5HXCA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 20 mm na+ and zero ca2+
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
304
structure length
300
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRMGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
total genus 138
structure length 300
sequence length 304
ec nomenclature
pdb deposition date 2016-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hxcA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hxcA02
5HXRA 5HYAA 5HWXA 5JDHA 5JDMA 3V5UA 3V5SA 5HWYA 5JDFA 5JDQA 5HXSA 5HXCA 5JDGA 5JDNA 5JDLA 5HXEA 5HXHA
chains in the Genus database with same CATH superfamily
2C0SA 1CUNA 2EHOA 3AXJA 1D0YA 4HFHA 1KF6A 4NXMT 4IHJE 2WSSV 4YTPA 2QVAA 3FZFB 4HFCA 1LVFA 4LF9T 4FJOA 1BR0A 3I9YA 3WI3A 3NZPA 4U33A 5ABGA 1MNEA 3DJBA 2F4VT 2WWUA 3CIRA 2CEAA 1VCSA 5FL0A 1GQEA 4OHFA 1MIWA 4LF4T 4H9SE 2KXPB 2Q9QD 2CXFA 2V7MA 1EZ3A 3HR0A 2LSIA 1T7SA 5J2UE 3V5UA 2LSGA 4H9PC 2CLYB 4X1KE 3E0ZA 4ASKA 3RQUA 4AXPA 2IW5B 2NW7A 4JUYA 4Z8XA 2YU1A 5JRCB 4I43B 5HXHA 3RGLA 3L39A 1IJ5A 2CLYC 5AQSB 2X0HA 3UTKA 3PUVF 2DNXA 4EYUA 2V7IA 3H3MA 2NR4A 4LF6T 2E5LT 5DQWA 3N9PA 3GWHA 3ZLIA 2KINB 3NRXA 3AAIA 5JR9A 2K24A 3PUXF 3OTOT 3EVYA 3KFWX 3AE5A 5T1DA 3BQIA 5L4EA 5HXEA 2DCFA 2A9UA 4ZZCA 4XAXB 3LDQB 1KFYA 1N34T 2XAQB 3RRWA 3RF1A 3FZLB 4KHPT 1NEKA 1YD8G 2WZIA 2H3RA 4DMVA 3M3ZB 2FJDA 1HX1B 4DV4T 2VKOA 3ZN0B 4HE8A 1MMGA 5KXJA 2ACZA 3KBUA 3QK6A 4AKHA 4YSXA 3N9QA 2OV9A 3H3AA 2V7KA 4MHCA 1XZYA 3HKCE 1HNXT 2XQAA 3I9WA 4TNWA 3NBXX 2G0UA 4LMJA 3I0QA 5H6RB 5FY7A 3N9LA 2HPLA 2KGXA 5FKYA 3UQ4A 3AEEA 3R84B 2XQ9A 5AFUL 5IYZE 3CX6B 5LP6E 4JI7T 4H9OC 3RHWA 3ZJ1A 1B7TA 2X9XA 4UF0A 1XMOT 4QX8B 2XSBA 3LK3B 2J47A 4CI1B 2KT9A 4ZS2A 1FMWA 3WAJA 3LBXB 3RIUA 2LE8A 5LMUT 3NWIA 5LMNT 4BJNA 4MALA 5EK3A 5JDLA 4F8HA 2B1EA 3P4WA 4ONRA 2LRKA 4HEAA 2D0TA 4IDPA 1IBKT 1Z8UA 4E7ZA 4KUMB 4HWFA 2D9DA 3ZN1B 4O4LE 1Y01A 2H7VC 1SJ7A 2H88A 3AEGA 3AA1B 4EB6E 1JNZA 2VK9A 2JMHA 2ES0A 2XTLA 3EI0A 2XHEB 2UU9T 5FXVA 3D0TA 4JI4T 4IGUA 4X5TA 2XAJB 2XY8B 5FNVE 2D5UA 5ETWA 4I50E 4YJ3E 2VWAA 3UULA 4KHZF 3Q5WA 4JBWF 3JADA 4BJMA 1SHZC 3EHZA 2NTXA 2E9XB 4YFSA 3AT7A 2JPFA 4MFRA 2DHRA 3AVSA 2BKPA 3AVRA 2YEVC 3VJZA 4YLHA 2VB6A 4Z90A 2K9AA 4UIGA 5KMGP 2B76A 3PUYF 1UURA 3HKEE 2E9XC 2FUPA 4AQFC 3GN5A 3N9NA 1HG5A 3NZQA 3KBTA 2K3WA 5ABEA 3NKZA 4DR1T 3LG7A 4EZ4A 2IAKA 4TNVA 4B3MT 3T1HT 2UUAT 3Q2MA 4WYVA 1MMDA 3ZMZB 1HS7A 2AXDS 5LBQB 3ZYMA 1J5WA 5BR8T 2IC6A 2WU5A 4JI0T 1LVKA 5HEGA 5HEHA 1E2AA 3N9MA 4CI3B 3B57A 1LRZA 3KV5A 5LXTE 2L9QA 5AQKB 4F6RC 4KBMB 4GK0E 5L47A 1O3XA 2KMFA 4JI6T 4JYAT 4DV5T 4LF5T 4BA9A 4EGWA 2WMOA 3DTOA 5F3JA 4IDNA 3NRYA 1T98A 5IWAT 4G63A 4IE6A 3KV4A 3ZKRA 5AQNB 3MK7C 4BGOA 3KVAA 5EK2A 5HXCA 1D0ZA 2ODUA 2X0LB 4AQGA 2LJLA 1OEDE 3KDSE 2WQYA 4DV3T 2FJBA 5AQJB 3ZEFB 4O8SA 1W0AA 2V6YB 4AKGA 4PK6A 4WNKA 3P8CD 4AKRB 4K0KT 3N2KE 5HEOA 4HTEA 3H37A 3RC8A 2ACXA 3AAEB 2HH7A 3B5MA 1ZP0A 1HTJF 3UU8A 4LFCT 2CWOA 3C4XA 3V5SA 2XPKA 3K3QC 2LSKA 4U31A 2XAHB 3UUNA 5CFBA 3BQKA 2Y6XA 4CN6A 4PJJA 2NTYA 4YHHT 2MTCA 2UXBT 2DWGA 4X64T 3QOFA 4EEBA 3QNUA 2CHNA 4LMLA 4AKLA 2WDQA 3ESLA 2XZEA 2LEHA 4U72A 4B3RT 3ANWB 4CXYA 3SFEA 2K48A 2MYSA 1DU2A 3UQ7A 4TWDA 4DNDA 5GONE 4DV2T 5JQGE 3FBLA 3K3OA 4B3ST 5L3FB 2MAWA 3VR9A 5LGTB 3B13A 4U7IA 2UUCT 3HI2A 2NWBA 1XDOA 2XAGB 4EV6A 2XAFB 4P0AA 3L09A 4H63H 5C2TA 1KK7A 2XQ6A 2CMRA 3MKDA 3PF0A 4ECGA 4HWIB 2V1DB 1UUSA 2J62A 4ZI3C 5JDGA 2BG9E 2KWIB 2CXDA 3X1DA 4HFDA 2KZ7B 5AQRB 1SUMB 2A72A 1W9RA 4IT4A 2W2UA 4QKNA 2L10A 5HWXA 3CX7B 4GKKT 3C4ZA 1ZV4X 5ABHA 4NUVA 3VRAA 1IAPA 1MMAA 4CN1A 3LFMA 4PJNA 2CXLA 4YSZA 5HXRA 3AE2A 2CHOA 2WWVA 2KLQA 5AQHB 3C98B 5LGNB 5LNKA 4UXNB 4GIWA 2W67A 4O2AE 2RP4A 2GK9A 3DYJA 4KI0F 3JAFA 1CHUA 2KSRA 4ZI2C 2NW8A 3CK6A 3PURA 2X9HA 2BDEA 5AQOB 1SJ8A 5FMNA 3ONLC 1FIOA 1J5ET 4TWHA 5LHGB 2X9YA 3K3NA 5KDMC 3ZYLA 5AQQB 1N32T 2L8KA 2IDOB 3FZHB 5JVDE 3RYCE 4F7GB 5EK4A 5J1GA 3RLFF 1X79A 2WU2A 4JI2T 2YK0A 4B3TT 3ONJA 1FEWA 4X62T 1YQ3A 3O4XE 2WM9A 1ZOYA 2XQ4A 3BK9A 2L7NA 3E08A 4P0BA 1VCTA 4JEHB 4CZZB 5AQPB 4AKIA 4YXDA 2V5CA 5L3EB 3T1YT 2J4GA 2BVMA 3W15B 2KWHA 2EHOB 3P4QA 4U3CA 1D1AA 3RYFE 3PTRB 4UR9A 2WCAA 4P09A 3CQXC 3AECA 5L3BB 3Q5XA 2X67A 4W8PA 4IE7A 3VRBA 4ADZA 2YOEA 3TLTA 4KX6A 3CWZB 2EHOC 4QH1A 2VQET 3OYZA 3ZYKA 5KX5E 5FYMA 2QA7A 2UXCT 4CN4A 1NAFA 2VVNA 4NPPA 4JI3T 