5HXSA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 10mm sr2+
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
300
structure length
296
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEENNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
total genus 122
structure length 296
sequence length 300
ec nomenclature
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hxsA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hxsA02
5JDFA 5JDLA 5HWYA 3V5UA 5HXCA 5HXHA 5HXSA 3V5SA 5JDMA 5JDHA 5JDQA 5HXRA 5JDNA 5HYAA 5JDGA 5HXEA 5HWXA
chains in the Genus database with same CATH superfamily
4OYKA 3BQLA 1WR6A 2VL8A 2XASB 4UIGA 3RIAA 3I0OA 3F57A 2L3LA 1US7B 2KWIB 2EHOD 3LBXB 4GOUA 2WDVA 4LFCT 3FYQA 3A7MA 4O4HE 4ZHQE 5ABFB 3AAAB 3ZKRA 4NXMT 4KHPT 5LGTB 4IE5A 4CN6A 2IDOB 4BJMA 3OBVE 3H37A 5JH7E 1JNRA 5JREA 4WNKA 4IDQA 1MIVA 3E22E 2KNDA 5FXXA 2PG8A 4AQYT 1IJ5A 1G73A 3JADA 4B3MT 3RIUC 4HFVA 4QXHB 4MBQA 3R6NA 3P7IA 4HEAA 4CI3B 3C4XA 2J62A 5LB7B 2LOPA 4F6RC 3L09A 3ANWA 3PV0F 2V1DB 2XAFB 2E9XA 3J9X1 2VKJA 3OKQA 3O1JA 3X1DA 3K3NA 3A5XA 4U7IA 2B76A 2MTCA 2UUBT 2YDQA 5AQRB 3NRXA 1IJ6A 2JQHA 4IIJE 2E5LT 3ZYMA 2LKHA 3D0TA 3C4ZA 4OFZA 3ETVA 3KV4A 3O1HA 3QC9A 3O4XE 2R6GF 2VVSA 1D0XA 3ZC0A 3PUVF 3AVSA 3L39A 4M1PA 4GK5E 4GYRA 2XZEA 3H3AA 4PJNA 2WMOA 3AE3A 3BK9A 2UXCT 2VQET 3FZLB 3Q5DA 3CX8B 4ZI7E 2XQ8A 3UUMA 1J1JA 3LK2B 4LFAT 4EZHA 2XQ5A 5EK4A 2UXDT 2X0HA 4O4IE 4CXXA 1QLBA 2A2FX 4AXPA 5L4EA 4IE7A 1MIWA 1HX1B 3ZJ2A 4TUYE 2QGSA 1M7KA 1E2AA 3M3ZB 2QA7A 1W0BA 2WZHA 2N9DA 2Y48B 5HXRA 5KXJA 2VK9A 3K3OA 4GKKT 4PW8A 1DU2A 4KMCA 4JI0T 3CX7B 5L3GB 4U2YA 5FXZA 4COFA 1NAFA 2CHNA 3RRCA 4DUZT 4JI6T 4MHCA 3ZPOA 2V7MA 5FVKA 2W62A 2DNXA 1BR4A 3AEBA 5J2TE 5LHHB 1LVFA 4U74A 3AEDA 2SPCA 2YK0A 4IDZA 2CEAA 1KFYA 5EK3A 4X65T 1IZNB 2X9WA 3MK7C 3AAIA 4QX7B 4CN1A 5JDHA 3RX6A 5AQFB 3ETUA 2DLRA 3UU3A 3QUJA 2EHOA 2D0UA 2FUPA 3M1CA 4IDPA 2C5JA 3DTOA 5DJQC 3NBXX 1LRZA 5C2TA 3RYHE 1L0VA 2ACXA 4ZS3A 4JI1T 4ZI2C 2D2SA 2M6BA 3N9PA 4ILUA 3PU3A 2L8KA 2C5KT 2WSSV 2IIUA 2CPTA 4X62T 3P4SA 2CXLA 5H6QB 1Y64B 4LMLA 