5HXSA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 10mm sr2+
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
300
structure length
296
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEENNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
molecule keywords sodium,calcium exchanger
total genus 122
structure length 296
sequence length 300
ec nomenclature
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hxsA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hxsA02
5JDLA 5HXHA 3V5UA 5JDHA 5JDNA 5HXCA 5HXSA 5HXRA 5HWYA 5HWXA 5JDGA 3V5SA 5JDMA 5HYAA 5JDQA 5JDFA 5HXEA
chains in the Genus database with same CATH superfamily
3IEEA 2VKHA 3NZQA 1W0AA 5AQQB 2W61A 3RQUA 2IAKA 5HWXA 4X64T 4X1IE 5BMVE 2ZM8A 4DR7T 3LK2B 1ZV4X 2LLYA 4UF0B 5L3DB 4ISSA 2Q9QA 2V6YA 3P4RA 5HXCA 2A9UA 2Y8DA 3AEBA 3DTOA 3UU5A 4H63H 2C5JA 2WM9A 2XZEA 1MMGA 3PUZF 3CK6A 2X9HA 4ZS3A 2IDOB 5LCYA 3V5SA 2WU5A 5HAXA 2XUEA 4LFBT 2XAJB 1GQEA 2NW8A 3HKDE 2Y6XA 3T1HT 4I55E 2WBLA 4U3CA 4BJNA 4CI2B 5JDQA 4KUMB 5DQWA 4O4LE 4BGOA 3AE5A 4JI8T 2LKGA 2J62A 2Q9QB 2V6YB 4EV6A 5AQJB 5AQIB 4HE8A 2UXCT 4HN9A 5DABA 2NR4A 2ODUA 5ABFB 3MZKB 3AA1B 3RC3A 2FJAA 2H7VC 2XSBA 1LVKA 2A2FX 3AEAA 3LG7A 3BQLA 3PURA 1B7TA 2VURA 3UUXB 5JDHA 3OJAA 1VCTA 1Z0PA 1ZKEA 4U31A 2KZ7B 4TUYE 2DI4A 5CGMA 1WYBA 4BJMA 2J1DG 1KFYA 3LJCA 4E7ZA 3KBUA 3RYFE 3N2GE 4DMVA 1WFDA 1S94A 2CWYA 3K8PC 3PUVF 4ZOLE 4IDOA 1UGOA 5IWAT 1KNZA 4NIQA 2BKPA 2A72A 2XSAA 3KDSE 3LSVA 4NXNT 2D0TA 2E9XC 5F5WA 3JC6D 5AQHB 3Q2MA 3WAKA 4A56A 3N9PA 2KINB 4P09A 2DNXA 3ZJ1A 3I9YA 1HCIA 3L39A 4U72A 4WW0A 4YTPA 2L10A 2X68A 4X20E 3VU7H 2WMOA 2L8KA 3JC6C 2QYWA 5AQMB 3OKQA 3QOFA 2MTQA 4EEBA 4EGWA 2DL1A 2FJDA 4V1Av 2LSJA 2Y48B 1MMAA 2YDSA 3N9OA 3Q9DA 4TWFA 2BS3A 3I9WA 2FJBA 2CHOA 2V8SV 4IE4A 2M6IA 2D9DA 2V5DA 1OEDC 1LRZA 1ZHCA 2CCQA 2CHNA 2QRXA 2B1EA 4MHCA 5L4EA 1JNRA 3P4SA 1WR0A 3KINB 5HEGA 3SRZA 1J5ET 2E5VA 1HNZT 2DWGA 3AA6B 4MALA 4PAGA 1JNZA 1XDPA 3UU4A 2K48A 1YQ3A 3TLWA 4I50E 3ZCIA 3FXDB 1X9BA 3MA9A 3WURA 4P1NA 1FMWA 4WBNE 4LMKA 3PF0A 1N32T 4PJLA 3CPZA 1QUUA 1D1BA 5HEOA 4O4IE 2I59A 4CXXA 2UXXB 2YDQA 3ETVA 5C8YE 5JDLA 5LG4A 2LEHA 4LMJA 2W62A 2BBJA 2X51A 4WNKA 2K24A 3NBXX 4X5TA 4JI5T 3KVAA 2XM1A 5AQLB 1MIYA 3C64A 4B3MT 1FJGT 4TZ4C 2QVAA 4DMWA 2V7JA 1N36T 3HI2A 1E1HB 4ECGA 2XQ9A 1WCRA 4UVAB 2W2UA 1US7B 2W4XA 1LVFA 1HX8A 3Q5XA 3FZLB 4X65T 3EVYA 4QXCB 2X9XA 4DR2T 3VJZA 1UK5A 2MYSA 1SUMB 1W9RA 2FJEA 3AA7B 3O4XE 5AQUB 4COFA 1X79A 3VKGA 1U5PA 2IC9A 2LKHA 2WY2A 2UXDT 1BR1A 3PDYA 3PJAJ 4AKRB 4F8HA 1VRBA 4ZZCA 4KMCA 4HWIB 2LJLA 3K3QC 3LBXB 4YLHA 1NEKA 3AAAB 2YU1A 4YTMA 4AIUA 2X66A 4CQIA 4DR1T 4JYAT 3CQGB 2KNDA 3AE8A 2H88A 5L4HA 4EYYR 4DV3T 2VK9A 5FXZA 4TWDA 3J7Yq 2Q9QC 2DCFA 3FXEB 2UUAT 1FEWA 4ZI3D 1HNWT 2NP9A 3I0QA 4IT4A 4HFDA 4AI6A 4ZI2C 4TNVA 4ISTA 3DYJA 3ONXA 4PJMA 2K5BB 2LRLA 2E8IA 4KBMB 3N9MA 2LRKA 2RA1A 3QB5A 5CJ5A 4B3RT 4HWDA 3RIFA 3EABA 3GA8A 3AE4A 3F57A 1S35A 2BZBA 2XQYA 5LP6E 2R6GF 1YKEB 4TV9E 3ZC0A 4EZHA 4QH4A 2LSKA 3CKDA 4Z8XA 5LB7B 4YTNA 5LGUB 3UQ7A 4DV6T 3ONLC 4H9PC 4UELA 5FVKA 1XMQT 3AXJA 2VQFT 2D0UA 5JDNA 4PW8A 3UU8A 1QSDA 3EDUA 3X1DA 5JR9C 3RRWA 3U3IA 2WDQA 5HYAA 2CBJA 2K9AA 4ZI2D 4NPPA 2WQYA 1XWMA 4U33A 2YEVC 4KI0F 4LF8T 4QH5A 2E2AA 4UV8B 3KV5A 2NW9A 3T8OA 4CZZB 4ZI7E 5IUXA 4QHOA 2Q9QD 3UU3A 2SPCA 5L3BB 2IMLA 3N9NA 1MMDA 2WB5A 3AT7A 4HFCA 5ABHA 4E7SA 4DV7T 2JQHA 4IDZA 4QXBB 2WWUA 4TNWA 4UV9B 5J2TE 3ZLIA 2UXBT 4AKHA 1VCSA 2FUPA 2WSSV 3JAEA 3FHNA 2LOPA 2H89A 4OYJA 3VKHA 4DNDA 2KVPA 4GK0E 1OEDA 2CXDA 2JIWA 3N5LA 4LMLA 1M7KA 5FYMA 4ONRA 1E2AA 3LK3B 2OA5A 1SA0E 3AEFA 3OYZA 4JBWF 4HTEA 3FB2A 4X62T 4TV8E 1L0VA 4ZHQE 3ZMZB 2CRBA 1XNQT 4JLEA 3A5XA 3ZEFB 5HCJA 1W09A 2NOXA 2BG9C 1T7SA 2KWIB 3WAJA 4CI1B 4CXYA 2WP9A 4PK4A 4HWCA 4MLKA 3EAMA 3ZT5A 4XAXB 4PK5A 3F2EA 4P0BA 2XY8B 2AXDS 5M4YA 3O1IA 3I1AA 2ZM2A 3UU6A 5JDFA 3FBZA 4A98A 1WRDA 2EHOB 5HEHA 3N9LA 2LM2A 5JRCB 3TLUA 5C2TA 5ADXL 4O2BE 2JRKA 3KFWX 1O3XA 3VR9A 5HCMA 1MMNA 3ZKRA 4K0KT 1CUNA 3AEDA 3DP7A 4LF6T 3T1YT 2L3LA 2BVMA 5LBMA 2CWOA 1ZEEA 2E5LT 3ZMTB 5AFUL 4JI1T 4MFRA 2MPKA 4UR9A 2IW5B 3SWHA 4LF9T 1MNEA 3JAFA 4ERRA 3AA0B 2V7MA 4GOUA 2WAUA 4GK5E 3RKOA 4OX9T 4TWHA 4HEAA 2V6XA 3UUMA 3ZMSB 1Y01A 3OYXA 2XAQB 2XQ5A 3TLVA 1IBMT 5JVDE 1WYCA 4DO0A 4GYSA 4PFOA 3RIAA 3RX6A 2LSGA 3PUWF 5BR8T 2KMFA 2LT3A 3QNUA 5LMUT 2E9XD 4CN6A 