5HXCA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 20 mm na+ and zero ca2+
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
304
structure length
300
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRMGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
molecule keywords sodium,calcium exchanger
total genus 138
structure length 300
sequence length 304
ec nomenclature
pdb deposition date 2016-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hxcA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hxcA02
5HXEA 5HWYA 5JDFA 5HXSA 5HXHA 5HXRA 5HXCA 5JDNA 5JDMA 5HWXA 5HYAA 5JDLA 5JDQA 3V5SA 5JDGA 5JDHA 3V5UA
chains in the Genus database with same CATH superfamily
2X0YA 4DNDA 4IE4A 2Y6XA 4ZI2C 2IC9A 4U2ZA 3UTKA 5L3EB 1XNRT 3AECA 3CQXC 3R6NA 3AEFA 4QWNB 2WWUA 5AQKB 5HXSA 1OEDC 2YDRA 5A1LA 1NAFA 3OJAA 4UV8B 5J1GA 3RRWA 1QUUA 1UCUA 5LBMA 3WAKA 3ZMVB 5ADXL 1WR6A 2HPLA 2X0CA 2Q9QB 2XSAA 2W00A 1HNXT 2LSYA 4LF6T 1SUMB 1KEYA 4X5TA 5HXCA 4AQFA 2HN2A 4IE6A 4TWDA 1WLXA 4CQIA 2KWHA 4X66T 1J1JA 4C90A 1B7TA 1OEDE 1D1BA 1KNPA 2XSBA 4WBNE 3TLVA 2FJBA 2BS4A 4O4IE 4DUZT 4EYUA 4HWIB 4NUUA 2XAQB 4X64T 1U4QA 2E9XD 2Z6EA 3KV5A 2FJEA 2CXDA 3AA7B 3FXDB 4BAYB 4EAHA 1IAPA 5KDMC 5M4YA 2BVMA 3L09A 3PJAJ 4O2BE 3WURA 2LHNA 2OV9A 2XM1A 1MIWA 2ZM8A 3AT7A 4KMCA 3M3ZB 2SPCA 5IWAT 2K3WA 2CMRA 4KP3C 4B6XA 5KXJA 3RIUC 4TV8E 3WSCA 5DQVA 3UU6A 4JI7T 2D0TA 4HWFA 5FXVA 4YY3T 4JI6T 3HL6A 5BMVE 3ONXA 2CHNA 4DV3T 2WAUA 4V1Av 3UT5E 4U3CA 5LJMA 2B1EA 3NZPA 1N36T 4W8PA 2AXDS 3FXEB 1MNDA 3UUNA 1T72A 2OLTA 2ODVA 3CWZB 3OVUA 3PV0F 5FL0A 2NTYA 3JAEA 3QUJA 2CPTA 1HF8A 5LJNA 4TNWA 3A8YC 3MA9A 2WSSV 3QK6A 4AI6A 3KDSE 2CLYB 4X1IE 2C5IT 3ZYLA 2WP9A 4AKLA 4DBRA 3RF1A 3GA8A 4U7IA 5FKYA 3RGLA 3VHLA 1V9DA 4AIUA 2MOZA 2BZBA 4CZZB 5CFBA 3GN5B 5L3FB 4DUYT 3E08A 1T7SA 4QKNA 5FL1A 4BJMA 5ABFB 4A5XA 3RYFE 2KVPA 2OA5A 3ONLC 3I1AA 3RLFF 4PFPA 4DV6T 3PU3A 3N2KE 2JQKA 4DV2T 4EEDA 4DIDB 3P8CD 3N9NA 4HFCA 5IUXA 4ERRA 3EI0A 3WI3A 2LQUA 2D0UA 5AQIB 4TZ4C 2E8IA 4JI0T 1XWMA 2CWOA 1OEDA 3P4WA 4H9OC 2NW7A 4TX5A 5HXRA 1FEWA 2V6XA 3ZN0B 3AE6A 2WWVA 4KBMB 1D0ZA 1G73A 2LSKA 1N32T 5L4EA 3AAAB 3PUWF 5FVKA 5LCYA 4DMWA 2MTCA 4YTPA 4Z90A 3KFWX 3B13A 1IBLT 3ETUA 3AB3B 4HFVA 5AQGB 3PURA 4TNVA 5DQWA 4NUVA 4TWFA 3EAMA 3V5SA 4DO0A 4DVDA 1BR2A 1UUSA 5AFUL 3C98B 4NXNT 1CUNA 2CE7A 4JLEA 4LMKA 2L8KA 1W0BA 2H3RA 1LVKA 2XQ7A 3FZLB 2XZEA 4YFSA 4PK5A 2D9DA 2EHOC 4CXXA 1HX1B 2W0GA 5H6QB 4XZCA 2C5JA 3ZJ1A 2LOPA 2KWIB 5HAXA 2JQHA 3VKHA 1MMNA 2XQ8A 3PUZF 4FJOA 2HH7A 2LSGA 2WDQA 4MLKA 5FVLA 4UIGA 4TWHA 3UUMA 3FZFB 1Y01A 2V8SV 2X9YA 4MFRA 3JADA 3M65A 2LRLA 3QC9A 2KXPB 4UVBB 3C4ZA 3B57A 4JI4T 2KT9A 2LEHA 2WM9A 2RP4A 2W4XA 4B3ST 3AA0B 2IMLA 4GYSA 4OX9T 2VKHA 4P0AA 4GKKT 2IC6A 2QA7A 4FI5A 3RC8A 4U74A 3CVRA 2LT3A 2YDQA 2CA5A 2HPJA 4L9IA 4DV0T 1YD8G 3PTRB 4I43B 5C3JA 2H7VC 2XTLA 3UULA 3PUXF 2C5KT 3P7IA 4EOZB 4B3MT 4LF5T 4P0BA 2V7JA 1CHUA 4IHJE 5KX5E 4AQFC 3M1CA 2XPKA 4HTEA 5JR9C 3AE4A 2HHHT 5J2UE 3SS1A 2QVAA 2XQ4A 3AEAA 5CJ5A 4PW8A 2B76A 2CLYC 2IHR1 2LM2A 4QH5A 1IZNB 4HFHA 1W0AA 3ZCIA 3UFEA 4EV6A 2FBWA 3SFEA 4DBQA 3JCFA 3LDQB 2LM9A 3HKBE 3ETVA 3MK7C 2JQQA 3LBXB 5HWYA 2LJLA 4DR6T 4ASKA 2WS3A 2CM0A 3MXZA 4UVAB 4WW0A 1L0VA 4IE5A 2WU5A 2X9WA 3N9LA 4PJMA 4ZI3C 3ZMUB 2L7NA 2XQYA 1WCRA 4IIJE 2XAHB 1KNZA 4DR7T 4JI1T 3PDYA 5ABFA 4O2AE 5LNKA 4CXWA 5L47A 2BS3A 4QXCB 3AEDA 5JDFA 1VCSA 2VQET 3N2GE 2K48A 2L9QA 4DR2T 2VKDA 3K8PC 5CA1E 2YU1A 5ABEA 1NWMX 2M67A 1YQ4A 2X9XA 4LMJA 2I0MA 4ANJA 2V6YA 1XDOA 4U33A 2DI4A 2MTQA 2UXNB 1EZ3A 3AAIA 3ZMTB 4BJNA 5KMGP 1SE7A 3C50A 2BG9B 1SJ7A 3A7MA 3RPUA 4YT0A 3KBUA 3HR0A 1HNWT 2M6IA 4KHPT 3P4QA 4OFZA 2XAJB 3EUHA 2HN1A 4YXDA 5JDMA 4HFDA 4EZ4A 3H37A 3PHF1 4JEUB 1UGOA 4IDNA 5H6RB 4OYKA 2J47A 2QRXA 4QX8B 2H89A 3F31A 2WMNA 2YEVC 5HEHA 3TLWA 1YW0A 1SJ8A 3CX8B 4ILCA 2BKNA 3HKCE 3SOLA 2PG8A 3IHRA 1D0XA 1LRZA 3AE7A 1E1HB 3F57A 3TLTA 2WDRA 1QLBA 2V7IA 1ZV4X 3MZKB 4ZS2A 3RRCA 2VVNA 1E2AA 2V26A 4N78D 2XQ3A 3ZYMA 3UQ7A 3WAJA 5LHHB 4CI1B 1MMGA 1YKEB 3LK42 3RC3A 1JNRA 2YDSA 3HKDE 5HEOA 3AE9A 3OYZA 3J7Yq 4AKIA 2DNXA 3K3NA 4OYJA 5TAOA 3ZMSB 2N1GA 4UVCB 4TV9E 5EK3A 2LRKA 1HFAA 2IAKA 1FMWA 3IBPA 4A56A 5AQLB 5HEJA 4EXTA 4YHJA 4ECGA 4ILBA 2UU9T 5JR9A 3RYIE 2X9HA 5CB4E 2VASA 4X62T 1LKXA 3C4XA 2EHOB 3L8RA 2KSRA 4ZOLE 5LBQB 1X79A 1BR1A 4KUMB 4CN1A 2BG9A 2XHEB 4ZXLA 5FMNA 