2LHNA 3SFDA 2W62A 3OKQA 5LG4A 2D0UA 1E7PA 2V8SV 1S94A 5DQVA 4Q25A 2VKHA 5JREA 5LHIB 1OEDA 4HFIA 3I1AA 4IDZA 2WAUA 4DV6T 2V5DA 4GYRA 2EHOD 2WBLA 3FB2A 4GOUA 2X51A 5JH7E 2AE9A 4ZOLE 4YTNA 3CX8B 3IEEA 3K1SA 2YINA 4IDQA 2VL0A 3EABA 3ONXA 4YT0A 3TKLB 1QSDA 1IBMT 2X66A 3I0OA 2IMLA 3PUSA 4IE0A 3PUWF 1ZHCA 4DR2T 4NUUA 5HEJA 3OYXA 4DV7T 3IBPA 5JR9B 4H9NC 3UUBA 1SA0E 4U2ZA 3Q5DA 5FVKA 3PV0F 3J7Yq 1KNZA 4HWHA 3MJXA 3AA0B 4C90A 2XQ7A 3ZSSA 4IE4A 2D2SA 4O2BE 3J9X1 5JR9C 4EYYR 4JV5T 2ZLYA 3UUMA 4ZHQE 1XNRT 4QH5A 4AIUA 3P50A 4IL4A 2BS2A 3LK42 2VL8A 2CWYA 2Y8DA 4WBNE 3FZMB 3E22E 1XWMA 3P4SA 2YKSA 3LK2B 3R6NA 5AQVB 4PNIA 2ZM8A 2PFVA 2BS3A 4HGAA 2A3DA 4EXTA 2XQ5A 1R8IA 4BAYB 2BG9A 4L9IA 5JTGA 1D0XA 3O1JA 2V7JA 2W0GA 2LHRA 5CA0E 3TLUA 5FL1A 3MA9A 2LRLA 2PBIA 4OYJA 3SWHA 3KINB 4TV9E 2E2AA 2QGSA 2BS4A 4PK5A 3UU5A 5L3GB 2LM9A 4UF0B 5L3DB 1YW0A 2YDQA 2VASA 5A1LA 2JQQA 5AQFB 3RPUA 2UXNB 3RYIE 3AE8A 3AY5A 3HA4A 5LHHB 3OVUA 2XQ8A 3UU6A 1UGOA 1WYBA 4OFZA 2JMKA 4U2YA 3L3PA 1WLXA 5IUXA 5LYJE 4JI8T 4HKAA 1D1BA 5AQTB 4XBFB 3EDVA 4WZXA 4TV8E 3UFGA 4PW8A 1T72A 2N2NA 3EAMA 3RIUC 2M6IA 5AQGB 1JNRA 1OWAA 4DMWA 3PJAJ 3FXEB 3AE1A 2YN6A 1H7CA 3RYHE 3N5LA 4YY3T 4O4JE 5F8PA 4EIWA 4ISTA 1FMVA 3RKGA 4TN7B 5LOVE 5FZTA 2E9XD 3KV9A 3O1HA 1QLBA 3O1IA 4HN9A 4ZEYA 2Q9QA 2V7LA 5CGMA 2WY2A 3ZMTB 1I94T 1OXZA 2JQ9A 1Z0PA 2JIWA 1NWMX 2QYWA 4NXNT 1MNDA 2IIUA 4YJ2E 2YDSA 4IE5A 1IZNB 3UFEA 3MXZA 2H7OA 5LG3A 4UV8B 4A5XA 4X20E 3OBVE 3SS1A 4O4HE 4DV1T 1HFAA 1U4QA 1Y64B 5FXZA 3ZSTA 2JJ9A 5HWYA 4GKJT 1IBLT 2KBBA 2WB5A 3JC6C 2BG9C 2L3LA 4IDOA 3AE7A 5FVLA 1HR0T 5DABA 5LGUB 4JI5T 3WAKA 4OX9T 3AE3A 5LJNA 5FP3A 4N78D 4QXCB 5FY1A 2CRBA 4C91A 3SRZA 4EOZB 4QX7B 3FYQA 2XM1A 2FJEA 4UELA 2DLRA 2WDVA 2Z6EA 4X1YE 3ZPOA 2XUEA 1KEYA 3A7MA 3P4PA 3VKGA 3C51A 3OJAA 4H9QC 1D1CA 2OA5A 3ETVA 3AE9A 5JRCA 4P1NA 1N36T 1G73A 4DBQA 2A2FX 2WS3A 3UT5E 5LB7B 3RIFA 2XJ7A 3RX6A 2XQYA 1VRBA 3IHRA 5JDMA 3RI5A 1WFDA 2M67A 3L8RA 4ZZBA 4IL9A 4JLEA 3MZKB 2CBJA 4UVAB 1HG2A 1UX5A 4OYKA 4EZHA 5HAXA 2ZM0A 5L2LA 4QXHB 4JI1T 2M6BA 3C64A 4WBOA 4IREA 2W00A 4YTMA 2HN1A 3TLSA 3QB5A 3AA6B 3JAEA 2UXDT 1UCUA 2X68A 4TX5A 1HCIA 1VOMA 5L4HA 4X65T 3PUAA 4HWDA 4LFAT 4EEDA 2XM2A 3P4RA 1IJ6A 3ZT7A 2JRKA 4DUZT 3QUJA 2W61A 5ABFB 1US7B 5FXWA 4PAGA 2PG8A 3HL6A 2LSYA 2X9WA 1YKHB 4ILCA 4ZI3D 4NIQA 2ZMAA 4WW0A 4HFBA 5LJMA 3U78A 2IUBA 4J2CA 3N2GE 3Q9DA 2I6HA 3FHNA 3QC9A 4LFBT 4I4TE 3T8OA 4K0UA 2X0YA 2XSAA 2DI4A 2CA5A 2I59A 4PFPA 3C50A 1HNZT 3DP7A 2CPTA 1N33T 4HFEA 3MACA 4PJMA 3M65A 1W0BA 2LQUA 2UUBT 3VHLA 3K8PC 2X0CA 4ZI2D 3LBXA 2MTQA 2RA1A 4CQIA 3AEBA 4ANJA 3WURA 2N1GA 3CQGB 4DUYT 3FZKB 3ZMVB 2LKHA 1XMQT 3AXJB 3N9OA 5C3JA 2MPKA 2LT3A 3PUQA 3U3IA 3OPCA 4CI2B 4A98A 4AISA 3Q5EA 3AEAA 4HFVA 3CKDA 4I0UA 3ZCIA 3HKBE 3LSVA 4H63V 2P9BA 2YU2A 1BR1A 2J1DG 3AEFA 3RH3A 4DR3T 2HN2A 3VU7H 4FI5A 3F2EA 4ERRA 5AQLB 2I0MA 1HX8A 2BKNA 3TLWA 3O9XA 5DJQC 5HEUA 2JQKA 3RQWA 2KVPA 3ZMUB 4KMCA 1MMNA 3ZC1A 1U5PA 5JDQA 1X9BA 2CCQA 4HWCA 3CQCB 3ABVA 5CA1E 2WDRA 1HNWT 3AE6A 5F5WA 4ZS3A 2VVSA 2RPAA 3IA3A 4DR6T 1XDPA 4IIJE 4TZ4C 5IHYA 4L5GA 1L0VA 2LKGA 4EAHA 4XZCA 3CPZA 2E9XA 4AQFA 4PJLA 2CM0A 1YQ4A 3ZJ2A 4QHOA 4I55E 2LOSA 4QWNB 2C5JA 3AA7B 3A5XA 1YXRA 3PUZF 5L3CB 2PTFA 5HYAA 2DL1A 4PFOA 3RRCA 1KNRA 2PJQA 5C8YE 5FY0A 2C5IT 2N9DA 4A97A 3N2OA 3PU8A 4AI6A 5JDFA 2W66A 4ISSA 3A8YC 3ZCJA 5JDNA 3LJCA 2V26A 1ZEEA 1W09A 2HHHT 4U7YA 2NW9A 2LSJA 3GA8A 5CJ5A 2CBIA 4DBRA 2NP9A 3S4UA 3CMLA 1HF8A 1LKXA 3PE0A 4DR4T 1ZKEA 5HXSA 3RC3A 3AE4A 3VKHA 3KVBA 5AQIB 1AJ3A 3WSCA 3UU3A 3FBZA 3SOLA 3PU3A 2C5KT 2V6XA 1OEDB 3RKOA 4ZXLA 2XASB 4LMKA 1WRDA 2QRXA 2ZM2A 2DWKA 2YDRA 5TAOA 4X1IE 4TWFA 2K5BB 1OEDC 4G2AA 5AQMB 2V6YA 4E7SA 4B6XA 4DO0A 1XNQT 4DIDB 5H6QB 1BR2A 2ZM6T 4COFA 4ZI7E 3QB5K 3PJAA 1E1HB 1KNPA 2MOZA 5FXXA 4DR5T 3ZT5A 4QXBB 2ODVA 1FJGT 1MIVA 1I6ZA 2HPJA 3VR8A 5HCMA 1T8BA 3PUGA 3M1CA 2Y48B 4ILUA 4UEMA 4JEUB 3EDUA 2VKDA 4UVBB 2MBGA 3F31A 5CB4E 1S35A 1WCRA 5ADXL 4A56A 2WMNA 2UXXB 3ANWA 4DV0T 5E0OA 3ZC0A 1WR0A 5AQUB 3KV6A 3P7IA 4U74A 2OLTA 4V1Av 4YHJA 4AQYT 1WYCA 3AAAB 3CVRA 3HKDE 4OK0A 2BG9B 4LF7T 2VURA 2VKJA 4L0RA 2NOXA 4MBQA 1G8XA 4GK5E 4KP3C 3G06A 4PK4A 2WZHA 3ZMSB 3UUXB 4QH4A 4YSYA 2KNDA 1UX4A 3ZT6A 3C4WA 3PHF1 4Z91A 2E8IA 1V9DA 3EUHA 5HCJA 4TUYE 1QUUA 1MIYA 3GMIA 5JDHA 3F57A 4MLKA 3GN5B 5J2TE 2SPCA 2VQFT 2BVLA 2LM2A 4ILAA 3TLVA 2LLYA 5ABFA 4ILBA 3AEDA 2E5VA 2FBWA 5BMVE 2BBJA 2BZBA 3RIAA 4H9RC 3IF8B 2W4XA 3PDYA 3ETUA 2H89A 4UV9B 1UK5A 5M4YA 1NENA 3JC6D 3AB3B 2XQ3A 2BKOA 5LBMA 4DR7T 4GYSA 4O4IE 2JQHA 4UVCB 3NVOA 4M1PA 4DVDA 5EZYE 2Q9QB 5LCYA 2BBHA 1WR6A 4LF8T 1YKEB 2WP9A 5LA6E 4X66T 1M62A 3FXDB 3BQLA 4CXXA 2CE7A 3JCFA 3UU4A 5J0ZA 1M7KA 2LOPA 1BR4A 2IC9A 1SE7A 2Q9QC 2IHR1 2FJAA 2R6GF 1J1JA 2W63A 4CXWA