1HR0T 1YKHB 2M67A 4UF0A 5HXSA 4KHPT 5IYZE 1BR0A 4X66T 5EK3A 1YXRA 2C5IT 2HN1A 2WDVA 5CA1E 5JREA 3NRYA 3AY5A 1SE7A 3VR8A 5DQVA 4ZZBA 2YINA 4ILBA 2X9WA 4IL4A 2X67A 2W66A 3AVSA 1IJ5A 2CLYB 2CBIA 2UXNB 5AQRB 3TLTA 2JMHA 4ILUA 5J0ZA 5LHHB 2XASB 2FBWA 2YOEA 3L09A 5F8PA 4YY3T 4G2AA 3ZN1B 3M65A 3L8RA 1IJ6A 1MIWA 3N2OA 3QUJA 5JR9A 1WLXA 3B5MA 3RGLA 5JH7E 4JI7T 2V1DB 3AE7A 2A3DA 3UUBA 5EZYE 3MJXA 2YU2A 4UVBB 2BG9A 2H3RA 3H3MA 3PE0A 2J47A 4YXDA 5JDGA 2ACXA 3R6NA 4FJOA 2HHHT 3MKDA 5FY0A 3UTKA 4B6XA 1DU2A 4L9IA 1T72A 1J5WA 1V9DA 3NVOA 3UUNA 2V7LA 3ZT6A 3BK9A 4K0UA 3RKGA 1YQ4A 4AISA 5HXHA 2CE7A 4HWHA 3RPUA 2CMRA 1IAPA 3FZFB 4YHHT 1XNRT 1HG2A 2X0YA 5LBQB 4A5XA 4JI2T 1D1CA 4CN1A 3CMLA 2CPTA 2W63A 3AB3B 3CX7B 1D0XA 5CFBA 4HFIA 4GKJT 3NKZA 2P9BA 3AE9A 4O2AE 3W15B 2KXPB 5AQVB 4AQFC 4HGAA 4EZ4A 3GN5A 4Z90A 2E9XB 2N9DA 4WZXA 1OEDE 2XAFB 3ETUA 5ETWA 3MACA 5FL0A 3EUHA 5FZTA 4AKLA 3E22E 5FXVA 4IE7A 2KLQA 3IHRA 2LE8A 2VWAA 4OHFA 4EAHA 3CWZB 3ZYKA 3NZPA 5HXEA 2HN2A 4ASKA 1KNPA 1W0BA 5CA0E 3AE1A 4W8PA 5DJQC 4YSZA 2ZM6T 2XAHB 2X9YA 3GN5B 2HPLA 3D0TA 1G73A 3N9QA 4TN7B 4UVCB 5FKYA 3UQ4A 2RPAA 4X1KE 1WR6A 2HPJA 3KV6A 4J2CA 5KMGP 1R8IA 3G06A 1Z8UA 5LNKA 5JDMA 2CA5A 2D2SA 1BR2A 1H7CA 2ES0A 4EIWA 1HS7A 4IREA 1IBKT 2XQ6A 3RIUC 4JV5T 4NUUA 5FP3A 1SJ7A 1NENA 3RC8A 2IUBA 4AKIA 2EHOD 3HKBE 4NXMT 2QA7A 3CIRA 3FZMB 1LKXA 2W0GA 5EK4A 2BG9E 5FY1A 2ACZA 2CM0A 4DV5T 3M1CA 5L3GB 2VL0A 4OK0A 2G0UA 4JI3T 3P4PA 3AAIA 3RH3A 3ANWB 2WMNA 3O1HA 2I0MA 5AQFB 1I94T 1G8XA 2XHEB 4GYRA 4IGUA 1CHUA 3ONJA 3OVUA 4AKGA 2XAGB 4EEDA 4YSYA 2BS4A 1UUSA 2X0LB 3RIUA 5LGNB 5HEUA 3V5UA 4WBOA 4F7GB 4B3TT 4LF4T 4F6RC 4DUZT 2VKOA 3PV0F 3UULA 5A1LA 3C51A 3OBVE 3AE3A 1KEYA 2MOZA 3SFEA 1MIVA 3DJBA 3E08A 1XMOT 3QC9A 5HEJA 5AQKB 4EXTA 3P4WA 2H7OA 2NW7A 4ADZA 4DV1T 1KK7A 5H6QB 5LHGB 3P7IA 4DUYT 2JMKA 1U4QA 3A7MA 3ANWA 3GWHA 5KDMC 2VASA 1IBLT 2MTCA 4IL9A 2IHR1 3RYIE 4YSXA 3ZPOA 2RP4A 3AECA 3SS1A 4U2ZA 3J9X1 2GK9A 3PTRB 4QKNA 5J2UE 3ZYLA 5JQGE 2NTYA 4IIJE 4H63V 1T98A 3K1SA 3RHWA 4Z91A 5LHIB 3AE6A 3MK7C 2NWBA 4IDPA 1IZNB 3LBXA 4EYUA 4YT0A 3PHF1 4ZI3C 3FYQA 2B76A 2WDRA 2VL8A 5L3FB 5JR9B 1SJ8A 3H3AA 3Q5WA 4XBFB 3O1JA 4QH1A 3ZN0B 4BAYB 2LSIA 2X0CA 2EHOC 4Q25A 2OLTA 3PU3A 4LF5T 1AJ3A 1QLBA 3QK6A 4G63A 4PNIA 4XZCA 2IC6A 4LFCT 3KVBA 2DHRA 4WYVA 4L5GA 4AQYT 4U7YA 2PG8A 5KX5E 4HWFA 5LMNT 2JPFA 4JI6T 4YJ2E 2N1GA 3FZKB 4DVDA 4ZEYA 1HF8A 1SHZC 3HA4A 2VKDA 2PBIA 2JQQA 5AQOB 2YKSA 3A8YC 2ZLYA 4I43B 1HG5A 1M62A 3C4XA 3PUGA 3PU8A 2E9XA 4IDQA 5FY7A 5FXWA 1HFAA 4H9RC 2L9QA 4QWNB 4O4JE 4TX5A 2MBGA 3R84B 4DIDB 2LHNA 5FXXA 4DR5T 2WZHA 3RF1A 4CI3B 2VQET 1HTJF 1I6ZA 2JQKA 3NWIA 4IE5A 3EHZA 5LOVE 4LFAT 3PUQA 4JEHB 3N2KE 3K3NA 4GIWA 1N34T 1N33T 3PUYF 4EB6E 3Q5DA 4KHZF 2OV9A 3RQWA 3AEGA 4H9NC 4N78D 4YHJA 3RRCA 3ZSTA 4ZS2A 4DV2T 2KSRA 3FBLA 5L47A 2C5KT 2XTLA 2MAWA 2PFVA 5LXTE 5FL1A 4CN4A 3EI0A 3OPCA 2XQ4A 1ZP0A 5FNVE 3ZMUB 4P0AA 2XQ3A 3C98B 1D0YA 1YD8G 2NTXA 2ZM0A 3LFMA 4OFZA 2YK0A 3LK42 4M1PA 3RI5A 3ZJ2A 4CXWA 3HKEE 4EOZB 1OXZA 5E0OA 1MNDA 1KF6A 2LSYA 4QXHB 2LOSA 2QGSA 3CQXC 4HFVA 3M3ZB 2ODVA 1UX5A 2CEAA 4O8SA 5AQTB 4UIGA 4HFEA 4ILCA 5HWYA 1XDOA 5LJMA 1ZOYA 5AQSB 1VOMA 5H6RB 1BR4A 2YDRA 4I4TE 5ABGA 2JJ9A 3CX8B 2WU2A 2KBBA 2UUCT 4JEUB 3P4QA 4X1YE 3CQCB 3AXJB 3ZMVB 4C91A 2XM2A 1E7PA 2AE9A 3IF8B 1UX4A 2LM9A 2VVSA 2CXFA 3L3PA 4IHJE 4UXNB 4DBQA 5LG3A 3PUXF 4GKKT 3KBTA 2YN6A 1UURA 3ABVA 2C0SA 4YFSA 3HR0A 4AXPA 4B3ST 4UEMA 5CB4E 5L2LA 3WSCA 2UU9T 4U2YA 3IA3A 5ABFA 3B57A 4OYKA 4PFPA 4ZXLA 3O9XA 2V5CA 3K3OA 3F31A 3BQIA 1NAFA 3GMIA 4DV4T 4H9OC 5HXRA 3CX6B 2J4GA 4MBQA 2V26A 3C4WA 3PUSA 4U7IA 3RYHE 2V7KA 4PJJA 2KWHA 4YJ3E 5LJNA 5IHYA 2PTFA 4BA9A 2L7NA 2KT9A 2K3WA 4HFBA 4QX8B 5LGTB 2W67A 3AVRA 3AEEA 3H37A 2BG9B 4IDNA 3PJAA 1J1JA 3PUAA 4NUVA 2WS3A 4A97A 4C90A 4JUYA 1D1AA 1EZ3A 3P8CD 3C4ZA 3VRBA 3HKCE 2F4VT 2XQ7A 3ESLA 5ABEA 4JI0T 5JRCA 5J1GA 2ZMAA 1NWMX 2EHOA 3KV9A 3EDVA 4I0UA 2D5UA 4O4HE 1T8BA 4H9SE 2VB6A 5AQNB 2WWVA 2UUBT 3RYCE 2WCAA 3IBPA 2N2NA 3LDQB 3VHLA 3AE2A 2Z6EA 2DLRA 2W00A 5KXJA 4DBRA 3SFDA 3Q5EA 3OTOT 4DR3T 2CLYC 3QB5K 2XQAA 4ILAA 5F3JA 2JQ9A 2KGXA 5LYJE 4H9QC 2BVLA 2IIUA 3UFEA 5FMNA 3B13A 2BKOA 4IE0A 4DR6T 2LHRA 3P50A 4PK6A 2VVNA 4PJNA 5GONE 1FMVA 2M6BA 5EK2A 5L3EB 4IE6A 3C50A 4HFHA 4QX7B 3VRAA 1UCUA 1HNXT 4DV0T 1HX1B 3AAEB 3TLSA 1OEDB 3RLFF 3JCFA 2BBHA 5AQPB 5T1DA 2X0HA 5LA6E 5FVLA 2BKNA 1D0ZA 3E0ZA 3HL6A 4FI5A 1OWAA 2XPKA 3CVRA 5TAOA 5JTGA 4HKAA 5AQGB 2XJ7A 4KP3C 1KNRA 2WZIA 3FZHB 2I6HA 3JADA 3BQKA 3KV4A 3WI3A 1XZYA 2V7IA 3U78A 3ZT7A 4LF7T 3TKLB 1FIOA 2BDEA 3ZSSA 2CXLA 3UFGA 5C3JA 2DWKA 2XQ8A 4KX6A 3SOLA 4AQGA 3ZYMA 5L3CB 3ZC1A 3ZCJA 2BS2A 1YW0A 2VKJA 4ANJA 2HH7A 3UT5E 4JI4T 4DR4T 2LQUA 4U74A 3I0OA 3S4UA 4AQFA 2PJQA 3MXZA 3NRXA 1Y64B 4L0RA