4CN6A 5T1DA 1KNRA 5FXZA 2QYWA 2JMKA 4DR1T 5L3DB 4B3RT 4NPPA 4LF4T 5L3GB 1E7PA 3KINB 2WY2A 3N5LA 4G2AA 2EHOA 4LMLA 1UX4A 1IJ6A 3AXJA 3H3AA 4P1NA 5AQQB 2W61A 3PF0A 3ESLA 2V1DB 2RPAA 1U5PA 3PUAA 2JRKA 4HKAA 4Z91A 5IYZE 5LP6E 3LK2B 2NTXA 1M7KA 2X0LB 2XQAA 3RYCE 2J62A 5JDQA 3LSVA 3RKGA 3MKDA 2KINB 1W09A 3ZEFB 3EHZA 2FJDA 4HEAA 3PJAA 2I59A 3CIRA 3K1SA 3W15B 4EZHA 2NP9A 2NWBA 3AEEA 4HGAA 4KI0F 2WQYA 1HR0T 1KF6A 5AQUB 4DV5T 4QH4A 3VU7H 1J5ET 4NXMT 3ZSTA 2WMOA 1KK7A 1S35A 2JPFA 2KLQA 2XJ7A 1VCTA 3T8OA 1N34T 3VKGA 3AEBA 1IBMT 4AKRB 2E2AA 4COFA 2E5VA 3RIAA 2C0SA 3L3PA 4HN9A 3N9QA 4LF7T 3UU3A 4A98A 4XBFB 2W67A 3KVAA 3P50A 5JREA 1XNQT 3P4SA 1AJ3A 3AY5A 2WB5A 2P9BA 3IA3A 3ZN1B 2XQ5A 3Q9DA 1XZYA 3C64A 2FUPA 2BG9C 3QOFA 3TLSA 2A3DA 3RYHE 4XAXB 3OTOT 2UXCT 3FBLA 2MBGA 4F8HA 2ZM2A 5GONE 3RI5A 3RQUA 4TN7B 5ABHA 2LOSA 2MAWA 2IW5B 2E9XC 3O1HA 2KMFA 3RH3A 1HS7A 5FZTA 4PJNA 4CI2B 3IF8B 4GK5E 3CMLA 2WDVA 2BBHA 3JC6D 1UX5A 1ZKEA 3E22E 1OXZA 3U3IA 4A97A 4JI3T 1T8BA 3Q5WA 5LXTE 2UUBT 2D2SA 3BQKA 4MHCA 4YTNA 3EDUA 4ZI7E 4JYAT 4ZI3D 5JDLA 5L3BB 3DP7A 3RIUA 1M62A 2GK9A 4G63A 1FJGT 2ES0A 3PUVF 4HWHA 5ABGA 2DLRA 4ISTA 4GOUA 4YTMA 1HG5A 1US7B 2CBJA 3O1IA 1Y64B 3AE1A 2DCFA 4AKHA 3H3MA 4PJJA 2CHOA 4UF0B 4ONRA 1OWAA 3N9MA 3ZMZB 2UXDT 4IL4A 4QH1A 2H88A 1HNZT 5JVDE 4HWCA 5LHIB 5LGTB 3ZC0A 2ACXA 4LFBT 5FY7A 2G0UA 4C91A 3ANWA 2UXBT 5L4HA 1GQEA 2KZ7B 2XUEA 4CI3B 4H9PC 4HE8A 2Y48B 5LA6E 3F2EA 3ZYKA 4DR5T 4O4LE 3I9YA 3EABA 4MALA 1HG2A 2X0HA 2E9XA 3UU5A 5FXXA 3ZPOA 5JH7E 2VKOA 3NWIA 5JRCB 3IEEA 1W9RA 5AQJB 3CQCB 2KBBA 2IDOB 4PNIA 1BR0A 4GK0E 1ZP0A 1YXRA 4HFBA 4DR4T 2DWGA 3N2OA 2PTFA 1YQ3A 3LJCA 3ZT6A 2CRBA 3P4RA 3PUYF 5FY1A 5E0OA 2PBIA 1VOMA 2D5UA 3CX7B 3OKQA 3P4PA 5HEGA 3JAFA 5LG4A 3PUQA 5AQPB 2VB6A 3DJBA 4WBOA 1NENA 3O1JA 4QHOA 3VJZA 3AVSA 3UU8A 5AQNB 4NIQA 2VVSA 2XAGB 4IREA 5HEUA 2M6BA 4JV5T 4LFAT 2V7KA 3ZC1A 2ZM6T 3VR9A 5AQMB 2LLYA 3BQIA 3KV6A 3MJXA 4IDPA 1WYBA 3FZHB 4ZHQE 2VK9A 2DL1A 4QXBB 3SWHA 2V5CA 2BVLA 4P09A 3V5UA 4ZZCA 3MACA 1XMQT 2LSJA 3ANWB 4PAGA 1HCIA 1IBKT 4X1YE 4H9RC 4JEHB 3UU4A 5LMNT 2X68A 3X1DA 3HA4A 4B3TT 2DWKA 3FHNA 1MNEA 4GYRA 2Q9QD 3Q2MA 4UF0A 5AQRB 4AXPA 5DJQC 3I0OA 5CGMA 3LK3B 5DABA 2W66A 5JR9B 4CXYA 4O4JE 4U72A 1SHZC 2V7LA 3ZKRA 4EB6E 1MMAA 1ZEEA 2LSIA 2YN6A 3PUSA 3Q5XA 1MIVA 3FB2A 3SRZA 2VQFT 2A2FX 4UEMA 4IT4A 4H63H 5FP3A 2LHRA 4IE0A 2J4GA 4EGWA 3AE5A 3EVYA 2XASB 3LFMA 4IDQA 3PE0A 4WNKA 3ZLIA 4DV1T 2ZLYA 2MYSA 2JMHA 3AEGA 5EK2A 2LKHA 1WFDA 5AQSB 2KNDA 1QSDA 3ONJA 3NVOA 4ILUA 2L10A 4DV4T 4IDOA 4I0UA 3RX6A 4CN4A 4U31A 1R8IA 4KX6A 4U2YA 4JI2T 4J2CA 4BA9A 5BR8T 4IL9A 1YKHB 3L39A 1DU2A 2CCQA 3FZKB 1D0YA 5JDGA 3RQWA 1N33T 2H7OA 3C4WA 3HKEE 5J2TE 3N9PA 3A5XA 4YSZA 3NBXX 4LF8T 4GKJT 1S94A 3ABVA 5JDHA 1J5WA 5ETWA 1D1CA 4ILAA 3OPCA 2WZHA 5HXHA 3VRAA 2Q9QA 4HFIA 1BR4A 4GIWA 2JIWA 4KHZF 2BKOA 5AQTB 4YJ2E 2K9AA 2J1DG 2CWYA 2K24A 4I4TE 2BKPA 2MPKA 5IHYA 3UUXB 3SFDA 4YHHT 2ZM0A 2UUAT 4F7GB 2BDEA 2PFVA 3I9WA 1KFYA 5L2LA 4IE7A 2BG9E 3AE8A 5JQGE 4F6RC 5EK4A 4X20E 1NEKA 3AXJB 2CXLA 4X65T 1VRBA 5HCJA 4JUYA 1MIYA 4DMVA 4YJ3E 4HWDA 4PJLA 4LF9T 3ZT5A 3G06A 3VRBA 2N9DA 3I0QA 1ZHCA 2W62A 4UXNB 1ZOYA 3AE2A 4ZS3A 4E7ZA 2A72A 3GMIA 3J9X1 3Q5EA 1X9BA 2JQ9A 4PK4A 2NW9A 4Q25A 2W2UA 1JNZA 2X66A 3NRYA 4EYYR 2VURA 5JDNA 3O4XE 4TUYE 3FZMB 4IGUA 4WYVA 4JI5T 2IIUA 2YKSA 5LMUT 3K3OA 3PU8A 3AAEB 3ZCJA 4AKGA 2ZMAA 1OEDB 4YLHA 3UQ4A 2WCAA 2NOXA 5C2TA 3HI2A 4YSYA 5AQVB 4JI8T 2N2NA 3AE3A 3QB5A 2A9UA 2L3LA 5L3CB 3K3QC 3U78A 5J0ZA 2FJAA 2IUBA 2PJQA 4OHFA 4X1KE 3RHWA 4AQYT 3E0ZA 1IJ5A 4L0RA 2V5DA 1Z0PA 3CKDA 2V7MA 3AA6B 4Z8XA 1MMDA 4OK0A 2XM2A 5LB7B 2I6HA 2VL8A 4ISSA 5FXWA 5HWXA 4H9SE 5LHGB 5AQOB 4JBWF 4EEBA 3RKOA 2AE9A 4O4HE 2JJ9A 4LFCT 2E5LT 1G8XA 2F4VT 1WRDA 4H63V 3CK6A 3NKZA 5CA0E 3ZSSA 4QXHB 5C8YE 2YK0A 5LYJE 2LE8A 4ZEYA 2CEAA 4IDZA 4I50E 3DYJA 5LGNB 4O8SA 4WZXA 5LG3A 4M1PA 3AA1B 1HX8A 5LGUB 1SA0E 2Y8DA 3ZT7A 1I6ZA 2KGXA 4PFOA 4BGOA 2CXFA 4UR9A 3LG7A 1UURA 3CPZA 2UXXB 2NW8A 4QX7B 3OBVE 5F8PA 1O3XA 5FYMA 5HXEA 2Q9QC 1I94T 1HTJF 3O9XA 4UV9B 2RA1A 3C51A 3BK9A 3QB5K 1XMOT 4E7SA 1LVFA 2ACZA 3KVBA 4MBQA 4ZZBA 4DV7T 2YU2A 5FNVE 2UUCT 2XQ9A 4I55E 3T1HT 4L5GA 3PUGA 3BQLA 4U7YA 3TKLB 2XY8B 3QNUA 3KV9A 3RIFA 2XAFB 3Q5DA 2LKGA 3OYXA 1H7CA 3ZJ2A 4DR3T 3NRXA 4PK6A 4EIWA 2YOEA 2VWAA 1D1AA 5AQHB 2XQ6A 3LBXA 5EZYE 3R84B 2BS2A 3KV4A 1UK5A 3CQGB 1WYCA 2YINA 5HCMA 1FMVA 3S4UA 2QGSA 3DTOA 4H9QC 2VKJA 3FBZA 5LOVE 2WU2A 2NR4A 3D0TA 4AISA 2BBJA 4AQGA 4K0KT 1XDPA 2E9XB 3GN5A 2VL0A 2W63A 3N9OA 3B5MA 5JRCA 3KBTA 3FYQA 3CX6B 1WR0A 4H9NC 3NZQA 4ADZA 4HFEA 3VR8A 1FIOA 4YSXA 5F3JA 5FY0A 5HYAA 3T1YT 2DHRA 2X51A 3GWHA 2EHOD 5F5WA 4K0UA 5AQFB 2CBIA 1T98A 3UFGA 3EDVA 2V6YB 3JC6C 3AVRA 2ODUA 2R6GF 4UELA 5JTGA 1Z8UA 2K5BB 2WZIA 2X67A 3TLUA 3UUBA 2WBLA 4ZI2D
