5HXCA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 20 mm na+ and zero ca2+
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
304
structure length
300
Chain Sequence
b'MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRMGGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium,calcium exchanger
molecule tags Membrane protein
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
total genus 138
structure length 300
sequence length 304
ec nomenclature
pdb deposition date 2016-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hxcA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hxcA02
3V5UA 5HYAA 5JDLA 5JDMA 3V5SA 5HXRA 5HWXA 5HXEA 5HWYA 5JDGA 5JDQA 5JDFA 5HXSA 5HXHA 5JDNA 5JDHA 5HXCA
chains in the Genus database with same CATH superfamily
4QX7B 3ZSTA 2E9XC 4H9NC 4A56A 2CHNA 5E0OA 4FI5A 5TAOA 3UFGA 1NEKA 5IYZE 1NAFA 5LCYA 4UVAB 2CBIA 3LJCA 3M65A 5LJMA 1CHUA 4B3ST 2FJAA 4PK5A 4ANJA 4DBRA 2X0LB 2CEAA 4JEHB 4J2CA 4DR4T 2LOPA 2VKJA 3O1JA 3E08A 4ZZCA 4QXBB 4HN9A 4NXNT 3N2GE 5FYMA 3I0OA 3RKOA 5L3EB 4DR2T 1KF6A 4CN4A 3N9OA 4CXWA 4B6XA 3RC8A 4DV1T 1MMGA 3L8RA 5F3JA 5FL0A 5IWAT 2CM0A 2LM2A 3VKHA 4Z90A 4F7GB 1LVKA 2MTQA 3RC3A 3C98B 4KUMB 4LMKA 2HN2A 1LKXA 2XJ7A 5F8PA 2M6IA 5HXSA 2NW8A 4ILUA 4HGAA 3SWHA 4AXPA 1SJ8A 3FZHB 1JNRA 2LRKA 5IHYA 3F2EA 4OHFA 2BVMA 2QVAA 4IGUA 5JR9B 4NXMT 3P4SA 3PUAA 3PUYF 4O4HE 2E9XB 1T8BA 4IL4A 2W00A 3LBXA 4UEMA 5HCMA 3N9MA 1N34T 4X64T 2N9DA 3AEDA 1D0XA 3AE6A 2J47A 4H63V 4JYAT 1VCSA 2PFVA 3KV6A 3J9X1 5ETWA 1N32T 3VJZA 3L39A 4A97A 2WZHA 3G06A 5J1GA 4HE8A 5F5WA 4H9RC 1XNQT 1AJ3A 4DUYT 4EB6E 5AQFB 1WYBA 1U4QA 5L3DB 2NOXA 1LVFA 2UUAT 3HKDE 3JC6D 3DP7A 3FHNA 2E5VA 2VKDA 2V7KA 3OVUA 3QUJA 4ADZA 4DO0A 4DV6T 5JRCB 4AI6A 2WU5A 2WSSV 3ZT7A 4AQYT 1OEDC 2J1DG 5JDFA 2LLYA 3A5XA 3BQKA 4AKHA 3IF8B 4EEBA 2KNDA 2PG8A 4HKAA 4TUYE 4EAHA 2E8IA 2L3LA 2L7NA 4P09A 4LFAT 2D0TA 1FIOA 2M67A 2OA5A 5LNKA 4X65T 3FZMB 1B7TA 3H3AA 4GOUA 4I50E 2CXDA 2JQKA 3CQXC 2BKNA 1HG2A 3PV0F 3SFEA 3VHLA 1HX1B 2BS2A 4C91A 2Y6XA 4QH1A 3HI2A 4U2YA 4CQIA 4A5XA 5JDGA 5LYJE 1QLBA 2BBHA 1SUMB 4QX8B 4WZXA 4AIUA 5ABHA 5LP6E 2NW9A 2JJ9A 3ANWA 1UX4A 4P0BA 1KNRA 1ZV4X 2B76A 2LHRA 2VASA 4H63H 3RX6A 1HNZT 1IBMT 5FL1A 2UUBT 4UF0B 3R6NA 3K3QC 3EDVA 2H7OA 1S35A 4P1NA 2E5LT 2CHOA 2D2SA 2YINA 3UUNA 5HEJA 3AXJB 3PU8A 4UELA 4X1YE 2NP9A 4F6RC 2A9UA 4ZI2C 2Y8DA 4ILBA 2EHOC 3U78A 3QC9A 4YXDA 2A3DA 4U3CA 4U31A 1XNRT 3UUBA 4OYJA 5AQRB 5J2UE 5HCJA 2YDQA 5FKYA 3NZPA 4KI0F 1MIWA 4MALA 4Z8XA 1UURA 3DJBA 2DWKA 3PE0A 4QXHB 4XAXB 5AQVB 5HAXA 3ZCIA 3CVRA 1E2AA 1ZOYA 3U3IA 1XWMA 3I9YA 4EZ4A 4ZI2D 3QB5A 2W2UA 1SHZC 2XHEB 4YTPA 4QHOA 4CN6A 2X9WA 1W0BA 4PK6A 3S4UA 3UT5E 1VCTA 3AE7A 2Q9QB 3AE4A 4U7YA 4O4JE 2VQET 3PUQA 5HEHA 3V5SA 2WAUA 3IHRA 4CI3B 5ABFA 1E7PA 2KVPA 5JDNA 2L9QA 2YK0A 3C4XA 3WSCA 2OLTA 4I43B 3F31A 3N2OA 4GIWA 4IT4A 3KVAA 2W67A 1D1CA 2L8KA 4H9SE 3ZMSB 4JI8T 2B1EA 2ZM8A 1WYCA 4H9OC 4IDQA 3ZPOA 2DCFA 1CUNA 4UR9A 3FBLA 4QKNA 2VVNA 2BVLA 2UXCT 3CQCB 2UXXB 4ZEYA 4PK4A 5HEUA 1L0VA 2WDVA 4WBNE 3ZYLA 3RIUA 2FBWA 2FJEA 2JPFA 2C0SA 4OFZA 1US7B 4DMWA 4YSYA 4DR3T 2Q9QD 5H6RB 5LG3A 3BK9A 3P8CD 3WAKA 3MACA 4DV3T 3NZQA 3EHZA 3H3MA 2XQ8A 2MBGA 2WCAA 1ZKEA 3NVOA 3UU4A 3RQWA 3HL6A 3UU5A 5L47A 3KV5A 4IE7A 2CXFA 2YU2A 2EHOB 3ZMTB 3PUWF 3JAEA 3MZKB 4W8PA 3FB2A 1YXRA 3WI3A 2CRBA 2IW5B 5T1DA 2BS3A 2ACXA 1YQ4A 3CQGB 4IDNA 1W09A 2PJQA 5FVLA 1Y01A 3OBVE 3HKBE 5LA6E 3RGLA 4DR5T 3ZMVB 3K8PC 1KK7A 3CPZA 3NBXX 3ZKRA 2QGSA 2XPKA 3CX7B 2LEHA 4HTEA 4P0AA 3C4WA 4LMLA 2H88A 4TWHA 4WYVA 3RIUC 3TLWA 5ABEA 5JREA 4LFCT 3ONLC 4NPPA 4XZCA 3KDSE 4HFIA 3CX6B 4ZOLE 1I94T 2HPJA 2YDRA 3FXDB 4I55E 4EXTA 4F8HA 5LGUB 2KSRA 2RA1A 4MFRA 3PF0A 4KMCA 2ZLYA 4YY3T 2VK9A 1EZ3A 5DQVA 3TLSA 2D0UA 5FXZA 2VQFT 2XQ3A 2E9XA 1VOMA 4GKKT 3L3PA 5L3GB 4OX9T 1IJ6A 3N9QA 4IHJE 4QWNB 2XTLA 3P4RA 1X79A 2C5KT 2C5IT 3ZLIA 4A98A 3PTRB 2DHRA 3ZJ1A 3W15B 4PFOA 5EK3A 5L3FB 3ANWB 5AQNB 2BG9A 2DI4A 2OV9A 4U33A 1MIYA 3QK6A 1VRBA 2XQ4A 5FMNA 5LG4A 5CGMA 2V7MA 3WURA 2XQAA 3Q5XA 4EV6A 1YKHB 3LK42 2CWOA 2X0CA 4BJMA 4DIDB 5IUXA 3ZT6A 2XY8B 3EUHA 3CK6A 2LSIA 2BKOA 1MNDA 2DL1A 3AEAA 3LK3B 2VWAA 4EEDA 3K3NA 3AY5A 2H89A 1WCRA 2IDOB 4JI0T 1UGOA 3MK7C 2WU2A 5GONE 1M62A 2LJLA 1T98A 2LM9A 4YFSA 1UUSA 2XZEA 3PJAJ 4YSZA 3H37A 3TLTA 4EIWA 4JBWF 3AAEB 4U7IA 4I4TE 1BR1A 1YW0A 2K48A 2KWHA 2NW7A 2XQ7A 2ACZA 3P7IA 