chains in the Genus database with same CATH topology
2VL8A 2CWYA 2C0SA 1CUNA 2EHOA 5F3JA 2Y8DA 3NRYA 1T98A 3ZCIA 4G63A 3HKBE 4IE6A 4WBNE 3E22E 4H63V 2P9BA 2YU2A 3KV4A 1D0YA 1BR1A 2J1DG 3RH3A 3LK2B 3R6NA 4PNIA 3VU7H 3MK7C 2ZM8A 2PFVA 4FI5A 4IHJE 3F2EA 4BGOA 4ERRA 2WSSV 4HGAA 2A3DA 3KVAA 1HX8A 5EK2A 1LVFA 4FJOA 3O9XA 4EXTA 5DJQC 5HXCA 1BR0A 1D0ZA 4BAYB 3I9YA 4L9IA 3WI3A 3NZPA 1D0XA 3O1JA 1MNEA 2V7JA 2W0GA 2ODUA 2WWUA 2X0LB 1MMNA 2LHRA 2CEAA 3DJBA 4KMCA 2LJLA 3KDSE 3ZC1A 4AQGA 5CA0E 3MA9A 1U5PA 5JDQA 4OHFA 2PBIA 4OYJA 3SWHA 3ZEFB 1MIWA 2CCQA 4O8SA 3KINB 4AKGA 3CQCB 4PK6A 4WNKA 4H9SE 4TV9E 2KXPB 3P8CD 2Q9QD 4AKRB 5CA1E 2CXFA 2V7MA 3N2KE 4HTEA 3H37A 1EZ3A 2QGSA 3RC8A 2ACXA 4PK5A 3AAEB 3HR0A 2LSIA 2HH7A 4ZS3A 5L3GB 2LM9A 4UF0B 5L3DB 1YW0A 1HTJF 5J2UE 2CWOA 2VASA 3C4XA 3V5UA 3V5SA 2LSGA 4H9PC 2CLYB 4X1KE 5A1LA 3E0ZA 2JQQA 4IIJE 4TZ4C 5IHYA 3RPUA 2UXNB 4ASKA 3RYIE 4L5GA 4EAHA 3HA4A 3K3QC 3CPZA 4XZCA 2E9XA 4AXPA 5LHHB 2IW5B 2LSKA 2NW7A 4PJLA 4AQFA 2CM0A 2XAHB 4JUYA 4Z8XA 3UUNA 3BQKA 2Y6XA 2YU1A 3ZJ2A 4PJJA 5JRCB 4QHOA 4I55E 2NTYA 2LOSA 4I43B 2MTCA 4QWNB 2C5JA 1WYBA 2DWGA 4OFZA 5HXHA 3AA7B 2JMKA 1IJ5A 3L3PA 3A5XA 1WLXA 5L3CB 4AKLA 5LYJE 5HYAA 2CLYC 4HFVA 4HKAA 4PFOA 3UTKA 4EYUA 2DNXA 3ESLA 3RRCA 1D1BA 4XBFB 3EDVA 2LEHA 4U72A 2V7IA 2PJQA 3ANWB 4TV8E 5C8YE 4CXYA 4PW8A 5FY0A 2K48A 2MYSA 2N2NA 4DNDA 2C5IT 4DMWA 1OWAA 3N9PA 5DQWA 2N9DA 3FXEB 5GONE 1H7CA 5JQGE 3RYHE 3GWHA 3ZLIA 3N5LA 2KINB 3N2OA 3NRXA 3FBLA 4O4JE 3AAIA 3K3OA 5F8PA 5JR9A 4ISTA 4EIWA 1FMVA 3PU8A 4AI6A 5JDFA 5L3FB 4TN7B 2K24A 5LOVE 3EVYA 4ISSA 5LGTB 3B13A 3KFWX 2E9XD 3KV9A 3ZCJA 3O1HA 3HI2A 2NWBA 5T1DA 3O1IA 3BQIA 5JDNA 4HN9A 5HXEA 3LJCA 2V26A 2DCFA 2Q9QA 2V7LA 2XAGB 1ZEEA 3ZMTB 4XAXB 1OXZA 2NW9A 2XAFB 4P0AA 3L09A 2LSJA 3GA8A 4H63H 1KK7A 2XAQB 3RRWA 4DBRA 2CMRA 2NP9A 1Z0PA 3S4UA 3CMLA 1NWMX 3MKDA 1HF8A 3PF0A 1LKXA 3PE0A 4ECGA 2V1DB 1ZKEA 5HXSA 1YD8G 4ZI3C 1MNDA 5JDGA 2H3RA 3RC3A 4DMVA 3VKHA 3KVBA 4YJ2E 2KWIB 2CXDA 2KZ7B 4IE5A 1IZNB 3UFEA 1AJ3A 3MXZA 2A72A 2H7OA 3WSCA 4UV8B 2VKOA 3FBZA 4X20E 3ZN0B 3SOLA 3OBVE 3SS1A 4O4HE 4QKNA 5HWXA 4HE8A 3PU3A 2C5KT 3CX7B 1HFAA 1U4QA 1Y64B 1MMGA 5FXZA 3C4ZA 1ZV4X 3KBUA 4NUVA 3QK6A 1IAPA 4AKHA 2JJ9A 5HWYA 1MMAA 3RKOA 3N9QA 3H3AA 2V7KA 3LFMA 4PJNA 2CXLA 4MHCA 5HXRA 2XASB 3HKCE 1WRDA 3JC6C 3I9WA 2KLQA 3C98B 5LGNB 2L3LA 2ZM2A 2DWKA 5LNKA 3NBXX 2G0UA 5TAOA 4X1IE 4UXNB 4GIWA 3I0QA 5DABA 5LGUB 4O2AE 5H6RB 2RP4A 2GK9A 5FY7A 3N9LA 2K5BB 3WAKA 4G2AA 4E7SA 2HPLA 4B6XA 3R84B 5LJNA 4ZI2C 4DO0A 2NW8A 5AFUL 5FP3A 3PURA 2X9HA 4N78D 2BDEA 4QXCB 5H6QB 1BR2A 5FY1A 5IYZE 3CX6B 5FMNA 5LP6E 4ZI7E 1FIOA 4C91A 4H9OC 3SRZA 5LHGB 2X9YA 1E1HB 3K3NA 2MOZA 5FXXA 3ZJ1A 4QX7B 4EOZB 1B7TA 2X9XA 4UF0A 5KDMC 3ZYLA 4UELA 4QXBB 2ODVA 1MIVA 4QX8B 2DLRA 2L8KA 2Z6EA 3LK3B 4CI1B 4X1YE 3ZPOA 2HPJA 5JVDE 2KT9A 2XUEA 4ZS2A 3RYCE 3VKGA 5EK4A 1FMWA 3C51A 3OJAA 4H9QC 3PUGA 1D1CA 5J1GA 3M1CA 2OA5A 3ETVA 1X79A 3WAJA 2Y48B 2YK0A 3LBXB 5JRCA 2LE8A 4ILUA 1FEWA 3ZMUB 4BJNA 4MALA 3O4XE 1G73A 4UEMA 5EK3A 4JEUB 3EDUA 2VKDA 4UVBB 4DBQA 5JDLA 2A2FX 2WM9A 2B1EA 2MBGA 3UT5E 3F31A 5CB4E 3BK9A 4ONRA 1S35A 5ADXL 3E08A 4A56A 2WMNA 4HEAA 4P0BA 2UXXB 4JEHB 3ANWA 3RX6A 2XQYA 4CZZB 5E0OA 2D0TA 4AKIA 1VRBA 3IHRA 3ZC0A 5JDMA 5L3EB 4E7ZA 4KUMB 2M67A 3KV6A 3P7IA 2BVMA 3W15B 2KWHA 4U74A 3ZN1B 2EHOB 4V1Av 3RYFE 1D1AA 4O4LE 2H7VC 3PTRB 4YHJA 4P09A 4JLEA 3MZKB 4UVAB 1HG2A 1UX5A 4OYKA 4EZHA 1WYCA 5HAXA 2ZM0A 3AAAB 5L2LA 4QXHB 3CQXC 3AA1B 4EB6E 5L3BB 3Q5XA 2X67A 3CVRA 3C64A 2VK9A 4IE7A 2JMHA 4ADZA 4WBOA 2ES0A 2XTLA 2XHEB 3HKDE 3CWZB 4OK0A 2W00A 2EHOC 2VKJA 4L0RA 3AA6B 2NOXA 3OYZA 4MBQA 3ZYKA 5FXVA 5KX5E 3D0TA 5FYMA 1G8XA 4IGUA 2QA7A 4GK5E 2XAJB 4KP3C 1UCUA 2X68A 4TX5A 1HCIA 1VOMA 4PK4A 5FNVE 1NAFA 3PUAA 3ZMSB 3UUXB 2KNDA 1UX4A 2D5UA 2LHNA 3C4WA 3PHF1 2W62A 1IJ6A 2JRKA 5ETWA 3OKQA 5LG4A 2D0UA 3QUJA 4I50E 1S94A 4YJ3E 2W61A 5DQVA 2VWAA 3UULA 1US7B 5FXWA 2E8IA 4PAGA 1V9DA 2VKHA 3Q5WA 5JREA 2PG8A 3HL6A 