1BR0A 1FIOA 3FZKB 2BKOA 4JI5T 5LHIB 2IW5B 3RGLA 4DR6T 4UVAB 3PUXF 1UK5A 3VR8A 1LVKA 4DV5T 3ONJA 3AE4A 1E7PA 2CCQA 3PHF1 3NZQA 5F8PA 2XQYA 2BBHA 2X68A 3ZMVB 5LJNA 3RYCE 2XPKA 3R84B 5L3EB 3WURA 4A5XA 4PJMA 4QXBB 4L5GA 3IHRA 3ZSSA 3N2OA 4AIUA 4UV8B 4PK4A 3PE0A 4YXDA 3KV5A 1I6ZA 2LSIA 3E08A 2MTQA 3BQIA 5AQLB 2ZMAA 2ODVA 3FB2A 4HWHA 1XZYA 4UR9A 4N78D 3N2GE 3ZMUB 3SFEA 1VOMA 5L47A 4WBNE 3T1HT 4B3ST 5JDQA 4H9OC 2XSAA 3IEEA 2NWBA 3PJAA 4IE0A 5LBMA 3S4UA 2NR4A 4NXNT 3ESLA 2CBJA 3BQKA 2W63A 5CGMA 3AEFA 3EABA 2CHOA 1XNRT 3AXJA 1D1BA 5KX5E 4EZ4A 3RIFA 3EAMA 2AE9A 2V6YB 2ZM2A 2XM1A 1WCRA 4K0UA 2QYWA 1OXZA 2XSBA 4O4LE 3CX6B 4CQIA 5HXCA 5CB4E 2JQQA 3RF1A 4ZOLE 5L3CB 3AECA 4KI0F 4YHJA 4ZI2D 2E9XD 4QXCB 3RPUA 4UEMA 4UVCB 5AQJB 1KK7A 3Q9DA 4A56A 3ZCIA 3AY5A 2BG9B 2X0LB 3JC6D 3ZMTB 3ZYKA 2L10A 4AKHA 2W00A 3W15B 5LNKA 1ZV4X 4P0BA 4H9RC 1SUMB 2LOSA 4HWCA 3AEGA 2X9HA 3N9NA 2ODUA 2IUBA 3LDQB 3RIUA 1NEKA 3PUZF 3FZHB 1GQEA 4C91A 4QH5A 4LF9T 4YT0A 1W0AA 1X9BA 4WBOA 2CXFA 4IDOA 2CLYB 3Q2MA 1MMGA 2I59A 4YJ2E 3L3PA 2MYSA 5EK2A 2BG9C 2V8SV 2XQ4A 5L2LA 4L9IA 2M67A 5FZTA 1M62A 2ZM0A 3PTRB 1KEYA 3UFEA 3RLFF 5L4HA 4AQFC 1FEWA 4EV6A 2WS3A 4AISA 5FL0A 3UUXB 4GK0E 5CJ5A 2KZ7B 5FYMA 2KINB 4DNDA 3I9WA 3C4WA 3P8CD 2BKNA 2YU2A 4KUMB 2J4GA 3IA3A 4X5TA 2KGXA 2XUEA 3GWHA 4X1IE 3AE2A 5JDLA 2DWKA 4JYAT 1R8IA 4GIWA 4HN9A 3CPZA 3UU6A 2FJDA 5AFUL 5JR9A 3CKDA 4IGUA 3PUAA 2WQYA 3PUYF 4ISTA 3MZKB 4B3TT 3PF0A 2WMNA 3I0QA 4LF8T 3DP7A 2LJLA 3AE8A 3GN5B 5LG3A 3PUSA 4CI2B 2W4XA 2Y8DA 2PBIA 4BJNA 4X1KE 5HWYA 4AKIA 4UF0A 4U31A 1YQ4A 4G63A 3TLUA 2ACZA 1AJ3A 3JAFA 2WU2A 3QK6A 2HPLA 5DQVA 4EYUA 3K8PC 4DV1T 3WAJA 4KBMB 3ONLC 4DV6T 5LMNT 4YTMA 2H7OA 1XDPA 1J5WA 3QOFA 1ZKEA 3O1IA 4ZZBA 4JI4T 2Q9QB 3A8YC 3JAEA 3HL6A 4EIWA 1YXRA 3CQGB 5LG4A 2VQFT 2M6IA 4PFOA 5BR8T 1HR0T 1HF8A 4O8SA 1BR2A 3P50A 2E5VA 4UELA 3N9QA 4EEBA 5FMNA 3PJAJ 5LXTE 2VL0A 4JEUB 3P4QA 1OWAA 1N32T 1E1HB 5E0OA 1ZOYA 3AA1B 3MA9A 3ZT6A 2WBLA 5AQSB 3U3IA 4C90A 1HNZT 1W09A 2MAWA 2YDSA 3CQXC 4H9NC 5HAXA 2H89A 4LMKA 2E2AA 4NIQA 4DIDB 2Q9QC 4EAHA 2OLTA 2NW7A 4HFCA 3ZN0B 3GA8A 