5HXCA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 20 mm na+ and zero ca2+
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
304
structure length
300
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRMGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 138
structure length 300
sequence length 304
ec nomenclature
pdb deposition date 2016-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hxcA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hxcA02
3V5SA 5JDMA 5JDHA 5JDQA 5HWYA 5HWXA 5HXHA 5JDGA 5JDNA 5HXSA 5JDLA 5HXEA 5HXCA 3V5UA 5HYAA 5HXRA 5JDFA
chains in the Genus database with same CATH superfamily
3AVRA 5L3CB 2YOEA 3WI3A 5LYJE 3O1JA 5CJ5A 2LJLA 2LSIA 4AISA 5HCMA 4CN1A 2WDQA 2E9XD 5HEOA 1XZYA 3P4RA 3I9YA 4IDQA 4DBQA 3SRZA 3PUYF 4GYRA 4LF4T 2BKPA 5M4YA 1AJ3A 1ZOYA 4YTPA 5HXSA 3ZC0A 5J0ZA 2K5BB 3WAKA 3ZMVB 2VURA 1HG5A 5FY0A 4DR5T 4Q25A 3P8CD 3UULA 3DTOA 4ZI3C 3BQLA 2NW9A 5LJMA 2H88A 2KGXA 3QUJA 3O4XE 1HCIA 2V26A 5ABFA 3BQKA 4GKKT 1FMVA 2W63A 3P7IA 4IE6A 2HHHT 3CX8B 2V7IA 4HFVA 1LVKA 4B3MT 2WP9A 2DHRA 4LMKA 3CQGB 4HN9A 3RIAA 1SHZC 3VRBA 2LQUA 3FZFB 4CI3B 1E7PA 1XDPA 2XM1A 2VQET 1BR4A 4P0AA 1T72A 4DV0T 2JJ9A 2B1EA 1HNWT 3BK9A 1NAFA 5FXXA 2ZMAA 5CFBA 3ZMTB 3F57A 2MTQA 1SJ8A 1FEWA 5DQWA 2X51A 3ONJA 2DCFA 1MIYA 4PK4A 4O8SA 5FL1A 2XAHB 1HNXT 4ONRA 2H7VC 5J2UE 1UURA 2P9BA 3PHF1 2DL1A 2LHRA 4TUYE 1O3XA 2WDVA 4DBRA 1W0AA 5FMNA 4EXTA 2MTCA 3VU7H 1N36T 5JQGE 3ZYMA 4QXCB 2CMRA 1LKXA 3MACA 3LDQB 4IDOA 3IBPA 2DNXA 1Z0PA 3MKDA 2JIWA 4DV3T 1Z8UA 1LVFA 3FYQA 2BVMA 5LJNA 1FIOA 2CCQA 2MYSA 2F4VT 3N9QA 2ODVA 2X0HA 1HNZT 2XQ5A 2N1GA 1HTJF 2LLYA 3RYHE 4C90A 5LG3A 4UVCB 4OX9T 3NVOA 4DMVA 3PJAA 2ACZA 3UU8A 4PJLA 5LHGB 4QWNB 4TWDA 5IWAT 3L8RA 1J5ET 2FJEA 1R8IA 1B7TA 2E8IA 2CXLA 1G8XA 2NP9A 2VWAA 4A56A 4EYYR 1ZP0A 4W8PA 2NOXA 3AA6B 4ZI3D 2IMLA 3AE5A 1WLXA 4UEMA 5TAOA 3RYCE 3PUVF 3AE9A 4DR3T 2BBHA 3AE7A 2V7KA 2XUEA 2LOSA 3UT5E 3AECA 1OEDC 2V7MA 5C3JA 3V5UA 3PUGA 4O2BE 5E0OA 3X1DA 5F3JA 3VHLA 4JI2T 2FJAA 4AKHA 2KSRA 2CBIA 3ZN0B 2Q9QA 4IL4A 4LF9T 3C4WA 5AQVB 5AQQB 4IE4A 4WNKA 3ZMUB 4LF6T 3HKDE 3AE1A 4EZ4A 2XQ3A 3I0QA 3Q5WA 4X66T 5JDFA 5DJQC 3HKEE 2ZM6T 3HL6A 4BJNA 4O2AE 1W0BA 3AAIA 3D0TA 1OEDA 4MHCA 3UUMA 4PFOA 1D0ZA 5KXJA 5ABHA 3O9XA 4XBFB 1OEDB 1XWMA 4WBOA 3RQWA 2DLRA 2X0YA 3ZCJA 3UFGA 4NXMT 1SJ7A 2BS2A 4BA9A 5CA1E 2VK9A 3RIFA 4QX7B 3AT7A 3LG7A 3AEEA 3N5LA 3AE3A 4P1NA 2BBJA 3IA3A 2D0UA 5DQVA 2N9DA 3ZC1A 3VR8A 2WU2A 3FHNA 2V6YB 1D1AA 4QXHB 3WAJA 2XQ6A 4XAXB 2LT3A 4AQYT 1T7SA 3RKGA 2LHNA 4LF7T 5HXEA 4UIGA 4OFZA 4MALA 5AQSB 4CI2B 1BR0A 4DV6T 4TZ4C 2L3LA 4I50E 3RRWA 3ZCIA 4IIJE 2D9DA 2WZIA 3RIUC 3ZYLA 2X66A 4C91A 2E9XA 2LSJA 5FXVA 4GK5E 5FXZA 2EHOC 4PJJA 4KI0F 5AQIB 5DABA 2V7JA 3QC9A 5AQMB 4UV8B 2M6BA 2LRLA 3NRXA 4XZCA 4PK5A 3RPUA 3J9X1 1ZV4X 2YU2A 2LOPA 5J1GA 4YLHA 3AA7B 3AAEB 4U2YA 2X67A 1Y01A 5IHYA 5LOVE 3C51A 3SS1A 1XDOA 1D0XA 3RIUA 3GA8A 2VB6A 2W4XA 3VKGA 4JI4T 4I4TE 3S4UA 4UF0B 2VASA 3LK2B 3KVAA 4EV6A 2DWKA 4GOUA 2EHOB 2IW5B 2VL8A 2CWYA 2WWUA 4JI7T 2KNDA 4DR4T 3RI5A 4YY3T 4NPPA 5AQNB 4Z8XA 3V5SA 3Q9DA 3LFMA 1UK5A 3RC3A 5KDMC 2IUBA 3L39A 3CX7B 3KINB 2I0MA 4HWDA 4WW0A 1KNZA 2LM2A 3AA0B 1N34T 4X62T 1IJ5A 3LBXB 4CXXA 4DR6T 2W0GA 5FYMA 4TN7B 2G0UA 4ZEYA 4IDNA 4IE0A 3F31A 3OKQA 3UQ4A 2UXCT 1US7B 1WCRA 3P4WA 1T98A 5L47A 2LKHA 3RQUA 1V9DA 2W00A 4HEAA 4L9IA 1BR1A 2OA5A 4DO0A 5L3GB 2NTYA 4G63A 2IC6A 5LP6E 2BZBA 3C98B 2XJ7A 3RLFF 3P4SA 4KX6A 3UU5A 3K3QC 3JADA 2LRKA 4AIUA 3N9OA 2JPFA 1MNEA 3FZLB 2FJBA 4H9NC 4U3CA 3FXEB 2YN6A 4ZS3A 2WAUA 2XAFB 3SOLA 3K8PC 1XNRT 3HR0A 3ZT6A 3AY5A 3A8YC 5AQKB 3T8OA 4KP3C 4U74A 1IBKT 4PJNA 2BKOA 2KWIB 2WS3A 3RYFE 3RX6A 3I9WA 2EHOD 5BR8T 5BMVE 4DV5T 4JI0T 1LRZA 3TLVA 3O1IA 2UU9T 4EZHA 1YW0A 4Z90A 2I6HA 1WRDA 3EI0A 3C4XA 4E7SA 2FUPA 2AXDS 1CHUA 3GWHA 1KNRA 5FVKA 2ODUA 2ZLYA 3CK6A 4KMCA 3KV9A 2VKDA 3LK42 4ZS2A 3DYJA 4H9PC 2OV9A 2XY8B 1H7CA 3JC6C 4FJOA 3G06A 3RGLA 4EYUA 2LSYA 2VVSA 1OWAA 2KVPA 4DR7T 4AQFC 1XMOT 1U5PA 4X64T 4IT4A 4LFCT 4B3RT 3U78A 1JNRA 4CXWA 5LHHB 3F2EA 1FMWA 1SE7A 4ZI2C 1ZHCA 2CWOA 3UUXB 3Q5DA 2CBJA 5HXHA 2CRBA 4LF8T 1VRBA 5JRCB 2QVAA 4HKAA 2KINB 5HWXA 1HF8A 4EB6E 4ISTA 2WM9A 4IHJE 3OYXA 3TLSA 1L0VA 2B76A 5AQTB 4CQIA 3SWHA 5AQGB 5ABEA 4X1KE 2QGSA 2N2NA 1E2AA 2ACXA 2C0SA 3EHZA 3ABVA 3UUBA 5CGMA 1MMNA 4WZXA 5FXWA 3FZKB 3AEGA 2YU1A 4AI6A 