3EUHA 5LHIB 2LSYA 2X9WA 4TUYE 4BJMA 1QUUA 1YKHB 1MIYA 3GMIA 5JDHA 1SHZC 4ZI3D 2NTXA 3F57A 4MLKA 2E9XB 3I1AA 4IDZA 4WW0A 2ZMAA 2WAUA 3GN5B 4YFSA 3AT7A 2JPFA 4MFRA 5J2TE 2DHRA 2SPCA 4GYRA 2BVLA 5LJMA 2EHOD 2WBLA 3U78A 3AVSA 3FB2A 4GOUA 4J2CA 3N2GE 3Q9DA 2X51A 5JH7E 3AVRA 2YEVC 3FHNA 3VJZA 3QC9A 4ZOLE 4YLHA 3CX8B 2VB6A 3IEEA 5BMVE 2K9AA 2BZBA 4H9RC 4UIGA 5KMGP 4I4TE 3IF8B 2YINA 3T8OA 3PDYA 4K0UA 3HKEE 2E9XC 3ONXA 2DI4A 1QSDA 3ETUA 3GN5A 3TKLB 4AQFC 4UV9B 2X66A 3I0OA 3N9NA 2CA5A 2I59A 1HG5A 4PFPA 5M4YA 3PUSA 4IE0A 3C50A 3AB3B 3JC6D 3NZQA 3KBTA 1ZHCA 3DP7A 5LBMA 4NUUA 4GYSA 4O4IE 3OYXA 3MACA 4PJMA 3M65A 4UVCB 3LG7A 3IBPA 4EZ4A 2IAKA 5JR9B 4H9NC 2LQUA 3VHLA 1SA0E 3K8PC 3Q2MA 4M1PA 4ZI2D 1MMDA 3LBXA 3ZMZB 4DVDA 1HS7A 3J7Yq 2MTQA 2RA1A 5EZYE 5LBQB 2Q9QB 3MJXA 5LCYA 3ZYMA 1KNZA 4CQIA 3AA0B 2IC6A 4ANJA 4C90A 3WURA 2N1GA 3CQGB 1WR6A 4IE4A 1YKEB 1LVKA 2D2SA 3ZMVB 5LA6E 4O2BE 3J9X1 3FXDB 5JR9C 3N9MA 4CI3B 4EYYR 3N9OA 3B57A 3BQLA 1LRZA 4CXXA 2CE7A 2ZLYA 3UUMA 2LT3A 3KV5A 3PUQA 2LOPA 3U3IA 5LXTE 2L9QA 1BR4A 2IC9A 4F6RC 4ZHQE 4KBMB 4CI2B 4GK0E 2Q9QC 1O3XA 2KMFA 3LK42 4BA9A 2WMOA 3CKDA 2W63A 3DTOA 4CXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXR A;  5HYA A;  5HWX A;  5JDH A;  5JDM A;  3V5U A;  3V5S A;  5HWY A;  5JDF A;  5JDQ A;  5HXS A;  5HXC A;  5JDG A;  5JDN A;  5JDL A;  5HXE A;  5HXH A; 
#chains in the Genus database with same CATH topology
 2C0S A;  1CUN A;  2EHO A;  3AXJ A;  1D0Y A;  4HFH A;  1KF6 A;  4NXM T;  4IHJ E;  2WSS V;  4YTP A;  2QVA A;  3FZF B;  4HFC A;  1LVF A;  4LF9 T;  4FJO A;  1BR0 A;  3I9Y A;  3WI3 A;  3NZP A;  4U33 A;  5ABG A;  1MNE A;  3DJB A;  2F4V T;  2WWU A;  3CIR A;  2CEA A;  1VCS A;  5FL0 A;  1GQE A;  4OHF A;  1MIW A;  4LF4 T;  4H9S E;  2KXP B;  2Q9Q D;  2CXF A;  2V7M A;  1EZ3 A;  3HR0 A;  2LSI A;  1T7S A;  5J2U E;  3V5U A;  2LSG A;  4H9P C;  2CLY B;  4X1K E;  3E0Z A;  4ASK A;  3RQU A;  4AXP A;  2IW5 B;  2NW7 A;  4JUY A;  4Z8X A;  2YU1 A;  5JRC B;  4I43 B;  5HXH A;  3RGL A;  3L39 A;  1IJ5 A;  2CLY C;  5AQS B;  2X0H A;  3UTK A;  3PUV F;  2DNX A;  4EYU A;  2V7I A;  3H3M A;  2NR4 A;  4LF6 T;  2E5L T;  5DQW A;  3N9P A;  3GWH A;  3ZLI A;  2KIN B;  3NRX A;  3AAI A;  5JR9 A;  2K24 A;  3PUX F;  3OTO T;  3EVY A;  3KFW X;  3AE5 A;  5T1D A;  3BQI A;  5L4E A;  5HXE A;  2DCF A;  2A9U A;  4ZZC A;  4XAX B;  3LDQ B;  1KFY A;  1N34 T;  2XAQ B;  3RRW A;  3RF1 A;  3FZL B;  4KHP T;  1NEK A;  1YD8 G;  2WZI A;  2H3R A;  4DMV A;  3M3Z B;  2FJD A;  1HX1 B;  4DV4 T;  2VKO A;  3ZN0 B;  4HE8 A;  1MMG A;  5KXJ A;  2ACZ A;  3KBU A;  3QK6 A;  4AKH A;  4YSX A;  3N9Q A;  2OV9 A;  3H3A A;  2V7K A;  4MHC A;  1XZY A;  3HKC E;  1HNX T;  2XQA A;  3I9W A;  4TNW A;  3NBX X;  2G0U A;  4LMJ A;  3I0Q A;  5H6R B;  5FY7 A;  3N9L A;  2HPL A;  2KGX A;  5FKY A;  3UQ4 A;  3AEE A;  3R84 B;  2XQ9 A;  5AFU L;  5IYZ E;  3CX6 B;  5LP6 E;  4JI7 T;  4H9O C;  3RHW A;  3ZJ1 A;  1B7T A;  2X9X A;  4UF0 A;  1XMO T;  4QX8 B;  2XSB A;  3LK3 B;  2J47 A;  4CI1 B;  2KT9 A;  4ZS2 A;  1FMW A;  3WAJ A;  3LBX B;  3RIU A;  2LE8 A;  5LMU T;  3NWI A;  5LMN T;  4BJN A;  4MAL A;  5EK3 A;  5JDL A;  4F8H A;  2B1E A;  3P4W A;  4ONR A;  2LRK A;  4HEA A;  2D0T A;  4IDP A;  1IBK T;  1Z8U A;  4E7Z A;  4KUM B;  4HWF A;  2D9D A;  3ZN1 B;  4O4L E;  1Y01 A;  2H7V C;  1SJ7 A;  2H88 A;  3AEG A;  3AA1 B;  4EB6 E;  1JNZ A;  2VK9 A;  2JMH A;  2ES0 A;  2XTL A;  3EI0 A;  2XHE B;  2UU9 T;  5FXV A;  3D0T A;  4JI4 T;  4IGU A;  4X5T A;  2XAJ B;  2XY8 B;  5FNV E;  2D5U A;  5ETW A;  4I50 E;  4YJ3 E;  2VWA A;  3UUL A;  4KHZ F;  3Q5W A;  4JBW F;  3JAD A;  4BJM A;  1SHZ C;  3EHZ A;  2NTX A;  2E9X B;  4YFS A;  3AT7 A;  2JPF A;  4MFR A;  2DHR A;  3AVS A;  2BKP A;  3AVR A;  2YEV C;  3VJZ A;  4YLH A;  2VB6 A;  4Z90 A;  2K9A A;  4UIG A;  5KMG P;  2B76 A;  3PUY F;  1UUR A;  3HKE E;  2E9X C;  2FUP A;  4AQF C;  3GN5 A;  3N9N A;  1HG5 A;  3NZQ A;  3KBT A;  2K3W A;  5ABE A;  3NKZ A;  4DR1 T;  3LG7 A;  4EZ4 A;  2IAK A;  4TNV A;  4B3M T;  3T1H T;  2UUA T;  3Q2M A;  4WYV A;  1MMD A;  3ZMZ B;  1HS7 A;  2AXD S;  5LBQ B;  3ZYM A;  1J5W A;  5BR8 T;  2IC6 A;  2WU5 A;  4JI0 T;  1LVK A;  5HEG A;  5HEH A;  1E2A A;  3N9M A;  4CI3 B;  3B57 A;  1LRZ A;  3KV5 A;  5LXT E;  2L9Q A;  5AQK B;  4F6R C;  4KBM B;  4GK0 E;  5L47 A;  1O3X A;  2KMF A;  4JI6 T;  4JYA T;  4DV5 T;  4LF5 