chains in the Genus database with same CATH topology
3IEEA 2VKHA 3NZQA 2W61A 2IAKA 5HWXA 4X1IE 5BMVE 2ZM8A 3LK2B 1ZV4X 4UF0B 5L3DB 4ISSA 2Q9QA 5HXCA 2Y8DA 3DTOA 4H63H 2C5JA 2WM9A 1MMGA 4ZS3A 3V5SA 2X9HA 5LCYA 5HAXA 2XUEA 2XAJB 2NW8A 3HKDE 2Y6XA 4I55E 2WBLA 5JDQA 4CI2B 4KUMB 5DQWA 4O4LE 2Q9QB 4HE8A 4HN9A 5DABA 2ODUA 3MZKB 3AA1B 3RC3A 3LG7A 2H7VC 3PURA 1LVKA 2A2FX 3UUXB 5JDHA 3BQLA 1B7TA 3OJAA 1ZKEA 1Z0PA 2KZ7B 4TUYE 2DI4A 1WYBA 4BJMA 2J1DG 3LJCA 4E7ZA 3KBUA 3RYFE 3N2GE 4DMVA 2CWYA 1S94A 3K8PC 4ZOLE 1KNZA 2A72A 3KDSE 2D0TA 2E9XC 3WAKA 3JC6D 4A56A 3Q2MA 3N9PA 2KINB 4P09A 2DNXA 3ZJ1A 3I9YA 1HCIA 4U72A 4WW0A 2X68A 4X20E 3VU7H 2WMOA 2L8KA 3JC6C 3OKQA 2MTQA 4V1Av 2LSJA 2Y48B 1MMAA 3N9OA 3Q9DA 3I9WA 4IE4A 1LRZA 1ZHCA 2CCQA 2B1EA 4MHCA 3SRZA 3KINB 2DWGA 3AA6B 4MALA 4PAGA 2K48A 4I50E 3ZCIA 3FXDB 3MA9A 3WURA 1FMWA 4WBNE 3PF0A 4PJLA 3CPZA 1QUUA 1D1BA 4O4IE 2I59A 4CXXA 2UXXB 3ETVA 5C8YE 5LG4A 5JDLA 2LEHA 2W62A 2X51A 4WNKA 2K24A 3NBXX 3KVAA 1MIYA 3C64A 4TZ4C 4DMWA 2V7JA 3HI2A 1E1HB 4ECGA 4UVAB 1US7B 1LVFA 1HX8A 3Q5XA 3VJZA 3EVYA 4QXCB 2X9XA 2MYSA 3AA7B 3O4XE 1X79A 3VKGA 1U5PA 2IC9A 1BR1A 3PDYA 4AKRB 1VRBA 4KMCA 2LJLA 3K3QC 3LBXB 4YLHA 4CQIA 3AAAB 2YU1A 2X66A 3CQGB 2KNDA 4EYYR 2VK9A 5FXZA 3J7Yq 2Q9QC 2DCFA 3FXEB 1FEWA 4ZI3D 2NP9A 3I0QA 4ZI2C 4ISTA 3ONXA 4PJMA 2K5BB 4KBMB 2E8IA 3N9MA 2RA1A 3GA8A 3F57A 1S35A 2BZBA 2XQYA 5LP6E 1YKEB 4TV9E 3ZC0A 4EZHA 2LSKA 3CKDA 4Z8XA 5LGUB 4H9PC 4UELA 2D0UA 4PW8A 1QSDA 3EDUA 5JR9C 3RRWA 3U3IA 5HYAA 2K9AA 4ZI2D 4BJNA 2YEVC 2NW9A 5JDNA 4UV8B 3T8OA 3KV5A 4ZI7E 4CZZB 4QHOA 2Q9QD 5L3BB 2SPCA 3AT7A 3N9NA 1MMDA 4E7SA 4QXBB 4IDZA 4UV9B 2WWUA 5J2TE 3ZLIA 4AKHA 2WSSV 3FHNA 2LOPA 4OYJA 3VKHA 4DNDA 4GK0E 2CXDA 3N5LA 5FYMA 4ONRA 3LK3B 2OA5A 1SA0E 3OYZA 4HTEA 3FB2A 4TV8E 4ZHQE 3ZMZB 4JLEA 3A5XA 3ZEFB 2NOXA 2KWIB 3WAJA 4CXYA 4CI1B 4PK4A 4MLKA 4XAXB 4PK5A 3F2EA 4P0BA 3O1IA 3I1AA 2ZM2A 5JDFA 3FBZA 1WRDA 2EHOB 3N9LA 5JRCB 5ADXL 4O2BE 2JRKA 3KFWX 1O3XA 1MMNA 1CUNA 3DP7A 2L3LA 2BVMA 5LBMA 2CWOA 1ZEEA 3ZMTB 5AFUL 4MFRA 2IW5B 3SWHA 1MNEA 4ERRA 3AA0B 2V7MA 4GOUA 2WAUA 4GK5E 3RKOA 4HEAA 3UUMA 3ZMSB 3OYXA 2XAQB 5JVDE 1WYCA 4DO0A 4GYSA 4PFOA 3RX6A 2LSGA 2KMFA 2LT3A 2E9XD 1YKHB 2M67A 4UF0A 5HXSA 1BR0A 5IYZE 5EK3A 2C5IT 5CA1E 5JREA 3NRYA 5DQVA 2YINA 2X9WA 2X67A 3AVSA 1IJ5A 2CLYB 2UXNB 2JMHA 4ILUA 5LHHB 2XASB 3L09A 5F8PA 4G2AA 3ZN1B 3M65A 1IJ6A 1MIWA 3N2OA 3QUJA 5JR9A 1WLXA 5JH7E 2V1DB 2A3DA 5M4YA 5EZYE 3MJXA 2YU2A 4UVBB 2H3RA 3PE0A 5JDGA 2ACXA 3R6NA 4FJOA 3MKDA 5FY0A 3UTKA 4B6XA 4L9IA 1V9DA 3UUNA 2V7LA 3BK9A 4K0UA 5HXHA 2CE7A 3RPUA 2CMRA 1IAPA 1HG2A 5LBQB 1D1CA 3CMLA 2W63A 3AB3B 3CX7B 4AI6A 1D0XA 2P9BA 4O2AE 3W15B 2KXPB 4AQFC 4HGAA 4EZ4A 3GN5A 2E9XB 2N9DA 5ETWA 2XAFB 3ETUA 3MACA 3EUHA 4AKLA 3E22E 5FXVA 4IE7A 2KLQA 3IHRA 2LE8A 2VWAA 4OHFA 4EAHA 3CWZB 3ZYKA 3NZPA 5HXEA 4ASKA 5CA0E 5DJQC 2XAHB 2X9YA 3GN5B 2HPLA 3D0TA 1G73A 3N9QA 4TN7B 4UVCB 4X1KE 1WR6A 2HPJA 3KV6A 4J2CA 5KMGP 5LNKA 5JDMA 2CA5A 2D2SA 1BR2A 1H7CA 2ES0A 4EIWA 1HS7A 4NUUA 5FP3A 3RC8A 4AKIA 2EHOD 3HKBE 2QA7A 1LKXA 2W0GA 5EK4A 3M1CA 5FY1A 2CM0A 5L3GB 4OK0A 2G0UA 3RH3A 3AAIA 3ANWB 2WMNA 3O1HA 1G8XA 2XHEB 4GYRA 4IGUA 2XAGB 2X0LB 5LGNB 3V5UA 4WBOA 4F6RC 2VKOA 3UULA 3C51A 3OBVE 2MOZA 1MIVA 3DJBA 3E08A 3QC9A 4EXTA 2H7OA 2NW7A 4ADZA 1KK7A 5H6QB 5LHGB 3P7IA 2JMKA 1U4QA 3ANWA 3GWHA 5KDMC 2VASA 2MTCA 3RYIE 3ZPOA 2RP4A 3SS1A 5J2UE 3J9X1 4AKGA 2GK9A 3PTRB 4QKNA 3ZYLA 5JQGE 2NTYA 4IIJE 4H63V 1T98A 5LHIB 3MK7C 2NWBA 1IZNB 3LBXA 4EYUA 3PHF1 4ZI3C 2VL8A 5L3FB 5JR9B 3H3AA 3Q5WA 4XBFB 3O1JA 3ZN0B 4BAYB 2LSIA 4BGOA 2EHOC 3PU3A 1AJ3A 4G63A 3QK6A 4PNIA 4XZCA 2IC6A 3KVBA 2DHRA 4L5GA 2PG8A 5KX5E 2JPFA 4YJ2E 2N1GA 4DVDA 3HA4A 1HF8A 1SHZC 2VKDA 2PBIA 2JQQA 4I43B 2ZLYA 5FY7A 1HG5A 3C4XA 3PUGA 3PU8A 2E9XA 5FXWA 1HFAA 4H9RC 2L9QA 4QWNB 4O4JE 4TX5A 2MBGA 3R84B 2LHNA 5FXXA 4CI3B 1HTJF 4IE5A 5LOVE 3PUQA 4JEHB 3N2KE 3K3NA 4GIWA 4EB6E 4N78D 4H9NC 4YHJA 3RRCA 4ZS2A 3FBLA 2C5KT 2XTLA 5LXTE 