chains in the Genus database with same CATH topology
4DNDA 4IE4A 2Y6XA 4ZI2C 2IC9A 3UTKA 5L3EB 3CQXC 3R6NA 4QWNB 2WWUA 5HXSA 5A1LA 1NAFA 3OJAA 4UV8B 5J1GA 3RRWA 1QUUA 1UCUA 5LBMA 3WAKA 3ZMVB 5ADXL 1WR6A 2HPLA 2Q9QB 2W00A 2LSYA 5HXCA 4AQFA 4IE6A 1WLXA 4CQIA 2KWHA 4C90A 4WBNE 1B7TA 1D1BA 4O4IE 4EYUA 4NUUA 2XAQB 1U4QA 2E9XD 2Z6EA 3KV5A 4BAYB 2CXDA 3AA7B 3FXDB 4EAHA 5KDMC 1IAPA 5M4YA 2BVMA 3L09A 4O2BE 3WURA 2LHNA 1MIWA 2ZM8A 3AT7A 4KMCA 2SPCA 2CMRA 4KP3C 4B6XA 4TV8E 3WSCA 5DQVA 2D0TA 5FXVA 3HL6A 3ONXA 2WAUA 4V1Av 3UT5E 5LJMA 2B1EA 3NZPA 3FXEB 1MNDA 3UUNA 2ODVA 3CWZB 2NTYA 3QUJA 1HF8A 5LJNA 4AI6A 3MA9A 2WSSV 3QK6A 3KDSE 2CLYB 4X1IE 2C5IT 3ZYLA 4AKLA 4DBRA 3GA8A 3VHLA 1V9DA 2MOZA 2BZBA 4CZZB 5L3FB 3GN5B 3E08A 4QKNA 4BJMA 3RYFE 2OA5A 3I1AA 4PFPA 3PU3A 3N2KE 3P8CD 3N9NA 4ERRA 2LQUA 3WI3A 2D0UA 4TZ4C 2E8IA 2CWOA 4H9OC 2NW7A 4TX5A 5HXRA 1FEWA 3ZN0B 4KBMB 1D0ZA 1G73A 2LSKA 3AAAB 5LCYA 2MTCA 4DMWA 3KFWX 3B13A 3ETUA 3AB3B 4HFVA 3PURA 5DQWA 4NUVA 4DO0A 3V5SA 4DVDA 1BR2A 5AFUL 3C98B 1CUNA 2CE7A 4JLEA 2L8KA 2H3RA 4YFSA 1LVKA 5JH7E 4PK5A 4CXXA 2EHOC 4E7SA 5JDLA 2W0GA 5H6QB 4XZCA 2C5JA 3ZJ1A 2LOPA 2KWIB 5HAXA 1MMNA 4FJOA 2HH7A 2LSGA 4MLKA 4UIGA 3UUMA 2X9YA 4MFRA 3M65A 3QC9A 2KXPB 4UVBB 3C4ZA 3B57A 2KT9A 2LEHA 2WM9A 2RP4A 3AA0B 4GYSA 2VKHA 4P0AA 2IC6A 2QA7A 4FI5A 3RC8A 4U74A 3CVRA 2LT3A 2CA5A 2HPJA 4L9IA 1YD8G 3PTRB 4I43B 2H7VC 2XTLA 3UULA 2C5KT 3P7IA 4EOZB 4P0BA 2V7JA 4IHJE 5KX5E 4AQFC 3M1CA 4HTEA 5JR9C 5J2UE 3SS1A 4PW8A 2CLYC 1IZNB 3ZCIA 3UFEA 2LM9A 3HKBE 3ETVA 3MK7C 2JQQA 3LBXB 5HWYA 2LJLA 4ASKA 2CM0A 3MXZA 4UVAB 4WW0A 4IE5A 2X9WA 3N9LA 4PJMA 4ZI3C 3ZMUB 2XQYA 4IIJE 2XAHB 1KNZA 3PDYA 4O2AE 5LNKA 4CXWA 4QXCB 5JDFA 3N2GE 2K48A 2L9QA 2VKDA 3K8PC 5CA1E 2YU1A 1NWMX 2M67A 2X9XA 4ANJA 2DI4A 2MTQA 2UXNB 1EZ3A 3AAIA 3ZMTB 4BJNA 5KMGP 3C50A 3RPUA 3KBUA 3HR0A 4OFZA 5JDMA 2XAJB 3EUHA 4EZ4A 3H37A 3PHF1 4JEUB 5H6RB 4OYKA 4QX8B 3F31A 2WMNA 2YEVC 1YW0A 3CX8B 3HKCE 3SOLA 2PG8A 3IHRA 1D0XA 1LRZA 3F57A 1E1HB 2V7IA 1ZV4X 3MZKB 4ZS2A 3RRCA 4N78D 2V26A 3ZYMA 3WAJA 5LHHB 4CI1B 1MMGA 1YKEB 3LK42 3RC3A 3J7Yq 3HKDE 4AKIA 3OYZA 2DNXA 3K3NA 4OYJA 5TAOA 3ZMSB 2N1GA 4UVCB 4TV9E 5EK3A 4A56A 1HFAA 2IAKA 1FMWA 3IBPA 4DBQA 4EXTA 4YHJA 4ECGA 5JR9A 3RYIE 2X9HA 5CB4E 2VASA 1LKXA 3C4XA 2EHOB 4ZOLE 5LBQB 5BMVE 1X79A 1BR1A 4KUMB 5T1DA 2XHEB 5FMNA 5FXZA 2JMKA 5L3DB 5L3GB 3KINB 3N5LA 4G2AA 2EHOA 1UX4A 1IJ6A 3H3AA 3PF0A 2W61A 3ESLA 2V1DB 3PUAA 1U5PA 4HKAA 2JRKA 5IYZE 5LP6E 3LK2B 2NTXA 2X0LB 3RYCE 5JDQA 3MKDA 2KINB 3ZEFB 4HEAA 2I59A 3W15B 4EZHA 2NP9A 2NWBA 4HGAA 3VU7H 2WMOA 1KK7A 1S35A 2JPFA 2KLQA 3T8OA 3VKGA 4AKRB 2C0SA 3L3PA 4HN9A 3N9QA 4XBFB 1AJ3A 3KVAA 5JREA 3ZN1B 2P9BA 3Q9DA 3C64A 2A3DA 3RYHE 4XAXB 3FBLA 2MBGA 2ZM2A 5GONE 4TN7B 2LOSA 2IW5B 2E9XC 3O1HA 2KMFA 3RH3A 1HS7A 4PJNA 4CI2B 3IF8B 4GK5E 3CMLA 3JC6D 1UX5A 1ZKEA 3E22E 1OXZA 3U3IA 5LXTE 3Q5WA 2D2SA 3BQKA 4MHCA 4ZI7E 3EDUA 4ZI3D 5L3BB 3DP7A 2GK9A 4G63A 2ES0A 2DLRA 4ISTA 4GOUA 1HG5A 1US7B 3O1IA 1Y64B 2DCFA 4AKHA 4UF0B 4PJJA 4ONRA 1OWAA 3N9MA 3ZMZB 5JVDE 5LGTB 5LHIB 3ZC0A 2ACXA 5FY7A 2G0UA 4C91A 3ANWA 2KZ7B 2XUEA 4CI3B 4H9PC 4HE8A 2Y48B 5LA6E 3F2EA 3ZYKA 4O4LE 3I9YA 4MALA 3VKHA 1HG2A 2E9XA 5JRCB 5FXXA 3ZPOA 2VKOA 3IEEA 3CQCB 4PNIA 1BR0A 4GK0E 2DWGA 3N2OA 3LJCA 5FY1A 5E0OA 2PBIA 1VOMA 2D5UA 3CX7B 3OKQA 5LG4A 3PUQA 2VB6A 3DJBA 4WBOA 3O1JA 4QHOA 3VJZA 3AVSA 2XAGB 2V7KA 3ZC1A 3BQIA 3KV6A 3MJXA 1WYBA 4ZHQE 2VK9A 4QXBB 3SWHA 2BVLA 4P09A 3V5UA 3MACA 2LSJA 3ANWB 4PAGA 1HCIA 4X1YE 4H9RC 4JEHB 2X68A 3HA4A 2DWKA 3FHNA 1MNEA 4GYRA 2Q9QD 3Q2MA 4UF0A 4AXPA 5DJQC 3I0OA 3LK3B 5DABA 5JR9B 4CXYA 4O4JE 4U72A 1SHZC 2V7LA 4EB6E 1MMAA 1ZEEA 2LSIA 3PUSA 3Q5XA 1MIVA 3FB2A 3SRZA 2A2FX 4UEMA 4H63H 5FP3A 2LHRA 4IE0A 3EVYA 2XASB 3LFMA 4WNKA 3PE0A 3ZLIA 2ZLYA 2MYSA 2JMHA 5EK2A 2KNDA 1QSDA 4ILUA 3RX6A 4J2CA 4BA9A 1YKHB 2CCQA 1D0YA 5JDGA 2H7OA 3C4WA 3HKEE 5J2TE 3N9PA 3A5XA 3NBXX 1S94A 5JDHA 5ETWA 1D1CA 5HXHA 2Q9QA 