2IHR1 2QA7A 1W09A 3W15B 2X9WA 2Y6XA 3M3ZB 1XNQT 3HI2A 3PF0A 5FVLA 2L8KA 5AQJB 4WBNE 2W2UA 3E0ZA 2JMHA 4H9QC 4U72A 5LBQB 1OEDE 1GQEA 3N2OA 3PTRB 1MMGA 4LF5T 3N9MA 3IHRA 2BKNA 2GK9A 1J1JA 4UELA 2X0LB 2PBIA 3KV6A 2BVLA 1WYBA 4QH1A 2JMKA 3PV0F 3ZMSB 3ZJ1A 4HFIA 5L3DB 4F7GB 4ILUA 3QK6A 2I59A 3MA9A 5FKYA 2KZ7B 3CQCB 3ZPOA 2XSAA 2K48A 4DUZT 4DV4T 4A5XA 4CN6A 1HS7A 2NR4A 4FI5A 3K3NA 2JRKA 3VR9A 4O4LE 3RKOA 4B6XA 4JBWF 1M7KA 2K24A 5JDLA 2HPLA 1IBLT 3JC6D 3ZEFB 3ZT5A 4IE7A 2XQ7A 5LNKA 2H89A 3SFDA 4UR9A 3E22E 4IL9A 4ILCA 1S35A 1KFYA 1Y64B 4MFRA 2JQQA 5LGNB 1NENA 3CKDA 3MJXA 1I6ZA 4HWCA 1HR0T 3WSCA 1G73A 4LFBT 2VQFT 4OK0A 4X20E 4ECGA 4EAHA 2KMFA 3CIRA 4ZI2D 2J62A 5JDQA 2JQHA 3U3IA 1VOMA 1IAPA 1WR0A 2A72A 3AXJB 2XASB 5EK4A 3ZSTA 2M67A 4TV8E 1N32T 4PNIA 3N2KE 5L3EB 4K0UA 5AQLB 4IDPA 4EEDA 5LGUB 2XQYA 4DUYT 3AA1B 2CXDA 4JLEA 3SFEA 3VRAA 3KV5A 1IBMT 1EZ3A 3EUHA 2UXBT 3DJBA 1MMAA 4YSXA 2UUAT 4I0UA 2VVNA 2X68A 2V6YA 3NRYA 4ISSA 3FBLA 5HEGA 1SUMB 4HFCA 5HWYA 4U7YA 2V5CA 5HEUA 1UUSA 1S94A 5ADXL 4GYSA 1J5WA 4HFHA 4F8HA 3P4PA 3ZMZB 5LHIB 4P09A 2J1DG 2MOZA 3CQXC 3PUZF 2UUBT 4UV9B 3UU3A 1DU2A 3BQIA 5L4EA 4BAYB 2ZM8A 5HXRA 2XQ8A 1SA0E 2W67A 5J2TE 1YQ3A 3EABA 5JDMA 3PUWF 1X79A 3H3AA 1M62A 5L2LA 3AVSA 4KBMB 5AQHB 3DP7A 2WSSV 3O1HA 5AQPB 3TLWA 2CLYC 2K9AA 2XQAA 3ZT7A 3PUQA 4HFDA 5HXCA 3GN5B 4ZI7E 4DR2T 4JYAT 3PE0A 4YJ2E 2VKJA 2CXFA 2H3RA 3HKCE 2KXPB 4UF0A 2WU5A 4OHFA 3K1SA 4DMWA 4TX5A 2KBBA 2QRXA 3PUAA 4U7IA 2EHOA 1QUUA 2X9HA 3Q5EA 2M6IA 5JR9C 3Q5XA 5LGTB 4TV9E 1MIWA 4OYKA 4H9RC 2PG8A 4AKLA 2JQKA 4QHOA 5LB7B 5HYAA 3RHWA 3LSVA 2CLYB 1ZEEA 3PJAJ 3ONLC 3LBXA 3ESLA 2LSKA 1N33T 2VKOA 4KUMB 2E5LT 4H9OC 3PURA 5HCJA 3UFEA 2PFVA 1D1BA 3OTOT 3PU8A 3LJCA 2NW7A 4DV2T 2BG9C 3H37A 5JR9B 2MBGA 5HAXA 3L3PA 3KVBA 4UVAB 5C8YE 2YINA 3M65A 3ZKRA 4BGOA 2CHOA 4JI3T 5EZYE 3P50A 4JV5T 3FB2A 4I43B 3QB5A 2XQ9A 4CN4A 2CA5A 1YKHB 4QX8B 4A98A 3PDYA 1E1HB 3VKHA 2CPTA 1KEYA 2YDQA 4HTEA 1X9BA 3FBZA 2BG9A 4NIQA 3MXZA 5JREA 2BG9B 3P4QA 3QB5K 5ABGA 2A9UA 4L0RA 2CHNA 1XMQT 3NZQA 2J4GA 4ZZBA 4YJ3E 5JDHA 4PJMA 3EAMA 3NKZA 5EK2A 4X1IE 2K3WA 3ETVA 4JEUB 4K0KT 5CA0E 3AE2A 5ETWA 5ABFB 1OXZA 2XAQB 3GMIA 4QKNA 1T8BA 3HKBE 1KK7A 2V8SV 2JQ9A 3AEAA 2W61A 4HGAA 4ZXLA 4EGWA 2C5JA 4HFBA 4MBQA 3EVYA 5JDGA 3M1CA 3OVUA 2IC9A 3RRCA 4COFA 2AE9A 2UUCT 4GIWA 2Y48B 4CXYA 3ZN1B 2KWHA 3CMLA 5JRCA 3R6NA 2WDRA 3TKLB 4LFAT 4EEBA 3IF8B 2C5IT 5LMUT 3AB3B 5EK3A 4GKJT 5JDNA 5H6QB 1FJGT 1NWMX 2LM9A 3JAEA 4YSYA 2V7LA 3VJZA 2XAJB 5LBMA 5FP3A 3N9PA 3OBVE 4PAGA 1WYCA 2YDRA 1UGOA 4CZZB 3RC8A 2RA1A 2A3DA 2WCAA 5F5WA 2XAGB 4AQFA 3H3MA 2L7NA 4NUVA 4NXNT 2NTXA 2LKGA 2XZEA 2LE8A 5H6RB 4UVBB 1HG2A 5AQUB 4ZHQE 5KX5E 3CVRA 2CM0A 4YHHT 4G2AA 4JI5T 4O4HE 2RPAA 2NWBA 3NZPA 4ADZA 4QH5A 3CWZB 4J2CA 4PFPA 3FZHB 4PK6A 2E5VA 3KV4A 5C2TA 2D0TA 2V5DA 1UX5A 1U4QA 3KBTA 5AQFB 5GONE 1W9RA 2C5KT 2WWVA 2L9QA 2YDSA 4DVDA 3OYZA 5LXTE 3AAAB 2ZM2A 2H7OA 1IZNB 2PJQA 4YT0A 3CPZA 4AXPA 3JCFA 3N9LA 2ES0A 2V6XA 3UU4A 2IDOB 3N2GE 4YFSA 4YHJA 2WY2A 1HX8A 5AFUL 2WBLA 2Q9QC 1D0YA 4ERRA 1WR6A 1KNPA 2UXNB 3TLUA 4CI1B 4YXDA 3AE8A 3KFWX 3C50A 2CE7A 4DV7T 2Z6EA 3PU3A 4HWHA 4L5GA 3I1AA 1YD8G 4N78D 5AQOB 3UU6A 2HH7A 1IJ6A 2W66A 2D2SA 5KMGP 4JI1T 3T1YT 3E08A 1MNDA 3ZLIA 4HFEA 1JNZA 1VCTA 1UX4A 3OJAA 3AEDA 3Q2MA 5LA6E 3ZYKA 5FZTA 5LG4A 4DR1T 2A2FX 4QXBB 2MAWA 4H63H 3A7MA 2KLQA 4ILBA 2QYWA 4JI8T 2Q9QB 3AXJA 3UUNA 1YKEB 1YXRA 3KDSE 2BS4A 4HWIB 2FBWA 5HEJA 2DI4A 3ONXA 3UQ7A 4IREA 3PUXF 4HE8A 3LK3B 2WQYA 3B57A 4TNVA 4A97A 4ZZCA 4X5TA 5FY1A 2PTFA 4YTNA 5A1LA 4P0BA 2ZM0A 2L10A 3ZJ2A 4X1YE 2V1DB 4B3ST 2XSBA 2DWGA 4U33A 3ETUA 1ZKEA 4Z91A 2HPJA 4OYJA 2E9XC 4IE5A 4ASKA 4H63V 2VKHA 5AQRB 5IUXA 3B5MA 1MMDA 4HWFA 2FJDA 4AKIA 1YQ4A 2XQ4A 3RH3A 3EDUA 4F6RC 4BJMA 2RP4A 4YTMA 1I94T 3KBUA 5CB4E 3MK7C 3B13A 4NUUA 5JH7E 3IEEA 3NWIA 3EDVA 5LMNT 4IGUA 4H9SE 2XM2A 4JI6T 1NEKA 3AEBA 3PUSA 2X9XA 2XHEB 2XTLA 4E7ZA 2MPKA 4AQGA 4TWHA 2OLTA 2HN2A 5L3FB 2W62A 3AE4A 1QSDA 2KT9A 3NBXX 4MLKA 4WYVA 2BDEA 3FZMB 1UCUA 2VL0A 4TNWA 3ZSSA 2E2AA 3J7Yq 3TLTA 4TWFA 2J47A 2LSGA 4JEHB 3GN5A 5IYZE 4DV1T 3WURA 3CX6B 4O4JE 2E9XB 3T1HT 2Q9QD 1WFDA 2SPCA 4ILAA 1VCSA 3RF1A 3JAFA 2D5UA 3L09A 3A5XA 5LCYA 4EOZB 3QNUA 3AE6A 4LMJA 1QLBA 2WMNA 4QH4A 4DIDB 4PW8A 4LMLA 2UXXB 4I55E 3I0OA 2WZHA 4UXNB 4ZOLE 4V1Av 1CUNA 2WMOA 5F8PA 3AEFA 3C64A 5L4HA 2CEAA 2XPKA 5JVDE 2BG9E 2HN1A 1D1CA 3N9NA 1BR2A 5HEHA 4KHZF 1KF6A 3K3OA 2R6GF 4B3TT 4O4IE 4U2ZA 1HFAA 5FL0A 4IDZA 4U31A 2WB5A 5FY7A 4X65T 3ANWA 5FNVE 2YKSA 4YSZA 4GK0E 3UTKA 2YK0A 3ANWB 2X9YA 3C4ZA 3FXDB 3RYIE 3R84B 4M1PA 5JR9A 4DNDA 2IAKA 5JTGA 2BS3A 3HA4A 4AKRB 3OPCA 5L3BB 4KHPT 4AKGA 4EIWA 1HX1B 2UXDT 3QOFA 1MIVA 2Y8DA 2NW8A 2YEVC 5T1DA 2X0CA 2LEHA 3MZKB 4JUYA 4ANJA 2IIUA