T;  4BA9 A;  4EGW A;  2WMO A;  3DTO A;  5F3J A;  4IDN A;  3NRY A;  1T98 A;  5IWA T;  4G63 A;  4IE6 A;  3KV4 A;  3ZKR A;  5AQN B;  3MK7 C;  4BGO A;  3KVA A;  5EK2 A;  5HXC A;  1D0Z A;  2ODU A;  2X0L B;  4AQG A;  2LJL A;  1OED E;  3KDS E;  2WQY A;  4DV3 T;  2FJB A;  5AQJ B;  3ZEF B;  4O8S A;  1W0A A;  2V6Y B;  4AKG A;  4PK6 A;  4WNK A;  3P8C D;  4AKR B;  4K0K T;  3N2K E;  5HEO A;  4HTE A;  3H37 A;  3RC8 A;  2ACX A;  3AAE B;  2HH7 A;  3B5M A;  1ZP0 A;  1HTJ F;  3UU8 A;  4LFC T;  2CWO A;  3C4X A;  3V5S A;  2XPK A;  3K3Q C;  2LSK A;  4U31 A;  2XAH B;  3UUN A;  5CFB A;  3BQK A;  2Y6X A;  4CN6 A;  4PJJ A;  2NTY A;  4YHH T;  2MTC A;  2UXB T;  2DWG A;  4X64 T;  3QOF A;  4EEB A;  3QNU A;  2CHN A;  4LML A;  4AKL A;  2WDQ A;  3ESL A;  2XZE A;  2LEH A;  4U72 A;  4B3R T;  3ANW B;  4CXY A;  3SFE A;  2K48 A;  2MYS A;  1DU2 A;  3UQ7 A;  4TWD A;  4DND A;  5GON E;  4DV2 T;  5JQG E;  3FBL A;  3K3O A;  4B3S T;  5L3F B;  2MAW A;  3VR9 A;  5LGT B;  3B13 A;  4U7I A;  2UUC T;  3HI2 A;  2NWB A;  1XDO A;  2XAG B;  4EV6 A;  2XAF B;  4P0A A;  3L09 A;  4H63 H;  5C2T A;  1KK7 A;  2XQ6 A;  2CMR A;  3MKD A;  3PF0 A;  4ECG A;  4HWI B;  2V1D B;  1UUS A;  2J62 A;  4ZI3 C;  5JDG A;  2BG9 E;  2KWI B;  2CXD A;  3X1D A;  4HFD A;  2KZ7 B;  5AQR B;  1SUM B;  2A72 A;  1W9R A;  4IT4 A;  2W2U A;  4QKN A;  2L10 A;  5HWX A;  3CX7 B;  4GKK T;  3C4Z A;  1ZV4 X;  5ABH A;  4NUV A;  3VRA A;  1IAP A;  1MMA A;  4CN1 A;  3LFM A;  4PJN A;  2CXL A;  4YSZ A;  5HXR A;  3AE2 A;  2CHO A;  2WWV A;  2KLQ A;  5AQH B;  3C98 B;  5LGN B;  5LNK A;  4UXN B;  4GIW A;  2W67 A;  4O2A E;  2RP4 A;  2GK9 A;  3DYJ A;  4KI0 F;  3JAF A;  1CHU A;  2KSR A;  4ZI2 C;  2NW8 A;  3CK6 A;  3PUR A;  2X9H A;  2BDE A;  5AQO B;  1SJ8 A;  5FMN A;  3ONL C;  1FIO A;  1J5E T;  4TWH A;  5LHG B;  2X9Y A;  3K3N A;  5KDM C;  3ZYL A;  5AQQ B;  1N32 T;  2L8K A;  2IDO B;  3FZH B;  5JVD E;  3RYC E;  4F7G B;  5EK4 A;  5J1G A;  3RLF F;  1X79 A;  2WU2 A;  4JI2 T;  2YK0 A;  4B3T T;  3ONJ A;  1FEW A;  4X62 T;  1YQ3 A;  3O4X E;  2WM9 A;  1ZOY A;  2XQ4 A;  3BK9 A;  2L7N A;  3E08 A;  4P0B A;  1VCT A;  4JEH B;  4CZZ B;  5AQP B;  4AKI A;  4YXD A;  2V5C A;  5L3E B;  3T1Y T;  2J4G A;  2BVM A;  3W15 B;  2KWH A;  2EHO B;  3P4Q A;  4U3C A;  1D1A A;  3RYF E;  3PTR B;  4UR9 A;  2WCA A;  4P09 A;  3CQX C;  3AEC A;  5L3B B;  3Q5X A;  2X67 A;  4W8P A;  4IE7 A;  3VRB A;  4ADZ A;  2YOE A;  3TLT A;  4KX6 A;  3CWZ B;  2EHO C;  4QH1 A;  2VQE T;  3OYZ A;  3ZYK A;  5KX5 E;  5FYM A;  2QA7 A;  2UXC T;  4CN4 A;  1NAF A;  2VVN A;  4NPP A;  4JI3 T;  2LHN A;  3SFD A;  2W62 A;  3OKQ A;  5LG4 A;  2D0U A;  1E7P A;  2V8S V;  1S94 A;  5DQV A;  4Q25 A;  2VKH A;  5JRE A;  5LHI B;  1OED A;  4HFI A;  3I1A A;  4IDZ A;  2WAU A;  4DV6 T;  2V5D A;  4GYR A;  2EHO D;  2WBL A;  3FB2 A;  4GOU A;  2X51 A;  5JH7 E;  2AE9 A;  4ZOL E;  4YTN A;  3CX8 B;  3IEE A;  3K1S A;  2YIN A;  4IDQ A;  2VL0 A;  3EAB A;  3ONX A;  4YT0 A;  3TKL B;  1QSD A;  1IBM T;  2X66 A;  3I0O A;  2IML A;  3PUS A;  4IE0 A;  3PUW F;  1ZHC A;  4DR2 T;  4NUU A;  5HEJ A;  3OYX A;  4DV7 T;  3IBP A;  5JR9 B;  4H9N C;  3UUB A;  1SA0 E;  4U2Z A;  3Q5D A;  5FVK A;  3PV0 F;  3J7Y q;  1KNZ A;  4HWH A;  3MJX A;  3AA0 B;  4C90 A;  2XQ7 A;  3ZSS A;  4IE4 A;  2D2S A;  4O2B E;  3J9X 1;  5JR9 C;  4EYY R;  4JV5 T;  2ZLY A;  3UUM A;  4ZHQ E;  1XNR T;  4QH5 A;  4AIU A;  3P50 A;  4IL4 A;  2BS2 A;  3LK4 2;  2VL8 A;  2CWY A;  2Y8D A;  4WBN E;  3FZM B;  3E22 E;  1XWM A;  3P4S A;  2YKS A;  3LK2 B;  3R6N A;  5AQV B;  4PNI A;  2ZM8 A;  2PFV A;  2BS3 A;  4HGA A;  2A3D A;  4EXT A;  2XQ5 A;  1R8I A;  4BAY B;  2BG9 A;  4L9I A;  5JTG A;  1D0X A;  3O1J A;  2V7J A;  2W0G A;  2LHR A;  5CA0 E;  3TLU A;  5FL1 A;  3MA9 A;  2LRL A;  2PBI A;  4OYJ A;  3SWH A;  3KIN B;  4TV9 E;  2E2A A;  2QGS A;  2BS4 A;  4PK5 A;  3UU5 A;  5L3G B;  2LM9 A;  4UF0 B;  5L3D B;  1YW0 A;  2YDQ A;  2VAS A;  5A1L A;  2JQQ A;  5AQF B;  3RPU A;  2UXN B;  3RYI E;  3AE8 A;  3AY5 A;  3HA4 A;  5LHH B;  3OVU A;  2XQ8 A;  3UU6 A;  1UGO A;  1WYB A;  4OFZ A;  2JMK A;  4U2Y A;  3L3P A;  1WLX A;  5IUX A;  5LYJ E;  4JI8 T;  4HKA A;  1D1B A;  5AQT B;  4XBF B;  3EDV A;  4WZX A;  4TV8 E;  3UFG A;  4PW8 A;  1T72 A;  2N2N A;  3EAM A;  3RIU C;  2M6I A;  5AQG B;  1JNR A;  1OWA A;  4DMW A;  3PJA J;  3FXE B;  3AE1 A;  2YN6 A;  1H7C