2PFVA 5FNVE 4P0AA 3C98B 1D0YA 1YD8G 2NTXA 2ZM0A 3LFMA 4OFZA 2YK0A 3LK42 4M1PA 3ZJ2A 4CXWA 4EOZB 3HKEE 1OXZA 5E0OA 1MNDA 2LSYA 4QXHB 2LOSA 2QGSA 3CQXC 4HFVA 4O8SA 2ODVA 1UX5A 2CEAA 5A1LA 4UIGA 5HWYA 5LJMA 3ZMUB 1VOMA 5H6RB 1BR4A 4I4TE 2JJ9A 3CX8B 4JEUB 4X1YE 3ZMVB 3CQCB 4C91A 3L3PA 3IF8B 1UX4A 2LM9A 2CXFA 4IHJE 4UXNB 4DBQA 3KBTA 2C0SA 4YFSA 3HR0A 4AXPA 4UEMA 5CB4E 5L2LA 3WSCA 3B57A 4OYKA 4PFPA 3O9XA 3K3OA 3F31A 3BQIA 1NAFA 3GMIA 4H9OC 5HXRA 3CX6B 4MBQA 2V26A 3C4WA 3PUSA 3RYHE 2V7KA 4PJJA 2KWHA 4YJ3E 5LJNA 5IHYA 4BA9A 2KT9A 4QX8B 5LGTB 3AVRA 3H37A 4NUVA 3PUAA 4C90A 4JUYA 1D1AA 1EZ3A 3P8CD 3C4ZA 3HKCE 3ESLA 5JRCA 5J1GA 2ZMAA 1NWMX 2EHOA 3KV9A 3EDVA 2D5UA 4O4HE 4H9SE 2VB6A 3RYCE 3IBPA 2N2NA 3VHLA 2Z6EA 2DLRA 2W00A 4DBRA 2CLYC 5F3JA 5LYJE 4H9QC 2BVLA 3UFEA 5FMNA 3B13A 4IE0A 2LHRA 4PK6A 4PJNA 5GONE 1FMVA 5EK2A 5L3EB 4IE6A 3C50A 4QX7B 1UCUA 3AAEB 5T1DA 5LA6E 3E0ZA 1D0ZA 3HL6A 4FI5A 1OWAA 3CVRA 5TAOA 4HKAA 4KP3C 3KV4A 3BQKA 3WI3A 2V7IA 3U78A 3TKLB 1FIOA 2BDEA 2CXLA 2DWKA 3SOLA 4AQGA 3ZYMA 5L3CB 3ZC1A 3ZCJA 1YW0A 2VKJA 4ANJA 2HH7A 3UT5E 2LQUA 4U74A 3I0OA 3S4UA 4AQFA 2PJQA 3MXZA 3NRXA 1Y64B 4L0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDL A;  5HXH A;  3V5U A;  5JDH A;  5JDN A;  5HXC A;  5HXS A;  5HXR A;  5HWY A;  5HWX A;  5JDG A;  3V5S A;  5JDM A;  5HYA A;  5JDQ A;  5JDF A;  5HXE A; 
#chains in the Genus database with same CATH topology
 3IEE A;  2VKH A;  3NZQ A;  1W0A A;  5AQQ B;  2W61 A;  3RQU A;  2IAK A;  5HWX A;  4X64 T;  4X1I E;  5BMV E;  2ZM8 A;  4DR7 T;  3LK2 B;  1ZV4 X;  2LLY A;  4UF0 B;  5L3D B;  4ISS A;  2Q9Q A;  2V6Y A;  3P4R A;  5HXC A;  2A9U A;  2Y8D A;  3AEB A;  3DTO A;  3UU5 A;  4H63 H;  2C5J A;  2WM9 A;  2XZE A;  1MMG A;  3PUZ F;  3CK6 A;  2X9H A;  4ZS3 A;  2IDO B;  5LCY A;  3V5S A;  2WU5 A;  5HAX A;  2XUE A;  4LFB T;  2XAJ B;  1GQE A;  2NW8 A;  3HKD E;  2Y6X A;  3T1H T;  4I55 E;  2WBL A;  4U3C A;  4BJN A;  4CI2 B;  5JDQ A;  4KUM B;  5DQW A;  4O4L E;  4BGO A;  3AE5 A;  4JI8 T;  2LKG A;  2J62 A;  2Q9Q B;  2V6Y B;  4EV6 A;  5AQJ B;  5AQI B;  4HE8 A;  2UXC T;  4HN9 A;  5DAB A;  2NR4 A;  2ODU A;  5ABF B;  3MZK B;  3AA1 B;  3RC3 A;  2FJA A;  2H7V C;  2XSB A;  1LVK A;  2A2F X;  3AEA A;  3LG7 A;  3BQL A;  3PUR A;  1B7T A;  2VUR A;  3UUX B;  5JDH A;  3OJA A;  1VCT A;  1Z0P A;  1ZKE A;  4U31 A;  2KZ7 B;  4TUY E;  2DI4 A;  5CGM A;  1WYB A;  4BJM A;  2J1D G;  1KFY A;  3LJC A;  4E7Z A;  3KBU A;  3RYF E;  3N2G E;  4DMV A;  1WFD A;  1S94 A;  2CWY A;  3K8P C;  3PUV F;  4ZOL E;  4IDO A;  1UGO A;  5IWA T;  1KNZ A;  4NIQ A;  2BKP A;  2A72 A;  2XSA A;  3KDS E;  3LSV A;  4NXN T;  2D0T A;  2E9X C;  5F5W A;  3JC6 D;  5AQH B;  3Q2M A;  3WAK A;  4A56 A;  3N9P A;  2KIN B;  4P09 A;  2DNX A;  3ZJ1 A;  3I9Y A;  1HCI A;  3L39 A;  4U72 A;  4WW0 A;  4YTP A;  2L10 A;  2X68 A;  4X20 E;  3VU7 H;  2WMO A;  2L8K A;  3JC6 C;  2QYW A;  5AQM B;  3OKQ A;  3QOF A;  2MTQ A;  4EEB A;  4EGW A;  2DL1 A;  2FJD A;  4V1A v;  2LSJ A;  2Y48 B;  1MMA A;  2YDS A;  3N9O A;  3Q9D A;  4TWF A;  2BS3 A;  3I9W A;  2FJB A;  2CHO A;  2V8S V;  4IE4 A;  2M6I A;  2D9D A;  2V5D A;  1OED C;  1LRZ A;  1ZHC A;  2CCQ A;  2CHN A;  2QRX A;  2B1E A;  4MHC A;  5L4E A;  1JNR A;  3P4S A;  1WR0 A;  3KIN B;  5HEG A;  3SRZ A;  1J5E T;  2E5V A;  1HNZ T;  2DWG A;  3AA6 B;  4MAL A;  4PAG A;  1JNZ A;  1XDP A;  3UU4 A;  2K48 A;  1YQ3 A;  3TLW A;  4I50 E;  3ZCI A;  3FXD B;  1X9B A;  3MA9 A;  3WUR A;  4P1N A;  1FMW A;  4WBN E;  4LMK A;  3PF0 A;  1N32 T;  4PJL A;  3CPZ A;  1QUU A;  1D1B A;  5HEO A;  4O4I E;  2I59 A;  4CXX A;  2UXX B;  2YDQ A;  3ETV A;  5C8Y E;  5JDL A;  5LG4 A;  2LEH A;  4LMJ A;  2W62 A;  2BBJ A;  2X51 A;  4WNK A;  2K24 A;  3NBX X;  4X5T A;  4JI5 T;  3KVA A;  2XM1 A;  5AQL B;  1MIY A;  3C64 A;  4B3M T;  1FJG T;  4TZ4 C;  2QVA A;  4DMW A;  2V7J A;  1N36 T;  3HI2 A;  1E1H B;  4ECG A;  2XQ9 A;  1WCR A;  4UVA B;  2W2U A;  1US7 B;  2W4X A;  1LVF A;  1HX8 A;  3Q5X A;  3FZL B;  4X65 T;  3EVY A;  4QXC B;  2X9X A;  4DR2 T;  3VJZ A;  1UK5 A;  2MYS A;  1SUM B;  1W9R A;  2FJE A;  3AA7 B;  3O4X E;  5AQU B;  4COF A;  1X79 A;  3VKG A;  1U5P A;  2IC9 A;  2LKH A;  2WY2 A;  2UXD T;  1BR1 A;  3PDY A;  3PJA J;  4AKR B;  4F8H A;  1VRB A;  4ZZC A;  4KMC A;  4HWI B;  2LJL A;  3K3Q C;  3LBX B;  4YLH A;  1NEK A;  3AAA B;  2YU1 A;  4YTM A;  