chains in the Genus database with same CATH topology
4TZ4C 2L3LA 4I50E 3RRWA 2JRKA 3ZCIA 3AVRA 5L3CB 3IF8B 2C5IT 4IIJE 4O4LE 3RKOA 3WI3A 4B6XA 3ZYLA 5LYJE 3O1JA 2X66A 2K24A 2LJLA 2LSIA 4C91A 5JDLA 2E9XA 2LSJA 3AB3B 5EK3A 4GK5E 5FXVA 5FXZA 5JDNA 5H6QB 1NWMX 2EHOC 2HPLA 2E9XD 2LM9A 4PJJA 3JC6D 3ZEFB 4IE7A 2V7LA 5DABA 3VJZA 5LNKA 2V7JA 2XAJB 3QC9A 5LBMA 5FP3A 3I9YA 3N9PA 4UV8B 3E22E 3OBVE 4DBQA 4PAGA 1S35A 1Y64B 3NRXA 4MFRA 1WYCA 2JQQA 4XZCA 5LGNB 3SRZA 4CZZB 3RC8A 2RA1A 3CKDA 2A3DA 4PK5A 3MJXA 4GYRA 2XAGB 4AQFA 3WSCA 5M4YA 4NUVA 3RPUA 2NTXA 1AJ3A 1G73A 3J9X1 1ZV4X 2LE8A 5HXSA 4OK0A 5H6RB 3ZC0A 4UVBB 1HG2A 4X20E 2YU2A 4ECGA 4EAHA 4ZHQE 5KX5E 2KMFA 2K5BB 2LOPA 4YLHA 5J1GA 3AA7B 3WAKA 3AAEB 4ZI2D 3CVRA 2CM0A 3ZMVB 2X67A 5JDQA 3U3IA 5IHYA 5LOVE 1HG5A 4G2AA 4O4HE 5FY0A 1VOMA 3C51A 1IAPA 3SS1A 2A72A 2NWBA 3NZPA 3P8CD 1D0XA 2XASB 5EK4A 4ADZA 2M67A 3DTOA 4TV8E 3UULA 4PNIA 3BQLA 3GA8A 4ZI3C 2VB6A 2NW9A 3CWZB 3N2KE 5LJMA 3VKGA 4J2CA 4PFPA 5L3EB 4I4TE 3S4UA 4K0UA 4UF0B 2VASA 3LK2B 3KVAA 4PK6A 3QUJA 5LGUB 3KV4A 2XQYA 3O4XE 1HCIA 2D0TA 3AA1B 2CXDA 2V26A 2DWKA 4GOUA 4JLEA 1UX5A 1U4QA 3BQKA 2EHOB 2IW5B 3KBTA 2VL8A 1FMVA 2W63A 3KV5A 3P7IA 2CWYA 4IE6A 5GONE 2C5KT 2WWUA 2L9QA 3CX8B 2V7IA 1EZ3A 3EUHA 4DVDA 2KNDA 4HFVA 3OYZA 1LVKA 3DJBA 1MMAA 5LXTE 3AAAB 2DHRA 2H7OA 2ZM2A 1IZNB 2PJQA 3CPZA 4AXPA 3CQGB 4Z8XA 3V5SA 3N9LA 4HN9A 3Q9DA 2ES0A 3LFMA 1SHZC 2X68A 3RC3A 5KDMC 2LQUA 3NRYA 4ISSA 3FBLA 3CX7B 3KINB 4CI3B 3N2GE 4WW0A 4YFSA 1BR4A 1KNZA 4P0AA 4YHJA 3AA0B 1HX8A 5HWYA 5AFUL 2WBLA 2JJ9A 1IJ5A 3LBXB 2Q9QC 2B1EA 3BK9A 1D0YA 1NAFA 4CXXA 5FXXA 4ERRA 2ZMAA 1WR6A 2UXNB 1S94A 5ADXL 4GYSA 2W0GA 3F57A 5FYMA 4TN7B 3ZMTB 2G0UA 2MTQA 4CI1B 4IE0A 3F31A 3KFWX 3ZMZB 5LHIB 1FEWA 4P09A 3OKQA 3C50A 2CE7A 1US7B 2J1DG 3CQXC 2MOZA 2Z6EA 3PU3A 4L5GA 5DQWA 1T98A 3I1AA 4UV9B 2X51A 1YD8G 4N78D 1V9DA 3BQIA 2W00A 2DCFA 1MIYA 2HH7A 4HEAA 1IJ6A 4L9IA 4BAYB 1BR1A 4PK4A 4O8SA 2ZM8A 5HXRA 2OA5A 4DO0A 2D2SA 5L3GB 2NTYA 4G63A 5KMGP 1SA0E 2IC6A 5J2TE 5LP6E 2BZBA 3C98B 2XAHB 5JDMA 4ONRA 3E08A 1MNDA 2H7VC 3ZLIA 1X79A 3H3AA 5J2UE 5L2LA 2P9BA 3PHF1 3AVSA 3K3QC 1UX4A 2LHRA 4KBMB 3OJAA 4TUYE 1O3XA 3Q2MA 5LA6E 3ZYKA 4DBRA 5FMNA 4EXTA 2MTCA 3DP7A 5LG4A 2WSSV 3VU7H 3O1HA 3N9OA 2JPFA 5JQGE 2A2FX 4QXBB 1MNEA 3ZYMA 4H9NC 2CLYC 4QXCB 3FXEB 2CMRA 2K9AA 1LKXA 3PUQA 4H63H 3MACA 5HXCA 2KLQA 4ZS3A 3IBPA 3GN5B 4ZI7E 2WAUA 2XAFB 3SOLA 2DNXA 2Q9QB 1Z0PA 3K8PC 3PE0A 4YJ2E 3UUNA 3MKDA 2VKJA 3HR0A 2CXFA 2H3RA 1YKEB 3HKCE 1LVFA 2KXPB 4UF0A 3KDSE 3T8OA 4OHFA 2BVMA 4DMWA 5LJNA 1FIOA 4KP3C 4TX5A 2CCQA 4U74A 2MYSA 3PUAA 3N9QA 4PJNA 2KWIB 2DI4A 2EHOA 2ODVA 3RYFE 3RX6A 3I9WA 3ONXA 2EHOD 1QUUA 2N1GA 1HTJF 2X9HA 5BMVE 3RYHE 5JR9C 3Q5XA 1LRZA 4C90A 5LGTB 4HE8A 4TV9E 3LK3B 1MIWA 3O1IA 4EZHA 1YW0A 1WRDA 3C4XA 3B57A 4E7SA 4OYKA 4UVCB 5FY1A 4H9RC 3GWHA 2PG8A 5A1LA 4P0BA 2ODUA 2ZLYA 2ZM0A 4KMCA 3KV9A 4AKLA 2VKDA 4DMVA 3ZJ2A 3LK42 4X1YE 4ZS2A 2V1DB 4PJLA 5LHGB 4QHOA 4QWNB 4H9PC 5HYAA 2CLYB 2DWGA 1ZEEA 3ETUA 1ZKEA 3LBXA 2HPJA 3ESLA 4OYJA 2LSKA 2E9XC 1B7TA 1H7CA 4IE5A 4ASKA 4H63V 2VKHA 2VKOA 2E8IA 3JC6C 4FJOA 2CXLA 1G8XA 2NP9A 2VWAA 4KUMB 1MMDA 4A56A 4EYYR 4AKIA 4H9OC 2NOXA 3PURA 3AA6B 4EYUA 4ZI3D 3RH3A 3EDUA 2LSYA 3UFEA 4F6RC 4BJMA 2RP4A 2PFVA 1OWAA 3KBUA 5CB4E 1WLXA 3MK7C 4UEMA 5TAOA 3RYCE 1D1BA 3B13A 4AQFC 4NUUA 5JH7E 3IEEA 3EDVA 1U5PA 3PU8A 3LJCA 4IGUA 2NW7A 4H9SE 3U78A 3H37A 3PUSA 2X9XA 4CXWA 2XHEB 5JR9B 5LHHB 2MBGA 2XTLA 4E7ZA 5HAXA 3F2EA 1FMWA 4AQGA 4ZI2C 1ZHCA 2CWOA 2V7KA 3L3PA 3KVBA 4UVAB 5C8YE 3UUXB 2XUEA 2YINA 2W62A 3M65A 2LOSA 3UT5E 5L3FB 5HXHA 1QSDA 4BGOA 1VRBA 2V7MA 2KT9A 3V5UA 5EZYE 3PUGA 3NBXX 4MLKA 5JRCB 4HKAA 2KINB 2BDEA 4O2BE 5HWXA 1UCUA 5E0OA 3FB2A 1HF8A 4I43B 5F3JA 3VHLA 4EB6E 4ISTA 2WM9A 4IHJE 3OYXA 4AKHA 3J7Yq 4CQIA 3SWHA 2LSGA 4JEHB 3GN5A 5IYZE 3ZN0B 3WURA 4X1KE 3CX6B 2QGSA 2N2NA 2Q9QA 4O4JE 2ACXA 2C0SA 2E9XB 2CA5A 2Q9QD 3C4WA 2SPCA 4IE4A 4WNKA 3ZMUB 1MMNA 1YKHB 4QX8B 2D5UA 3HKDE 5FXWA 3L09A 