A;  3RYH E;  3N5L A;  4YY3 T;  4O4J E;  5F8P A;  4EIW A;  4IST A;  1FMV A;  3RKG A;  4TN7 B;  5LOV E;  5FZT A;  2E9X D;  3KV9 A;  3O1H A;  1QLB A;  3O1I A;  4HN9 A;  4ZEY A;  2Q9Q A;  2V7L A;  5CGM A;  2WY2 A;  3ZMT B;  1I94 T;  1OXZ A;  2JQ9 A;  1Z0P A;  2JIW A;  1NWM X;  2QYW A;  4NXN T;  1MND A;  2IIU A;  4YJ2 E;  2YDS A;  4IE5 A;  1IZN B;  3UFE A;  3MXZ A;  2H7O A;  5LG3 A;  4UV8 B;  4A5X A;  4X20 E;  3OBV E;  3SS1 A;  4O4H E;  4DV1 T;  1HFA A;  1U4Q A;  1Y64 B;  5FXZ A;  3ZST A;  2JJ9 A;  5HWY A;  4GKJ T;  1IBL T;  2KBB A;  2WB5 A;  3JC6 C;  2BG9 C;  2L3L A;  4IDO A;  3AE7 A;  5FVL A;  1HR0 T;  5DAB A;  5LGU B;  4JI5 T;  3WAK A;  4OX9 T;  3AE3 A;  5LJN A;  5FP3 A;  4N78 D;  4QXC B;  5FY1 A;  2CRB A;  4C91 A;  3SRZ A;  4EOZ B;  4QX7 B;  3FYQ A;  2XM1 A;  2FJE A;  4UEL A;  2DLR A;  2WDV A;  2Z6E A;  4X1Y E;  3ZPO A;  2XUE A;  1KEY A;  3A7M A;  3P4P A;  3VKG A;  3C51 A;  3OJA A;  4H9Q C;  1D1C A;  2OA5 A;  3ETV A;  3AE9 A;  5JRC A;  4P1N A;  1N36 T;  1G73 A;  4DBQ A;  2A2F X;  2WS3 A;  3UT5 E;  5LB7 B;  3RIF A;  2XJ7 A;  3RX6 A;  2XQY A;  1VRB A;  3IHR A;  5JDM A;  3RI5 A;  1WFD A;  2M67 A;  3L8R A;  4ZZB A;  4IL9 A;  4JLE A;  3MZK B;  2CBJ A;  4UVA B;  1HG2 A;  1UX5 A;  4OYK A;  4EZH A;  5HAX A;  2ZM0 A;  5L2L A;  4QXH B;  4JI1 T;  2M6B A;  3C64 A;  4WBO A;  4IRE A;  2W00 A;  4YTM A;  2HN1 A;  3TLS A;  3QB5 A;  3AA6 B;  3JAE A;  2UXD T;  1UCU A;  2X68 A;  4TX5 A;  1HCI A;  1VOM A;  5L4H A;  4X65 T;  3PUA A;  4HWD A;  4LFA T;  4EED A;  2XM2 A;  3P4R A;  1IJ6 A;  3ZT7 A;  2JRK A;  4DUZ T;  3QUJ A;  2W61 A;  5ABF B;  1US7 B;  5FXW A;  4PAG A;  2PG8 A;  3HL6 A;  2LSY A;  2X9W A;  1YKH B;  4ILC A;  4ZI3 D;  4NIQ A;  2ZMA A;  4WW0 A;  4HFB A;  5LJM A;  3U78 A;  2IUB A;  4J2C A;  3N2G E;  3Q9D A;  2I6H A;  3FHN A;  3QC9 A;  4LFB T;  4I4T E;  3T8O A;  4K0U A;  2X0Y A;  2XSA A;  2DI4 A;  2CA5 A;  2I59 A;  4PFP A;  3C50 A;  1HNZ T;  3DP7 A;  2CPT A;  1N33 T;  4HFE A;  3MAC A;  4PJM A;  3M65 A;  1W0B A;  2LQU A;  2UUB T;  3VHL A;  3K8P C;  2X0C A;  4ZI2 D;  3LBX A;  2MTQ A;  2RA1 A;  4CQI A;  3AEB A;  4ANJ A;  3WUR A;  2N1G A;  3CQG B;  4DUY T;  3FZK B;  3ZMV B;  2LKH A;  1XMQ T;  3AXJ B;  3N9O A;  5C3J A;  2MPK A;  2LT3 A;  3PUQ A;  3U3I A;  3OPC A;  4CI2 B;  4A98 A;  4AIS A;  3Q5E A;  3AEA A;  4HFV A;  3CKD A;  4I0U A;  3ZCI A;  3HKB E;  3LSV A;  4H63 V;  2P9B A;  2YU2 A;  1BR1 A;  2J1D G;  3AEF A;  3RH3 A;  4DR3 T;  2HN2 A;  3VU7 H;  4FI5 A;  3F2E A;  4ERR A;  5AQL B;  2I0M A;  1HX8 A;  2BKN A;  3TLW A;  3O9X A;  5DJQ C;  5HEU A;  2JQK A;  3RQW A;  2KVP A;  3ZMU B;  4KMC A;  1MMN A;  3ZC1 A;  1U5P A;  5JDQ A;  1X9B A;  2CCQ A;  4HWC A;  3CQC B;  3ABV A;  5CA1 E;  2WDR A;  1HNW T;  3AE6 A;  5F5W A;  4ZS3 A;  2VVS A;  2RPA A;  3IA3 A;  4DR6 T;  1XDP A;  4IIJ E;  4TZ4 C;  5IHY A;  4L5G A;  1L0V A;  2LKG A;  4EAH A;  4XZC A;  3CPZ A;  2E9X A;  4AQF A;  4PJL A;  2CM0 A;  1YQ4 A;  3ZJ2 A;  4QHO A;  4I55 E;  2LOS A;  4QWN B;  2C5J A;  3AA7 B;  3A5X A;  1YXR A;  3PUZ F;  5L3C B;  2PTF A;  5HYA A;  2DL1 A;  4PFO A;  3RRC A;  1KNR A;  2PJQ A;  5C8Y E;  5FY0 A;  2C5I T;  2N9D A;  4A97 A;  3N2O A;  3PU8 A;  4AI6 A;  5JDF A;  2W66 A;  4ISS A;  3A8Y C;  3ZCJ A;  5JDN A;  3LJC A;  2V26 A;  1ZEE A;  1W09 A;  2HHH T;  4U7Y A;  2NW9 A;  2LSJ A;  3GA8 A;  5CJ5 A;  2CBI A;  4DBR A;  2NP9 A;  3S4U A;  3CML A;  1HF8 A;  1LKX A;  3PE0 A;  4DR4 T;  1ZKE A;  5HXS A;  3RC3 A;  3AE4 A;  3VKH A;  3KVB A;  5AQI B;  1AJ3 A;  3WSC A;  3UU3 A;  3FBZ A;  3SOL A;  3PU3 A;  2C5K T;  2V6X A;  1OED B;  3RKO A;  4ZXL A;  2XAS B;  4LMK A;  1WRD A;  2QRX A;  2ZM2 A;  2DWK A;  2YDR A;  5TAO A;  4X1I E;  4TWF A;  2K5B B;  1OED C;  4G2A A;  5AQM B;  2V6Y A;  4E7S A;  4B6X A;  4DO0 A;  1XNQ T;  4DID B;  5H6Q B;  1BR2 A;  2ZM6 T;  4COF A;  4ZI7 E;  3QB5 K;  3PJA A;  1E1H B;  1KNP A;  2MOZ A;  5FXX A;  4DR5 T;  3ZT5 A;  4QXB B;  2ODV A;  1FJG T;  1MIV A;  1I6Z A;  2HPJ A;  3VR8 A;  5HCM A;  1T8B A;  3PUG A;  3M1C A;  2Y48 B;  4ILU A;  4UEM A;  4JEU B;  3EDU A;  2VKD A;  4UVB B;  2MBG A;  3F31 A;  5CB4 E;  1S35 A;  1WCR A;  5ADX L;  4A56 A;  2WMN A;  2UXX B;  3ANW A;  4DV0 T;  5E0O A;  3ZC0 A;  1WR0 A;  5AQU B;  3KV6 A;  3P7I A;  4U74 A;  2OLT A;  4V1A v;  4YHJ A;  4AQY T;  1WYC A;  3AAA B;  3CVR A;  3HKD E;  4OK0 A;  