4AIU A;  2X66 A;  4CQI A;  4DR1 T;  4JYA T;  3CQG B;  2KND A;  3AE8 A;  2H88 A;  5L4H A;  4EYY R;  4DV3 T;  2VK9 A;  5FXZ A;  4TWD A;  3J7Y q;  2Q9Q C;  2DCF A;  3FXE B;  2UUA T;  1FEW A;  4ZI3 D;  1HNW T;  2NP9 A;  3I0Q A;  4IT4 A;  4HFD A;  4AI6 A;  4ZI2 C;  4TNV A;  4IST A;  3DYJ A;  3ONX A;  4PJM A;  2K5B B;  2LRL A;  2E8I A;  4KBM B;  3N9M A;  2LRK A;  2RA1 A;  3QB5 A;  5CJ5 A;  4B3R T;  4HWD A;  3RIF A;  3EAB A;  3GA8 A;  3AE4 A;  3F57 A;  1S35 A;  2BZB A;  2XQY A;  5LP6 E;  2R6G F;  1YKE B;  4TV9 E;  3ZC0 A;  4EZH A;  4QH4 A;  2LSK A;  3CKD A;  4Z8X A;  5LB7 B;  4YTN A;  5LGU B;  3UQ7 A;  4DV6 T;  3ONL C;  4H9P C;  4UEL A;  5FVK A;  1XMQ T;  3AXJ A;  2VQF T;  2D0U A;  5JDN A;  4PW8 A;  3UU8 A;  1QSD A;  3EDU A;  3X1D A;  5JR9 C;  3RRW A;  3U3I A;  2WDQ A;  5HYA A;  2CBJ A;  2K9A A;  4ZI2 D;  4NPP A;  2WQY A;  1XWM A;  4U33 A;  2YEV C;  4KI0 F;  4LF8 T;  4QH5 A;  2E2A A;  4UV8 B;  3KV5 A;  2NW9 A;  3T8O A;  4CZZ B;  4ZI7 E;  5IUX A;  4QHO A;  2Q9Q D;  3UU3 A;  2SPC A;  5L3B B;  2IML A;  3N9N A;  1MMD A;  2WB5 A;  3AT7 A;  4HFC A;  5ABH A;  4E7S A;  4DV7 T;  2JQH A;  4IDZ A;  4QXB B;  2WWU A;  4TNW A;  4UV9 B;  5J2T E;  3ZLI A;  2UXB T;  4AKH A;  1VCS A;  2FUP A;  2WSS V;  3JAE A;  3FHN A;  2LOP A;  2H89 A;  4OYJ A;  3VKH A;  4DND A;  2KVP A;  4GK0 E;  1OED A;  2CXD A;  2JIW A;  3N5L A;  4LML A;  1M7K A;  5FYM A;  4ONR A;  1E2A A;  3LK3 B;  2OA5 A;  1SA0 E;  3AEF A;  3OYZ A;  4JBW F;  4HTE A;  3FB2 A;  4X62 T;  4TV8 E;  1L0V A;  4ZHQ E;  3ZMZ B;  2CRB A;  1XNQ T;  4JLE A;  3A5X A;  3ZEF B;  5HCJ A;  1W09 A;  2NOX A;  2BG9 C;  1T7S A;  2KWI B;  3WAJ A;  4CI1 B;  4CXY A;  2WP9 A;  4PK4 A;  4HWC A;  4MLK A;  3EAM A;  3ZT5 A;  4XAX B;  4PK5 A;  3F2E A;  4P0B A;  2XY8 B;  2AXD S;  5M4Y A;  3O1I A;  3I1A A;  2ZM2 A;  3UU6 A;  5JDF A;  3FBZ A;  4A98 A;  1WRD A;  2EHO B;  5HEH A;  3N9L A;  2LM2 A;  5JRC B;  3TLU A;  5C2T A;  5ADX L;  4O2B E;  2JRK A;  3KFW X;  1O3X A;  3VR9 A;  5HCM A;  1MMN A;  3ZKR A;  4K0K T;  1CUN A;  3AED A;  3DP7 A;  4LF6 T;  3T1Y T;  2L3L A;  2BVM A;  5LBM A;  2CWO A;  1ZEE A;  2E5L T;  3ZMT B;  5AFU L;  4JI1 T;  4MFR A;  2MPK A;  4UR9 A;  2IW5 B;  3SWH A;  4LF9 T;  1MNE A;  3JAF A;  4ERR A;  3AA0 B;  2V7M A;  4GOU A;  2WAU A;  4GK5 E;  3RKO A;  4OX9 T;  4TWH A;  4HEA A;  2V6X A;  3UUM A;  3ZMS B;  1Y01 A;  3OYX A;  2XAQ B;  2XQ5 A;  3TLV A;  1IBM T;  5JVD E;  1WYC A;  4DO0 A;  4GYS A;  4PFO A;  3RIA A;  3RX6 A;  2LSG A;  3PUW F;  5BR8 T;  2KMF A;  2LT3 A;  3QNU A;  5LMU T;  2E9X D;  4CN6 A;  1HR0 T;  1YKH B;  2M67 A;  4UF0 A;  5HXS A;  4KHP T;  5IYZ E;  1BR0 A;  4X66 T;  5EK3 A;  1YXR A;  2C5I T;  2HN1 A;  2WDV A;  5CA1 E;  5JRE A;  3NRY A;  3AY5 A;  1SE7 A;  3VR8 A;  5DQV A;  4ZZB A;  2YIN A;  4ILB A;  2X9W A;  4IL4 A;  2X67 A;  2W66 A;  3AVS A;  1IJ5 A;  2CLY B;  2CBI A;  2UXN B;  5AQR B;  3TLT A;  2JMH A;  4ILU A;  5J0Z A;  5LHH B;  2XAS B;  2FBW A;  2YOE A;  3L09 A;  5F8P A;  4YY3 T;  4G2A A;  3ZN1 B;  3M65 A;  3L8R A;  1IJ6 A;  1MIW A;  3N2O A;  3QUJ A;  5JR9 A;  1WLX A;  3B5M A;  3RGL A;  5JH7 E;  4JI7 T;  2V1D B;  3AE7 A;  2A3D A;  3UUB A;  5EZY E;  3MJX A;  2YU2 A;  4UVB B;  2BG9 A;  2H3R A;  3H3M A;  3PE0 A;  2J47 A;  4YXD A;  5JDG A;  2ACX A;  3R6N A;  4FJO A;  2HHH T;  3MKD A;  5FY0 A;  3UTK A;  4B6X A;  1DU2 A;  4L9I A;  1T72 A;  1J5W A;  1V9D A;  3NVO A;  3UUN A;  2V7L A;  3ZT6 A;  3BK9 A;  4K0U A;  3RKG A;  1YQ4 A;  4AIS A;  5HXH A;  2CE7 A;  4HWH A;  3RPU A;  2CMR A;  1IAP A;  3FZF B;  4YHH T;  1XNR T;  1HG2 A;  2X0Y A;  5LBQ B;  4A5X A;  4JI2 T;  1D1C A;  4CN1 A;  3CML A;  2CPT A;  2W63 A;  3AB3 B;  3CX7 B;  1D0X A;  5CFB A;  4HFI A;  4GKJ T;  3NKZ A;  2P9B A;  3AE9 A;  4O2A E;  3W15 B;  2KXP B;  5AQV B;  4AQF C;  4HGA A;  4EZ4 A;  3GN5 A;  4Z90 A;  2E9X B;  2N9D A;  4WZX A;  1OED E;  2XAF B;  3ETU A;  5ETW A;  3MAC A;  5FL0 A;  3EUH A;  5FZT A;  4AKL A;  3E22 E;  5FXV A;  4IE7 A;  2KLQ A;  3IHR A;  2LE8 A;  2VWA A;  4OHF A;  4EAH A;  3CWZ B;  3ZYK A;  3NZP A;  5HXE A;  2HN2 A;  4ASK A;  1KNP A;  1W0B A;  5CA0 E;  3AE1 A;  4W8P A;  5DJQ C;  4YSZ A;  2ZM6 T;  2XAH B;  2X9Y A;  3GN5 B;  2HPL A;  3D0T A;  1G73 A;  3N9Q A;  4TN7 B;  4UVC B;  5FKY A;  3UQ4 A;  2RPA A;  4X1K E;  1WR6 A;  2HPJ A;  3KV6 A;  4J2C A;  5KMG P;  1R8I A;  3G06 