4IE0A 4X1IE 4IDZA 4M1PA 2D5UA 3ZYKA 1UCUA 4IDPA 3UTKA 4DUZT 3P4PA 4KHZF 2NWBA 2VB6A 3TKLB 2UXNB 3UQ4A 1XMQT 1IBLT 1WFDA 4DMVA 2BG9C 2VVSA 4PJLA 4NUUA 1ZP0A 1NENA 3I0QA 3JADA 3RRWA 2FJBA 3AEBA 2LKHA 5CB4E 3RYIE 3FXEB 1FMVA 2YDSA 3FZFB 4TV8E 3LFMA 1M7KA 3UQ7A 3ESLA 2DLRA 2KT9A 2JQHA 3RYHE 3ZN1B 3F57A 3P4QA 3RPUA 2MAWA 4LF6T 4IE6A 4ZI7E 1Y64B 3ZN0B 2KINB 2XAQB 4WBOA 1IAPA 2K3WA 1SJ7A 3L09A 2LE8A 4HFHA 1KEYA 2BG9E 3I9WA 4L0RA 2J62A 2Y48B 4UIGA 2FJDA 2XM1A 3V5UA 4ASKA 3KINB 3AE5A 5C8YE 2NTYA 2X66A 3GN5A 3RYFE 2XQ5A 4O4LE 3RF1A 4AKLA 1BR4A 4O4IE 3RIFA 2WZIA 2CLYC 3LG7A 5AQKB 3QOFA 3UU8A 5KMGP 5LHHB 2ZM0A 5AQSB 3C50A 3OYZA 2DNXA 2V26A 4YJ2E 3O1HA 5LBMA 3K1SA 3AVRA 4V1Av 4ISTA 4EGWA 4TV9E 4NUVA 2WBLA 3JAFA 3FZKB 3O1IA 5LOVE 3B57A 1G73A 2WP9A 3OYXA 4GK0E 4X1KE 5JVDE 3SS1A 2WQYA 5CA1E 5C3JA 4UV9B 2MYSA 4JV5T 1OEDE 5FXXA 5L4HA 5M4YA 1JNZA 4TZ4C 3Q5EA 2H3RA 5LB7B 4EYYR 4GK5E 5AQLB 4ECGA 4DNDA 3QB5K 3O4XE 1MIVA 3KBUA 3A7MA 4JI1T 3KVBA 2LQUA 3RRCA 1T72A 2XSBA 4ZI3C 4PJNA 2KZ7B 1HX8A 3CWZB 3LSVA 2AXDS 2CXLA 2XAFB 1J5ET 4YTMA 2W63A 4G63A 2K24A 1XDPA 2CMRA 2WDRA 5DABA 2WWVA 3R84B 5KX5E 2QA7A 2XUEA 5LXTE 3VKGA 1D1AA 4HWIB 1R8IA 4YTNA 5LMNT 3KFWX 4COFA 3N9LA 4HFDA 3RH3A 5AQMB 3RI5A 5AQTB 2BDEA 2JMKA 2R6GF 4HWCA 3N9NA 3EVYA 3LBXB 4B3TT 2V7LA 1J1JA 2XAJB 3AE9A 2GK9A 3IA3A 3OKQA 2V1DB 2KXPB 3AE3A 2H7VC 3Q5DA 5L2LA 2V6YA 2W0GA 3FZLB 1D0YA 1IZNB 2LSGA 3KV9A 4LF8T 3ZCJA 4BAYB 4PJMA 5EZYE 2W66A 2X9HA 3LK2B 3UU3A 1W9RA 2X9YA 3AVSA 3O9XA 2XAHB 5A1LA 2I6HA 4H9PC 2KMFA 4GYRA 2VKOA 2NTXA 4HFVA 4ZS2A 2ODUA 2I59A 2YN6A 3D0TA 4TWFA 3ZMZB 3N9PA 4ZXLA 4AQGA 5LJNA 3FBZA 5JRCA 1G8XA 2LSYA 3DTOA 4IE5A 1D1BA 2XQYA 2J4GA 4IL9A 3TLVA 4C90A 4YT0A 4DR7T 1DU2A 3TLUA 2W61A 4X5TA 4HEAA 3QNUA 1HCIA 1OEDA 2VKHA 2WDQA 3PUGA 3PUSA 4I0UA 3LDQB 4PJJA 5ABFB 5EK2A 4YHJA 3BQLA 5L3BB 1FJGT 3RKGA 1UK5A 2W4XA 3MXZA 5C2TA 3AEGA 5HWYA 5CJ5A 4JI2T 5JDQA 2WMOA 2XAGB 3ZSSA 5JDLA 4TX5A 3A8YC 2LHNA 5J2TE 3PHF1 2VURA 4JEUB 4B3RT 4KX6A 4NIQA 3VR9A 3AA1B 2WB5A 5HXHA 4X20E 4X66T 3CIRA 2XM2A 5AFUL 3HKCE 4HWFA 1FMWA 2CCQA 4BA9A 5HYAA 1SE7A 4TNWA 2XASB 5LGNB 4CXXA 2V7IA 1O3XA 5HXRA 5HXEA 2XQ9A 4K0UA 3UU6A 5L3CB 4UF0A 4JI3T 4DR1T 3K3OA 1KFYA 3EI0A 4ISSA 3J7Yq 4BGOA 3AXJA 3NKZA 5HEGA 2MTCA 2M6BA 3C64A 5AQIB 3MA9A 2IUBA 3T8OA 5BMVE 4LF4T 2N2NA 2IC9A 4O2BE 5CA0E 3AT7A 4G2AA 2UXDT 4N78D 3E0ZA 4U2ZA 2LSJA 4O2AE 5JTGA 4HFEA 1ZHCA 2JQQA 3RYCE 3ZMUB 4AISA 1OXZA 5AQGB 5BR8T 4ONRA 5JR9C 2Z6EA 3NWIA 2HPLA 5HXCA 5FY1A 2V5CA 2LSKA 4CZZB 2X67A 4DR6T 2KGXA 4TWDA 3CX8B 3PJAA 2VL8A 5LGTB 2JIWA 5FVKA 3HA4A 1D0ZA 3ZC1A 4K0KT 3UULA 3PU3A 2ZM2A 4QXCB 3M1CA 3AE1A 1GQEA 4JI6T 4IIJE 4CN1A 4DV7T 4LF9T 3AE2A 3CMLA 3IBPA 2RPAA 1HS7A 1XZYA 2FUPA 1W0AA 2WS3A 3ABVA 4UXNB 4AKGA 2UXBT 1HR0T 2ZMAA 4JI4T 2CA5A 3GN5B 5LBQB 4IDOA 3SRZA 3SOLA 4DBQA 3AECA 1BR0A 4ZZBA 1S94A 3CKDA 2RP4A 1T7SA 3AA6B 5JQGE 1Z8UA 3OPCA 2YEVC 3AAAB 3KV4A 4QH5A 3VRAA 4BJNA 4MLKA 4TNVA 2CLYB 2X9XA 4O8SA 2KLQA 4YLHA 1Z0PA 2PBIA 2EHOA 1X9BA 5HWXA 2WWUA 2E9XD 3Q2MA 2ES0A 3SFDA 4ZI3D 4GKJT 4YJ3E 5LMUT 3ETVA 1NWMX 4GYSA 1BR2A 2BKPA 2JQ9A 1HFAA 5AQUB 3GMIA 2G0UA 3HR0A 4U72A 4ZS3A 2IIUA 3RLFF 4UV8B 2A72A 4YHHT 4JI7T 5AQQB 4L9IA 3VRBA 1HTJF 1YQ3A 1FEWA 2A2FX 2CPTA 5FXVA 4DVDA 1WRDA 5JDMA 4H9QC 2AE9A 2C5JA 2XQ6A 2X51A 2W62A 5FZTA 3N2KE 3B5MA 4KP3C 2N1GA 3PUVF 4AKRB 4JI5T 3IEEA 2KBBA 1MMAA 1YD8G 1ZEEA 2QRXA 3C4ZA 2MPKA 2BS4A 3HKEE 3P50A 4HWHA 4Z91A 5AQPB 4EZHA 5FY0A 3EDUA 1HNWT 2D9DA 3T1YT 3NRYA 3T1HT 2UU9T 1I6ZA 2NR4A 3EAMA 4HWDA 2P9BA 4PNIA 3AB3B 3BQIA 1WLXA 1WR6A 2HH7A 4AKIA 4CI1B 3JCFA 1OEDB 3UFEA 4EOZB 5KXJA 2HN1A 5DQWA 2VL0A 1IJ5A 1WR0A 2Q9QC 3Q9DA 4E7SA 3OTOT 1QSDA 4WNKA 3AA7B 2YOEA 5ABGA 4YSXA 3ZJ2A 2IAKA 3AE8A 3AEFA 4IE4A 4DV5T 4PFPA 1OWAA 2V6YB 4Q25A 1U5PA 4X62T 5CFBA 4AQFC 3ZC0A 3NRXA 3ONXA 2I0MA 1N36T 3DYJA 3AAIA 4ILAA 2K5BB 2WY2A 4LF7T 2YU1A 3PUZF 2CWYA 3ZYMA 1HNXT 2Q9QA 2LRLA 3VR8A 4LF5T 4JLEA 1UX5A 3ZEFB 2LOSA 2BBJA 3P4WA 3RIAA 3AEEA 4AQFA 5LHIB 1H7CA 4DV0T 4MBQA 4UVCB 2IMLA 3E22E 1E1HB 1MMNA 2LT3A 4HFBA 4U74A 2LKGA 4DV4T 4FJOA 5FXWA 4LFBT 4XBFB 5L4EA 3M3ZB 2HHHT 4LMJA 3Q5WA 5KDMC 3RHWA 2CBJA 5H6QB 4OYKA 4ERRA 2BZBA 1J5WA 3ZT5A 3UUXB 1QUUA 5FY7A 4E7ZA 4KHPT 4IREA 4TN7B 3MJXA 1MMDA 5AQOB 3B13A 3GA8A 3VU7H 2X68A 5HEOA 5LHGB 1YKEB 2IHR1 5AQJB 1XMOT 4HFCA 3I1AA 2CE7A 2X0YA 3KBTA 4WW0A 3RQUA 4ZHQE 2BG9B 2IC6A 3X1DA 4DV2T 2L10A 2F4VT 1HG5A 2PTFA 3N5LA 4OK0A 1KNZA 2V6XA 4PAGA 2UUCT 2X0HA 1KNPA 2JRKA 3ONJA 5J0ZA 2E2AA 2K9AA 2KWIB 2V8SV 3ETUA 2EHOD 5EK4A 1MNEA 2V5DA 4MHCA 4QH4A 1V9DA 3GWHA 2JMHA 3PUXF 4L5GA 3PURA 5JR9A 4CI2B 3MKDA 3PDYA 5ADXL 1HF8A 3UUMA 4EYUA 4B3MT 5DJQC 5JH7E 1SA0E 3FYQA 3JC6C 4ILCA 4KBMB 5AQHB 2WM9A 2ODVA 3WAJA 3C51A 5JDHA 5FP3A 5FNVE 1XDOA 2ZM6T 2V7JA 2QYWA 2XSAA 2SPCA 3AA0B 3OJAA 4UVBB 1N33T 2MOZA 4CXYA 3EABA 4JUYA 4PW8A 1LRZA 2DWGA 2WMNA 1IBKT 2YKSA