1BR4A 4GIWA 4YJ2E 2K9AA 2J1DG 2CWYA 2K24A 4I4TE 3UUXB 5IHYA 2ZM0A 2BDEA 2PFVA 3I9WA 5L2LA 4IE7A 5JQGE 4F6RC 5EK4A 4X20E 2CXLA 1VRBA 4JUYA 1MIYA 4DMVA 4YJ3E 4PJLA 2N9DA 3I0QA 1ZHCA 2W62A 4UXNB 2WBLA 4ZS3A 4E7ZA 2A72A 3GMIA 3J9X1 4PK4A 2NW9A 2X66A 3NRYA 4EYYR 5JDNA 3O4XE 4TUYE 4IGUA 3K3OA 3PU8A 3AAEB 3ZCJA 4AKGA 2ZMAA 4YLHA 2NOXA 3HI2A 2N2NA 5L3CB 2L3LA 3K3QC 3U78A 2PJQA 4OHFA 4X1KE 3E0ZA 1IJ5A 4L0RA 1Z0PA 3CKDA 2V7MA 3AA6B 4Z8XA 1MMDA 4OK0A 4ISSA 2VL8A 5FXWA 5HWXA 5LHGB 4H9SE 3RKOA 4O4HE 2JJ9A 1G8XA 1WRDA 4H63V 5CA0E 4QXHB 5C8YE 2YK0A 5LYJE 2LE8A 2CEAA 4IDZA 4I50E 5LGNB 4O8SA 4M1PA 3AA1B 1HX8A 5LGUB 1SA0E 2Y8DA 4PFOA 4BGOA 2CXFA 3LG7A 3CPZA 2UXXB 2NW8A 4QX7B 3OBVE 5F8PA 1O3XA 5FYMA 5HXEA 2Q9QC 1HTJF 3O9XA 4UV9B 2RA1A 3C51A 3BK9A 1LVFA 3KVBA 4MBQA 2YU2A 5FNVE 4I55E 4L5GA 3PUGA 3BQLA 3TKLB 3KV9A 2XAFB 3OYXA 1H7CA 3ZJ2A 3NRXA 4PK6A 4EIWA 2VWAA 1D1AA 5EZYE 3LBXA 3R84B 3KV4A 3CQGB 1WYCA 2YINA 1FMVA 3S4UA 2QGSA 3DTOA 4H9QC 3FBZA 2VKJA 5LOVE 3D0TA 4AQGA 2E9XB 3GN5A 2W63A 3N9OA 5JRCA 3KBTA 3CX6B 4H9NC 4ADZA 3NZQA 1FIOA 5F3JA 5FY0A 5HYAA 2DHRA 2X51A 3GWHA 2EHOD 1T98A 3EDVA 3JC6C 2ODUA 4UELA 2K5BB 2X67A 4K0UA 3AVRA 4ZI2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXE A;  5HWY A;  5JDF A;  5HXS A;  5HXH A;  5HXR A;  5HXC A;  5JDN A;  5JDM A;  5HWX A;  5HYA A;  5JDL A;  5JDQ A;  3V5S A;  5JDG A;  5JDH A;  3V5U A; 
#chains in the Genus database with same CATH topology
 2X0Y A;  4DND A;  4IE4 A;  2Y6X A;  4ZI2 C;  2IC9 A;  4U2Z A;  3UTK A;  5L3E B;  1XNR T;  3AEC A;  3CQX C;  3R6N A;  3AEF A;  4QWN B;  2WWU A;  5AQK B;  5HXS A;  1OED C;  2YDR A;  5A1L A;  1NAF A;  3OJA A;  4UV8 B;  5J1G A;  3RRW A;  1QUU A;  1UCU A;  5LBM A;  3WAK A;  3ZMV B;  5ADX L;  1WR6 A;  2HPL A;  2X0C A;  2Q9Q B;  2XSA A;  2W00 A;  1HNX T;  2LSY A;  4LF6 T;  1SUM B;  1KEY A;  4X5T A;  5HXC A;  4AQF A;  2HN2 A;  4IE6 A;  4TWD A;  1WLX A;  4CQI A;  2KWH A;  4X66 T;  1J1J A;  4C90 A;  1B7T A;  1OED E;  1D1B A;  1KNP A;  2XSB A;  4WBN E;  3TLV A;  2FJB A;  2BS4 A;  4O4I E;  4DUZ T;  4EYU A;  4HWI B;  4NUU A;  2XAQ B;  4X64 T;  1U4Q A;  2E9X D;  2Z6E A;  3KV5 A;  2FJE A;  2CXD A;  3AA7 B;  3FXD B;  4BAY B;  4EAH A;  1IAP A;  5KDM C;  5M4Y A;  2BVM A;  3L09 A;  3PJA J;  4O2B E;  3WUR A;  2LHN A;  2OV9 A;  2XM1 A;  1MIW A;  2ZM8 A;  3AT7 A;  4KMC A;  3M3Z B;  2SPC A;  5IWA T;  2K3W A;  2CMR A;  4KP3 C;  4B6X A;  5KXJ A;  3RIU C;  4TV8 E;  3WSC A;  5DQV A;  3UU6 A;  4JI7 T;  2D0T A;  4HWF A;  5FXV A;  4YY3 T;  4JI6 T;  3HL6 A;  5BMV E;  3ONX A;  2CHN A;  4DV3 T;  2WAU A;  4V1A v;  3UT5 E;  4U3C A;  5LJM A;  2B1E A;  3NZP A;  1N36 T;  4W8P A;  2AXD S;  3FXE B;  1MND A;  3UUN A;  1T72 A;  2OLT A;  2ODV A;  3CWZ B;  3OVU A;  3PV0 F;  5FL0 A;  2NTY A;  3JAE A;  3QUJ A;  2CPT A;  1HF8 A;  5LJN A;  4TNW A;  3A8Y C;  3MA9 A;  2WSS V;  3QK6 A;  4AI6 A;  3KDS E;  2CLY B;  4X1I E;  2C5I T;  3ZYL A;  2WP9 A;  4AKL A;  4DBR A;  3RF1 A;  3GA8 A;  4U7I A;  5FKY A;  3RGL A;  3VHL A;  1V9D A;  4AIU A;  2MOZ A;  2BZB A;  4CZZ B;  5CFB A;  3GN5 B;  5L3F B;  4DUY T;  3E08 A;  1T7S A;  4QKN A;  5FL1 A;  4BJM A;  5ABF B;  4A5X A;  3RYF E;  2KVP A;  2OA5 A;  3ONL C;  3I1A A;  3RLF F;  4PFP A;  4DV6 T;  3PU3 A;  3N2K E;  2JQK A;  4DV2 T;  4EED A;  4DID B;  3P8C D;  3N9N A;  4HFC A;  5IUX A;  4ERR A;  3EI0 A;  3WI3 A;  2LQU A;  2D0U A;  5AQI B;  4TZ4 C;  2E8I A;  4JI0 T;  1XWM A;  2CWO A;  1OED A;  3P4W A;  4H9O C;  2NW7 A;  4TX5 A;  5HXR A;  1FEW A;  2V6X A;  3ZN0 B;  3AE6 A;  2WWV A;  4KBM B;  1D0Z A;  1G73 A;  2LSK A;  1N32 T;  5L4E A;  3AAA B;  3PUW F;  5FVK A;  5LCY A;  4DMW A;  2MTC A;  4YTP A;  4Z90 A;  3KFW X;  3B13 A;  1IBL T;  3ETU A;  3AB3 B;  4HFV A;  5AQG B;  3PUR A;  4TNV A;  5DQW A;  4NUV A;  4TWF A;  3EAM A;  3V5S A;  4DO0 A;  4DVD A;  1BR2 A;  1UUS A;  5AFU L;  3C98 B;  4NXN T;  1CUN A;  2CE7 A;  4JLE A;  4LMK A;  2L8K A;  1W0B A;  2H3R A;  1LVK A;  2XQ7 A;  3FZL B;  2XZE A;  4YFS A;  4PK5 A;  2D9D A;  2EHO C;  4CXX A;  1HX1 B;  2W0G A;  5H6Q B;  4XZC A;  2C5J A;  3ZJ1 A;  2LOP A;  2KWI B;  5HAX A;  2JQH A;  3VKH A;  1MMN A;  2XQ8 A;  3PUZ F;  4FJO A;  2HH7 A;  2LSG A;  2WDQ A;  4MLK A;  5FVL A;  4UIG A;  4TWH A;  3UUM A;  3FZF B;  1Y01 A;  2V8S V;  2X9Y A;  4MFR A;  3JAD A;  3M65 A;  2LRL A;  3QC9 A;  2KXP B;  4UVB B;  