A;  1Z8U A;  5LNK A;  5JDM A;  2CA5 A;  2D2S A;  1BR2 A;  1H7C A;  2ES0 A;  4EIW A;  1HS7 A;  4IRE A;  1IBK T;  2XQ6 A;  3RIU C;  4JV5 T;  4NUU A;  5FP3 A;  1SJ7 A;  1NEN A;  3RC8 A;  2IUB A;  4AKI A;  2EHO D;  3HKB E;  4NXM T;  2QA7 A;  3CIR A;  3FZM B;  1LKX A;  2W0G A;  5EK4 A;  2BG9 E;  5FY1 A;  2ACZ A;  2CM0 A;  4DV5 T;  3M1C A;  5L3G B;  2VL0 A;  4OK0 A;  2G0U A;  4JI3 T;  3P4P A;  3AAI A;  3RH3 A;  3ANW B;  2WMN A;  3O1H A;  2I0M A;  5AQF B;  1I94 T;  1G8X A;  2XHE B;  4GYR A;  4IGU A;  1CHU A;  3ONJ A;  3OVU A;  4AKG A;  2XAG B;  4EED A;  4YSY A;  2BS4 A;  1UUS A;  2X0L B;  3RIU A;  5LGN B;  5HEU A;  3V5U A;  4WBO A;  4F7G B;  4B3T T;  4LF4 T;  4F6R C;  4DUZ T;  2VKO A;  3PV0 F;  3UUL A;  5A1L A;  3C51 A;  3OBV E;  3AE3 A;  1KEY A;  2MOZ A;  3SFE A;  1MIV A;  3DJB A;  3E08 A;  1XMO T;  3QC9 A;  5HEJ A;  5AQK B;  4EXT A;  3P4W A;  2H7O A;  2NW7 A;  4ADZ A;  4DV1 T;  1KK7 A;  5H6Q B;  5LHG B;  3P7I A;  4DUY T;  2JMK A;  1U4Q A;  3A7M A;  3ANW A;  3GWH A;  5KDM C;  2VAS A;  1IBL T;  2MTC A;  4IL9 A;  2IHR 1;  3RYI E;  4YSX A;  3ZPO A;  2RP4 A;  3AEC A;  3SS1 A;  4U2Z A;  3J9X 1;  2GK9 A;  3PTR B;  4QKN A;  5J2U E;  3ZYL A;  5JQG E;  2NTY A;  4IIJ E;  4H63 V;  1T98 A;  3K1S A;  3RHW A;  4Z91 A;  5LHI B;  3AE6 A;  3MK7 C;  2NWB A;  4IDP A;  1IZN B;  3LBX A;  4EYU A;  4YT0 A;  3PHF 1;  4ZI3 C;  3FYQ A;  2B76 A;  2WDR A;  2VL8 A;  5L3F B;  5JR9 B;  1SJ8 A;  3H3A A;  3Q5W A;  4XBF B;  3O1J A;  4QH1 A;  3ZN0 B;  4BAY B;  2LSI A;  2X0C A;  2EHO C;  4Q25 A;  2OLT A;  3PU3 A;  4LF5 T;  1AJ3 A;  1QLB A;  3QK6 A;  4G63 A;  4PNI A;  4XZC A;  2IC6 A;  4LFC T;  3KVB A;  2DHR A;  4WYV A;  4L5G A;  4AQY T;  4U7Y A;  2PG8 A;  5KX5 E;  4HWF A;  5LMN T;  2JPF A;  4JI6 T;  4YJ2 E;  2N1G A;  3FZK B;  4DVD A;  4ZEY A;  1HF8 A;  1SHZ C;  3HA4 A;  2VKD A;  2PBI A;  2JQQ A;  5AQO B;  2YKS A;  3A8Y C;  2ZLY A;  4I43 B;  1HG5 A;  1M62 A;  3C4X A;  3PUG A;  3PU8 A;  2E9X A;  4IDQ A;  5FY7 A;  5FXW A;  1HFA A;  4H9R C;  2L9Q A;  4QWN B;  4O4J E;  4TX5 A;  2MBG A;  3R84 B;  4DID B;  2LHN A;  5FXX A;  4DR5 T;  2WZH A;  3RF1 A;  4CI3 B;  2VQE T;  1HTJ F;  1I6Z A;  2JQK A;  3NWI A;  4IE5 A;  3EHZ A;  5LOV E;  4LFA T;  3PUQ A;  4JEH B;  3N2K E;  3K3N A;  4GIW A;  1N34 T;  1N33 T;  3PUY F;  4EB6 E;  3Q5D A;  4KHZ F;  2OV9 A;  3RQW A;  3AEG A;  4H9N C;  4N78 D;  4YHJ A;  3RRC A;  3ZST A;  4ZS2 A;  4DV2 T;  2KSR A;  3FBL A;  5L47 A;  2C5K T;  2XTL A;  2MAW A;  2PFV A;  5LXT E;  5FL1 A;  4CN4 A;  3EI0 A;  3OPC A;  2XQ4 A;  1ZP0 A;  5FNV E;  3ZMU B;  4P0A A;  2XQ3 A;  3C98 B;  1D0Y A;  1YD8 G;  2NTX A;  2ZM0 A;  3LFM A;  4OFZ A;  2YK0 A;  3LK4 2;  4M1P A;  3RI5 A;  3ZJ2 A;  4CXW A;  3HKE E;  4EOZ B;  1OXZ A;  5E0O A;  1MND A;  1KF6 A;  2LSY A;  4QXH B;  2LOS A;  2QGS A;  3CQX C;  4HFV A;  3M3Z B;  2ODV A;  1UX5 A;  2CEA A;  4O8S A;  5AQT B;  4UIG A;  4HFE A;  4ILC A;  5HWY A;  1XDO A;  5LJM A;  1ZOY A;  5AQS B;  1VOM A;  5H6R B;  1BR4 A;  2YDR A;  4I4T E;  5ABG A;  2JJ9 A;  3CX8 B;  2WU2 A;  2KBB A;  2UUC T;  4JEU B;  3P4Q A;  4X1Y E;  3CQC B;  3AXJ B;  3ZMV B;  4C91 A;  2XM2 A;  1E7P A;  2AE9 A;  3IF8 B;  1UX4 A;  2LM9 A;  2VVS A;  2CXF A;  3L3P A;  4IHJ E;  4UXN B;  4DBQ A;  5LG3 A;  3PUX F;  4GKK T;  3KBT A;  2YN6 A;  1UUR A;  3ABV A;  2C0S A;  4YFS A;  3HR0 A;  4AXP A;  4B3S T;  4UEM A;  5CB4 E;  5L2L A;  3WSC A;  2UU9 T;  4U2Y A;  3IA3 A;  5ABF A;  3B57 A;  4OYK A;  4PFP A;  4ZXL A;  3O9X A;  2V5C A;  3K3O A;  3F31 A;  3BQI A;  1NAF A;  3GMI A;  4DV4 T;  4H9O C;  5HXR A;  3CX6 B;  2J4G A;  4MBQ A;  2V26 A;  3C4W A;  3PUS A;  4U7I A;  3RYH E;  2V7K A;  4PJJ A;  2KWH A;  4YJ3 E;  5LJN A;  5IHY A;  2PTF A;  4BA9 A;  2L7N A;  2KT9 A;  2K3W A;  4HFB A;  4QX8 B;  5LGT B;  2W67 A;  3AVR A;  3AEE A;  3H37 A;  2BG9 B;  4IDN A;  3PJA A;  1J1J A;  3PUA A;  4NUV A;  2WS3 A;  4A97 A;  4C90 A;  4JUY A;  1D1A A;  1EZ3 A;  3P8C D;  3C4Z A;  3VRB A;  3HKC E;  2F4V T;  2XQ7 A;  3ESL A;  5ABE A;  4JI0 T;  5JRC A;  5J1G A;  2ZMA A;  1NWM X;  2EHO A;  3KV9 A;  3EDV A;  4I0U A;  2D5U A;  4O4H E;  1T8B A;  4H9S E;  2VB6 A;  5AQN B;  2WWV A;  2UUB T;  3RYC E;  2WCA A;  3IBP A;  2N2N A;  3LDQ B;  3VHL A;  3AE2 A;  2Z6E A;  2DLR A;  2W00 A;  5KXJ A;  4DBR A;  3SFD A;  3Q5E A;  3OTO T;  4DR3 T;  2CLY C;  3QB5 K;  2XQA A;  