3V5UA 4MLKA 1X79A 3PUQA 1KNPA 1KNRA 3AE6A 1UURA 3E0ZA 3AB3B 3UU8A 4CXYA 5HXHA 2BZBA 4YSXA 1CHUA 2UUAT 4CI1B 2VASA 4HFBA 1QSDA 3B13A 2MBGA 3KV9A 4OHFA 1OEDE 4YFSA 4ILCA 2BS3A 1SHZC 2BS4A 2W67A 4TNVA 3AA0B 2WY2A 2YOEA 5HWXA 1YD8G 3PUGA 1EZ3A 5KDMC 3CVRA 4QHOA 2CXDA 2X9XA 2A3DA 5IYZE 3DJBA 4TV9E 4DV2T 3ANWB 5J1GA 3FXDB 2C5IT 5BMVE 2E9XB 2JPFA 3T1YT 5LHGB 2CMRA 3AEAA 3MXZA 3RC3A 2LKGA 2NP9A 3N9MA 5HEOA 2MPKA 4X1YE 3CMLA 3ZMZB 4QH1A 4BGOA 4JV5T 2H3RA 2IC9A 4JI3T 4DV3T 3NWIA 2IMLA 4GKJT 5JDFA 2LQUA 3ZT7A 2XAQB 3HI2A 2NTXA 2CWOA 2W61A 4IHJE 4QWNB 4E7SA 4X66T 2X51A 2XQ6A 3ABVA 2Y6XA 5JRCA 3FHNA 1YKEB 4W8PA 3SFDA 1O3XA 2HN2A 3ZYLA 1S94A 3UT5E 3UUNA 4U7YA 1MNEA 5EZYE 4Z90A 2LSGA 1N36T 3C50A 3P4RA 1MIYA 2LE8A 1UX5A 2XM2A 4DVDA 1OEDA 4AKRB 2XY8B 2MOZA 3TLVA 1MMNA 4YJ3E 2DHRA 3SRZA 3OVUA 5A1LA 2C0SA 2KWHA 2VKHA 4UVBB 2VKOA 4LFBT 2JMKA 2WP9A 2DL1A 5HCJA 4MFRA 1D1AA 4ZI3C 1Y01A 4HFDA 3VR9A 2BS2A 1MMDA 3OYZA 2V7KA 5AQNB 5AQQB 1N34T 5LGNB 2CRBA 4EEDA 4TWFA 4XBFB 4PK5A 4QH4A 4FI5A 4PK6A 3KBUA 4IREA 5C8YE 2EHOB 3EHZA 3N2KE 2H7VC 4PJLA 4OX9T 3FBZA 2V5CA 3VRAA 3CK6A 4EGWA 2LSJA 4UXNB 1G8XA 3Q5EA 1KNZA 2FBWA 4PFPA 3NVOA 2LSKA 4TNWA 1MNDA 4A98A 3AAEB 4DV7T 2CBIA 3P4PA 2LT3A 4U33A 3RQWA 1HG2A 1N33T 2V7JA 1D0YA 4JI2T 3EDUA 3ZCJA 4DBRA 4YHHT 5L3DB 2BVLA 4HWDA 2XAJB 1HNWT 3QB5K 5AQIB 2NW9A 3CIRA 4H9SE 4JBWF 2UUCT 2X9YA 2UU9T 1V9DA 3RYIE 4LF4T 2HHHT 5ABHA 3LBXA 1JNZA 4B3RT 5ABFA 2XJ7A 2KMFA 1WFDA 2X0YA 3ZMSB 5JDGA 3H3MA 3RI5A 1WLXA 4ZI3D 2IAKA 1BR1A 4XAXB 4WW0A 2RP4A 4Z91A 4E7ZA 2W66A 3LG7A 4JI8T 3OPCA 3ZSTA 4F8HA 2W0GA 3CQCB 1UX4A 2NOXA 4Q25A 5HXSA 3AXJB 4HFHA 3K1SA 3KDSE 4G2AA 5AQMB 1IBLT 3U78A 2I6HA 5JVDE 1KF6A 4QKNA 4ZS2A 3AA7B 4ASKA 5T1DA 4P09A 3LFMA 4FJOA 3UFGA 4XZCA 4YSYA 4I0UA 4ERRA 2CLYC 4JLEA 2LEHA 4TN7B 5ETWA 4DO0A 5LGUB 2GK9A 2L9QA 3ZJ1A 4LF7T 3RHWA 2VWAA 4BA9A 2YN6A 4NPPA 3AE9A 3NRYA 4DV0T 4EYYR 1W9RA 3HA4A 3J7Yq 5LP6E 2ES0A 4BAYB 2QRXA 2FJEA 3HKDE 4DR3T 5F5WA 3HR0A 4DV4T 1YQ3A 1XDOA 3V5SA 2RPAA 4JI7T 4IDNA 3FZMB 5GONE 2V26A 1UUSA 2LRLA 3RKOA 3UULA 4PJJA 1HFAA 2XQ9A 5AQOB 4ADZA 