3PDYA 3A5XA 1E1HB 5LCYA 3VKHA 2YU1A 4EOZB 4AI6A 4EZ4A 3I0QA 3Q5WA 2WMNA 4HTEA 5JDFA 3FBZA 2QA7A 4PW8A 5DJQC 2UXXB 3HKEE 4I55E 3I0OA 3W15B 3HL6A 4UXNB 4ZOLE 4V1Av 1CUNA 3MXZA 2X9WA 2Y6XA 2WMOA 5F8PA 4BJNA 4O2AE 5JREA 3HI2A 3AAIA 3D0TA 3PF0A 4MHCA 3UUMA 3C64A 2L8KA 4L0RA 4PFOA 2CEAA 1D0ZA 5JVDE 4WBNE 3NZQA 1D1CA 3O9XA 4XBFB 3N9NA 4WBOA 3E0ZA 2DLRA 2JMHA 1BR2A 4H9QC 4YJ3E 5JDHA 4U72A 4PJMA 5LBQB 3ZCJA 3N2OA 3PTRB 1MMGA 5EK2A 3K3OA 4X1IE 3N9MA 3IHRA 3ETVA 4JEUB 5CA0E 4O4IE 1HFAA 2GK9A 5ETWA 4BA9A 5CA1E 2VK9A 4IDZA 4UELA 1OXZA 2X0LB 2PBIA 3KV6A 2XAQB 2BVLA 4QX7B 3AT7A 3GMIA 5FY7A 3LG7A 4QKNA 3HKBE 1KK7A 1WYBA 2JMKA 3ANWA 3ZMSB 5FNVE 3N5LA 3ZJ1A 2W61A 4HGAA 4GK0E 3UTKA 2YK0A 2D0UA 3ANWB 2X9YA 5L3DB 5DQVA 3C4ZA 3FXDB 2N9DA 3RYIE 4ILUA 3QK6A 2I59A 3ZC1A 2C5JA 3R84B 4M1PA 4MBQA 3EVYA 5JDGA 3M1CA 3MA9A 3FHNA 2IC9A 2KZ7B 1D1AA 3CQCB 5JR9A 3RRCA 4DNDA 2IAKA 4QXHB 3ZPOA 3WAJA 4XAXB 3HA4A 2K48A 2LT3A 4AKRB 5L3BB 4GIWA 2Y48B 4CXYA 4AKGA 4EIWA 3ZN1B 2KWHA 3CMLA 5JRCA 1MIVA 3R6NA 2Y8DA 2LHNA 2NW8A 1HS7A 4FI5A 5HXEA 2YEVC 4UIGA 4OFZA 5T1DA 4MALA 3TKLB 3K3NA 2LEHA 3MZKB 4JUYA 4CI2B 1BR0A 4ANJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5S A;  5JDM A;  5JDH A;  5JDQ A;  5HWY A;  5HWX A;  5HXH A;  5JDG A;  5JDN A;  5HXS A;  5JDL A;  5HXE A;  5HXC A;  3V5U A;  5HYA A;  5HXR A;  5JDF A; 
#chains in the Genus database with same CATH topology
 3AVR A;  5L3C B;  2YOE A;  3WI3 A;  5LYJ E;  3O1J A;  5CJ5 A;  2LJL A;  2LSI A;  4AIS A;  5HCM A;  4CN1 A;  2WDQ A;  2E9X D;  5HEO A;  1XZY A;  3P4R A;  3I9Y A;  4IDQ A;  4DBQ A;  3SRZ A;  3PUY F;  4GYR A;  4LF4 T;  2BKP A;  5M4Y A;  1AJ3 A;  1ZOY A;  4YTP A;  5HXS A;  3ZC0 A;  5J0Z A;  2K5B B;  3WAK A;  3ZMV B;  2VUR A;  1HG5 A;  5FY0 A;  4DR5 T;  4Q25 A;  3P8C D;  3UUL A;  3DTO A;  4ZI3 C;  3BQL A;  2NW9 A;  5LJM A;  2H88 A;  2KGX A;  3QUJ A;  3O4X E;  1HCI A;  2V26 A;  5ABF A;  3BQK A;  4GKK T;  1FMV A;  2W63 A;  3P7I A;  4IE6 A;  2HHH T;  3CX8 B;  2V7I A;  4HFV A;  1LVK A;  4B3M T;  2WP9 A;  2DHR A;  4LMK A;  3CQG B;  4HN9 A;  3RIA A;  1SHZ C;  3VRB A;  2LQU A;  3FZF B;  4CI3 B;  1E7P A;  1XDP A;  2XM1 A;  2VQE T;  1BR4 A;  4P0A A;  1T72 A;  4DV0 T;  2JJ9 A;  2B1E A;  1HNW T;  3BK9 A;  1NAF A;  5FXX A;  2ZMA A;  5CFB A;  3ZMT B;  3F57 A;  2MTQ A;  1SJ8 A;  1FEW A;  5DQW A;  2X51 A;  3ONJ A;  2DCF A;  1MIY A;  4PK4 A;  4O8S A;  5FL1 A;  2XAH B;  1HNX T;  4ONR A;  2H7V C;  5J2U E;  1UUR A;  2P9B A;  3PHF 1;  2DL1 A;  2LHR A;  4TUY E;  1O3X A;  2WDV A;  4DBR A;  1W0A A;  5FMN A;  4EXT A;  2MTC A;  3VU7 H;  1N36 T;  5JQG E;  3ZYM A;  4QXC B;  2CMR A;  1LKX A;  3MAC A;  3LDQ B;  4IDO A;  3IBP A;  2DNX A;  1Z0P A;  3MKD A;  2JIW A;  4DV3 T;  1Z8U A;  1LVF A;  3FYQ A;  2BVM A;  5LJN A;  1FIO A;  2CCQ A;  2MYS A;  2F4V T;  3N9Q A;  2ODV A;  2X0H A;  1HNZ T;  2XQ5 A;  2N1G A;  1HTJ F;  2LLY A;  3RYH E;  4C90 A;  5LG3 A;  4UVC B;  4OX9 T;  3NVO A;  4DMV A;  3PJA A;  2ACZ A;  3UU8 A;  4PJL A;  5LHG B;  4QWN B;  4TWD A;  5IWA T;  3L8R A;  1J5E T;  2FJE A;  1R8I A;  1B7T A;  2E8I A;  2CXL A;  1G8X A;  2NP9 A;  2VWA A;  4A56 A;  4EYY R;  1ZP0 A;  4W8P A;  2NOX A;  3AA6 B;  4ZI3 D;  2IML A;  3AE5 A;  1WLX A;  4UEM A;  5TAO A;  3RYC E;  3PUV F;  3AE9 A;  4DR3 T;  2BBH A;  3AE7 A;  2V7K A;  2XUE A;  2LOS A;  3UT5 E;  3AEC A;  1OED C;  2V7M A;  5C3J A;  3V5U A;  3PUG A;  4O2B E;  5E0O A;  3X1D A;  5F3J A;  3VHL A;  4JI2 T;  2FJA A;  4AKH A;  2KSR A;  2CBI A;  3ZN0 B;  2Q9Q A;  4IL4 A;  4LF9 T;  3C4W A;  5AQV B;  5AQQ B;  4IE4 A;  4WNK A;  3ZMU B;  4LF6 T;  3HKD E;  3AE1 A;  4EZ4 A;  2XQ3 A;  3I0Q A;  3Q5W A;  4X66 T;  5JDF A;  5DJQ C;  3HKE E;  2ZM6 T;  3HL6 A;  4BJN A;  4O2A E;  1W0B A;  3AAI A;  3D0T A;  1OED A;  4MHC A;  3UUM A;  4PFO A;  1D0Z A;  5KXJ A;  5ABH A;  3O9X A;  4XBF B;  1OED B;  1XWM A;  4WBO A;  3RQW A;  2DLR A;  2X0Y A;  3ZCJ A;  3UFG A;  4NXM T;  1SJ7 A;  2BS2 A;  4BA9 A;  5CA1 E;  2VK9 A;  3RIF A;  4QX7 B;  3AT7 A;  3LG7 A;  3AEE A;  3N5L A;  3AE3 A;  4P1N A;  2BBJ A;  3IA3 A;  2D0U A;  5DQV A;  2N9D A;  3ZC1 A;  3VR8 A;  2WU2 A;  3FHN A;  2V6Y B;  1D1A A;  4QXH B;  3WAJ A;  2XQ6 A;  4XAX B;  2LT3 A;  4AQY T;  1T7S A;  3RKG A;  2LHN A;  4LF7 T;  5HXE A;  4UIG A;  4OFZ A;  4MAL A;  5AQS B;  4CI2 B;  1BR0 A;  4DV6 T;  4TZ4 C;  2L3L A;  