2BG9 B;  4LF7 T;  2VUR A;  2VKJ A;  4L0R A;  2NOX A;  4MBQ A;  1G8X A;  4GK5 E;  4KP3 C;  3G06 A;  4PK4 A;  2WZH A;  3ZMS B;  3UUX B;  4QH4 A;  4YSY A;  2KND A;  1UX4 A;  3ZT6 A;  3C4W A;  3PHF 1;  4Z91 A;  2E8I A;  1V9D A;  3EUH A;  5HCJ A;  4TUY E;  1QUU A;  1MIY A;  3GMI A;  5JDH A;  3F57 A;  4MLK A;  3GN5 B;  5J2T E;  2SPC A;  2VQF T;  2BVL A;  2LM2 A;  4ILA A;  3TLV A;  2LLY A;  5ABF A;  4ILB A;  3AED A;  2E5V A;  2FBW A;  5BMV E;  2BBJ A;  2BZB A;  3RIA A;  4H9R C;  3IF8 B;  2W4X A;  3PDY A;  3ETU A;  2H89 A;  4UV9 B;  1UK5 A;  5M4Y A;  1NEN A;  3JC6 D;  3AB3 B;  2XQ3 A;  2BKO A;  5LBM A;  4DR7 T;  4GYS A;  4O4I E;  2JQH A;  4UVC B;  3NVO A;  4M1P A;  4DVD A;  5EZY E;  2Q9Q B;  5LCY A;  2BBH A;  1WR6 A;  4LF8 T;  1YKE B;  2WP9 A;  5LA6 E;  4X66 T;  1M62 A;  3FXD B;  3BQL A;  4CXX A;  2CE7 A;  3JCF A;  3UU4 A;  5J0Z A;  1M7K A;  2LOP A;  1BR4 A;  2IC9 A;  1SE7 A;  2Q9Q C;  2IHR 1;  2FJA A;  2R6G F;  1J1J A;  2W63 A;  4CXW A; 
#chains in the Genus database with same CATH homology
 2VL8 A;  2CWY A;  2C0S A;  1CUN A;  2EHO A;  5F3J A;  2Y8D A;  3NRY A;  1T98 A;  3ZCI A;  4G63 A;  3HKB E;  4IE6 A;  4WBN E;  3E22 E;  4H63 V;  2P9B A;  2YU2 A;  3KV4 A;  1D0Y A;  1BR1 A;  2J1D G;  3RH3 A;  3LK2 B;  3R6N A;  4PNI A;  3VU7 H;  3MK7 C;  2ZM8 A;  2PFV A;  4FI5 A;  4IHJ E;  3F2E A;  4BGO A;  4ERR A;  2WSS V;  4HGA A;  2A3D A;  3KVA A;  1HX8 A;  5EK2 A;  1LVF A;  4FJO A;  3O9X A;  4EXT A;  5DJQ C;  5HXC A;  1BR0 A;  1D0Z A;  4BAY B;  3I9Y A;  4L9I A;  3WI3 A;  3NZP A;  1D0X A;  3O1J A;  1MNE A;  2V7J A;  2W0G A;  2ODU A;  2WWU A;  2X0L B;  1MMN A;  2LHR A;  2CEA A;  3DJB A;  4KMC A;  2LJL A;  3KDS E;  3ZC1 A;  4AQG A;  5CA0 E;  3MA9 A;  1U5P A;  5JDQ A;  4OHF A;  2PBI A;  4OYJ A;  3SWH A;  3ZEF B;  1MIW A;  2CCQ A;  4O8S A;  3KIN B;  4AKG A;  3CQC B;  4PK6 A;  4WNK A;  4H9S E;  4TV9 E;  2KXP B;  3P8C D;  2Q9Q D;  4AKR B;  5CA1 E;  2CXF A;  2V7M A;  3N2K E;  4HTE A;  3H37 A;  1EZ3 A;  2QGS A;  3RC8 A;  2ACX A;  4PK5 A;  3AAE B;  3HR0 A;  2LSI A;  2HH7 A;  4ZS3 A;  5L3G B;  2LM9 A;  4UF0 B;  5L3D B;  1YW0 A;  1HTJ F;  5J2U E;  2CWO A;  2VAS A;  3C4X A;  3V5U A;  3V5S A;  2LSG A;  4H9P C;  2CLY B;  4X1K E;  5A1L A;  3E0Z A;  2JQQ A;  4IIJ E;  4TZ4 C;  5IHY A;  3RPU A;  2UXN B;  4ASK A;  3RYI E;  4L5G A;  4EAH A;  3HA4 A;  3K3Q C;  3CPZ A;  4XZC A;  2E9X A;  4AXP A;  5LHH B;  2IW5 B;  2LSK A;  2NW7 A;  4PJL A;  4AQF A;  2CM0 A;  2XAH B;  4JUY A;  4Z8X A;  3UUN A;  3BQK A;  2Y6X A;  2YU1 A;  3ZJ2 A;  4PJJ A;  5JRC B;  4QHO A;  4I55 E;  2NTY A;  2LOS A;  4I43 B;  2MTC A;  4QWN B;  2C5J A;  1WYB A;  2DWG A;  4OFZ A;  5HXH A;  3AA7 B;  2JMK A;  1IJ5 A;  3L3P A;  3A5X A;  1WLX A;  5L3C B;  4AKL A;  5LYJ E;  5HYA A;  2CLY C;  4HFV A;  4HKA A;  4PFO A;  3UTK A;  4EYU A;  2DNX A;  3ESL A;  3RRC A;  1D1B A;  4XBF B;  3EDV A;  2LEH A;  4U72 A;  2V7I A;  2PJQ A;  3ANW B;  4TV8 E;  5C8Y E;  4CXY A;  4PW8 A;  5FY0 A;  2K48 A;  2MYS A;  2N2N A;  4DND A;  2C5I T;  4DMW A;  1OWA A;  3N9P A;  5DQW A;  2N9D A;  3FXE B;  5GON E;  1H7C A;  5JQG E;  3RYH E;  3GWH A;  3ZLI A;  3N5L A;  2KIN B;  3N2O A;  3NRX A;  3FBL A;  4O4J E;  3AAI A;  3K3O A;  5F8P A;  5JR9 A;  4IST A;  4EIW A;  1FMV A;  3PU8 A;  4AI6 A;  5JDF A;  5L3F B;  4TN7 B;  2K24 A;  5LOV E;  3EVY A;  4ISS A;  5LGT B;  3B13 A;  3KFW X;  2E9X D;  3KV9 A;  3ZCJ A;  3O1H A;  3HI2 A;  2NWB A;  5T1D A;  3O1I A;  3BQI A;  5JDN A;  4HN9 A;  5HXE A;  3LJC A;  2V26 A;  2DCF A;  2Q9Q A;  2V7L A;  2XAG B;  1ZEE A;  3ZMT B;  4XAX B;  1OXZ A;  2NW9 A;  2XAF B;  4P0A A;  3L09 A;  2LSJ A;  3GA8 A;  4H63 H;  1KK7 A;  2XAQ B;  3RRW A;  4DBR A;  2CMR A;  2NP9 A;  1Z0P A;  3S4U A;  3CML A;  1NWM X;  3MKD A;  1HF8 A;  3PF0 A;  1LKX A;  3PE0 A;  4ECG A;  2V1D B;  1ZKE A;  5HXS A;  1YD8 G;  4ZI3 C;  1MND A;  5JDG A;  2H3R A;  3RC3 A;  4DMV A;  3VKH A;  3KVB A;  4YJ2 E;  2KWI B;  2CXD A;  2KZ7 B;  4IE5 A;  1IZN B;  3UFE A;  1AJ3 A;  3MXZ A;  2A72 A;  2H7O A;  3WSC A;  4UV8 B;  2VKO A;  3FBZ A;  4X20 E;  3ZN0 B;  3SOL A;  3OBV E;  3SS1 A;  4O4H E;  4QKN A;  5HWX A;  4HE8 A;  3PU3 A;  2C5K T;  3CX7 B;  1HFA A;  1U4Q A;  1Y64 B;  1MMG A;  5FXZ A;  3C4Z A;  1ZV4 X;  3KBU A;  4NUV A;  3QK6 A;  1IAP A;  4AKH A;  2JJ9 A;  5HWY A;  1MMA A;  3RKO A;  3N9Q A;  3H3A A;  