4PAGA 4DUYT 2H88A 3KVBA 3JCFA 2PFVA 4ZZCA 5F3JA 4L0RA 2VVNA 3EI0A 2QVAA 4LF5T 4I4TE 2WB5A 2XQ3A 2RA1A 3HKCE 1VCTA 3UQ7A 4PNIA 2DI4A 2UXXB 3ZT5A 1HNXT 2N2NA 5FVLA 1VCSA 5DABA 4H9QC 3TKLB 1I94T 2X0CA 5FKYA 4YLHA 4HTEA 3AE5A 4ZEYA 1IAPA 5LA6E 4EB6E 4GYSA 1T72A 4CN4A 5LMUT 3LJCA 5HEUA 3OTOT 5C3JA 3VRBA 4HWFA 2XTLA 3UU5A 1D1CA 1SJ7A 5JR9B 4DR1T 1UCUA 2JMHA 4AKLA 4TWHA 2KVPA 4ONRA 3QB5A 1XMOT 2NTYA 1ZP0A 4P1NA 4DBQA 3AE7A 2LHRA 2HPJA 2PTFA 2NW8A 3Q5XA 4U2ZA 5AQVB 4IL4A 1Z8UA 4DMWA 3O9XA 2HH7A 2OA5A 3LK3B 3VJZA 2W2UA 2CM0A 3AEEA 3G06A 4ILAA 4UF0B 5JDNA 1XNQT 5AQKB 4IT4A 3F31A 5CA0E 3C64A 3SOLA 4DMVA 2LM9A 3B57A 3WI3A 4NUVA 2L7NA 2I0MA 1S35A 4HE8A 5TAOA 1XWMA 4UV9B 2F4VT 4TX5A 5AQHB 4P0AA 5CFBA 5FL1A 4KP3C 3WSCA 2XHEB 2K24A 1YW0A 2K5BB 5J0ZA 2CA5A 5J2UE 4X20E 5JR9C 3UU4A 3B5MA 4DR2T 1UGOA 2XQ7A 3OYXA 3KV6A 4U3CA 3N9LA 2YDRA 4IE4A 4O2BE 2WAUA 1HS7A 4U72A 5M4YA 2BG9E 3F2EA 4DR5T 3FXEB 3QNUA 3CWZB 3I1AA 3Q5WA 4HGAA 5JTGA 5FY1A 2IHR1 2CWYA 2WU5A 5ABGA 3N5LA 1T98A 1B7TA 1U4QA 4K0KT 1WYCA 5LJMA 2X66A 4LMJA 2K3WA 4KX6A 1FJGT 2LHNA 2XQAA 5L3FB 1NWMX 2BVMA 3IBPA 3PUWF 2FJAA 4HWIB 2KSRA 2XAGB 5IWAT 4HFIA 5JQGE 2N1GA 5FXVA 5AQTB 1SE7A 2OV9A 5FY0A 2BKPA 1H7CA 4WYVA 5KMGP 3LSVA 5L3BB 4AQGA 4ANJA 4LF6T 3UUBA 2ZM6T 2BDEA 3ZN1B 3UQ4A 3TLWA 1T8BA 4I43B 4A97A 3VU7H 3SS1A 3AT7A 2E9XC 2V6YA 3MKDA 2KT9A 2Q9QD 1FMVA 2LM2A 3AA6B 2YEVC 2A72A 3PU8A 1XMQT 2WM9A 3JC6C 2JJ9A 4V1Av 4HKAA 4ECGA 1HG5A 3OJAA 3L8RA 3KVAA 4JEHB 3VKGA 3AVRA 2PJQA 5CA1E 5LYJE 2UXBT 3M65A 5AQGB 2DWGA 2WWUA 2BG9A 2JQ9A 2CE7A 1T7SA 3KFWX 1LKXA 1YKHB 2V6XA 2D9DA 4H63V 4IL9A 2WCAA 4YTPA 4AQFA 4HFEA 4DR4T 2ZLYA 2VKDA 5DQWA 4YY3T 4B6XA 1Z0PA 3UTKA 2IC6A 3DYJA 4JUYA 3HKBE 5ADXL 2VURA 4YTNA 1IBMT 2YINA 4MALA 5AQUB 4QX8B 3EDVA 2YU1A 3TLSA 2AXDS 3ZLIA 5LCYA 3WAKA 5ABEA 2KXPB 4ISSA 2P9BA 4Z8XA 2X67A 3PURA 5HEJA 2K9AA 3RYFE 2ZM8A 3VKHA 2JIWA 3SWHA 1ZEEA 3T8OA 3FZFB 4AKGA 3EVYA 2KLQA 5HYAA 5IUXA 3C51A 2XAHB 3MACA 3RKGA 4I55E 5FXWA 2WDRA 1ZHCA 1U5PA 4KHZF 5JRCB 4CZZB 1WYBA 2HN1A 3P4WA 4CXWA 3AE1A 2E8IA 2DCFA 3KINB 2V7LA 3RRWA 4YSZA 3I9YA 