3C4Z A;  3B57 A;  4JI4 T;  2KT9 A;  2LEH A;  2WM9 A;  2RP4 A;  2W4X A;  4B3S T;  3AA0 B;  2IML A;  4GYS A;  4OX9 T;  2VKH A;  4P0A A;  4GKK T;  2IC6 A;  2QA7 A;  4FI5 A;  3RC8 A;  4U74 A;  3CVR A;  2LT3 A;  2YDQ A;  2CA5 A;  2HPJ A;  4L9I A;  4DV0 T;  1YD8 G;  3PTR B;  4I43 B;  5C3J A;  2H7V C;  2XTL A;  3UUL A;  3PUX F;  2C5K T;  3P7I A;  4EOZ B;  4B3M T;  4LF5 T;  4P0B A;  2V7J A;  1CHU A;  4IHJ E;  5KX5 E;  4AQF C;  3M1C A;  2XPK A;  4HTE A;  5JR9 C;  3AE4 A;  2HHH T;  5J2U E;  3SS1 A;  2QVA A;  2XQ4 A;  3AEA A;  5CJ5 A;  4PW8 A;  2B76 A;  2CLY C;  2IHR 1;  2LM2 A;  4QH5 A;  1IZN B;  4HFH A;  1W0A A;  3ZCI A;  3UFE A;  4EV6 A;  2FBW A;  3SFE A;  4DBQ A;  3JCF A;  3LDQ B;  2LM9 A;  3HKB E;  3ETV A;  3MK7 C;  2JQQ A;  3LBX B;  5HWY A;  2LJL A;  4DR6 T;  4ASK A;  2WS3 A;  2CM0 A;  3MXZ A;  4UVA B;  4WW0 A;  1L0V A;  4IE5 A;  2WU5 A;  2X9W A;  3N9L A;  4PJM A;  4ZI3 C;  3ZMU B;  2L7N A;  2XQY A;  1WCR A;  4IIJ E;  2XAH B;  1KNZ A;  4DR7 T;  4JI1 T;  3PDY A;  5ABF A;  4O2A E;  5LNK A;  4CXW A;  5L47 A;  2BS3 A;  4QXC B;  3AED A;  5JDF A;  1VCS A;  2VQE T;  3N2G E;  2K48 A;  2L9Q A;  4DR2 T;  2VKD A;  3K8P C;  5CA1 E;  2YU1 A;  5ABE A;  1NWM X;  2M67 A;  1YQ4 A;  2X9X A;  4LMJ A;  2I0M A;  4ANJ A;  2V6Y A;  1XDO A;  4U33 A;  2DI4 A;  2MTQ A;  2UXN B;  1EZ3 A;  3AAI A;  3ZMT B;  4BJN A;  5KMG P;  1SE7 A;  3C50 A;  2BG9 B;  1SJ7 A;  3A7M A;  3RPU A;  4YT0 A;  3KBU A;  3HR0 A;  1HNW T;  2M6I A;  4KHP T;  3P4Q A;  4OFZ A;  2XAJ B;  3EUH A;  2HN1 A;  4YXD A;  5JDM A;  4HFD A;  4EZ4 A;  3H37 A;  3PHF 1;  4JEU B;  1UGO A;  4IDN A;  5H6R B;  4OYK A;  2J47 A;  2QRX A;  4QX8 B;  2H89 A;  3F31 A;  2WMN A;  2YEV C;  5HEH A;  3TLW A;  1YW0 A;  1SJ8 A;  3CX8 B;  4ILC A;  2BKN A;  3HKC E;  3SOL A;  2PG8 A;  3IHR A;  1D0X A;  1LRZ A;  3AE7 A;  1E1H B;  3F57 A;  3TLT A;  2WDR A;  1QLB A;  2V7I A;  1ZV4 X;  3MZK B;  4ZS2 A;  3RRC A;  2VVN A;  1E2A A;  2V26 A;  4N78 D;  2XQ3 A;  3ZYM A;  3UQ7 A;  3WAJ A;  5LHH B;  4CI1 B;  1MMG A;  1YKE B;  3LK4 2;  3RC3 A;  1JNR A;  2YDS A;  3HKD E;  5HEO A;  3AE9 A;  3OYZ A;  3J7Y q;  4AKI A;  2DNX A;  3K3N A;  4OYJ A;  5TAO A;  3ZMS B;  2N1G A;  4UVC B;  4TV9 E;  5EK3 A;  2LRK A;  1HFA A;  2IAK A;  1FMW A;  3IBP A;  4A56 A;  5AQL B;  5HEJ A;  4EXT A;  4YHJ A;  4ECG A;  4ILB A;  2UU9 T;  5JR9 A;  3RYI E;  2X9H A;  5CB4 E;  2VAS A;  4X62 T;  1LKX A;  3C4X A;  2EHO B;  3L8R A;  2KSR A;  4ZOL E;  5LBQ B;  1X79 A;  1BR1 A;  4KUM B;  4CN1 A;  2BG9 A;  2XHE B;  4ZXL A;  5FMN A;  4CN6 A;  5T1D A;  1KNR A;  5FXZ A;  2QYW A;  2JMK A;  4DR1 T;  5L3D B;  4B3R T;  4NPP A;  4LF4 T;  5L3G B;  1E7P A;  3KIN B;  2WY2 A;  3N5L A;  4G2A A;  2EHO A;  4LML A;  1UX4 A;  1IJ6 A;  3AXJ A;  3H3A A;  4P1N A;  5AQQ B;  2W61 A;  3PF0 A;  3ESL A;  2V1D B;  2RPA A;  1U5P A;  3PUA A;  2JRK A;  4HKA A;  4Z91 A;  5IYZ E;  5LP6 E;  3LK2 B;  2NTX A;  1M7K A;  2X0L B;  2XQA A;  3RYC E;  2J62 A;  5JDQ A;  3LSV A;  3RKG A;  3MKD A;  2KIN B;  1W09 A;  3ZEF B;  3EHZ A;  2FJD A;  4HEA A;  3PJA A;  2I59 A;  3CIR A;  3K1S A;  3W15 B;  4EZH A;  2NP9 A;  2NWB A;  3AEE A;  4HGA A;  4KI0 F;  2WQY A;  1HR0 T;  1KF6 A;  5AQU B;  4DV5 T;  4QH4 A;  3VU7 H;  1J5E T;  4NXM T;  3ZST A;  2WMO A;  1KK7 A;  1S35 A;  2JPF A;  2KLQ A;  2XJ7 A;  1VCT A;  3T8O A;  1N34 T;  3VKG A;  3AEB A;  1IBM T;  4AKR B;  2E2A A;  4COF A;  2E5V A;  3RIA A;  2C0S A;  3L3P A;  4HN9 A;  3N9Q A;  4LF7 T;  3UU3 A;  4A98 A;  4XBF B;  2W67 A;  3KVA A;  3P50 A;  5JRE A;  1XNQ T;  3P4S A;  1AJ3 A;  3AY5 A;  2WB5 A;  2P9B A;  3IA3 A;  3ZN1 B;  2XQ5 A;  3Q9D A;  1XZY A;  3C64 A;  2FUP A;  2BG9 C;  3QOF A;  3TLS A;  2A3D A;  3RYH E;  4XAX B;  3OTO T;  2UXC T;  3FBL A;  2MBG A;  4F8H A;  2ZM2 A;  5GON E;  3RI5 A;  3RQU A;  4TN7 B;  5ABH A;  2LOS A;  2MAW A;  2IW5 B;  2E9X C;  3O1H A;  2KMF A;  3RH3 A;  1HS7 A;  5FZT A;  4PJN A;  4CI2 B;  3IF8 B;  4GK5 E;  3CML A;  2WDV A;  2BBH A;  3JC6 D;  1UX5 A;  1ZKE A;  3E22 E;  1OXZ A;  3U3I A;  4A97 A;  4JI3 T;  1T8B A;  3Q5W A;  5LXT E;  2UUB T;  2D2S A;  3BQK A;  4MHC A;  4YTN A;  3EDU A;  4ZI7 E;  4JYA T;  4ZI3 D;  5JDL A;  5L3B B;  3DP7 A;  3RIU A;  1M62 A;  2GK9 A;  4G63 A;  1FJG T;  2ES0 A;  3PUV F;  4HWH A;  5ABG A;  2DLR A;  4IST A;  4GOU A;  4YTM A;  1HG5 A;  1US7 B;  2CBJ A;  3O1I A;  1Y64 B;  