4ILA A;  5F3J A;  2JQ9 A;  2KGX A;  5LYJ E;  4H9Q C;  2BVL A;  2IIU A;  3UFE A;  5FMN A;  3B13 A;  2BKO A;  4IE0 A;  4DR6 T;  2LHR A;  3P50 A;  4PK6 A;  2VVN A;  4PJN A;  5GON E;  1FMV A;  2M6B A;  5EK2 A;  5L3E B;  4IE6 A;  3C50 A;  4HFH A;  4QX7 B;  3VRA A;  1UCU A;  1HNX T;  4DV0 T;  1HX1 B;  3AAE B;  3TLS A;  1OED B;  3RLF F;  3JCF A;  2BBH A;  5AQP B;  5T1D A;  2X0H A;  5LA6 E;  5FVL A;  2BKN A;  1D0Z A;  3E0Z A;  3HL6 A;  4FI5 A;  1OWA A;  2XPK A;  3CVR A;  5TAO A;  5JTG A;  4HKA A;  5AQG B;  2XJ7 A;  4KP3 C;  1KNR A;  2WZI A;  3FZH B;  2I6H A;  3JAD A;  3BQK A;  3KV4 A;  3WI3 A;  1XZY A;  2V7I A;  3U78 A;  3ZT7 A;  4LF7 T;  3TKL B;  1FIO A;  2BDE A;  3ZSS A;  2CXL A;  3UFG A;  5C3J A;  2DWK A;  2XQ8 A;  4KX6 A;  3SOL A;  4AQG A;  3ZYM A;  5L3C B;  3ZC1 A;  3ZCJ A;  2BS2 A;  1YW0 A;  2VKJ A;  4ANJ A;  2HH7 A;  3UT5 E;  4JI4 T;  4DR4 T;  2LQU A;  4U74 A;  3I0O A;  3S4U A;  4AQF A;  2PJQ A;  3MXZ A;  3NRX A;  1Y64 B;  4L0R A; 
#chains in the Genus database with same CATH homology
 3IEE A;  2VKH A;  3NZQ A;  2W61 A;  2IAK A;  5HWX A;  4X1I E;  5BMV E;  2ZM8 A;  3LK2 B;  1ZV4 X;  4UF0 B;  5L3D B;  4ISS A;  2Q9Q A;  5HXC A;  2Y8D A;  3DTO A;  4H63 H;  2C5J A;  2WM9 A;  1MMG A;  4ZS3 A;  3V5S A;  2X9H A;  5LCY A;  5HAX A;  2XUE A;  2XAJ B;  2NW8 A;  3HKD E;  2Y6X A;  4I55 E;  2WBL A;  5JDQ A;  4CI2 B;  4KUM B;  5DQW A;  4O4L E;  2Q9Q B;  4HE8 A;  4HN9 A;  5DAB A;  2ODU A;  3MZK B;  3AA1 B;  3RC3 A;  3LG7 A;  2H7V C;  3PUR A;  1LVK A;  2A2F X;  3UUX B;  5JDH A;  3BQL A;  1B7T A;  3OJA A;  1ZKE A;  1Z0P A;  2KZ7 B;  4TUY E;  2DI4 A;  1WYB A;  4BJM A;  2J1D G;  3LJC A;  4E7Z A;  3KBU A;  3RYF E;  3N2G E;  4DMV A;  2CWY A;  1S94 A;  3K8P C;  4ZOL E;  1KNZ A;  2A72 A;  3KDS E;  2D0T A;  2E9X C;  3WAK A;  3JC6 D;  4A56 A;  3Q2M A;  3N9P A;  2KIN B;  4P09 A;  2DNX A;  3ZJ1 A;  3I9Y A;  1HCI A;  4U72 A;  4WW0 A;  2X68 A;  4X20 E;  3VU7 H;  2WMO A;  2L8K A;  3JC6 C;  3OKQ A;  2MTQ A;  4V1A v;  2LSJ A;  2Y48 B;  1MMA A;  3N9O A;  3Q9D A;  3I9W A;  4IE4 A;  1LRZ A;  1ZHC A;  2CCQ A;  2B1E A;  4MHC A;  3SRZ A;  3KIN B;  2DWG A;  3AA6 B;  4MAL A;  4PAG A;  2K48 A;  4I50 E;  3ZCI A;  3FXD B;  3MA9 A;  3WUR A;  1FMW A;  4WBN E;  3PF0 A;  4PJL A;  3CPZ A;  1QUU A;  1D1B A;  4O4I E;  2I59 A;  4CXX A;  2UXX B;  3ETV A;  5C8Y E;  5LG4 A;  5JDL A;  2LEH A;  2W62 A;  2X51 A;  4WNK A;  2K24 A;  3NBX X;  3KVA A;  1MIY A;  3C64 A;  4TZ4 C;  4DMW A;  2V7J A;  3HI2 A;  1E1H B;  4ECG A;  4UVA B;  1US7 B;  1LVF A;  1HX8 A;  3Q5X A;  3VJZ A;  3EVY A;  4QXC B;  2X9X A;  2MYS A;  3AA7 B;  3O4X E;  1X79 A;  3VKG A;  1U5P A;  2IC9 A;  1BR1 A;  3PDY A;  4AKR B;  1VRB A;  4KMC A;  2LJL A;  3K3Q C;  3LBX B;  4YLH A;  4CQI A;  3AAA B;  2YU1 A;  2X66 A;  3CQG B;  2KND A;  4EYY R;  2VK9 A;  5FXZ A;  3J7Y q;  2Q9Q C;  2DCF A;  3FXE B;  1FEW A;  4ZI3 D;  2NP9 A;  3I0Q A;  4ZI2 C;  4IST A;  3ONX A;  4PJM A;  2K5B B;  4KBM B;  2E8I A;  3N9M A;  2RA1 A;  3GA8 A;  3F57 A;  1S35 A;  2BZB A;  2XQY A;  5LP6 E;  1YKE B;  4TV9 E;  3ZC0 A;  4EZH A;  2LSK A;  3CKD A;  4Z8X A;  5LGU B;  4H9P C;  4UEL A;  2D0U A;  4PW8 A;  1QSD A;  3EDU A;  5JR9 C;  3RRW A;  3U3I A;  5HYA A;  2K9A A;  4ZI2 D;  4BJN A;  2YEV C;  2NW9 A;  5JDN A;  4UV8 B;  3T8O A;  3KV5 A;  4ZI7 E;  4CZZ B;  4QHO A;  2Q9Q D;  5L3B B;  2SPC A;  3AT7 A;  3N9N A;  1MMD A;  4E7S A;  4QXB B;  4IDZ A;  4UV9 B;  2WWU A;  5J2T E;  3ZLI A;  4AKH A;  2WSS V;  3FHN A;  2LOP A;  4OYJ A;  3VKH A;  4DND A;  4GK0 E;  2CXD A;  3N5L A;  5FYM A;  4ONR A;  3LK3 B;  2OA5 A;  1SA0 E;  3OYZ A;  4HTE A;  3FB2 A;  4TV8 E;  4ZHQ E;  3ZMZ B;  4JLE A;  3A5X A;  3ZEF B;  2NOX A;  2KWI B;  3WAJ A;  4CXY A;  4CI1 B;  4PK4 A;  4MLK A;  4XAX B;  4PK5 A;  3F2E A;  4P0B A;  3O1I A;  3I1A A;  2ZM2 A;  5JDF A;  3FBZ A;  1WRD A;  2EHO B;  3N9L A;  5JRC B;  5ADX L;  4O2B E;  2JRK A;  3KFW X;  1O3X A;  1MMN A;  1CUN A;  3DP7 A;  2L3L A;  2BVM A;  5LBM A;  2CWO A;  1ZEE A;  3ZMT B;  5AFU L;  4MFR A;  2IW5 B;  3SWH A;  1MNE A;  4ERR A;  3AA0 B;  2V7M A;  4GOU A;  2WAU A;  4GK5 E;  3RKO A;  4HEA A;  3UUM A;  3ZMS B;  3OYX A;  2XAQ B;  5JVD E;  1WYC A;  4DO0 A;  4GYS A;  4PFO A;  3RX6 A;  2LSG A;  2KMF A;  2LT3 A;  2E9X D;  1YKH B;  2M67 A;  4UF0 A;  5HXS A;  1BR0 A;  5IYZ E;  5EK3 A;  2C5I T;  