B;  2X67 A;  3PU8 A;  3GWH A;  2HPL A;  2L9Q A;  1O3X A;  4GK5 E;  4IE4 A;  3M65 A;  3Q5W A;  2C5J A;  3ETU A;  2KZ7 B;  3VU7 H;  2YU2 A;  4JEH B;  2KLQ A;  4C91 A;  1MMD A;  2IC6 A;  3AAA B;  1HX8 A;  3QK6 A;  3PUS A;  1AJ3 A;  2RP4 A;  3UUM A;  1HG5 A;  2I59 A;  3QC9 A;  3KIN B;  4FJO A;  5HXR A;  2G0U A;  3NRY A;  4QX7 B;  4UF0 A;  5JDF A;  2XHE B;  4PK6 A;  1MMG A;  3MZK B;  3PUR A;  4O4I E;  4MBQ A;  3PTR B;  4PAG A;  4HN9 A;  2BVL A;  3A5X A;  4H9O C;  1FIO A;  3H37 A;  2X66 A;  3LG7 A;  3HKD E;  3F2E A;  4YJ3 E;  3AA0 B;  1CUN A;  3KFW X;  2DI4 A;  2UXN B;  2Z6E A;  4L5G A;  2DWG A;  3R6N A;  3KV6 A;  2NW9 A;  2CMR A;  5LHI B;  3U78 A;  4UEL A;  4JUY A;  3FHN A;  3LK2 B;  3RX6 A;  2VL8 A;  2LSJ A;  2D2S A;  2NW8 A;  4EIW A;  4MFR A;  4IE7 A;  1QUU A;  2V7L A;  2QA7 A;  3ANW A;  5LYJ E;  2NWB A;  3OYZ A;  2N9D A;  5FXW A;  2LM9 A;  2CXD A;  2BVM A;  4XAX B;  3CKD A;  2BZB A;  4IE0 A;  3M1C A;  3FBZ A;  5DJQ C;  2NP9 A;  2HPJ A;  3Q5X A;  3ZMV B;  2C5K T;  5LGU B;  3Q2M A;  5LP6 E;  2DNX A;  4OYK A;  5FY1 A;  4ISS A;  4Z8X A;  4B6X A;  4AKG A;  4XZC A;  2LOS A;  4O2A E;  4V1A v;  1D0Y A;  1LRZ A;  2Y48 B;  4DBR A;  2LSI A;  2N1G A;  4ILU A;  3AA6 B;  3ZC0 A;  1FEW A;  5HXE A;  4O2B E;  4QHO A;  4U74 A;  3N5L A;  4ZI2 C;  2ACX A;  4H63 H;  3AVS A;  4DVD A;  4ONR A;  4KUM B;  3RKO A;  2JJ9 A;  4WBO A;  2ZM0 A;  2MTQ A;  2XAQ B;  4HE8 A;  3HKC E;  3UUN A;  2VKJ A;  4UEM A;  1E1H B;  4ZI3 C;  4H9P C;  5LGT B;  4QXC B;  1IAP A;  3JC6 D;  3K8P C;  5JDM A;  3NRX A;  2CA5 A;  1FMW A;  3BQK A;  2MBG A;  4EOZ B;  4EYY R;  3UTK A;  1Y64 B;  1ZKE A;  2Q9Q B;  3TKL B;  2PJQ A;  2XAG B;  4EAH A;  3L09 A;  3QUJ A;  4YLH A;  5FMN A;  3CWZ B;  1IJ5 A;  4EXT A;  3CQC B;  4HKA A;  3R84 B;  2NTY A;  4UXN B;  3B13 A;  3KVB A;  3N2K E;  3C4W A;  4CXW A;  5M4Y A;  3UFE A;  5J2U E;  4DO0 A;  4EYU A;  4TN7 B;  5JR9 A;  4IE6 A;  2E9X D;  2V7J A;  4AKL A;  5FYM A;  4BAY B;  3WUR A;  3D0T A;  5JVD E;  4HEA A;  1U4Q A;  2Y6X A;  2ZMA A;  2PFV A;  4IIJ E;  4DBQ A;  2W00 A;  3N9M A;  4NUV A;  3ZC1 A;  4UF0 B;  5KDM C;  3NBX X;  3C4X A;  2LJL A;  4CQI A;  3VKG A;  2XQY A;  4L0R A;  4YFS A;  1HTJ F;  3PUA A;  5LHH B;  4X1I E;  2A72 A;  2MYS A;  2N2N A;  3DP7 A;  3EUH A;  5IYZ E;  1MMA A;  4WBN E;  1MNE A;  3N2G E;  2IAK A;  5JDN A;  3SWH A;  4BJN A;  1UX5 A;  2LSK A;  3L3P A;  4ZI7 E;  