chains in the Genus database with same CATH topology
4QX7B 2E9XC 4H9NC 4A56A 5E0OA 4FI5A 5TAOA 5IYZE 1NAFA 5LCYA 4UVAB 3LJCA 5LJMA 3M65A 4PK5A 4ANJA 4DBRA 2X0LB 2CEAA 4JEHB 4J2CA 2LOPA 2VKJA 3O1JA 3E08A 4QXBB 4HN9A 3N2GE 5FYMA 3I0OA 3RKOA 5L3EB 3N9OA 4CXWA 4B6XA 3RC8A 1MMGA 5F3JA 2CM0A 3VKHA 1LVKA 2MTQA 3RC3A 3C98B 4KUMB 5F8PA 5HXSA 1LKXA 2NW8A 4ILUA 4HGAA 3SWHA 4AXPA 5IHYA 3F2EA 4OHFA 2BVMA 4IGUA 5JR9B 3PUAA 4O4HE 4UEMA 2E9XB 3WAKA 2W00A 3LBXA 3N9MA 2N9DA 1D0XA 4H63V 2PFVA 3KV6A 3J9X1 5ETWA 3VJZA 5J1GA 4HE8A 4H9RC 1AJ3A 4EB6E 1WYBA 1U4QA 5L3DB 2NOXA 1LVFA 3HKDE 3JC6D 3DP7A 3FHNA 4ADZA 2VKDA 2V7KA 4DO0A 3QUJA 5JRCB 2WSSV 2J1DG 5JDFA 3A5XA 3BQKA 4AKHA 3IF8B 2KNDA 2PG8A 4HKAA 4TUYE 4EAHA 2E8IA 2L3LA 4P09A 2D0TA 1FIOA 2M67A 2OA5A 5LNKA 1B7TA 3H3AA 4GOUA 4I50E 2CXDA 3CQXC 1HG2A 3VHLA 4C91A 2Y6XA 4CQIA 3HI2A 5JDGA 5LYJE 5LP6E 4QX8B 2NW9A 2JJ9A 3ANWA 1UX4A 4P0BA 1ZV4X 2LHRA 3RX6A 2VASA 4H63H 4UF0B 3R6NA 3K3QC 3EDVA 2H7OA 1S35A 2D2SA 2YINA 3UUNA 3PU8A 4UELA 4X1YE 4F6RC 2NP9A 4ZI2C 5JR9C 2Y8DA 2EHOC 3U78A 3QC9A 2A3DA 4OYJA 5J2UE 3NZPA 1MIWA 4MALA 4Z8XA 3DJBA 2DWKA 3PE0A 4QXHB 4XAXB 5HAXA 3ZCIA 4EZ4A 3CVRA 3U3IA 5JDLA 3I9YA 1SHZC 2XHEB 4QHOA 2X9WA 4PK6A 3S4UA 3UT5E 2Q9QB 4O4JE 3PUQA 4CI3B 3V5SA 2WAUA 3IHRA 5JDNA 2L9QA 2YK0A 3C4XA 3WSCA 4I43B 3F31A 3N2OA 4GIWA 3KVAA 1D1CA 2L8KA 4H9SE 3ZMSB 2B1EA 2ZM8A 1WYCA 4H9OC 3ZPOA 2DCFA 1CUNA 3FBLA 4QKNA 2BVLA 3CQCB 2UXXB 4PK4A 4WBNE 3ZYLA 2JPFA 4OFZA 2C0SA 1US7B 4DMWA 2Q9QD 5H6RB 3P8CD 3MACA 3NZQA 2MBGA 1ZKEA 3HL6A 3KV5A 4IE7A 2CXFA 2YU2A 2EHOB 3ZMTB 3MZKB 3FB2A 3WI3A 2IW5B 5T1DA 2ACXA 3CQGB 2PJQA 3OBVE 3HKBE 5LA6E 3ZMVB 3K8PC 1KK7A 3CPZA 3NBXX 2QGSA 3CX7B 2LEHA 4HTEA 4P0AA 3C4WA 5JREA 4XZCA 3KDSE 3CX6B 4ZOLE 2HPJA 3FXDB 4I55E 4EXTA 5LGUB 3PF0A 2RA1A 4MFRA 4KMCA 2ZLYA 2VK9A 1EZ3A 5DQVA 2D0UA 5FXZA 2E9XA 1VOMA 3L3PA 5L3GB 1IJ6A 3N9QA 4IHJE 4QWNB 2XTLA 1X79A 2C5KT 2C5IT 3ZLIA 3PTRB 2DHRA 3ZJ1A 3W15B 4PFOA 5EK3A 5L3FB 3ANWB 5FMNA 2DI4A 1MIYA 3QK6A 1VRBA 5LG4A 3WURA 2V7MA 3Q5XA 1YKHB 3LK42 2CWOA 4BJMA 3EUHA 2LSIA 1MNDA 3LK3B 2VWAA 3K3NA 3MK7C 5GONE 2LJLA 1T98A 2LM9A 4YFSA 3H37A 4EIWA 3AAEB 4I4TE 1BR1A 1YW0A 2K48A 2KWHA 2NW7A 3P7IA 4IE0A 4X1IE 4IDZA 4M1PA 2D5UA 3ZYKA 1UCUA 3UTKA 3TKLB 2NWBA 2VB6A 2UXNB 4DMVA 4PJLA 4ECGA 4NUUA 3RRWA 3I0QA 5CB4E 3RYIE 3FXEB 1FMVA 4TV8E 3LFMA 3ESLA 2DLRA 2KT9A 3RYHE 3ZN1B 3F57A 3RPUA 4IE6A 4ZI7E 1Y64B 3ZN0B 2KINB 2XAQB 4WBOA 1IAPA 3L09A 2LE8A 3I9WA 4L0RA 2Y48B 4UIGA 3V5UA 4ASKA 3KINB 5C8YE 2NTYA 2X66A 3GN5A 3RYFE 4AKLA 4O4LE 1BR4A 4O4IE 5KMGP 2CLYC 3LG7A 5LHHB 2ZM0A 3C50A 3OYZA 2DNXA 2V26A 4YJ2E 3O1HA 5LBMA 3AVRA 4V1Av 4ISTA 4TV9E 4NUVA 2WBLA 3O1IA 5LOVE 3B57A 1G73A 4GK0E 3OYXA 4X1KE 3SS1A 5JVDE 5CA1E 4UV9B 2MYSA 5FXXA 5M4YA 4TZ4C 4EYYR 2H3RA 4GK5E 4DNDA 3O4XE 1MIVA 3KBUA 2LQUA 3KVBA 3RRCA 4ZI3C 4PJNA 2KZ7B 1HX8A 3CWZB 2CXLA 2XAFB 2W63A 4G63A 2K24A 2CMRA 5L2LA 5DABA 3R84B 3VKGA 5KX5E 2QA7A 2XUEA 5LXTE 1D1AA 3KFWX 3N9LA 3RH3A 2BDEA 2JMKA 3N9NA 3EVYA 3LBXB 2V7LA 2XAJB 2GK9A 3OKQA 2V1DB 2KXPB 2H7VC 2W0GA 1D0YA 1IZNB 2LSGA 3KV9A 3ZCJA 4BAYB 4PJMA 5EZYE 2X9HA 3LK2B 2X9YA 3AVSA 3O9XA 2XAHB 5A1LA 4H9PC 2KMFA 4GYRA 2VKOA 2NTXA 4HFVA 4ZS2A 2ODUA 2I59A 3D0TA 3ZMZB 3N9PA 5JRCA 4AQGA 3FBZA 1G8XA 3DTOA 2LSYA 4IE5A 1D1BA 2XQYA 4C90A 4AI6A 2W61A 4HEAA 1HCIA 2VKHA 3PUGA 3PUSA 4PJJA 5L3BB 5EK2A 4YHJA 3BQLA 3MXZA 5HWYA 5JDQA 2WMOA 2XAGB 4TX5A 2LHNA 5J2TE 3PHF1 4JEUB 3AA1B 5HXHA 4X20E 5AFUL 3HKCE 1FMWA 2CCQA 4BA9A 5HYAA 2XASB 5LGNB 4CXXA 2V7IA 1O3XA 5HXRA 5HXEA 4K0UA 5L3CB 4UF0A 3K3OA 4ISSA 3J7Yq 4BGOA 2MTCA 5BMVE 3C64A 3MA9A 3T8OA 3AT7A 2N2NA 2IC9A 4O2BE 5CA0E 4G2AA 4N78D 3E0ZA 2LSJA 4O2AE 1ZHCA 2JQQA 3RYCE 3ZMUB 1OXZA 4ONRA 2Z6EA 5HXCA 2HPLA 5FY1A 4CZZB 2LSKA 2X67A 3CX8B 2VL8A 5LGTB 3HA4A 1D0ZA 3ZC1A 3UULA 3PU3A 2ZM2A 4QXCB 3M1CA 4IIJE 3CMLA 3IBPA 1HS7A 4UXNB 4AKGA 2ZMAA 2CA5A 3GN5B 5LBQB 