2V7K A;  3LFM A;  4PJN A;  2CXL A;  4MHC A;  5HXR A;  2XAS B;  3HKC E;  1WRD A;  3JC6 C;  3I9W A;  2KLQ A;  3C98 B;  5LGN B;  2L3L A;  2ZM2 A;  2DWK A;  5LNK A;  3NBX X;  2G0U A;  5TAO A;  4X1I E;  4UXN B;  4GIW A;  3I0Q A;  5DAB A;  5LGU B;  4O2A E;  5H6R B;  2RP4 A;  2GK9 A;  5FY7 A;  3N9L A;  2K5B B;  3WAK A;  4G2A A;  4E7S A;  2HPL A;  4B6X A;  3R84 B;  5LJN A;  4ZI2 C;  4DO0 A;  2NW8 A;  5AFU L;  5FP3 A;  3PUR A;  2X9H A;  4N78 D;  2BDE A;  4QXC B;  5H6Q B;  1BR2 A;  5FY1 A;  5IYZ E;  3CX6 B;  5FMN A;  5LP6 E;  4ZI7 E;  1FIO A;  4C91 A;  4H9O C;  3SRZ A;  5LHG B;  2X9Y A;  1E1H B;  3K3N A;  2MOZ A;  5FXX A;  3ZJ1 A;  4QX7 B;  4EOZ B;  1B7T A;  2X9X A;  4UF0 A;  5KDM C;  3ZYL A;  4UEL A;  4QXB B;  2ODV A;  1MIV A;  4QX8 B;  2DLR A;  2L8K A;  2Z6E A;  3LK3 B;  4CI1 B;  4X1Y E;  3ZPO A;  2HPJ A;  5JVD E;  2KT9 A;  2XUE A;  4ZS2 A;  3RYC E;  3VKG A;  5EK4 A;  1FMW A;  3C51 A;  3OJA A;  4H9Q C;  3PUG A;  1D1C A;  5J1G A;  3M1C A;  2OA5 A;  3ETV A;  1X79 A;  3WAJ A;  2Y48 B;  2YK0 A;  3LBX B;  5JRC A;  2LE8 A;  4ILU A;  1FEW A;  3ZMU B;  4BJN A;  4MAL A;  3O4X E;  1G73 A;  4UEM A;  5EK3 A;  4JEU B;  3EDU A;  2VKD A;  4UVB B;  4DBQ A;  5JDL A;  2A2F X;  2WM9 A;  2B1E A;  2MBG A;  3UT5 E;  3F31 A;  5CB4 E;  3BK9 A;  4ONR A;  1S35 A;  5ADX L;  3E08 A;  4A56 A;  2WMN A;  4HEA A;  4P0B A;  2UXX B;  4JEH B;  3ANW A;  3RX6 A;  2XQY A;  4CZZ B;  5E0O A;  2D0T A;  4AKI A;  1VRB A;  3IHR A;  3ZC0 A;  5JDM A;  5L3E B;  4E7Z A;  4KUM B;  2M67 A;  3KV6 A;  3P7I A;  2BVM A;  3W15 B;  2KWH A;  4U74 A;  3ZN1 B;  2EHO B;  4V1A v;  3RYF E;  1D1A A;  4O4L E;  2H7V C;  3PTR B;  4YHJ A;  4P09 A;  4JLE A;  3MZK B;  4UVA B;  1HG2 A;  1UX5 A;  4OYK A;  4EZH A;  1WYC A;  5HAX A;  2ZM0 A;  3AAA B;  5L2L A;  4QXH B;  3CQX C;  3AA1 B;  4EB6 E;  5L3B B;  3Q5X A;  2X67 A;  3CVR A;  3C64 A;  2VK9 A;  4IE7 A;  2JMH A;  4ADZ A;  4WBO A;  2ES0 A;  2XTL A;  2XHE B;  3HKD E;  3CWZ B;  4OK0 A;  2W00 A;  2EHO C;  2VKJ A;  4L0R A;  3AA6 B;  2NOX A;  3OYZ A;  4MBQ A;  3ZYK A;  5FXV A;  5KX5 E;  3D0T A;  5FYM A;  1G8X A;  4IGU A;  2QA7 A;  4GK5 E;  2XAJ B;  4KP3 C;  1UCU A;  2X68 A;  4TX5 A;  1HCI A;  1VOM A;  4PK4 A;  5FNV E;  1NAF A;  3PUA A;  3ZMS B;  3UUX B;  2KND A;  1UX4 A;  2D5U A;  2LHN A;  3C4W A;  3PHF 1;  2W62 A;  1IJ6 A;  2JRK A;  5ETW A;  3OKQ A;  5LG4 A;  2D0U A;  3QUJ A;  4I50 E;  1S94 A;  4YJ3 E;  2W61 A;  5DQV A;  2VWA A;  3UUL A;  1US7 B;  5FXW A;  2E8I A;  4PAG A;  1V9D A;  2VKH A;  3Q5W A;  5JRE A;  2PG8 A;  3HL6 A;  3EUH A;  5LHI B;  2LSY A;  2X9W A;  4TUY E;  4BJM A;  1QUU A;  1YKH B;  1MIY A;  3GMI A;  5JDH A;  1SHZ C;  4ZI3 D;  2NTX A;  3F57 A;  4MLK A;  2E9X B;  3I1A A;  4IDZ A;  4WW0 A;  2ZMA A;  2WAU A;  3GN5 B;  4YFS A;  3AT7 A;  2JPF A;  4MFR A;  5J2T E;  2DHR A;  2SPC A;  4GYR A;  2BVL A;  5LJM A;  2EHO D;  2WBL A;  3U78 A;  3AVS A;  3FB2 A;  4GOU A;  4J2C A;  3N2G E;  3Q9D A;  2X51 A;  5JH7 E;  3AVR A;  2YEV C;  3FHN A;  3VJZ A;  3QC9 A;  4ZOL E;  4YLH A;  3CX8 B;  2VB6 A;  3IEE A;  5BMV E;  2K9A A;  2BZB A;  4H9R C;  4UIG A;  5KMG P;  4I4T E;  3IF8 B;  2YIN A;  3T8O A;  3PDY A;  4K0U A;  3HKE E;  2E9X C;  3ONX A;  2DI4 A;  1QSD A;  3ETU A;  3GN5 A;  3TKL B;  4AQF C;  4UV9 B;  2X66 A;  3I0O A;  3N9N A;  2CA5 A;  2I59 A;  1HG5 A;  4PFP A;  5M4Y A;  3PUS A;  4IE0 A;  3C50 A;  3AB3 B;  3JC6 D;  3NZQ A;  3KBT A;  1ZHC A;  3DP7 A;  5LBM A;  4NUU A;  4GYS A;  4O4I E;  3OYX A;  3MAC A;  4PJM A;  3M65 A;  4UVC B;  3LG7 A;  3IBP A;  4EZ4 A;  2IAK A;  5JR9 B;  4H9N C;  2LQU A;  3VHL A;  1SA0 E;  3K8P C;  3Q2M A;  4M1P A;  4ZI2 D;  1MMD A;  3LBX A;  3ZMZ B;  4DVD A;  1HS7 A;  3J7Y q;  2MTQ A;  2RA1 A;  5EZY E;  5LBQ B;  2Q9Q B;  3MJX A;  5LCY A;  3ZYM A;  1KNZ A;  4CQI A;  3AA0 B;  2IC6 A;  4ANJ A;  4C90 A;  3WUR A;  2N1G A;  3CQG B;  1WR6 A;  4IE4 A;  1YKE B;  1LVK A;  2D2S A;  3ZMV B;  5LA6 E;  4O2B E;  3J9X 1;  3FXD B;  5JR9 C;  3N9M A;  4CI3 B;  4EYY R;  3N9O A;  3B57 A;  3BQL A;  1LRZ A;  4CXX A;  2CE7 A;  2ZLY A;  3UUM A;  2LT3 A;  3KV5 A;  3PUQ A;  2LOP A;  3U3I A;  5LXT E;  2L9Q A;  1BR4 A;  2IC9 A;  4F6R C;  4ZHQ E;  4KBM B;  4CI2 B;  4GK0 E;  2Q9Q C;  1O3X A;  2KMF A;  3LK4 2;  4BA9 A;  2WMO A;  3CKD A;  2W63 A;  3DTO A;  4CXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...