4I50 E;  3RRW A;  3ZCI A;  4IIJ E;  2D9D A;  2WZI A;  3RIU C;  3ZYL A;  2X66 A;  4C91 A;  2E9X A;  2LSJ A;  5FXV A;  4GK5 E;  5FXZ A;  2EHO C;  4PJJ A;  4KI0 F;  5AQI B;  5DAB A;  2V7J A;  3QC9 A;  5AQM B;  4UV8 B;  2M6B A;  2LRL A;  3NRX A;  4XZC A;  4PK5 A;  3RPU A;  3J9X 1;  1ZV4 X;  2YU2 A;  2LOP A;  5J1G A;  4YLH A;  3AA7 B;  3AAE B;  4U2Y A;  2X67 A;  1Y01 A;  5IHY A;  5LOV E;  3C51 A;  3SS1 A;  1XDO A;  1D0X A;  3RIU A;  3GA8 A;  2VB6 A;  2W4X A;  3VKG A;  4JI4 T;  4I4T E;  3S4U A;  4UF0 B;  2VAS A;  3LK2 B;  3KVA A;  4EV6 A;  2DWK A;  4GOU A;  2EHO B;  2IW5 B;  2VL8 A;  2CWY A;  2WWU A;  4JI7 T;  2KND A;  4DR4 T;  3RI5 A;  4YY3 T;  4NPP A;  5AQN B;  4Z8X A;  3V5S A;  3Q9D A;  3LFM A;  1UK5 A;  3RC3 A;  5KDM C;  2IUB A;  3L39 A;  3CX7 B;  3KIN B;  2I0M A;  4HWD A;  4WW0 A;  1KNZ A;  2LM2 A;  3AA0 B;  1N34 T;  4X62 T;  1IJ5 A;  3LBX B;  4CXX A;  4DR6 T;  2W0G A;  5FYM A;  4TN7 B;  2G0U A;  4ZEY A;  4IDN A;  4IE0 A;  3F31 A;  3OKQ A;  3UQ4 A;  2UXC T;  1US7 B;  1WCR A;  3P4W A;  1T98 A;  5L47 A;  2LKH A;  3RQU A;  1V9D A;  2W00 A;  4HEA A;  4L9I A;  1BR1 A;  2OA5 A;  4DO0 A;  5L3G B;  2NTY A;  4G63 A;  2IC6 A;  5LP6 E;  2BZB A;  3C98 B;  2XJ7 A;  3RLF F;  3P4S A;  4KX6 A;  3UU5 A;  3K3Q C;  3JAD A;  2LRK A;  4AIU A;  3N9O A;  2JPF A;  1MNE A;  3FZL B;  2FJB A;  4H9N C;  4U3C A;  3FXE B;  2YN6 A;  4ZS3 A;  2WAU A;  2XAF B;  3SOL A;  3K8P C;  1XNR T;  3HR0 A;  3ZT6 A;  3AY5 A;  3A8Y C;  5AQK B;  3T8O A;  4KP3 C;  4U74 A;  1IBK T;  4PJN A;  2BKO A;  2KWI B;  2WS3 A;  3RYF E;  3RX6 A;  3I9W A;  2EHO D;  5BR8 T;  5BMV E;  4DV5 T;  4JI0 T;  1LRZ A;  3TLV A;  3O1I A;  2UU9 T;  4EZH A;  1YW0 A;  4Z90 A;  2I6H A;  1WRD A;  3EI0 A;  3C4X A;  4E7S A;  2FUP A;  2AXD S;  1CHU A;  3GWH A;  1KNR A;  5FVK A;  2ODU A;  2ZLY A;  3CK6 A;  4KMC A;  3KV9 A;  2VKD A;  3LK4 2;  4ZS2 A;  3DYJ A;  4H9P C;  2OV9 A;  2XY8 B;  1H7C A;  3JC6 C;  4FJO A;  3G06 A;  3RGL A;  4EYU A;  2LSY A;  2VVS A;  1OWA A;  2KVP A;  4DR7 T;  4AQF C;  1XMO T;  1U5P A;  4X64 T;  4IT4 A;  4LFC T;  4B3R T;  3U78 A;  1JNR A;  4CXW A;  5LHH B;  3F2E A;  1FMW A;  1SE7 A;  4ZI2 C;  1ZHC A;  2CWO A;  3UUX B;  3Q5D A;  2CBJ A;  5HXH A;  2CRB A;  4LF8 T;  1VRB A;  5JRC B;  2QVA A;  4HKA A;  2KIN B;  5HWX A;  1HF8 A;  4EB6 E;  4IST A;  2WM9 A;  4IHJ E;  3OYX A;  3TLS A;  1L0V A;  2B76 A;  5AQT B;  4CQI A;  3SWH A;  5AQG B;  5ABE A;  4X1K E;  2QGS A;  2N2N A;  1E2A A;  2ACX A;  2C0S A;  3EHZ A;  3ABV A;  3UUB A;  5CGM A;  1MMN A;  4WZX A;  5FXW A;  3FZK B;  3AEG A;  2YU1 A;  4AI6 A;  2IHR 1;  2QA7 A;  1W09 A;  3W15 B;  2X9W A;  2Y6X A;  3M3Z B;  1XNQ T;  3HI2 A;  3PF0 A;  5FVL A;  2L8K A;  5AQJ B;  4WBN E;  2W2U A;  3E0Z A;  2JMH A;  4H9Q C;  4U72 A;  5LBQ B;  1OED E;  1GQE A;  3N2O A;  3PTR B;  1MMG A;  4LF5 T;  3N9M A;  3IHR A;  2BKN A;  2GK9 A;  1J1J A;  4UEL A;  2X0L B;  2PBI A;  3KV6 A;  2BVL A;  1WYB A;  4QH1 A;  2JMK A;  3PV0 F;  3ZMS B;  3ZJ1 A;  4HFI A;  5L3D B;  4F7G B;  4ILU A;  3QK6 A;  2I59 A;  3MA9 A;  5FKY A;  2KZ7 B;  3CQC B;  3ZPO A;  2XSA A;  2K48 A;  4DUZ T;  4DV4 T;  4A5X A;  4CN6 A;  1HS7 A;  2NR4 A;  4FI5 A;  3K3N A;  2JRK A;  3VR9 A;  4O4L E;  3RKO A;  4B6X A;  4JBW F;  1M7K A;  2K24 A;  5JDL A;  2HPL A;  1IBL T;  3JC6 D;  3ZEF B;  3ZT5 A;  4IE7 A;  2XQ7 A;  5LNK A;  2H89 A;  3SFD A;  4UR9 A;  3E22 E;  4IL9 A;  4ILC A;  1S35 A;  1KFY A;  1Y64 B;  4MFR A;  2JQQ A;  5LGN B;  1NEN A;  3CKD A;  3MJX A;  1I6Z A;  4HWC A;  1HR0 T;  3WSC A;  1G73 A;  4LFB T;  2VQF T;  4OK0 A;  4X20 E;  4ECG A;  4EAH A;  2KMF A;  3CIR A;  4ZI2 D;  2J62 A;  5JDQ A;  2JQH A;  3U3I A;  1VOM A;  1IAP A;  1WR0 A;  2A72 A;  3AXJ B;  2XAS B;  5EK4 A;  3ZST A;  2M67 A;  4TV8 E;  1N32 T;  4PNI A;  3N2K E;  5L3E B;  4K0U A;  5AQL B;  4IDP A;  4EED A;  5LGU B;  2XQY A;  4DUY T;  3AA1 B;  2CXD A;  4JLE A;  3SFE A;  3VRA A;  3KV5 A;  1IBM T;  1EZ3 A;  3EUH A;  2UXB T;  3DJB A;  1MMA A;  4YSX A;  2UUA T;  4I0U A;  2VVN A;  2X68 A;  2V6Y A;  3NRY A;  4ISS A;  3FBL A;  5HEG A;  1SUM B;  4HFC A;  5HWY A;  4U7Y A;  2V5C A;  5HEU A;  1UUS A;  1S94 A;  5ADX L;  4GYS A;  1J5W A;  4HFH A;  4F8H A;  3P4P A;  3ZMZ B;  5LHI B;  4P09 A;  2J1D G;  2MOZ A;  3CQX C;  3PUZ F;  2UUB T;  4UV9 B;  3UU3 A;  1DU2 A;  3BQI A;  5L4E A;  4BAY B;  2ZM8 A;  