1HX8A 1FMWA 2Z6EA 3NZPA 3IF8B 1OEDB 2J1DG 1D0ZA 3VHLA 1MMAA 4TZ4C 2D0TA 2V5DA 2EHOC 4ILBA 2D5UA 4ZXLA 5HXEA 3FBLA 4X64T 3GN5A 1HCIA 3RC8A 5FY7A 3N9OA 1SJ8A 5AQPB 5IHYA 3ONXA 5FP3A 4TWDA 5FNVE 2JRKA 2FJBA 3LK42 1VRBA 2LRKA 2LLYA 2WZIA 3ZC1A 3PDYA 2KBBA 1WRDA 1NENA 4H63H 3K3QC 4OK0A 4OYJA 3EUHA 2K48A 2YKSA 2G0UA 4I50E 4WZXA 3HKEE 3MJXA 5LOVE 2BBJA 1OEDC 4O4JE 5HCMA 1CUNA 4NUUA 4IE6A 5LBQB 4H9PC 2Q9QA 3KBTA 5HEGA 4O2AE 2J47A 5H6RB 2A9UA 4EXTA 2WDQA 2VB6A 4J2CA 3TLTA 3RH3A 2LSYA 2UXNB 3C98B 3RQUA 1HTJF 4AI6A 1IBKT 3NKZA 1J5ET 5JDMA 2V7IA 4TV8E 4DR7T 2JQKA 2B1EA 4EOZB 3GMIA 2WWVA 3ZEFB 1QUUA 1WR0A 1SA0E 5HEHA 4F7GB
chains in the Genus database with same CATH topology
4YHJA 4OYKA 4ZI2D 1MNEA 2E9XD 5EZYE 2LSGA 3BQLA 1WR6A 4QXCB 3RPUA 2VL8A 4UEMA 4UVCB 3F31A 5CA0E 3C64A 3C50A 3SOLA 2XASB 1KK7A 4DMVA 4UIGA 3Q9DA 1MIYA 2LM9A 3B57A 2LE8A 3I0OA 3WI3A 1UX5A 3F57A 3ZCIA 4A56A 4NUVA 4DVDA 4AKRB 1S35A 2X0LB 2L3LA 3JC6D 2MOZA 4HE8A 5TAOA 3ZMTB 4UV9B 4TX5A 1MMNA 3ZYKA 4YJ3E 1US7B 2KWIB 4AKHA 4P0AA 2EHOD 3LBXB 4GOUA 2W00A 4KP3C 3WSCA 2DHRA 2XHEB 2K24A 3W15B 1YW0A 3SRZA 4O4HE 2K5BB 5LNKA 4ZHQE 1ZV4X 3AAAB 2CA5A 4P0BA 4X20E 5J2UE 5JR9C 4H9RC 2LOSA 5A1LA 2C0SA 2X9HA 3N9NA 3OYXA 3KV6A 2ODUA 2KWHA 3N9LA 2VKHA 4UVBB 2VKOA 4IE4A 5LGTB 4O2BE 4IE5A 2JMKA 2WAUA 1HS7A 4BJMA 3OBVE 4C91A 4U72A 4MFRA 5M4YA 3F2EA 3H37A 1D1AA 5JH7E 4ZI3C 3FXEB 3CWZB 3I1AA 5JREA 3Q5WA 4HGAA 1MMDA 3OYZA 2V7KA 4WNKA 1MIVA 3E22E 2KNDA 5FY1A 2CWYA 4WBOA 2CXFA 5FXXA 5LGNB 2CLYB 3N5LA 3Q2MA 1T98A 2PG8A 1MMGA 1B7TA 1U4QA 4XBFB 2I59A 1WYCA 1IJ5A 4PK5A 1G73A 2MYSA 2X66A 3L3PA 4YJ2E 5EK2A 5LJMA 5L2LA 4L9IA 2M67A 2LHNA 4HFVA 4QXHB 1NWMX 2BVMA 4MBQA 4FI5A 2ZM0A 3PTRB 4PK6A 3R6NA 5L3FB 3P7IA 3IBPA 4HEAA 4CI3B 3UFEA 3C4XA 2LOPA 4F6RC 3KBUA 2XAGB 3L09A 3ANWA 4AQFC 5C8YE 2EHOB 1FEWA 3N2KE 2H7VC 2V1DB 2XAFB 4PJLA 2E9XA 3FBZA 5JQGE 3J9X1 3UUXB 4GK0E 2N1GA 5FXVA 2VKJA 3OKQA 2KZ7B 2LSJA 5FYMA 4UXNB 5FY0A 2KINB 3O1JA 4DNDA 3I9WA 3K3NA 3C4WA 3P8CD 3A5XA 2YU2A 1G8XA 4KUMB 1KNZA 1H7CA 4PFPA 2MTCA 2LSKA 2XUEA 3GWHA 4X1IE 3NRXA 5KMGP 1IJ6A 1MNDA 