3SRZA 3SOLA 4DBQA 1BR0A 1S94A 3CKDA 2RP4A 3AA6B 5JQGE 4BJNA 2YEVC 3AAAB 3KV4A 4ZI2D 5LHIB 4MLKA 4YLHA 2CLYB 2X9XA 4O8SA 2KLQA 1Z0PA 2PBIA 2EHOA 5HWXA 2WWUA 2E9XD 3Q2MA 2ES0A 4ZI3D 4YJ3E 3ETVA 1NWMX 4GYSA 1BR2A 1HFAA 3GMIA 2G0UA 3HR0A 4U72A 4ZS3A 4UV8B 2A72A 4L9IA 1HTJF 1FEWA 2A2FX 5FXVA 4DVDA 1WRDA 5JDMA 4H9QC 2C5JA 2X51A 2W62A 3N2KE 4KP3C 2N1GA 4AKRB 3IEEA 1MMAA 1YD8G 1ZEEA 3C4ZA 3HKEE 4EZHA 5FY0A 3EDUA 3NRYA 4PNIA 2P9BA 3AB3B 3BQIA 1WLXA 1WR6A 2HH7A 4AKIA 4CI1B 3UFEA 4EOZB 5DQWA 1IJ5A 2Q9QC 3Q9DA 4E7SA 1QSDA 4WNKA 3AA7B 3ZJ2A 2IAKA 4IE4A 4PFPA 1OWAA 1U5PA 3ZC0A 4AQFC 3NRXA 3ONXA 3AAIA 2K5BB 2YU1A 2CWYA 3ZYMA 2Q9QA 4JLEA 1UX5A 3ZEFB 2LOSA 4AQFA 1H7CA 4MBQA 4UVCB 3E22E 1E1HB 1MMNA 2LT3A 4U74A 4XBFB 4FJOA 5FXWA 3Q5WA 5KDMC 5H6QB 4OYKA 4ERRA 2BZBA 3UUXB 1QUUA 5FY7A 4E7ZA 2DWGA 4TN7B 3MJXA 1MMDA 3B13A 3GA8A 3VU7H 2X68A 5LHGB 1YKEB 3I1AA 2CE7A 4WW0A 3KBTA 4ZHQE 2IC6A 1HG5A 3N5LA 4OK0A 1KNZA 4PAGA 2JRKA 2K9AA 3ETUA 2KWIB 5EK4A 2EHOD 1MNEA 4MHCA 5JR9A 4CI2B 1V9DA 3GWHA 2JMHA 4L5GA 5LJNA 3PURA 5ADXL 3MKDA 3PDYA 1HF8A 3UUMA 4EYUA 5DJQC 5JH7E 1SA0E 3JC6C 4KBMB 2WM9A 2ODVA 3WAJA 3C51A 5JDHA 5FP3A 5FNVE 2V7JA 3AA0B 3OJAA 2SPCA 4UVBB 2MOZA 4CXYA 4JUYA 4PW8A 1LRZA 3BK9A 2WMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5U A;  5HYA A;  5JDL A;  5JDM A;  3V5S A;  5HXR A;  5HWX A;  5HXE A;  5HWY A;  5JDG A;  5JDQ A;  5JDF A;  5HXS A;  5HXH A;  5JDN A;  5JDH A;  5HXC A; 
#chains in the Genus database with same CATH topology
 4QX7 B;  3ZST A;  2E9X C;  4H9N C;  4A56 A;  2CHN A;  5E0O A;  4FI5 A;  5TAO A;  3UFG A;  1NEK A;  5IYZ E;  1NAF A;  5LCY A;  4UVA B;  2CBI A;  3LJC A;  3M65 A;  5LJM A;  1CHU A;  4B3S T;  2FJA A;  4PK5 A;  4ANJ A;  4DBR A;  2X0L B;  2CEA A;  4JEH B;  4J2C A;  4DR4 T;  2LOP A;  2VKJ A;  3O1J A;  3E08 A;  4ZZC A;  4QXB B;  4HN9 A;  4NXN T;  3N2G E;  5FYM A;  3I0O A;  3RKO A;  5L3E B;  4DR2 T;  1KF6 A;  4CN4 A;  3N9O A;  4CXW A;  4B6X A;  3RC8 A;  4DV1 T;  1MMG A;  3L8R A;  5F3J A;  5FL0 A;  5IWA T;  2CM0 A;  2LM2 A;  3VKH A;  4Z90 A;  4F7G B;  1LVK A;  2MTQ A;  3RC3 A;  3C98 B;  4KUM B;  4LMK A;  2HN2 A;  1LKX A;  2XJ7 A;  5F8P A;  2M6I A;  5HXS A;  2NW8 A;  4ILU A;  4HGA A;  3SWH A;  4AXP A;  1SJ8 A;  3FZH B;  1JNR A;  2LRK A;  5IHY A;  3F2E A;  4OHF A;  2BVM A;  2QVA A;  4IGU A;  5JR9 B;  4NXM T;  3P4S A;  3PUA A;  3PUY F;  4O4H E;  2E9X B;  1T8B A;  4IL4 A;  2W00 A;  3LBX A;  4UEM A;  5HCM A;  3N9M A;  1N34 T;  4X64 T;  2N9D A;  3AED A;  1D0X A;  3AE6 A;  2J47 A;  4H63 V;  4JYA T;  1VCS A;  2PFV A;  3KV6 A;  3J9X 1;  5ETW A;  1N32 T;  3VJZ A;  3L39 A;  4A97 A;  2WZH A;  3G06 A;  5J1G A;  4HE8 A;  5F5W A;  4H9R C;  1XNQ T;  1AJ3 A;  4DUY T;  4EB6 E;  5AQF B;  1WYB A;  1U4Q A;  5L3D B;  2NOX A;  1LVF A;  2UUA T;  3HKD E;  3JC6 D;  3DP7 A;  3FHN A;  2E5V A;  2VKD A;  2V7K A;  3OVU A;  3QUJ A;  4ADZ A;  4DO0 A;  4DV6 T;  5JRC B;  4AI6 A;  2WU5 A;  2WSS V;  3ZT7 A;  4AQY T;  1OED C;  2J1D G;  5JDF A;  2LLY A;  3A5X A;  3BQK A;  4AKH A;  3IF8 B;  4EEB A;  2KND A;  2PG8 A;  4HKA A;  4TUY E;  4EAH A;  2E8I A;  2L3L A;  2L7N A;  4P09 A;  4LFA T;  2D0T A;  1FIO A;  2M67 A;  2OA5 A;  5LNK A;  4X65 T;  3FZM B;  1B7T A;  3H3A A;  4GOU A;  4I50 E;  2CXD A;  2JQK A;  3CQX C;  2BKN A;  1HG2 A;  3PV0 F;  3SFE A;  3VHL A;  1HX1 B;  2BS2 A;  4C91 A;  2Y6X A;  4QH1 A;  3HI2 A;  4U2Y A;  4CQI A;  4A5X A;  5JDG A;  5LYJ E;  1QLB A;  2BBH A;  1SUM B;  4QX8 B;  4WZX A;  4AIU A;  5ABH A;  5LP6 E;  2NW9 A;  2JJ9 A;  3ANW A;  1UX4 A;  4P0B A;  1KNR A;  1ZV4 X;  2B76 A;  2LHR A;  2VAS A;  4H63 H;  3RX6 A;  1HNZ T;  1IBM T;  5FL1 A;  2UUB T;  4UF0 B;  3R6N A;  3K3Q C;  3EDV A;  2H7O A;  1S35 A;  4P1N A;  2E5L T;  2CHO A;  2D2S A;  2YIN A;  3UUN A;  5HEJ A;  3AXJ B;  3PU8 A;  4UEL A;  4X1Y E;  2NP9 A;  4F6R C;  2A9U A;  4ZI2 C;  2Y8D A;  4ILB A;  2EHO C;  3U78 A;  3QC9 A;  4YXD A;  2A3D A;  4U3C A;  4U31 A;  1XNR T;  3UUB A;  4OYJ A;  5AQR B;  5J2U E;  5HCJ A;  2YDQ A;  5FKY A;  3NZP A;  4KI0 F;  1MIW A;  4MAL A;  4Z8X A;  1UUR A;  3DJB A;  2DWK A;  3PE0 A;  4QXH B;  4XAX B;  5AQV B;  5HAX A;  3ZCI A;  3CVR A;  1E2A A;  1ZOY A;  3U3I A;  1XWM A;  3I9Y A;  4EZ4 A;  4ZI2 D;  3QB5 A;  2W2U A;  1SHZ C;  2XHE B;  4YTP A;  4QHO A;  4CN6 A;  2X9W A;  1W0B A;  4PK6 A;  3S4U A;  3UT5 E;  1VCT A;  3AE7 A;  2Q9Q