5CA1 E;  5JRE A;  3NRY A;  5DQV A;  2YIN A;  2X9W A;  2X67 A;  3AVS A;  1IJ5 A;  2CLY B;  2UXN B;  2JMH A;  4ILU A;  5LHH B;  2XAS B;  3L09 A;  5F8P A;  4G2A A;  3ZN1 B;  3M65 A;  1IJ6 A;  1MIW A;  3N2O A;  3QUJ A;  5JR9 A;  1WLX A;  5JH7 E;  2V1D B;  2A3D A;  5M4Y A;  5EZY E;  3MJX A;  2YU2 A;  4UVB B;  2H3R A;  3PE0 A;  5JDG A;  2ACX A;  3R6N A;  4FJO A;  3MKD A;  5FY0 A;  3UTK A;  4B6X A;  4L9I A;  1V9D A;  3UUN A;  2V7L A;  3BK9 A;  4K0U A;  5HXH A;  2CE7 A;  3RPU A;  2CMR A;  1IAP A;  1HG2 A;  5LBQ B;  1D1C A;  3CML A;  2W63 A;  3AB3 B;  3CX7 B;  4AI6 A;  1D0X A;  2P9B A;  4O2A E;  3W15 B;  2KXP B;  4AQF C;  4HGA A;  4EZ4 A;  3GN5 A;  2E9X B;  2N9D A;  5ETW A;  2XAF B;  3ETU A;  3MAC A;  3EUH A;  4AKL A;  3E22 E;  5FXV A;  4IE7 A;  2KLQ A;  3IHR A;  2LE8 A;  2VWA A;  4OHF A;  4EAH A;  3CWZ B;  3ZYK A;  3NZP A;  5HXE A;  4ASK A;  5CA0 E;  5DJQ C;  2XAH B;  2X9Y A;  3GN5 B;  2HPL A;  3D0T A;  1G73 A;  3N9Q A;  4TN7 B;  4UVC B;  4X1K E;  1WR6 A;  2HPJ A;  3KV6 A;  4J2C A;  5KMG P;  5LNK A;  5JDM A;  2CA5 A;  2D2S A;  1BR2 A;  1H7C A;  2ES0 A;  4EIW A;  1HS7 A;  4NUU A;  5FP3 A;  3RC8 A;  4AKI A;  2EHO D;  3HKB E;  2QA7 A;  1LKX A;  2W0G A;  5EK4 A;  3M1C A;  5FY1 A;  2CM0 A;  5L3G B;  4OK0 A;  2G0U A;  3RH3 A;  3AAI A;  3ANW B;  2WMN A;  3O1H A;  1G8X A;  2XHE B;  4GYR A;  4IGU A;  2XAG B;  2X0L B;  5LGN B;  3V5U A;  4WBO A;  4F6R C;  2VKO A;  3UUL A;  3C51 A;  3OBV E;  2MOZ A;  1MIV A;  3DJB A;  3E08 A;  3QC9 A;  4EXT A;  2H7O A;  2NW7 A;  4ADZ A;  1KK7 A;  5H6Q B;  5LHG B;  3P7I A;  2JMK A;  1U4Q A;  3ANW A;  3GWH A;  5KDM C;  2VAS A;  2MTC A;  3RYI E;  3ZPO A;  2RP4 A;  3SS1 A;  5J2U E;  3J9X 1;  4AKG A;  2GK9 A;  3PTR B;  4QKN A;  3ZYL A;  5JQG E;  2NTY A;  4IIJ E;  4H63 V;  1T98 A;  5LHI B;  3MK7 C;  2NWB A;  1IZN B;  3LBX A;  4EYU A;  3PHF 1;  4ZI3 C;  2VL8 A;  5L3F B;  5JR9 B;  3H3A A;  3Q5W A;  4XBF B;  3O1J A;  3ZN0 B;  4BAY B;  2LSI A;  4BGO A;  2EHO C;  3PU3 A;  1AJ3 A;  4G63 A;  3QK6 A;  4PNI A;  4XZC A;  2IC6 A;  3KVB A;  2DHR A;  4L5G A;  2PG8 A;  5KX5 E;  2JPF A;  4YJ2 E;  2N1G A;  4DVD A;  3HA4 A;  1HF8 A;  1SHZ C;  2VKD A;  2PBI A;  2JQQ A;  4I43 B;  2ZLY A;  5FY7 A;  1HG5 A;  3C4X A;  3PUG A;  3PU8 A;  2E9X A;  5FXW A;  1HFA A;  4H9R C;  2L9Q A;  4QWN B;  4O4J E;  4TX5 A;  2MBG A;  3R84 B;  2LHN A;  5FXX A;  4CI3 B;  1HTJ F;  4IE5 A;  5LOV E;  3PUQ A;  4JEH B;  3N2K E;  3K3N A;  4GIW A;  4EB6 E;  4N78 D;  4H9N C;  4YHJ A;  3RRC A;  4ZS2 A;  3FBL A;  2C5K T;  2XTL A;  5LXT E;  2PFV A;  5FNV E;  4P0A A;  3C98 B;  1D0Y A;  1YD8 G;  2NTX A;  2ZM0 A;  3LFM A;  4OFZ A;  2YK0 A;  3LK4 2;  4M1P A;  3ZJ2 A;  4CXW A;  4EOZ B;  3HKE E;  1OXZ A;  5E0O A;  1MND A;  2LSY A;  4QXH B;  2LOS A;  2QGS A;  3CQX C;  4HFV A;  4O8S A;  2ODV A;  1UX5 A;  2CEA A;  5A1L A;  4UIG A;  5HWY A;  5LJM A;  3ZMU B;  1VOM A;  5H6R B;  1BR4 A;  4I4T E;  2JJ9 A;  3CX8 B;  4JEU B;  4X1Y E;  3ZMV B;  3CQC B;  4C91 A;  3L3P A;  3IF8 B;  1UX4 A;  2LM9 A;  2CXF A;  4IHJ E;  4UXN B;  4DBQ A;  3KBT A;  2C0S A;  4YFS A;  3HR0 A;  4AXP A;  4UEM A;  5CB4 E;  5L2L A;  3WSC A;  3B57 A;  4OYK A;  4PFP A;  3O9X A;  3K3O A;  3F31 A;  3BQI A;  1NAF A;  3GMI A;  4H9O C;  5HXR A;  3CX6 B;  4MBQ A;  2V26 A;  3C4W A;  3PUS A;  3RYH E;  2V7K A;  4PJJ A;  2KWH A;  4YJ3 E;  5LJN A;  5IHY A;  4BA9 A;  2KT9 A;  4QX8 B;  5LGT B;  3AVR A;  3H37 A;  4NUV A;  3PUA A;  4C90 A;  4JUY A;  1D1A A;  1EZ3 A;  3P8C D;  3C4Z A;  3HKC E;  3ESL A;  5JRC A;  5J1G A;  2ZMA A;  1NWM X;  2EHO A;  3KV9 A;  3EDV A;  2D5U A;  4O4H E;  4H9S E;  2VB6 A;  3RYC E;  3IBP A;  2N2N A;  3VHL A;  2Z6E A;  2DLR A;  2W00 A;  4DBR A;  2CLY C;  5F3J A;  5LYJ E;  4H9Q C;  2BVL A;  3UFE A;  5FMN A;  3B13 A;  4IE0 A;  2LHR A;  4PK6 A;  4PJN A;  5GON E;  1FMV A;  5EK2 A;  5L3E B;  4IE6 A;  3C50 A;  4QX7 B;  1UCU A;  3AAE B;  5T1D A;  5LA6 E;  3E0Z A;  1D0Z A;  3HL6 A;  4FI5 A;  1OWA A;  3CVR A;  5TAO A;  4HKA A;  4KP3 C;  3KV4 A;  3BQK A;  3WI3 A;  2V7I A;  3U78 A;  3TKL B;  1FIO A;  2BDE A;  2CXL A;  2DWK A;  3SOL A;  4AQG A;  3ZYM A;  5L3C B;  3ZC1 A;  3ZCJ A;  1YW0 A;  2VKJ A;  4ANJ A;  2HH7 A;  3UT5 E;  2LQU A;  4U74 A;  3I0O A;  3S4U A;  4AQF A;  2PJQ A;  3MXZ A;  3NRX A;  1Y64 B;  4L0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...