5JDLA 4IIJE 2DWKA 3AAEB 3ZYMA 5L3BB 4GIWA 4AQGA 4ANJA 3D0TA 2LT3A 3C4ZA 3CPZA 4HN9A 4OFZA 5AFUL 5JR9A 2BDEA 1HG2A 3CKDA 3ZN1B 2V7JA 4IGUA 3ETVA 1D0YA 3KV4A 3EDUA 3O1HA 3QC9A 3PUAA 4ISTA 3MZKB 3O4XE 3ZCJA 4DBRA 3PF0A 2WMNA 4I43B 3VU7H 3I0QA 3SS1A 1D0XA 3ZC0A 2E9XC 3DP7A 3AT7A 2LJLA 3MKDA 3AVSA 4M1PA 2KT9A 3GN5B 2Q9QD 1FMVA 4GK5E 4GYRA 3PUSA 3AA6B 5L3DB 2BVLA 3H3AA 2YEVC 4PJNA 2WMOA 2A72A 4CI2B 3PU8A 3BK9A 2Y8DA 2WM9A 3JC6C 2JJ9A 2XAJB 2PBIA 4HKAA 4V1Av 4ECGA 1HG5A 4BJNA 4X1KE 3OJAA 3CX8B 4ZI7E 3UUMA 3KVAA 5HWYA 3LK2B 4AKIA 4JEHB 4EZHA 4UF0A 3VKGA 2NW9A 4G63A 4H9SE 3AVRA 5EK4A 2PJQA 5CA1E 5LYJE 1AJ3A 3M65A 4O4IE 4CXXA 3QK6A 2DWGA 2A2FX 4AXPA 2WWUA 2X9YA 2HPLA 5DQVA 1V9DA 4IE7A 3RYIE 1MIWA 4EYUA 3K8PC 2CE7A 3KFWX 3ZJ2A 1LKXA 2QGSA 4TUYE 1YKHB 4H63V 3WAJA 4KBMB 3LBXA 2QA7A 4AQFA 2ZLYA 2VKDA 5DQWA 4B6XA 1Z0PA 2N9DA 2Y48B 5HXRA 3UTKA 2IC6A 2KMFA 2H7OA 2VK9A 3K3OA 4JUYA 4PW8A 3ZMSB 4KMCA 3HKBE 5ADXL 3CX7B 5L3GB 5FXZA 5JDGA 1NAFA 1ZKEA 3O1IA 2YINA 4MALA 3RRCA 4QX8B 3EDVA 2YU1A 2Q9QB 3ZLIA 5LCYA 3WAKA 1WLXA 4ZI3D 4MHCA 3ZPOA 2IAKA 1BR1A 2V7MA 4XAXB 3HL6A 4EIWA 3CQGB 2KXPB 4WW0A 4ISSA 2P9BA 2RP4A 5LG4A 4Z8XA 2X67A 3PURA 2K9AA 3RYFE 2W62A 2DNXA 1BR4A 2ZM8A 4PFOA 5J2TE 4E7ZA 5LHHB 3VKHA 1LVFA 4U74A 3LG7A 2SPCA 2YK0A 1HF8A 3SWHA 4IDZA 1ZEEA 4O8SA 3T8OA 4AKGA 2CEAA 1BR2A 2W0GA 2KLQA 3CQCB 1UX4A 3EVYA 5HYAA 5EK3A 3C51A 2XAHB 2NOXA 1IZNB 4UELA 5HXSA 3N9QA 2X9WA 3MACA 5FMNA 3MK7C 3AAIA 4QX7B 5LXTE 5JDHA 4I55E 3KDSE 4G2AA 4JEUB 5FXWA 3RX6A 3U78A 1OWAA 5JVDE 3ETUA 2DLRA 1E1HB 3QUJA 5E0OA 2EHOA 2D0UA 3AA1B 3MA9A 1ZHCA 4QKNA 1U5PA 2WBLA 4ZS2A 3U3IA 5JRCB 3M1CA 4CZZB 1WYBA 4CXWA 4C90A 2E8IA 2C5JA 2DCFA 3AA7B 3KINB 4ASKA 4P09A 3LFMA 5T1DA 3DTOA 5DJQC 4FJOA 3NBXX 4XZCA 1LRZA 4H9NC 3CQXC 3RYHE 2V7LA 3RRWA 5HAXA 4ERRA 2ACXA 2CLYC 4JLEA 3I9YA 4ZS3A 1HX8A 4ZI2C 2LEHA 4TN7B 2D2SA 5ETWA 1FMWA 4DO0A 2Z6EA 5LGUB 2Q9QC 3N9PA 2GK9A 4EAHA 2L9QA 2NW7A 4ILUA 3PU3A 3ZJ1A 2L8KA 3NZPA 3IF8B 2C5KT 2WSSV 3ZN0B 2VWAA 3GA8A 3V5UA 2CXLA 4MLKA 2J1DG 5H6QB 1X79A 1D0ZA 1Y64B 3VHLA 1MMAA 3NRYA 4TZ4C 4EYYR 3HA4A 