3AE1 A;  2DCF A;  4AKH A;  3H3M A;  4PJJ A;  2CHO A;  4UF0 B;  4ONR A;  1OWA A;  3N9M A;  3ZMZ B;  2UXD T;  4IL4 A;  4QH1 A;  2H88 A;  1HNZ T;  5JVD E;  4HWC A;  5LHI B;  5LGT B;  3ZC0 A;  2ACX A;  4LFB T;  5FY7 A;  2G0U A;  4C91 A;  3ANW A;  2UXB T;  5L4H A;  1GQE A;  2KZ7 B;  2XUE A;  4CI3 B;  4H9P C;  4HE8 A;  2Y48 B;  5LA6 E;  3F2E A;  3ZYK A;  4DR5 T;  4O4L E;  3I9Y A;  3EAB A;  4MAL A;  1HG2 A;  2X0H A;  2E9X A;  3UU5 A;  5FXX A;  3ZPO A;  5JH7 E;  2VKO A;  3NWI A;  5JRC B;  3IEE A;  1W9R A;  5AQJ B;  3CQC B;  2KBB A;  2IDO B;  4PNI A;  1BR0 A;  4GK0 E;  1ZP0 A;  1YXR A;  4HFB A;  4DR4 T;  2DWG A;  3N2O A;  2PTF A;  1YQ3 A;  3LJC A;  3ZT6 A;  2CRB A;  3P4R A;  3PUY F;  5FY1 A;  5E0O A;  2PBI A;  1VOM A;  2D5U A;  3CX7 B;  3OKQ A;  3P4P A;  5HEG A;  3JAF A;  5LG4 A;  3PUQ A;  5AQP B;  2VB6 A;  3DJB A;  4WBO A;  1NEN A;  3O1J A;  4QHO A;  3VJZ A;  3AVS A;  3UU8 A;  5AQN B;  4NIQ A;  2VVS A;  2XAG B;  4IRE A;  5HEU A;  2M6B A;  4JV5 T;  4LFA T;  2V7K A;  3ZC1 A;  2ZM6 T;  3VR9 A;  5AQM B;  2LLY A;  3BQI A;  3KV6 A;  3MJX A;  4IDP A;  1WYB A;  3FZH B;  4ZHQ E;  2VK9 A;  2DL1 A;  4QXB B;  3SWH A;  2V5C A;  2BVL A;  4P09 A;  3V5U A;  4ZZC A;  3MAC A;  1XMQ T;  2LSJ A;  3ANW B;  4PAG A;  1HCI A;  1IBK T;  4X1Y E;  4H9R C;  4JEH B;  3UU4 A;  5LMN T;  2X68 A;  3X1D A;  3HA4 A;  4B3T T;  2DWK A;  3FHN A;  1MNE A;  4GYR A;  2Q9Q D;  3Q2M A;  4UF0 A;  5AQR B;  4AXP A;  5DJQ C;  3I0O A;  5CGM A;  3LK3 B;  5DAB A;  2W66 A;  5JR9 B;  4CXY A;  4O4J E;  4U72 A;  1SHZ C;  2V7L A;  3ZKR A;  4EB6 E;  1MMA A;  1ZEE A;  2LSI A;  2YN6 A;  3PUS A;  3Q5X A;  1MIV A;  3FB2 A;  3SRZ A;  2VQF T;  2A2F X;  4UEM A;  4IT4 A;  4H63 H;  5FP3 A;  2LHR A;  4IE0 A;  2J4G A;  4EGW A;  3AE5 A;  3EVY A;  2XAS B;  3LFM A;  4IDQ A;  3PE0 A;  4WNK A;  3ZLI A;  4DV1 T;  2ZLY A;  2MYS A;  2JMH A;  3AEG A;  5EK2 A;  2LKH A;  1WFD A;  5AQS B;  2KND A;  1QSD A;  3ONJ A;  3NVO A;  4ILU A;  2L10 A;  4DV4 T;  4IDO A;  4I0U A;  3RX6 A;  4CN4 A;  4U31 A;  1R8I A;  4KX6 A;  4U2Y A;  4JI2 T;  4J2C A;  4BA9 A;  5BR8 T;  4IL9 A;  1YKH B;  3L39 A;  1DU2 A;  2CCQ A;  3FZK B;  1D0Y A;  5JDG A;  3RQW A;  1N33 T;  2H7O A;  3C4W A;  3HKE E;  5J2T E;  3N9P A;  3A5X A;  4YSZ A;  3NBX X;  4LF8 T;  4GKJ T;  1S94 A;  3ABV A;  5JDH A;  1J5W A;  5ETW A;  1D1C A;  4ILA A;  3OPC A;  2WZH A;  5HXH A;  3VRA A;  2Q9Q A;  4HFI A;  1BR4 A;  4GIW A;  2JIW A;  4KHZ F;  2BKO A;  5AQT B;  4YJ2 E;  2K9A A;  2J1D G;  2CWY A;  2K24 A;  4I4T E;  2BKP A;  2MPK A;  5IHY A;  3UUX B;  3SFD A;  4YHH T;  2ZM0 A;  2UUA T;  4F7G B;  2BDE A;  2PFV A;  3I9W A;  1KFY A;  5L2L A;  4IE7 A;  2BG9 E;  3AE8 A;  5JQG E;  4F6R C;  5EK4 A;  4X20 E;  1NEK A;  3AXJ B;  2CXL A;  4X65 T;  1VRB A;  5HCJ A;  4JUY A;  1MIY A;  4DMV A;  4YJ3 E;  4HWD A;  4PJL A;  4LF9 T;  3ZT5 A;  3G06 A;  3VRB A;  2N9D A;  3I0Q A;  1ZHC A;  2W62 A;  4UXN B;  1ZOY A;  3AE2 A;  4ZS3 A;  4E7Z A;  2A72 A;  3GMI A;  3J9X 1;  3Q5E A;  1X9B A;  2JQ9 A;  4PK4 A;  2NW9 A;  4Q25 A;  2W2U A;  1JNZ A;  2X66 A;  3NRY A;  4EYY R;  2VUR A;  5JDN A;  3O4X E;  4TUY E;  3FZM B;  4IGU A;  4WYV A;  4JI5 T;  2IIU A;  2YKS A;  5LMU T;  3K3O A;  3PU8 A;  3AAE B;  3ZCJ A;  4AKG A;  2ZMA A;  1OED B;  4YLH A;  3UQ4 A;  2WCA A;  2NOX A;  5C2T A;  3HI2 A;  4YSY A;  5AQV B;  4JI8 T;  2N2N A;  3AE3 A;  3QB5 A;  2A9U A;  2L3L A;  5L3C B;  3K3Q C;  3U78 A;  5J0Z A;  2FJA A;  2IUB A;  2PJQ A;  4OHF A;  4X1K E;  3RHW A;  4AQY T;  3E0Z A;  1IJ5 A;  4L0R A;  2V5D A;  1Z0P A;  3CKD A;  2V7M A;  3AA6 B;  4Z8X A;  1MMD A;  4OK0 A;  2XM2 A;  5LB7 B;  2I6H A;  2VL8 A;  4ISS A;  5FXW A;  5HWX A;  4H9S E;  5LHG B;  5AQO B;  4JBW F;  4EEB A;  3RKO A;  2AE9 A;  4O4H E;  2JJ9 A;  4LFC T;  2E5L T;  1G8X A;  2F4V T;  1WRD A;  4H63 V;  3CK6 A;  3NKZ A;  5CA0 E;  3ZSS A;  4QXH B;  5C8Y E;  2YK0 A;  5LYJ E;  2LE8 A;  4ZEY A;  2CEA A;  4IDZ A;  4I50 E;  3DYJ A;  5LGN B;  4O8S A;  4WZX A;  5LG3 A;  4M1P A;  3AA1 B;  1HX8 A;  5LGU B;  1SA0 E;  2Y8D A;  3ZT7 A;  1I6Z A;  2KGX A;  4PFO A;  4BGO A;  2CXF A;  4UR9 A;  3LG7 A;  1UUR A;  3CPZ A;  2UXX B;  2NW8 A;  4QX7 B;  3OBV E;  5F8P A;  1O3X A;  5FYM A;  5HXE A;  2Q9Q C;  1I94 T;  1HTJ F;  3O9X A;  4UV9 B;  2RA1 A;  3C51 A;  3BK9 A;  3QB5 K;  1XMO T;  4E7S A;  1LVF A;  2ACZ A;  3KVB A;  4MBQ A;  