5HXR A;  2XQ8 A;  1SA0 E;  2W67 A;  5J2T E;  1YQ3 A;  3EAB A;  5JDM A;  3PUW F;  1X79 A;  3H3A A;  1M62 A;  5L2L A;  3AVS A;  4KBM B;  5AQH B;  3DP7 A;  2WSS V;  3O1H A;  5AQP B;  3TLW A;  2CLY C;  2K9A A;  2XQA A;  3ZT7 A;  3PUQ A;  4HFD A;  5HXC A;  3GN5 B;  4ZI7 E;  4DR2 T;  4JYA T;  3PE0 A;  4YJ2 E;  2VKJ A;  2CXF A;  2H3R A;  3HKC E;  2KXP B;  4UF0 A;  2WU5 A;  4OHF A;  3K1S A;  4DMW A;  4TX5 A;  2KBB A;  2QRX A;  3PUA A;  4U7I A;  2EHO A;  1QUU A;  2X9H A;  3Q5E A;  2M6I A;  5JR9 C;  3Q5X A;  5LGT B;  4TV9 E;  1MIW A;  4OYK A;  4H9R C;  2PG8 A;  4AKL A;  2JQK A;  4QHO A;  5LB7 B;  5HYA A;  3RHW A;  3LSV A;  2CLY B;  1ZEE A;  3PJA J;  3ONL C;  3LBX A;  3ESL A;  2LSK A;  1N33 T;  2VKO A;  4KUM B;  2E5L T;  4H9O C;  3PUR A;  5HCJ A;  3UFE A;  2PFV A;  1D1B A;  3OTO T;  3PU8 A;  3LJC A;  2NW7 A;  4DV2 T;  2BG9 C;  3H37 A;  5JR9 B;  2MBG A;  5HAX A;  3L3P A;  3KVB A;  4UVA B;  5C8Y E;  2YIN A;  3M65 A;  3ZKR A;  4BGO A;  2CHO A;  4JI3 T;  5EZY E;  3P50 A;  4JV5 T;  3FB2 A;  4I43 B;  3QB5 A;  2XQ9 A;  4CN4 A;  2CA5 A;  1YKH B;  4QX8 B;  4A98 A;  3PDY A;  1E1H B;  3VKH A;  2CPT A;  1KEY A;  2YDQ A;  4HTE A;  1X9B A;  3FBZ A;  2BG9 A;  4NIQ A;  3MXZ A;  5JRE A;  2BG9 B;  3P4Q A;  3QB5 K;  5ABG A;  2A9U A;  4L0R A;  2CHN A;  1XMQ T;  3NZQ A;  2J4G A;  4ZZB A;  4YJ3 E;  5JDH A;  4PJM A;  3EAM A;  3NKZ A;  5EK2 A;  4X1I E;  2K3W A;  3ETV A;  4JEU B;  4K0K T;  5CA0 E;  3AE2 A;  5ETW A;  5ABF B;  1OXZ A;  2XAQ B;  3GMI A;  4QKN A;  1T8B A;  3HKB E;  1KK7 A;  2V8S V;  2JQ9 A;  3AEA A;  2W61 A;  4HGA A;  4ZXL A;  4EGW A;  2C5J A;  4HFB A;  4MBQ A;  3EVY A;  5JDG A;  3M1C A;  3OVU A;  2IC9 A;  3RRC A;  4COF A;  2AE9 A;  2UUC T;  4GIW A;  2Y48 B;  4CXY A;  3ZN1 B;  2KWH A;  3CML A;  5JRC A;  3R6N A;  2WDR A;  3TKL B;  4LFA T;  4EEB A;  3IF8 B;  2C5I T;  5LMU T;  3AB3 B;  5EK3 A;  4GKJ T;  5JDN A;  5H6Q B;  1FJG T;  1NWM X;  2LM9 A;  3JAE A;  4YSY A;  2V7L A;  3VJZ A;  2XAJ B;  5LBM A;  5FP3 A;  3N9P A;  3OBV E;  4PAG A;  1WYC A;  2YDR A;  1UGO A;  4CZZ B;  3RC8 A;  2RA1 A;  2A3D A;  2WCA A;  5F5W A;  2XAG B;  4AQF A;  3H3M A;  2L7N A;  4NUV A;  4NXN T;  2NTX A;  2LKG A;  2XZE A;  2LE8 A;  5H6R B;  4UVB B;  1HG2 A;  5AQU B;  4ZHQ E;  5KX5 E;  3CVR A;  2CM0 A;  4YHH T;  4G2A A;  4JI5 T;  4O4H E;  2RPA A;  2NWB A;  3NZP A;  4ADZ A;  4QH5 A;  3CWZ B;  4J2C A;  4PFP A;  3FZH B;  4PK6 A;  2E5V A;  3KV4 A;  5C2T A;  2D0T A;  2V5D A;  1UX5 A;  1U4Q A;  3KBT A;  5AQF B;  5GON E;  1W9R A;  2C5K T;  2WWV A;  2L9Q A;  2YDS A;  4DVD A;  3OYZ A;  5LXT E;  3AAA B;  2ZM2 A;  2H7O A;  1IZN B;  2PJQ A;  4YT0 A;  3CPZ A;  4AXP A;  3JCF A;  3N9L A;  2ES0 A;  2V6X A;  3UU4 A;  2IDO B;  3N2G E;  4YFS A;  4YHJ A;  2WY2 A;  1HX8 A;  5AFU L;  2WBL A;  2Q9Q C;  1D0Y A;  4ERR A;  1WR6 A;  1KNP A;  2UXN B;  3TLU A;  4CI1 B;  4YXD A;  3AE8 A;  3KFW X;  3C50 A;  2CE7 A;  4DV7 T;  2Z6E A;  3PU3 A;  4HWH A;  4L5G A;  3I1A A;  1YD8 G;  4N78 D;  5AQO B;  3UU6 A;  2HH7 A;  1IJ6 A;  2W66 A;  2D2S A;  5KMG P;  4JI1 T;  3T1Y T;  3E08 A;  1MND A;  3ZLI A;  4HFE A;  1JNZ A;  1VCT A;  1UX4 A;  3OJA A;  3AED A;  3Q2M A;  5LA6 E;  3ZYK A;  5FZT A;  5LG4 A;  4DR1 T;  2A2F X;  4QXB B;  2MAW A;  4H63 H;  3A7M A;  2KLQ A;  4ILB A;  2QYW A;  4JI8 T;  2Q9Q B;  3AXJ A;  3UUN A;  1YKE B;  1YXR A;  3KDS E;  2BS4 A;  4HWI B;  2FBW A;  5HEJ A;  2DI4 A;  3ONX A;  3UQ7 A;  4IRE A;  3PUX F;  4HE8 A;  3LK3 B;  2WQY A;  3B57 A;  4TNV A;  4A97 A;  4ZZC A;  4X5T A;  5FY1 A;  2PTF A;  4YTN A;  5A1L A;  4P0B A;  2ZM0 A;  2L10 A;  3ZJ2 A;  4X1Y E;  2V1D B;  4B3S T;  2XSB A;  2DWG A;  4U33 A;  3ETU A;  1ZKE A;  4Z91 A;  2HPJ A;  4OYJ A;  2E9X C;  4IE5 A;  4ASK A;  4H63 V;  2VKH A;  5AQR B;  5IUX A;  3B5M A;  1MMD A;  4HWF A;  2FJD A;  4AKI A;  1YQ4 A;  2XQ4 A;  3RH3 A;  3EDU A;  4F6R C;  4BJM A;  2RP4 A;  4YTM A;  1I94 T;  3KBU A;  5CB4 E;  3MK7 C;  3B13 A;  4NUU A;  5JH7 E;  3IEE A;  3NWI A;  3EDV A;  5LMN T;  4IGU A;  4H9S E;  2XM2 A;  4JI6 T;  1NEK A;  3AEB A;  3PUS A;  2X9X A;  2XHE B;  2XTL A;  4E7Z A;  2MPK A;  4AQG A;  4TWH A;  2OLT A;  2HN2 A;  5L3F B;  2W62 A;  3AE4 A;  1QSD A;  2KT9 A;  3NBX X;  4MLK A;  4WYV A;  2BDE A;  3FZM B;  1UCU A;  2VL0 A;  4TNW A;  3ZSS A;  2E2A A;  3J7Y q;  3TLT A;  4TWF A;  2J47 A;  2LSG A;  4JEH B;  3GN5 