2D0TA 3PUQA 3J7Yq 1BR0A 5LP6E 2ES0A 2EHOC 4BAYB 2D5UA 5HXEA 3HKDE 1FIOA 3FBLA 3HR0A 5LHIB 2IW5B 3E0ZA 3AB3B 3GN5A 4UVAB 4CXYA 1HCIA 3RC8A 5FY7A 5HXHA 3V5SA 3N9OA 1LVKA 2BZBA 4CI1B 5IHYA 2VASA 3ONXA 5FP3A 2CCQA 5FNVE 2JRKA 3PHF1 1QSDA 3NZQA 5F8PA 2XQYA 3LK42 2X68A 3B13A 3ZMVB 2MBGA 5GONE 5LJNA 1VRBA 2V26A 3RYCE 3KV9A 4OHFA 4YFSA 3RKOA 3UULA 4PJJA 1HFAA 3R84B 1SHZC 5L3EB 3ZC1A 4ADZA 3WURA 4PJMA 3PDYA 4L5GA 4PAGA 4QXBB 1WRDA 3IHRA 3AA0B 3N2OA 4UV8B 4H63H 3KVBA 3K3QC 4OK0A 4PK4A 4OYJA 3EUHA 2K48A 5HWXA 2PFVA 1YD8G 5F3JA 2G0UA 4L0RA 4I50E 3PUGA 1EZ3A 5KDMC 3HKEE 3MJXA 3PE0A 3KV5A 5LOVE 4I4TE 3CVRA 2LSIA 3E08A 4O4JE 2RA1A 2MTQA 4QHOA 3HKCE 2CXDA 3BQIA 4PNIA 2DI4A 2UXXB 2X9XA 2A3DA 1CUNA 2ZMAA 2ODVA 4NUUA 3FB2A 3DJBA 4IE6A 5IYZE 4TV9E 4N78D 2N2NA 3ANWB 3N2GE 3ZMUB 5J1GA 3FXDB 5DABA 2C5IT 5LBQB 5BMVE 1VOMA 4H9QC 3TKLB 2E9XB 2JPFA 4H9PC 4WBNE 2Q9QA 4YLHA 3KBTA 5JDQA 5LHGB 4O2AE 2CMRA 4H9OC 4HTEA 3RC3A 1IAPA 3MXZA 5H6RB 3IEEA 2NWBA 4IE0A 5LA6E 2NP9A 4EB6E 3N9MA 5LBMA 4GYSA 4X1YE 4BA9A 3CMLA 3ZMZB 3LJCA 3S4UA 4EXTA 2VB6A 4J2CA 4BGOA 3ESLA 2H3RA 3RH3A 2XTLA 2IC9A 3BQKA 2W63A 1D1CA 2LSYA 2UXNB 3C98B 5JR9B 5JDFA 1HTJF 1UCUA 2JMHA 4AI6A 4AKLA 1D1BA 5KX5E 4ONRA 4EZ4A 2LQUA 2NTYA 2XAQB 4DBQA 3HI2A 2NTXA 2LHRA 2CWOA 2W61A 4IHJE 2HPJA 4QWNB 2ZM2A 4E7SA 2NW8A 3Q5XA 2X51A 5JDMA 2V7IA 2Y6XA 4K0UA 4TV8E 5JRCA 3FHNA 4DMWA 1OXZA 2HH7A 3O9XA 2B1EA 4EOZB 1YKEB 2OA5A 3LK3B 3GMIA 1O3XA 4O4LE 3CX6B 3VJZA 3ZYLA 2CM0A 4CQIA 3ZEFB 1QUUA 1S94A 3UT5E 5HXCA 1SA0E 5CB4E 2JQQA 4UF0B 3UUNA 5JDNA 4ZOLE 5L3CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDF A;  5JDL A;  5HWY A;  3V5U A;  5HXC A;  5HXH A;  5HXS A;  3V5S A;  5JDM A;  5JDH A;  5JDQ A;  5HXR A;  5JDN A;  5HYA A;  5JDG A;  5HXE A;  5HWX A; 
#chains in the Genus database with same CATH topology