4ZZB A;  4DV7 T;  2YU2 A;  5FNV E;  2UUC T;  2XQ9 A;  4I55 E;  3T1H T;  4L5G A;  3PUG A;  3BQL A;  4U7Y A;  3TKL B;  2XY8 B;  3QNU A;  3KV9 A;  3RIF A;  2XAF B;  3Q5D A;  2LKG A;  3OYX A;  1H7C A;  3ZJ2 A;  4DR3 T;  3NRX A;  4PK6 A;  4EIW A;  2YOE A;  2VWA A;  1D1A A;  5AQH B;  2XQ6 A;  3LBX A;  5EZY E;  3R84 B;  2BS2 A;  3KV4 A;  1UK5 A;  3CQG B;  1WYC A;  2YIN A;  5HCM A;  1FMV A;  3S4U A;  2QGS A;  3DTO A;  4H9Q C;  2VKJ A;  3FBZ A;  5LOV E;  2WU2 A;  2NR4 A;  3D0T A;  4AIS A;  2BBJ A;  4AQG A;  4K0K T;  1XDP A;  2E9X B;  3GN5 A;  2VL0 A;  2W63 A;  3N9O A;  3B5M A;  5JRC A;  3KBT A;  3FYQ A;  3CX6 B;  1WR0 A;  4H9N C;  3NZQ A;  4ADZ A;  4HFE A;  3VR8 A;  1FIO A;  4YSX A;  5F3J A;  5FY0 A;  5HYA A;  3T1Y T;  2DHR A;  2X51 A;  3GWH A;  2EHO D;  5F5W A;  4K0U A;  5AQF B;  2CBI A;  1T98 A;  3UFG A;  3EDV A;  2V6Y B;  3JC6 C;  3AVR A;  2ODU A;  2R6G F;  4UEL A;  5JTG A;  1Z8U A;  2K5B B;  2WZI A;  2X67 A;  3TLU A;  3UUB A;  2WBL A;  4ZI2 D; 
#chains in the Genus database with same CATH homology
 4DND A;  4IE4 A;  2Y6X A;  4ZI2 C;  2IC9 A;  3UTK A;  5L3E B;  3CQX C;  3R6N A;  4QWN B;  2WWU A;  5HXS A;  5A1L A;  1NAF A;  3OJA A;  4UV8 B;  5J1G A;  3RRW A;  1QUU A;  1UCU A;  5LBM A;  3WAK A;  3ZMV B;  5ADX L;  1WR6 A;  2HPL A;  2Q9Q B;  2W00 A;  2LSY A;  5HXC A;  4AQF A;  4IE6 A;  1WLX A;  4CQI A;  2KWH A;  4C90 A;  4WBN E;  1B7T A;  1D1B A;  4O4I E;  4EYU A;  4NUU A;  2XAQ B;  1U4Q A;  2E9X D;  2Z6E A;  3KV5 A;  4BAY B;  2CXD A;  3AA7 B;  3FXD B;  4EAH A;  5KDM C;  1IAP A;  5M4Y A;  2BVM A;  3L09 A;  4O2B E;  3WUR A;  2LHN A;  1MIW A;  2ZM8 A;  3AT7 A;  4KMC A;  2SPC A;  2CMR A;  4KP3 C;  4B6X A;  4TV8 E;  3WSC A;  5DQV A;  2D0T A;  5FXV A;  3HL6 A;  3ONX A;  2WAU A;  4V1A v;  3UT5 E;  5LJM A;  2B1E A;  3NZP A;  3FXE B;  1MND A;  3UUN A;  2ODV A;  3CWZ B;  2NTY A;  3QUJ A;  1HF8 A;  5LJN A;  4AI6 A;  3MA9 A;  2WSS V;  3QK6 A;  3KDS E;  2CLY B;  4X1I E;  2C5I T;  3ZYL A;  4AKL A;  4DBR A;  3GA8 A;  3VHL A;  1V9D A;  2MOZ A;  2BZB A;  4CZZ B;  5L3F B;  3GN5 B;  3E08 A;  4QKN A;  4BJM A;  3RYF E;  2OA5 A;  3I1A A;  4PFP A;  3PU3 A;  3N2K E;  3P8C D;  3N9N A;  4ERR A;  2LQU A;  3WI3 A;  2D0U A;  4TZ4 C;  2E8I A;  2CWO A;  4H9O C;  2NW7 A;  4TX5 A;  5HXR A;  1FEW A;  3ZN0 B;  4KBM B;  1D0Z A;  1G73 A;  2LSK A;  3AAA B;  5LCY A;  2MTC A;  4DMW A;  3KFW X;  3B13 A;  3ETU A;  3AB3 B;  4HFV A;  3PUR A;  5DQW A;  4NUV A;  4DO0 A;  3V5S A;  4DVD A;  1BR2 A;  5AFU L;  3C98 B;  1CUN A;  2CE7 A;  4JLE A;  2L8K A;  2H3R A;  4YFS A;  1LVK A;  5JH7 E;  4PK5 A;  4CXX A;  2EHO C;  4E7S A;  5JDL A;  2W0G A;  5H6Q B;  4XZC A;  2C5J A;  3ZJ1 A;  2LOP A;  2KWI B;  5HAX A;  1MMN A;  4FJO A;  2HH7 A;  2LSG A;  4MLK A;  4UIG A;  3UUM A;  2X9Y A;  4MFR A;  3M65 A;  3QC9 A;  2KXP B;  4UVB B;  3C4Z A;  3B57 A;  2KT9 A;  2LEH A;  2WM9 A;  2RP4 A;  3AA0 B;  4GYS A;  2VKH A;  4P0A A;  2IC6 A;  2QA7 A;  4FI5 A;  3RC8 A;  4U74 A;  3CVR A;  2LT3 A;  2CA5 A;  2HPJ A;  4L9I A;  1YD8 G;  3PTR B;  4I43 B;  2H7V C;  2XTL A;  3UUL A;  2C5K T;  3P7I A;  4EOZ B;  4P0B A;  2V7J A;  4IHJ E;  5KX5 E;  4AQF C;  3M1C A;  4HTE A;  5JR9 C;  5J2U E;  3SS1 A;  4PW8 A;  2CLY C;  1IZN B;  3ZCI A;  3UFE A;  2LM9 A;  3HKB E;  3ETV A;  3MK7 C;  2JQQ A;  3LBX B;  5HWY A;  2LJL A;  4ASK A;  2CM0 A;  3MXZ A;  4UVA B;  4WW0 A;  4IE5 A;  2X9W A;  3N9L A;  4PJM A;  4ZI3 C;  3ZMU B;  2XQY A;  4IIJ E;  2XAH B;  1KNZ A;  3PDY A;  4O2A E;  5LNK A;  4CXW A;  4QXC B;  5JDF A;  3N2G E;  2K48 A;  2L9Q A;  2VKD A;  3K8P C;  5CA1 E;  2YU1 A;  1NWM X;  2M67 A;  2X9X A;  4ANJ A;  2DI4 A;  2MTQ A;  2UXN B;  1EZ3 A;  3AAI A;  3ZMT B;  4BJN A;  5KMG P;  3C50 A;  3RPU A;  3KBU A;  3HR0 A;  4OFZ A;  5JDM A;  2XAJ B;  3EUH A;  4EZ4 A;  3H37 A;  3PHF 1;  4JEU B;  5H6R B;  4OYK A;  4QX8 B;  3F31 A;  2WMN A;  2YEV C;  1YW0 A;  3CX8 B;  3HKC E;  3SOL A;  2PG8 A;  3IHR A;  1D0X A;  1LRZ A;  3F57 A;  1E1H B;  2V7I A;  1ZV4 X;  3MZK B;  4ZS2 A;  3RRC A;  4N78 D;  2V26 A;  3ZYM A;  3WAJ A;  5LHH B;  4CI1 B;  1MMG A;  1YKE B;  3LK4 2;  3RC3 A;  3J7Y q;  3HKD E;  4AKI A;  3OYZ A;  2DNX A;  3K3N A;  4OYJ A;  5TAO A;  3ZMS B;  2N1G A;  4UVC B;  4TV9 E;  5EK3 A;  4A56 A;  1HFA A;  2IAK A;  1FMW A;  3IBP A;  4DBQ A;  4EXT A;  4YHJ A;  4ECG A;  5JR9 A;  3RYI E;  2X9H