3HKB E;  3ZCJ A;  4AKH A;  2CLY B;  5CA1 E;  5TAO A;  3ZN0 B;  2LSY A;  4PNI A;  4ERR A;  2WBL A;  4ZHQ E;  4KMC A;  3ESL A;  5LGN B;  2C0S A;  4QXB B;  2B1E A;  2DHR A;  3ANW B;  3O1I A;  1HF8 A;  3RRW A;  4TX5 A;  5HWX A;  5T1D A;  3CX8 B;  1SHZ C;  5F8P A;  5JRE A;  2QGS A;  4ASK A;  4UV9 B;  2VKD A;  3HKE E;  3CML A;  3V5U A;  1LVF A;  1QSD A;  3WI3 A;  2VKH A;  5JR9 C;  4ZS2 A;  4H63 V;  2W61 A;  4GK0 E;  3MKD A;  3I1A A;  4XBF B;  3GN5 A;  4UIG A;  2YU1 A;  3IHR A;  2WMO A;  3ONX A;  3CVR A;  2LSG A;  2KIN B;  2CXF A;  5FXV A;  2X51 A;  4AQG A;  1HCI A;  5DQV A;  3CQG B;  1D1B A;  2IC9 A;  1IZN B;  2H3R A;  2K9A A;  2Q9Q C;  3N2O A;  5DAB A;  5CA0 E;  3AA7 B;  3ZPO A;  4PJL A;  5F3J A;  3U3I A;  5L3C B;  2WMN A;  1T98 A;  3SS1 A;  3I0O A;  3AA1 B;  3RPU A;  3F31 A;  3BK9 A;  3K3N A;  2VAS A;  4IHJ E;  4N78 D;  4IST A;  3VHL A;  1YKE B;  4CZZ B;  3ZMT B;  3C50 A;  2LOP A;  4FI5 A;  4TZ4 C;  1HS7 A;  4X1K E;  2LT3 A;  1VRB A;  2EHO D;  1BR2 A;  3AB3 B;  2KND A;  4CI3 B;  2DCF A;  1US7 B;  3O4X E;  4PK4 A;  5JR9 B;  5FXX A;  3E0Z A;  2EHO A;  4EZH A;  4OYJ A;  3O9X A;  1G73 A;  1BR0 A;  2CE7 A;  2X9X A;  5H6R B;  4CXY A;  2KMF A;  4X20 E;  5JDG A;  1U5P A;  2KXP B;  5AFU L;  5JDH A;  1NAF A;  3PHF 1;  1WYB A;  2E9X B;  2YIN A;  4ZOL E;  4P0A A;  4TV9 E;  4O8S A;  4QXH B;  3ZN1 B;  3IF8 B;  4TV8 E;  2K48 A;  1MND A;  3C51 A;  3C4Z A;  1WRD A;  3SRZ A;  3RYF E;  4OK0 A;  4UVC B;  4G63 A;  5ETW A;  2CLY C;  5EK2 A;  3CX7 B;  2VWA A;  3RC3 A;  2OA5 A;  2XAJ B;  2SPC A;  2WSS V;  3KV4 A;  3O1H A;  4EB6 E;  3DJB A;  2JQQ A;  3HI2 A;  4H9S E;  5LHG B;  3LJC A;  3MK7 C;  2X0L B;  3T8O A;  4AXP A;  4EZ4 A;  5LNK A;  2V7M A;  2XAH B;  2HH7 A;  4H9N C;  4C90 A;  1WLX A;  3C64 A;  3VKH A;  1X79 A;  3UUL A;  4HGA A;  3FXD B;  1HG2 A;  1YD8 G;  2E9X A;  4G2A A;  4WNK A;  5EZY E;  5LA6 E;  3ZYM A;  3ZMS B;  5JDL A;  2X9Y A;  3CQX C;  1MIW A;  4DMV A;  4QKN A;  2W63 A;  4AKR B;  2LQU A;  3E08 A;  3J7Y q;  1FMV A;  4KP3 C;  5L3D B;  2EHO C;  2XAF B;  3PUG A;  3I9W A;  2ZM2 A;  5LJN A;  2BDE A;  4NUU A;  3PU3 A;  4O4J E;  3GN5 B;  2ZLY A;  4YHJ A;  4GYR A;  3FBL A;  2ES0 A;  4K0U A;  5A1L A;  3WAJ A;  1D1C A;  2V7K A;  1NWM X;  5LCY A;  1BR1 A;  3KV5 A;  5C8Y E;  3ZJ2 A;  4ECG A;  1MIY A;  2D0U A;  3N9N A;  4I4T E;  1ZV4 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...