B;  3AE4 A;  4U7Y A;  4O4J E;  2VQE T;  3PUQ A;  5HEH A;  3V5S A;  2WAU A;  3IHR A;  4CI3 B;  5ABF A;  1E7P A;  2KVP A;  5JDN A;  2L9Q A;  2YK0 A;  3C4X A;  3WSC A;  2OLT A;  4I43 B;  3F31 A;  3N2O A;  4GIW A;  4IT4 A;  3KVA A;  2W67 A;  1D1C A;  2L8K A;  4H9S E;  3ZMS B;  4JI8 T;  2B1E A;  2ZM8 A;  1WYC A;  4H9O C;  4IDQ A;  3ZPO A;  2DCF A;  1CUN A;  4UR9 A;  3FBL A;  4QKN A;  2VVN A;  2BVL A;  2UXC T;  3CQC B;  2UXX B;  4ZEY A;  4PK4 A;  5HEU A;  1L0V A;  2WDV A;  4WBN E;  3ZYL A;  3RIU A;  2FBW A;  2FJE A;  2JPF A;  2C0S A;  4OFZ A;  1US7 B;  4DMW A;  4YSY A;  4DR3 T;  2Q9Q D;  5H6R B;  5LG3 A;  3BK9 A;  3P8C D;  3WAK A;  3MAC A;  4DV3 T;  3NZQ A;  3EHZ A;  3H3M A;  2XQ8 A;  2MBG A;  2WCA A;  1ZKE A;  3NVO A;  3UU4 A;  3RQW A;  3HL6 A;  3UU5 A;  5L47 A;  3KV5 A;  4IE7 A;  2CXF A;  2YU2 A;  2EHO B;  3ZMT B;  3PUW F;  3JAE A;  3MZK B;  4W8P A;  3FB2 A;  1YXR A;  3WI3 A;  2CRB A;  2IW5 B;  5T1D A;  2BS3 A;  2ACX A;  1YQ4 A;  3CQG B;  4IDN A;  1W09 A;  2PJQ A;  5FVL A;  1Y01 A;  3OBV E;  3HKB E;  5LA6 E;  3RGL A;  4DR5 T;  3ZMV B;  3K8P C;  1KK7 A;  3CPZ A;  3NBX X;  3ZKR A;  2QGS A;  2XPK A;  3CX7 B;  2LEH A;  4HTE A;  4P0A A;  3C4W A;  4LML A;  2H88 A;  4TWH A;  4WYV A;  3RIU C;  3TLW A;  5ABE A;  5JRE A;  4LFC T;  3ONL C;  4NPP A;  4XZC A;  3KDS E;  4HFI A;  3CX6 B;  4ZOL E;  1I94 T;  2HPJ A;  2YDR A;  3FXD B;  4I55 E;  4EXT A;  4F8H A;  5LGU B;  2KSR A;  2RA1 A;  4MFR A;  3PF0 A;  4KMC A;  2ZLY A;  4YY3 T;  2VK9 A;  1EZ3 A;  5DQV A;  3TLS A;  2D0U A;  5FXZ A;  2VQF T;  2XQ3 A;  2E9X A;  1VOM A;  4GKK T;  3L3P A;  5L3G B;  4OX9 T;  1IJ6 A;  3N9Q A;  4IHJ E;  4QWN B;  2XTL A;  3P4R A;  1X79 A;  2C5K T;  2C5I T;  3ZLI A;  4A98 A;  3PTR B;  2DHR A;  3ZJ1 A;  3W15 B;  4PFO A;  5EK3 A;  5L3F B;  3ANW B;  5AQN B;  2BG9 A;  2DI4 A;  2OV9 A;  4U33 A;  1MIY A;  3QK6 A;  1VRB A;  2XQ4 A;  5FMN A;  5LG4 A;  5CGM A;  2V7M A;  3WUR A;  2XQA A;  3Q5X A;  4EV6 A;  1YKH B;  3LK4 2;  2CWO A;  2X0C A;  4BJM A;  4DID B;  5IUX A;  3ZT6 A;  2XY8 B;  3EUH A;  3CK6 A;  2LSI A;  2BKO A;  1MND A;  2DL1 A;  3AEA A;  3LK3 B;  2VWA A;  4EED A;  3K3N A;  3AY5 A;  2H89 A;  1WCR A;  2IDO B;  4JI0 T;  1UGO A;  3MK7 C;  2WU2 A;  5GON E;  1M62 A;  2LJL A;  1T98 A;  2LM9 A;  4YFS A;  1UUS A;  2XZE A;  3PJA J;  4YSZ A;  3H37 A;  3TLT A;  4EIW A;  4JBW F;  3AAE B;  4U7I A;  4I4T E;  1BR1 A;  1YW0 A;  2K48 A;  2KWH A;  2NW7 A;  2XQ7 A;  2ACZ A;  3P7I A;  4IE0 A;  4X1I E;  4IDZ A;  4M1P A;  2D5U A;  3ZYK A;  1UCU A;  4IDP A;  3UTK A;  4DUZ T;  3P4P A;  4KHZ F;  2NWB A;  2VB6 A;  3TKL B;  2UXN B;  3UQ4 A;  1XMQ T;  1IBL T;  1WFD A;  4DMV A;  2BG9 C;  2VVS A;  4PJL A;  4NUU A;  1ZP0 A;  1NEN A;  3I0Q A;  3JAD A;  3RRW A;  2FJB A;  3AEB A;  2LKH A;  5CB4 E;  3RYI E;  3FXE B;  1FMV A;  2YDS A;  3FZF B;  4TV8 E;  3LFM A;  1M7K A;  3UQ7 A;  3ESL A;  2DLR A;  2KT9 A;  2JQH A;  3RYH E;  3ZN1 B;  3F57 A;  3P4Q A;  3RPU A;  2MAW A;  4LF6 T;  4IE6 A;  4ZI7 E;  1Y64 B;  3ZN0 B;  2KIN B;  2XAQ B;  4WBO A;  1IAP A;  2K3W A;  1SJ7 A;  3L09 A;  2LE8 A;  4HFH A;  1KEY A;  2BG9 E;  3I9W A;  4L0R A;  2J62 A;  2Y48 B;  4UIG A;  2FJD A;  2XM1 A;  3V5U A;  4ASK A;  3KIN B;  3AE5 A;  5C8Y E;  2NTY A;  2X66 A;  3GN5 A;  3RYF E;  2XQ5 A;  4O4L E;  3RF1 A;  4AKL A;  1BR4 A;  4O4I E;  3RIF A;  2WZI A;  2CLY C;  3LG7 A;  5AQK B;  3QOF A;  3UU8 A;  5KMG P;  5LHH B;  2ZM0 A;  5AQS B;  3C50 A;  3OYZ A;  2DNX A;  2V26 A;  4YJ2 E;  3O1H A;  5LBM A;  3K1S A;  3AVR A;  4V1A v;  4IST A;  4EGW A;  4TV9 E;  4NUV A;  2WBL A;  3JAF A;  3FZK B;  3O1I A;  5LOV E;  3B57 A;  1G73 A;  2WP9 A;  3OYX A;  4GK0 E;  4X1K E;  5JVD E;  3SS1 A;  2WQY A;  5CA1 E;  5C3J A;  4UV9 B;  2MYS A;  4JV5 T;  1OED E;  5FXX A;  5L4H A;  5M4Y A;  1JNZ A;  4TZ4 C;  3Q5E A;  2H3R A;  5LB7 B;  4EYY R;  4GK5 E;  5AQL B;  4ECG A;  4DND A;  3QB5 K;  3O4X E;  1MIV A;  3KBU A;  3A7M A;  4JI1 T;  3KVB A;  2LQU A;  3RRC A;  1T72 A;  2XSB A;  4ZI3 C;  4PJN A;  2KZ7 B;  1HX8 A;  3CWZ B;  3LSV A;  2AXD S;  2CXL A;  2XAF B;  1J5E T;  4YTM A;  2W63 A;  4G63 A;  2K24 A;  1XDP A;  2CMR A;  2WDR A;  5DAB A;  2WWV A;  3R84 B;  5KX5 E;  2QA7 A;  2XUE A;  5LXT E;  3VKG A;  1D1A A;  4HWI B;  1R8I A;  4YTN A;  5LMN T;  3KFW X;  4COF A;  3N9L A;  4HFD A;  3RH3 A;  5AQM B;  3RI5 A;  5AQT B;  2BDE A;  2JMK