A;  5IYZ E;  4DV1 T;  3WUR A;  3CX6 B;  4O4J E;  2E9X B;  3T1H T;  2Q9Q D;  1WFD A;  2SPC A;  4ILA A;  1VCS A;  3RF1 A;  3JAF A;  2D5U A;  3L09 A;  3A5X A;  5LCY A;  4EOZ B;  3QNU A;  3AE6 A;  4LMJ A;  1QLB A;  2WMN A;  4QH4 A;  4DID B;  4PW8 A;  4LML A;  2UXX B;  4I55 E;  3I0O A;  2WZH A;  4UXN B;  4ZOL E;  4V1A v;  1CUN A;  2WMO A;  5F8P A;  3AEF A;  3C64 A;  5L4H A;  2CEA A;  2XPK A;  5JVD E;  2BG9 E;  2HN1 A;  1D1C A;  3N9N A;  1BR2 A;  5HEH A;  4KHZ F;  1KF6 A;  3K3O A;  2R6G F;  4B3T T;  4O4I E;  4U2Z A;  1HFA A;  5FL0 A;  4IDZ A;  4U31 A;  2WB5 A;  5FY7 A;  4X65 T;  3ANW A;  5FNV E;  2YKS A;  4YSZ A;  4GK0 E;  3UTK A;  2YK0 A;  3ANW B;  2X9Y A;  3C4Z A;  3FXD B;  3RYI E;  3R84 B;  4M1P A;  5JR9 A;  4DND A;  2IAK A;  5JTG A;  2BS3 A;  3HA4 A;  4AKR B;  3OPC A;  5L3B B;  4KHP T;  4AKG A;  4EIW A;  1HX1 B;  2UXD T;  3QOF A;  1MIV A;  2Y8D A;  2NW8 A;  2YEV C;  5T1D A;  2X0C A;  2LEH A;  3MZK B;  4JUY A;  4ANJ A;  2IIU A; 
#chains in the Genus database with same CATH homology
 4TZ4 C;  2L3L A;  4I50 E;  3RRW A;  2JRK A;  3ZCI A;  3AVR A;  5L3C B;  3IF8 B;  2C5I T;  4IIJ E;  4O4L E;  3RKO A;  3WI3 A;  4B6X A;  3ZYL A;  5LYJ E;  3O1J A;  2X66 A;  2K24 A;  2LJL A;  2LSI A;  4C91 A;  5JDL A;  2E9X A;  2LSJ A;  3AB3 B;  5EK3 A;  4GK5 E;  5FXV A;  5FXZ A;  5JDN A;  5H6Q B;  1NWM X;  2EHO C;  2HPL A;  2E9X D;  2LM9 A;  4PJJ A;  3JC6 D;  3ZEF B;  4IE7 A;  2V7L A;  5DAB A;  3VJZ A;  5LNK A;  2V7J A;  2XAJ B;  3QC9 A;  5LBM A;  5FP3 A;  3I9Y A;  3N9P A;  4UV8 B;  3E22 E;  3OBV E;  4DBQ A;  4PAG A;  1S35 A;  1Y64 B;  3NRX A;  4MFR A;  1WYC A;  2JQQ A;  4XZC A;  5LGN B;  3SRZ A;  4CZZ B;  3RC8 A;  2RA1 A;  3CKD A;  2A3D A;  4PK5 A;  3MJX A;  4GYR A;  2XAG B;  4AQF A;  3WSC A;  5M4Y A;  4NUV A;  3RPU A;  2NTX A;  1AJ3 A;  1G73 A;  3J9X 1;  1ZV4 X;  2LE8 A;  5HXS A;  4OK0 A;  5H6R B;  3ZC0 A;  4UVB B;  1HG2 A;  4X20 E;  2YU2 A;  4ECG A;  4EAH A;  4ZHQ E;  5KX5 E;  2KMF A;  2K5B B;  2LOP A;  4YLH A;  5J1G A;  3AA7 B;  3WAK A;  3AAE B;  4ZI2 D;  3CVR A;  2CM0 A;  3ZMV B;  2X67 A;  5JDQ A;  3U3I A;  5IHY A;  5LOV E;  1HG5 A;  4G2A A;  4O4H E;  5FY0 A;  1VOM A;  3C51 A;  1IAP A;  3SS1 A;  2A72 A;  2NWB A;  3NZP A;  3P8C D;  1D0X A;  2XAS B;  5EK4 A;  4ADZ A;  2M67 A;  3DTO A;  4TV8 E;  3UUL A;  4PNI A;  3BQL A;  3GA8 A;  4ZI3 C;  2VB6 A;  2NW9 A;  3CWZ B;  3N2K E;  5LJM A;  3VKG A;  4J2C A;  4PFP A;  5L3E B;  4I4T E;  3S4U A;  4K0U A;  4UF0 B;  2VAS A;  3LK2 B;  3KVA A;  4PK6 A;  3QUJ A;  5LGU B;  3KV4 A;  2XQY A;  3O4X E;  1HCI A;  2D0T A;  3AA1 B;  2CXD A;  2V26 A;  2DWK A;  4GOU A;  4JLE A;  1UX5 A;  1U4Q A;  3BQK A;  2EHO B;  2IW5 B;  3KBT A;  2VL8 A;  1FMV A;  2W63 A;  3KV5 A;  3P7I A;  2CWY A;  4IE6 A;  5GON E;  2C5K T;  2WWU A;  2L9Q A;  3CX8 B;  2V7I A;  1EZ3 A;  3EUH A;  4DVD A;  2KND A;  4HFV A;  3OYZ A;  1LVK A;  3DJB A;  1MMA A;  5LXT E;  3AAA B;  2DHR A;  2H7O A;  2ZM2 A;  1IZN B;  2PJQ A;  3CPZ A;  4AXP A;  3CQG B;  4Z8X A;  3V5S A;  3N9L A;  4HN9 A;  3Q9D A;  2ES0 A;  3LFM A;  1SHZ C;  2X68 A;  3RC3 A;  5KDM C;  2LQU A;  3NRY A;  4ISS A;  3FBL A;  3CX7 B;  3KIN B;  4CI3 B;  3N2G E;  4WW0 A;  4YFS A;  1BR4 A;  1KNZ A;  4P0A A;  4YHJ A;  3AA0 B;  1HX8 A;  5HWY A;  5AFU L;  2WBL A;  2JJ9 A;  1IJ5 A;  3LBX B;  2Q9Q C;  2B1E A;  3BK9 A;  1D0Y A;  1NAF A;  4CXX A;  5FXX A;  4ERR A;  2ZMA A;  1WR6 A;  2UXN B;  1S94 A;  5ADX L;  4GYS A;  2W0G A;  3F57 A;  5FYM A;  4TN7 B;  3ZMT B;  2G0U A;  2MTQ A;  4CI1 B;  4IE0 A;  3F31 A;  3KFW X;  3ZMZ B;  5LHI B;  1FEW A;  4P09 A;  3OKQ A;  3C50 A;  2CE7 A;  1US7 B;  2J1D G;  3CQX C;  2MOZ A;  2Z6E A;  3PU3 A;  4L5G A;  5DQW A;  1T98 A;  3I1A A;  4UV9 B;  2X51 A;  1YD8 G;  4N78 D;  1V9D A;  3BQI A;  2W00 A;  2DCF A;  1MIY A;  2HH7 A;  4HEA A;  1IJ6 A;  4L9I A;  4BAY B;  1BR1 A;  4PK4 A;  4O8S A;  2ZM8 A;  5HXR A;  2OA5 A;  4DO0 A;  2D2S A;  5L3G B;  2NTY A;  4G63 A;  5KMG P;  1SA0 E;  2IC6 A;  5J2T E;  5LP6 E;  2BZB A;  3C98 B;  2XAH B;  5JDM A;  4ONR A;  3E08 A;  1MND A;  2H7V C;  3ZLI A;  1X79 A;  3H3A A;  5J2U E;  5L2L A;  2P9B A;  3PHF 1;  3AVS A;  3K3Q C;  1UX4 A;  2LHR A;  4KBM B;  3OJA A;  4TUY E;  1O3X A;  3Q2M A;  5LA6 E;  3ZYK A;  4DBR A;  5FMN A;  4EXT A;  2MTC A;  3DP7 A;  5LG4 A;  2WSS V;  3VU7 H;  3O1H A;  3N9O A;  2JPF