A;  5CB4 E;  2VAS A;  1LKX A;  3C4X A;  2EHO B;  4ZOL E;  5LBQ B;  5BMV E;  1X79 A;  1BR1 A;  4KUM B;  5T1D A;  2XHE B;  5FMN A;  5FXZ A;  2JMK A;  5L3D B;  5L3G B;  3KIN B;  3N5L A;  4G2A A;  2EHO A;  1UX4 A;  1IJ6 A;  3H3A A;  3PF0 A;  2W61 A;  3ESL A;  2V1D B;  3PUA A;  1U5P A;  4HKA A;  2JRK A;  5IYZ E;  5LP6 E;  3LK2 B;  2NTX A;  2X0L B;  3RYC E;  5JDQ A;  3MKD A;  2KIN B;  3ZEF B;  4HEA A;  2I59 A;  3W15 B;  4EZH A;  2NP9 A;  2NWB A;  4HGA A;  3VU7 H;  2WMO A;  1KK7 A;  1S35 A;  2JPF A;  2KLQ A;  3T8O A;  3VKG A;  4AKR B;  2C0S A;  3L3P A;  4HN9 A;  3N9Q A;  4XBF B;  1AJ3 A;  3KVA A;  5JRE A;  3ZN1 B;  2P9B A;  3Q9D A;  3C64 A;  2A3D A;  3RYH E;  4XAX B;  3FBL A;  2MBG A;  2ZM2 A;  5GON E;  4TN7 B;  2LOS A;  2IW5 B;  2E9X C;  3O1H A;  2KMF A;  3RH3 A;  1HS7 A;  4PJN A;  4CI2 B;  3IF8 B;  4GK5 E;  3CML A;  3JC6 D;  1UX5 A;  1ZKE A;  3E22 E;  1OXZ A;  3U3I A;  5LXT E;  3Q5W A;  2D2S A;  3BQK A;  4MHC A;  4ZI7 E;  3EDU A;  4ZI3 D;  5L3B B;  3DP7 A;  2GK9 A;  4G63 A;  2ES0 A;  2DLR A;  4IST A;  4GOU A;  1HG5 A;  1US7 B;  3O1I A;  1Y64 B;  2DCF A;  4AKH A;  4UF0 B;  4PJJ A;  4ONR A;  1OWA A;  3N9M A;  3ZMZ B;  5JVD E;  5LGT B;  5LHI B;  3ZC0 A;  2ACX A;  5FY7 A;  2G0U A;  4C91 A;  3ANW A;  2KZ7 B;  2XUE A;  4CI3 B;  4H9P C;  4HE8 A;  2Y48 B;  5LA6 E;  3F2E A;  3ZYK A;  4O4L E;  3I9Y A;  4MAL A;  3VKH A;  1HG2 A;  2E9X A;  5JRC B;  5FXX A;  3ZPO A;  2VKO A;  3IEE A;  3CQC B;  4PNI A;  1BR0 A;  4GK0 E;  2DWG A;  3N2O A;  3LJC A;  5FY1 A;  5E0O A;  2PBI A;  1VOM A;  2D5U A;  3CX7 B;  3OKQ A;  5LG4 A;  3PUQ A;  2VB6 A;  3DJB A;  4WBO A;  3O1J A;  4QHO A;  3VJZ A;  3AVS A;  2XAG B;  2V7K A;  3ZC1 A;  3BQI A;  3KV6 A;  3MJX A;  1WYB A;  4ZHQ E;  2VK9 A;  4QXB B;  3SWH A;  2BVL A;  4P09 A;  3V5U A;  3MAC A;  2LSJ A;  3ANW B;  4PAG A;  1HCI A;  4X1Y E;  4H9R C;  4JEH B;  2X68 A;  3HA4 A;  2DWK A;  3FHN A;  1MNE A;  4GYR A;  2Q9Q D;  3Q2M A;  4UF0 A;  4AXP A;  5DJQ C;  3I0O A;  3LK3 B;  5DAB A;  5JR9 B;  4CXY A;  4O4J E;  4U72 A;  1SHZ C;  2V7L A;  4EB6 E;  1MMA A;  1ZEE A;  2LSI A;  3PUS A;  3Q5X A;  1MIV A;  3FB2 A;  3SRZ A;  2A2F X;  4UEM A;  4H63 H;  5FP3 A;  2LHR A;  4IE0 A;  3EVY A;  2XAS B;  3LFM A;  4WNK A;  3PE0 A;  3ZLI A;  2ZLY A;  2MYS A;  2JMH A;  5EK2 A;  2KND A;  1QSD A;  4ILU A;  3RX6 A;  4J2C A;  4BA9 A;  1YKH B;  2CCQ A;  1D0Y A;  5JDG A;  2H7O A;  3C4W A;  3HKE E;  5J2T E;  3N9P A;  3A5X A;  3NBX X;  1S94 A;  5JDH A;  5ETW A;  1D1C A;  5HXH A;  2Q9Q A;  1BR4 A;  4GIW A;  4YJ2 E;  2K9A A;  2J1D G;  2CWY A;  2K24 A;  4I4T E;  3UUX B;  5IHY A;  2ZM0 A;  2BDE A;  2PFV A;  3I9W A;  5L2L A;  4IE7 A;  5JQG E;  4F6R C;  5EK4 A;  4X20 E;  2CXL A;  1VRB A;  4JUY A;  1MIY A;  4DMV A;  4YJ3 E;  4PJL A;  2N9D A;  3I0Q A;  1ZHC A;  2W62 A;  4UXN B;  2WBL A;  4ZS3 A;  4E7Z A;  2A72 A;  3GMI A;  3J9X 1;  4PK4 A;  2NW9 A;  2X66 A;  3NRY A;  4EYY R;  5JDN A;  3O4X E;  4TUY E;  4IGU A;  3K3O A;  3PU8 A;  3AAE B;  3ZCJ A;  4AKG A;  2ZMA A;  4YLH A;  2NOX A;  3HI2 A;  2N2N A;  5L3C B;  2L3L A;  3K3Q C;  3U78 A;  2PJQ A;  4OHF A;  4X1K E;  3E0Z A;  1IJ5 A;  4L0R A;  1Z0P A;  3CKD A;  2V7M A;  3AA6 B;  4Z8X A;  1MMD A;  4OK0 A;  4ISS A;  2VL8 A;  5FXW A;  5HWX A;  5LHG B;  4H9S E;  3RKO A;  4O4H E;  2JJ9 A;  1G8X A;  1WRD A;  4H63 V;  5CA0 E;  4QXH B;  5C8Y E;  2YK0 A;  5LYJ E;  2LE8 A;  2CEA A;  4IDZ A;  4I50 E;  5LGN B;  4O8S A;  4M1P A;  3AA1 B;  1HX8 A;  5LGU B;  1SA0 E;  2Y8D A;  4PFO A;  4BGO A;  2CXF A;  3LG7 A;  3CPZ A;  2UXX B;  2NW8 A;  4QX7 B;  3OBV E;  5F8P A;  1O3X A;  5FYM A;  5HXE A;  2Q9Q C;  1HTJ F;  3O9X A;  4UV9 B;  2RA1 A;  3C51 A;  3BK9 A;  1LVF A;  3KVB A;  4MBQ A;  2YU2 A;  5FNV E;  4I55 E;  4L5G A;  3PUG A;  3BQL A;  3TKL B;  3KV9 A;  2XAF B;  3OYX A;  1H7C A;  3ZJ2 A;  3NRX A;  4PK6 A;  4EIW A;  2VWA A;  1D1A A;  5EZY E;  3LBX A;  3R84 B;  3KV4 A;  3CQG B;  1WYC A;  2YIN A;  1FMV A;  3S4U A;  2QGS A;  3DTO A;  4H9Q C;  3FBZ A;  2VKJ A;  5LOV E;  3D0T A;  4AQG A;  2E9X B;  3GN5 A;  2W63 A;  3N9O A;  5JRC A;  3KBT A;  3CX6 B;  4H9N C;  4ADZ A;  3NZQ A;  1FIO A;  5F3J A;  5FY0 A;  5HYA A;  2DHR A;  2X51 A;  3GWH A;  2EHO D;  1T98 A;  3EDV A;  3JC6 C;  2ODU A;  4UEL A;  2K5B B;  2X67 A;  4K0U A;  3AVR A;  4ZI2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...