A;  2R6G F;  4HWC A;  3N9N A;  3EVY A;  3LBX B;  4B3T T;  2V7L A;  1J1J A;  2XAJ B;  3AE9 A;  2GK9 A;  3IA3 A;  3OKQ A;  2V1D B;  2KXP B;  3AE3 A;  2H7V C;  3Q5D A;  5L2L A;  2V6Y A;  2W0G A;  3FZL B;  1D0Y A;  1IZN B;  2LSG A;  3KV9 A;  4LF8 T;  3ZCJ A;  4BAY B;  4PJM A;  5EZY E;  2W66 A;  2X9H A;  3LK2 B;  3UU3 A;  1W9R A;  2X9Y A;  3AVS A;  3O9X A;  2XAH B;  5A1L A;  2I6H A;  4H9P C;  2KMF A;  4GYR A;  2VKO A;  2NTX A;  4HFV A;  4ZS2 A;  2ODU A;  2I59 A;  2YN6 A;  3D0T A;  4TWF A;  3ZMZ B;  3N9P A;  4ZXL A;  4AQG A;  5LJN A;  3FBZ A;  5JRC A;  1G8X A;  2LSY A;  3DTO A;  4IE5 A;  1D1B A;  2XQY A;  2J4G A;  4IL9 A;  3TLV A;  4C90 A;  4YT0 A;  4DR7 T;  1DU2 A;  3TLU A;  2W61 A;  4X5T A;  4HEA A;  3QNU A;  1HCI A;  1OED A;  2VKH A;  2WDQ A;  3PUG A;  3PUS A;  4I0U A;  3LDQ B;  4PJJ A;  5ABF B;  5EK2 A;  4YHJ A;  3BQL A;  5L3B B;  1FJG T;  3RKG A;  1UK5 A;  2W4X A;  3MXZ A;  5C2T A;  3AEG A;  5HWY A;  5CJ5 A;  4JI2 T;  5JDQ A;  2WMO A;  2XAG B;  3ZSS A;  5JDL A;  4TX5 A;  3A8Y C;  2LHN A;  5J2T E;  3PHF 1;  2VUR A;  4JEU B;  4B3R T;  4KX6 A;  4NIQ A;  3VR9 A;  3AA1 B;  2WB5 A;  5HXH A;  4X20 E;  4X66 T;  3CIR A;  2XM2 A;  5AFU L;  3HKC E;  4HWF A;  1FMW A;  2CCQ A;  4BA9 A;  5HYA A;  1SE7 A;  4TNW A;  2XAS B;  5LGN B;  4CXX A;  2V7I A;  1O3X A;  5HXR A;  5HXE A;  2XQ9 A;  4K0U A;  3UU6 A;  5L3C B;  4UF0 A;  4JI3 T;  4DR1 T;  3K3O A;  1KFY A;  3EI0 A;  4ISS A;  3J7Y q;  4BGO A;  3AXJ A;  3NKZ A;  5HEG A;  2MTC A;  2M6B A;  3C64 A;  5AQI B;  3MA9 A;  2IUB A;  3T8O A;  5BMV E;  4LF4 T;  2N2N A;  2IC9 A;  4O2B E;  5CA0 E;  3AT7 A;  4G2A A;  2UXD T;  4N78 D;  3E0Z A;  4U2Z A;  2LSJ A;  4O2A E;  5JTG A;  4HFE A;  1ZHC A;  2JQQ A;  3RYC E;  3ZMU B;  4AIS A;  1OXZ A;  5AQG B;  5BR8 T;  4ONR A;  5JR9 C;  2Z6E A;  3NWI A;  2HPL A;  5HXC A;  5FY1 A;  2V5C A;  2LSK A;  4CZZ B;  2X67 A;  4DR6 T;  2KGX A;  4TWD A;  3CX8 B;  3PJA A;  2VL8 A;  5LGT B;  2JIW A;  5FVK A;  3HA4 A;  1D0Z A;  3ZC1 A;  4K0K T;  3UUL A;  3PU3 A;  2ZM2 A;  4QXC B;  3M1C A;  3AE1 A;  1GQE A;  4JI6 T;  4IIJ E;  4CN1 A;  4DV7 T;  4LF9 T;  3AE2 A;  3CML A;  3IBP A;  2RPA A;  1HS7 A;  1XZY A;  2FUP A;  1W0A A;  2WS3 A;  3ABV A;  4UXN B;  4AKG A;  2UXB T;  1HR0 T;  2ZMA A;  4JI4 T;  2CA5 A;  3GN5 B;  5LBQ B;  4IDO A;  3SRZ A;  3SOL A;  4DBQ A;  3AEC A;  1BR0 A;  4ZZB A;  1S94 A;  3CKD A;  2RP4 A;  1T7S A;  3AA6 B;  5JQG E;  1Z8U A;  3OPC A;  2YEV C;  3AAA B;  3KV4 A;  4QH5 A;  3VRA A;  4BJN A;  4MLK A;  4TNV A;  2CLY B;  2X9X A;  4O8S A;  2KLQ A;  4YLH A;  1Z0P A;  2PBI A;  2EHO A;  1X9B A;  5HWX A;  2WWU A;  2E9X D;  3Q2M A;  2ES0 A;  3SFD A;  4ZI3 D;  4GKJ T;  4YJ3 E;  5LMU T;  3ETV A;  1NWM X;  4GYS A;  1BR2 A;  2BKP A;  2JQ9 A;  1HFA A;  5AQU B;  3GMI A;  2G0U A;  3HR0 A;  4U72 A;  4ZS3 A;  2IIU A;  3RLF F;  4UV8 B;  2A72 A;  4YHH T;  4JI7 T;  5AQQ B;  4L9I A;  3VRB A;  1HTJ F;  1YQ3 A;  1FEW A;  2A2F X;  2CPT A;  5FXV A;  4DVD A;  1WRD A;  5JDM A;  4H9Q C;  2AE9 A;  2C5J A;  2XQ6 A;  2X51 A;  2W62 A;  5FZT A;  3N2K E;  3B5M A;  4KP3 C;  2N1G A;  3PUV F;  4AKR B;  4JI5 T;  3IEE A;  2KBB A;  1MMA A;  1YD8 G;  1ZEE A;  2QRX A;  3C4Z A;  2MPK A;  2BS4 A;  3HKE E;  3P50 A;  4HWH A;  4Z91 A;  5AQP B;  4EZH A;  5FY0 A;  3EDU A;  1HNW T;  2D9D A;  3T1Y T;  3NRY A;  3T1H T;  2UU9 T;  1I6Z A;  2NR4 A;  3EAM A;  4HWD A;  2P9B A;  4PNI A;  3AB3 B;  3BQI A;  1WLX A;  1WR6 A;  2HH7 A;  4AKI A;  4CI1 B;  3JCF A;  1OED B;  3UFE A;  4EOZ B;  5KXJ A;  2HN1 A;  5DQW A;  2VL0 A;  1IJ5 A;  1WR0 A;  2Q9Q C;  3Q9D A;  4E7S A;  3OTO T;  1QSD A;  4WNK A;  3AA7 B;  2YOE A;  5ABG A;  4YSX A;  3ZJ2 A;  2IAK A;  3AE8 A;  3AEF A;  4IE4 A;  4DV5 T;  4PFP A;  1OWA A;  2V6Y B;  4Q25 A;  1U5P A;  4X62 T;  5CFB A;  4AQF C;  3ZC0 A;  3NRX A;  3ONX A;  2I0M A;  1N36 T;  3DYJ A;  3AAI A;  4ILA A;  2K5B B;  2WY2 A;  4LF7 T;  2YU1 A;  3PUZ F;  2CWY A;  3ZYM A;  1HNX T;  2Q9Q A;  2LRL A;  3VR8 A;  4LF5 T;  4JLE A;  1UX5 A;  3ZEF B;  2LOS A;  2BBJ A;  3P4W A;  3RIA A;  3AEE A;  4AQF A;  5LHI B;  1H7C A;  4DV0 T;  4MBQ A;  4UVC B;  2IML A;  3E22 E;  1E1H B;  1MMN A;  2LT3 A;  4HFB A;  4U74 A;  2LKG A;  4DV4 T;  4FJO A;  5FXW A;  4LFB T;  4XBF B;  5L4E A;  3M3Z B;  2HHH T;  4LMJ A;  3Q5W A;  5KDM C;  3RHW A;  2CBJ A;  5H6Q B;  4OYK A;  4ERR A;  2BZB A;  1J5W A;  3ZT5 