A;  5JQG E;  2A2F X;  4QXB B;  1MNE A;  3ZYM A;  4H9N C;  2CLY C;  4QXC B;  3FXE B;  2CMR A;  2K9A A;  1LKX A;  3PUQ A;  4H63 H;  3MAC A;  5HXC A;  2KLQ A;  4ZS3 A;  3IBP A;  3GN5 B;  4ZI7 E;  2WAU A;  2XAF B;  3SOL A;  2DNX A;  2Q9Q B;  1Z0P A;  3K8P C;  3PE0 A;  4YJ2 E;  3UUN A;  3MKD A;  2VKJ A;  3HR0 A;  2CXF A;  2H3R A;  1YKE B;  3HKC E;  1LVF A;  2KXP B;  4UF0 A;  3KDS E;  3T8O A;  4OHF A;  2BVM A;  4DMW A;  5LJN A;  1FIO A;  4KP3 C;  4TX5 A;  2CCQ A;  4U74 A;  2MYS A;  3PUA A;  3N9Q A;  4PJN A;  2KWI B;  2DI4 A;  2EHO A;  2ODV A;  3RYF E;  3RX6 A;  3I9W A;  3ONX A;  2EHO D;  1QUU A;  2N1G A;  1HTJ F;  2X9H A;  5BMV E;  3RYH E;  5JR9 C;  3Q5X A;  1LRZ A;  4C90 A;  5LGT B;  4HE8 A;  4TV9 E;  3LK3 B;  1MIW A;  3O1I A;  4EZH A;  1YW0 A;  1WRD A;  3C4X A;  3B57 A;  4E7S A;  4OYK A;  4UVC B;  5FY1 A;  4H9R C;  3GWH A;  2PG8 A;  5A1L A;  4P0B A;  2ODU A;  2ZLY A;  2ZM0 A;  4KMC A;  3KV9 A;  4AKL A;  2VKD A;  4DMV A;  3ZJ2 A;  3LK4 2;  4X1Y E;  4ZS2 A;  2V1D B;  4PJL A;  5LHG B;  4QHO A;  4QWN B;  4H9P C;  5HYA A;  2CLY B;  2DWG A;  1ZEE A;  3ETU A;  1ZKE A;  3LBX A;  2HPJ A;  3ESL A;  4OYJ A;  2LSK A;  2E9X C;  1B7T A;  1H7C A;  4IE5 A;  4ASK A;  4H63 V;  2VKH A;  2VKO A;  2E8I A;  3JC6 C;  4FJO A;  2CXL A;  1G8X A;  2NP9 A;  2VWA A;  4KUM B;  1MMD A;  4A56 A;  4EYY R;  4AKI A;  4H9O C;  2NOX A;  3PUR A;  3AA6 B;  4EYU A;  4ZI3 D;  3RH3 A;  3EDU A;  2LSY A;  3UFE A;  4F6R C;  4BJM A;  2RP4 A;  2PFV A;  1OWA A;  3KBU A;  5CB4 E;  1WLX A;  3MK7 C;  4UEM A;  5TAO A;  3RYC E;  1D1B A;  3B13 A;  4AQF C;  4NUU A;  5JH7 E;  3IEE A;  3EDV A;  1U5P A;  3PU8 A;  3LJC A;  4IGU A;  2NW7 A;  4H9S E;  3U78 A;  3H37 A;  3PUS A;  2X9X A;  4CXW A;  2XHE B;  5JR9 B;  5LHH B;  2MBG A;  2XTL A;  4E7Z A;  5HAX A;  3F2E A;  1FMW A;  4AQG A;  4ZI2 C;  1ZHC A;  2CWO A;  2V7K A;  3L3P A;  3KVB A;  4UVA B;  5C8Y E;  3UUX B;  2XUE A;  2YIN A;  2W62 A;  3M65 A;  2LOS A;  3UT5 E;  5L3F B;  5HXH A;  1QSD A;  4BGO A;  1VRB A;  2V7M A;  2KT9 A;  3V5U A;  5EZY E;  3PUG A;  3NBX X;  4MLK A;  5JRC B;  4HKA A;  2KIN B;  2BDE A;  4O2B E;  5HWX A;  1UCU A;  5E0O A;  3FB2 A;  1HF8 A;  4I43 B;  5F3J A;  3VHL A;  4EB6 E;  4IST A;  2WM9 A;  4IHJ E;  3OYX A;  4AKH A;  3J7Y q;  4CQI A;  3SWH A;  2LSG A;  4JEH B;  3GN5 A;  5IYZ E;  3ZN0 B;  3WUR A;  4X1K E;  3CX6 B;  2QGS A;  2N2N A;  2Q9Q A;  4O4J E;  2ACX A;  2C0S A;  2E9X B;  2CA5 A;  2Q9Q D;  3C4W A;  2SPC A;  4IE4 A;  4WNK A;  3ZMU B;  1MMN A;  1YKH B;  4QX8 B;  2D5U A;  3HKD E;  5FXW A;  3L09 A;  3PDY A;  3A5X A;  1E1H B;  5LCY A;  3VKH A;  2YU1 A;  4EOZ B;  4AI6 A;  4EZ4 A;  3I0Q A;  3Q5W A;  2WMN A;  4HTE A;  5JDF A;  3FBZ A;  2QA7 A;  4PW8 A;  5DJQ C;  2UXX B;  3HKE E;  4I55 E;  3I0O A;  3W15 B;  3HL6 A;  4UXN B;  4ZOL E;  4V1A v;  1CUN A;  3MXZ A;  2X9W A;  2Y6X A;  2WMO A;  5F8P A;  4BJN A;  4O2A E;  5JRE A;  3HI2 A;  3AAI A;  3D0T A;  3PF0 A;  4MHC A;  3UUM A;  3C64 A;  2L8K A;  4L0R A;  4PFO A;  2CEA A;  1D0Z A;  5JVD E;  4WBN E;  3NZQ A;  1D1C A;  3O9X A;  4XBF B;  3N9N A;  4WBO A;  3E0Z A;  2DLR A;  2JMH A;  1BR2 A;  4H9Q C;  4YJ3 E;  5JDH A;  4U72 A;  4PJM A;  5LBQ B;  3ZCJ A;  3N2O A;  3PTR B;  1MMG A;  5EK2 A;  3K3O A;  4X1I E;  3N9M A;  3IHR A;  3ETV A;  4JEU B;  5CA0 E;  4O4I E;  1HFA A;  2GK9 A;  5ETW A;  4BA9 A;  5CA1 E;  2VK9 A;  4IDZ A;  4UEL A;  1OXZ A;  2X0L B;  2PBI A;  3KV6 A;  2XAQ B;  2BVL A;  4QX7 B;  3AT7 A;  3GMI A;  5FY7 A;  3LG7 A;  4QKN A;  3HKB E;  1KK7 A;  1WYB A;  2JMK A;  3ANW A;  3ZMS B;  5FNV E;  3N5L A;  3ZJ1 A;  2W61 A;  4HGA A;  4GK0 E;  3UTK A;  2YK0 A;  2D0U A;  3ANW B;  2X9Y A;  5L3D B;  5DQV A;  3C4Z A;  3FXD B;  2N9D A;  3RYI E;  4ILU A;  3QK6 A;  2I59 A;  3ZC1 A;  2C5J A;  3R84 B;  4M1P A;  4MBQ A;  3EVY A;  5JDG A;  3M1C A;  3MA9 A;  3FHN A;  2IC9 A;  2KZ7 B;  1D1A A;  3CQC B;  5JR9 A;  3RRC A;  4DND A;  2IAK A;  4QXH B;  3ZPO A;  3WAJ A;  4XAX B;  3HA4 A;  2K48 A;  2LT3 A;  4AKR B;  5L3B B;  4GIW A;  2Y48 B;  4CXY A;  4AKG A;  4EIW A;  3ZN1 B;  2KWH A;  3CML A;  5JRC A;  1MIV A;  3R6N A;  2Y8D A;  2LHN A;  2NW8 A;  1HS7 A;  4FI5 A;  5HXE A;  2YEV C;  4UIG A;  4OFZ A;  5T1D A;  4MAL A;  3TKL B;  3K3N A;  2LEH A;  3MZK B;  4JUY A;  4CI2 B;  1BR0 A;  4ANJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...