A;  3UUX B;  1QUU A;  5FY7 A;  4E7Z A;  4KHP T;  4IRE A;  4TN7 B;  3MJX A;  1MMD A;  5AQO B;  3B13 A;  3GA8 A;  3VU7 H;  2X68 A;  5HEO A;  5LHG B;  1YKE B;  2IHR 1;  5AQJ B;  1XMO T;  4HFC A;  3I1A A;  2CE7 A;  2X0Y A;  3KBT A;  4WW0 A;  3RQU A;  4ZHQ E;  2BG9 B;  2IC6 A;  3X1D A;  4DV2 T;  2L10 A;  2F4V T;  1HG5 A;  2PTF A;  3N5L A;  4OK0 A;  1KNZ A;  2V6X A;  4PAG A;  2UUC T;  2X0H A;  1KNP A;  2JRK A;  3ONJ A;  5J0Z A;  2E2A A;  2K9A A;  2KWI B;  2V8S V;  3ETU A;  2EHO D;  5EK4 A;  1MNE A;  2V5D A;  4MHC A;  4QH4 A;  1V9D A;  3GWH A;  2JMH A;  3PUX F;  4L5G A;  3PUR A;  5JR9 A;  4CI2 B;  3MKD A;  3PDY A;  5ADX L;  1HF8 A;  3UUM A;  4EYU A;  4B3M T;  5DJQ C;  5JH7 E;  1SA0 E;  3FYQ A;  3JC6 C;  4ILC A;  4KBM B;  5AQH B;  2WM9 A;  2ODV A;  3WAJ A;  3C51 A;  5JDH A;  5FP3 A;  5FNV E;  1XDO A;  2ZM6 T;  2V7J A;  2QYW A;  2XSA A;  2SPC A;  3AA0 B;  3OJA A;  4UVB B;  1N33 T;  2MOZ A;  4CXY A;  3EAB A;  4JUY A;  4PW8 A;  1LRZ A;  2DWG A;  2WMN A;  1IBK T;  2YKS A; 
#chains in the Genus database with same CATH homology
 4QX7 B;  2E9X C;  4H9N C;  4A56 A;  5E0O A;  4FI5 A;  5TAO A;  5IYZ E;  1NAF A;  5LCY A;  4UVA B;  3LJC A;  5LJM A;  3M65 A;  4PK5 A;  4ANJ A;  4DBR A;  2X0L B;  2CEA A;  4JEH B;  4J2C A;  2LOP A;  2VKJ A;  3O1J A;  3E08 A;  4QXB B;  4HN9 A;  3N2G E;  5FYM A;  3I0O A;  3RKO A;  5L3E B;  3N9O A;  4CXW A;  4B6X A;  3RC8 A;  1MMG A;  5F3J A;  2CM0 A;  3VKH A;  1LVK A;  2MTQ A;  3RC3 A;  3C98 B;  4KUM B;  5F8P A;  5HXS A;  1LKX A;  2NW8 A;  4ILU A;  4HGA A;  3SWH A;  4AXP A;  5IHY A;  3F2E A;  4OHF A;  2BVM A;  4IGU A;  5JR9 B;  3PUA A;  4O4H E;  4UEM A;  2E9X B;  3WAK A;  2W00 A;  3LBX A;  3N9M A;  2N9D A;  1D0X A;  4H63 V;  2PFV A;  3KV6 A;  3J9X 1;  5ETW A;  3VJZ A;  5J1G A;  4HE8 A;  4H9R C;  1AJ3 A;  4EB6 E;  1WYB A;  1U4Q A;  5L3D B;  2NOX A;  1LVF A;  3HKD E;  3JC6 D;  3DP7 A;  3FHN A;  4ADZ A;  2VKD A;  2V7K A;  4DO0 A;  3QUJ A;  5JRC B;  2WSS V;  2J1D G;  5JDF A;  3A5X A;  3BQK A;  4AKH A;  3IF8 B;  2KND A;  2PG8 A;  4HKA A;  4TUY E;  4EAH A;  2E8I A;  2L3L A;  4P09 A;  2D0T A;  1FIO A;  2M67 A;  2OA5 A;  5LNK A;  1B7T A;  3H3A A;  4GOU A;  4I50 E;  2CXD A;  3CQX C;  1HG2 A;  3VHL A;  4C91 A;  2Y6X A;  4CQI A;  3HI2 A;  5JDG A;  5LYJ E;  5LP6 E;  4QX8 B;  2NW9 A;  2JJ9 A;  3ANW A;  1UX4 A;  4P0B A;  1ZV4 X;  2LHR A;  3RX6 A;  2VAS A;  4H63 H;  4UF0 B;  3R6N A;  3K3Q C;  3EDV A;  2H7O A;  1S35 A;  2D2S A;  2YIN A;  3UUN A;  3PU8 A;  4UEL A;  4X1Y E;  4F6R C;  2NP9 A;  4ZI2 C;  5JR9 C;  2Y8D A;  2EHO C;  3U78 A;  3QC9 A;  2A3D A;  4OYJ A;  5J2U E;  3NZP A;  1MIW A;  4MAL A;  4Z8X A;  3DJB A;  2DWK A;  3PE0 A;  4QXH B;  4XAX B;  5HAX A;  3ZCI A;  4EZ4 A;  3CVR A;  3U3I A;  5JDL A;  3I9Y A;  1SHZ C;  2XHE B;  4QHO A;  2X9W A;  4PK6 A;  3S4U A;  3UT5 E;  2Q9Q B;  4O4J E;  3PUQ A;  4CI3 B;  3V5S A;  2WAU A;  3IHR A;  5JDN A;  2L9Q A;  2YK0 A;  3C4X A;  3WSC A;  4I43 B;  3F31 A;  3N2O A;  4GIW A;  3KVA A;  1D1C A;  2L8K A;  4H9S E;  3ZMS B;  2B1E A;  2ZM8 A;  1WYC A;  4H9O C;  3ZPO A;  2DCF A;  1CUN A;  3FBL A;  4QKN A;  2BVL A;  3CQC B;  2UXX B;  4PK4 A;  4WBN E;  3ZYL A;  2JPF A;  4OFZ A;  2C0S A;  1US7 B;  4DMW A;  2Q9Q D;  5H6R B;  3P8C D;  3MAC A;  3NZQ A;  2MBG A;  1ZKE A;  3HL6 A;  3KV5 A;  4IE7 A;  2CXF A;  2YU2 A;  2EHO B;  3ZMT B;  3MZK B;  3FB2 A;  3WI3 A;  2IW5 B;  5T1D A;  2ACX A;  3CQG B;  2PJQ A;  3OBV E;  3HKB E;  5LA6 E;  3ZMV B;  3K8P C;  1KK7 A;  3CPZ A;  3NBX X;  2QGS A;  3CX7 B;  2LEH A;  4HTE A;  4P0A A;  3C4W A;  5JRE A;  4XZC A;  3KDS E;  3CX6 B;  4ZOL E;  2HPJ A;  3FXD B;  4I55 E;  4EXT A;  5LGU B;  3PF0 A;  2RA1 A;  4MFR A;  4KMC A;  2ZLY A;  2VK9 A;  1EZ3 A;  5DQV A;  2D0U A;  5FXZ A;  2E9X A;  1VOM A;  3L3P A;  5L3G B;  1IJ6 A;  3N9Q A;  4IHJ E;  4QWN B;  2XTL A;  1X79 A;  2C5K T;  2C5I T;  3ZLI A;  3PTR B;  2DHR A;  3ZJ1 A;  3W15 B;  4PFO A;  5EK3 A;  5L3F B;  3ANW B;  5FMN A;  2DI4 A;  1MIY A;  3QK6 A;  1VRB A;  5LG4 A;  3WUR A;  2V7M A;  3Q5X A;  1YKH B;  3LK4 2;  2CWO A;  4BJM A;  3EUH A;  2LSI A;  1MND A;  3LK3 B;  2VWA A;  3K3N A;  3MK7 C;  5GON E;  2LJL A;  1T98 A;  2LM9 A;  4YFS A;  3H37 A;  4EIW A;  3AAE B;  4I4T E;  1BR1 A;  1YW0 A;  2K48 A;  2KWH A;  2NW7 A;  3P7I A;  4IE0 A;  4X1I E;  4IDZ A;  4M1P A;  2D5U A;  3ZYK A;  1UCU A;  3UTK A;  3TKL B;  2NWB A;  2VB6 A;  2UXN B;  4DMV A;  4PJL A;  4ECG A;  4NUU A;  3RRW A;  3I0Q A;  5CB4 E;  3RYI E;  3FXE B;  1FMV A;  4TV8 E;  3LFM A;  3ESL A;  2DLR A;  2KT9 A;  3RYH E;  3ZN1 B;  3F57 A;  3RPU A;  4IE6 A;  4ZI7 E;  1Y64 B;  3ZN0 B;  2KIN B;  2XAQ B;  4WBO A;  1IAP A;  3L09 A;  2LE8 A;  3I9W A;  4L0R A;  2Y48 B;  4UIG A;  3V5U A;  4ASK A;  3KIN B;  5C8Y E;  2NTY A;  2X66 A;  3GN5 A;  3RYF E;  4AKL A;  4O4L E;  1BR4 A;  4O4I E;  5KMG P;  2CLY C;  3LG7 A;  5LHH B;  2ZM0 A;  3C50 A;  3OYZ A;  2DNX A;  2V26 A;  4YJ2 E;  3O1H A;  5LBM A;  3AVR A;  4V1A v;  4IST A;  4TV9 E;  4NUV A;  2WBL A;  3O1I A;  5LOV E;  3B57 A;  1G73 A;  4GK0 E;  3OYX A;  4X1K E;  3SS1 A;  5JVD E;  5CA1 E;  4UV9 B;  2MYS A;  5FXX A;  5M4Y A;  4TZ4 C;  4EYY R;  2H3R A;  4GK5 E;  4DND A;  3O4X E;  1MIV A;  3KBU A;  2LQU A;  3KVB A;  3RRC A;  4ZI3 C;  4PJN A;  2KZ7 B;  1HX8 A;  3CWZ B;  2CXL A;  2XAF B;  2W63 A;  4G63 A;  2K24 A;  2CMR A;  5L2L A;  5DAB A;  3R84 B;  3VKG A;  5KX5 E;  2QA7 A;  2XUE A;  5LXT E;  1D1A A;  3KFW X;  3N9L A;  3RH3 A;  2BDE A;  2JMK A;  3N9N A;  3EVY A;  3LBX B;  2V7L A;  2XAJ B;  2GK9 A;  3OKQ A;  2V1D B;  2KXP B;  2H7V C;  2W0G A;  1D0Y A;  1IZN B;  2LSG A;  3KV9 A;  3ZCJ A;  4BAY B;  4PJM A;  5EZY E;  2X9H A;  3LK2 B;  2X9Y A;  3AVS A;  3O9X A;  2XAH B;  5A1L A;  4H9P C;  2KMF A;  4GYR A;  2VKO A;  2NTX A;  4HFV A;  4ZS2 A;  2ODU A;  2I59 A;  3D0T A;  3ZMZ B;  3N9P A;  5JRC A;  4AQG A;  3FBZ A;  1G8X A;  3DTO A;  2LSY A;  4IE5 A;  1D1B A;  2XQY A;  4C90 A;  4AI6 A;  2W61 A;  4HEA A;  1HCI A;  2VKH A;  3PUG A;  3PUS A;  4PJJ A;  5L3B B;  5EK2 A;  4YHJ A;  3BQL A;  3MXZ A;  5HWY A;  5JDQ A;  2WMO A;  2XAG B;  4TX5 A;  2LHN A;  5J2T E;  3PHF 1;  4JEU B;  3AA1 B;  5HXH A;  4X20 E;  5AFU L;  3HKC E;  1FMW A;  2CCQ A;  4BA9 A;  5HYA A;  2XAS B;  5LGN B;  4CXX A;  2V7I A;  1O3X A;  5HXR A;  5HXE A;  4K0U A;  5L3C B;  4UF0 A;  3K3O A;  4ISS A;  3J7Y q;  4BGO A;  2MTC A;  5BMV E;  3C64 A;  3MA9 A;  3T8O A;  3AT7 A;  2N2N A;  2IC9 A;  4O2B E;  5CA0 E;  4G2A A;  4N78 D;  3E0Z A;  2LSJ A;  4O2A E;  1ZHC A;  2JQQ A;  3RYC E;  3ZMU B;  1OXZ A;  4ONR A;  2Z6E A;  5HXC A;  2HPL A;  5FY1 A;  4CZZ B;  2LSK A;  2X67 A;  3CX8 B;  2VL8 A;  5LGT B;  3HA4 A;  1D0Z A;  3ZC1 A;  3UUL A;  3PU3 A;  2ZM2 A;  4QXC B;  3M1C A;  4IIJ E;  3CML A;  3IBP A;  1HS7 A;  4UXN B;  4AKG A;  2ZMA A;  2CA5 A;  3GN5 B;  5LBQ B;  3SRZ A;  3SOL A;  4DBQ A;  1BR0 A;  1S94 A;  3CKD A;  2RP4 A;  3AA6 B;  5JQG E;  4BJN A;  2YEV C;  3AAA B;  3KV4 A;  4ZI2 D;  5LHI B;  4MLK A;  4YLH A;  2CLY B;  2X9X A;  4O8S A;  2KLQ A;  1Z0P A;  2PBI A;  2EHO A;  5HWX A;  2WWU A;  2E9X D;  3Q2M A;  2ES0 A;  4ZI3 D;  4YJ3 E;  3ETV A;  1NWM X;  4GYS A;  1BR2 A;  1HFA A;  3GMI A;  2G0U A;  3HR0 A;  4U72 A;  4ZS3 A;  4UV8 B;  2A72 A;  4L9I A;  1HTJ F;  1FEW A;  2A2F X;  5FXV A;  4DVD A;  1WRD A;  5JDM A;  4H9Q C;  2C5J A;  2X51 A;  2W62 A;  3N2K E;  4KP3 C;  2N1G A;  4AKR B;  3IEE A;  1MMA A;  1YD8 G;  1ZEE A;  3C4Z A;  3HKE E;  4EZH A;  5FY0 A;  3EDU A;  3NRY A;  4PNI A;  2P9B A;  3AB3 B;  3BQI A;  1WLX A;  1WR6 A;  2HH7 A;  4AKI A;  4CI1 B;  3UFE A;  4EOZ B;  5DQW A;  1IJ5 A;  2Q9Q C;  3Q9D A;  4E7S A;  1QSD A;  4WNK A;  3AA7 B;  3ZJ2 A;  2IAK A;  4IE4 A;  4PFP A;  1OWA A;  1U5P A;  3ZC0 A;  4AQF C;  3NRX A;  3ONX A;  3AAI A;  2K5B B;  2YU1 A;  2CWY A;  3ZYM A;  2Q9Q A;  4JLE A;  1UX5 A;  3ZEF B;  2LOS A;  4AQF A;  1H7C A;  4MBQ A;  4UVC B;  3E22 E;  1E1H B;  1MMN A;  2LT3 A;  4U74 A;  4XBF B;  4FJO A;  5FXW A;  3Q5W A;  5KDM C;  5H6Q B;  4OYK A;  4ERR A;  2BZB A;  3UUX B;  1QUU A;  5FY7 A;  4E7Z A;  2DWG A;  4TN7 B;  3MJX A;  1MMD A;  3B13 A;  3GA8 A;  3VU7 H;  2X68 A;  5LHG B;  1YKE B;  3I1A A;  2CE7 A;  4WW0 A;  3KBT A;  4ZHQ E;  2IC6 A;  1HG5 A;  3N5L A;  4OK0 A;  1KNZ A;  4PAG A;  2JRK A;  2K9A A;  3ETU A;  2KWI B;  5EK4 A;  2EHO D;  1MNE A;  4MHC A;  5JR9 A;  4CI2 B;  1V9D A;  3GWH A;  2JMH A;  4L5G A;  5LJN A;  3PUR A;  5ADX L;  3MKD A;  3PDY A;  1HF8 A;  3UUM A;  4EYU A;  5DJQ C;  5JH7 E;  1SA0 E;  3JC6 C;  4KBM B;  2WM9 A;  2ODV A;  3WAJ A;  3C51 A;  5JDH A;  5FP3 A;  5FNV E;  2V7J A;  3AA0 B;  3OJA A;  2SPC A;  4UVB B;  2MOZ A;  4CXY A;  4JUY A;  4PW8 A;  1LRZ A;  3BK9 A;  2WMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...