 4OYK A;  3BQL A;  1WR6 A;  2VL8 A;  2XAS B;  4UIG A;  3RIA A;  3I0O A;  3F57 A;  2L3L A;  1US7 B;  2KWI B;  2EHO D;  3LBX B;  4GOU A;  2WDV A;  4LFC T;  3FYQ A;  3A7M A;  4O4H E;  4ZHQ E;  5ABF B;  3AAA B;  3ZKR A;  4NXM T;  4KHP T;  5LGT B;  4IE5 A;  4CN6 A;  2IDO B;  4BJM A;  3OBV E;  3H37 A;  5JH7 E;  1JNR A;  5JRE A;  4WNK A;  4IDQ A;  1MIV A;  3E22 E;  2KND A;  5FXX A;  2PG8 A;  4AQY T;  1IJ5 A;  1G73 A;  3JAD A;  4B3M T;  3RIU C;  4HFV A;  4QXH B;  4MBQ A;  3R6N A;  3P7I A;  4HEA A;  4CI3 B;  3C4X A;  2J62 A;  5LB7 B;  2LOP A;  4F6R C;  3L09 A;  3ANW A;  3PV0 F;  2V1D B;  2XAF B;  2E9X A;  3J9X 1;  2VKJ A;  3OKQ A;  3O1J A;  3X1D A;  3K3N A;  3A5X A;  4U7I A;  2B76 A;  2MTC A;  2UUB T;  2YDQ A;  5AQR B;  3NRX A;  1IJ6 A;  2JQH A;  4IIJ E;  2E5L T;  3ZYM A;  2LKH A;  3D0T A;  3C4Z A;  4OFZ A;  3ETV A;  3KV4 A;  3O1H A;  3QC9 A;  3O4X E;  2R6G F;  2VVS A;  1D0X A;  3ZC0 A;  3PUV F;  3AVS A;  3L39 A;  4M1P A;  4GK5 E;  4GYR A;  2XZE A;  3H3A A;  4PJN A;  2WMO A;  3AE3 A;  3BK9 A;  2UXC T;  2VQE T;  3FZL B;  3Q5D A;  3CX8 B;  4ZI7 E;  2XQ8 A;  3UUM A;  1J1J A;  3LK2 B;  4LFA T;  4EZH A;  2XQ5 A;  5EK4 A;  2UXD T;  2X0H A;  4O4I E;  4CXX A;  1QLB A;  2A2F X;  4AXP A;  5L4E A;  4IE7 A;  1MIW A;  1HX1 B;  3ZJ2 A;  4TUY E;  2QGS A;  1M7K A;  1E2A A;  3M3Z B;  2QA7 A;  1W0B A;  2WZH A;  2N9D A;  2Y48 B;  5HXR A;  5KXJ A;  2VK9 A;  3K3O A;  4GKK T;  4PW8 A;  1DU2 A;  4KMC A;  4JI0 T;  3CX7 B;  5L3G B;  4U2Y A;  5FXZ A;  4COF A;  1NAF A;  2CHN A;  3RRC A;  4DUZ T;  4JI6 T;  4MHC A;  3ZPO A;  2V7M A;  5FVK A;  2W62 A;  2DNX A;  1BR4 A;  3AEB A;  5J2T E;  5LHH B;  1LVF A;  4U74 A;  3AED A;  2SPC A;  2YK0 A;  4IDZ A;  2CEA A;  1KFY A;  5EK3 A;  4X65 T;  1IZN B;  2X9W A;  3MK7 C;  3AAI A;  4QX7 B;  4CN1 A;  5JDH A;  3RX6 A;  5AQF B;  3ETU A;  2DLR A;  3UU3 A;  3QUJ A;  2EHO A;  2D0U A;  2FUP A;  3M1C A;  4IDP A;  2C5J A;  3DTO A;  5DJQ C;  3NBX X;  1LRZ A;  5C2T A;  3RYH E;  1L0V A;  2ACX A;  4ZS3 A;  4JI1 T;  4ZI2 C;  2D2S A;  2M6B A;  3N9P A;  4ILU A;  3PU3 A;  2L8K A;  2C5K T;  2WSS V;  2IIU A;  2CPT A;  4X62 T;  3P4S A;  2CXL A;  5H6Q B;  1Y64 B;  4LML A;  1BR0 A;  1FIO A;  3FZK B;  2BKO A;  4JI5 T;  5LHI B;  2IW5 B;  3RGL A;  4DR6 T;  4UVA B;  3PUX F;  1UK5 A;  3VR8 A;  1LVK A;  4DV5 T;  3ONJ A;  3AE4 A;  1E7P A;  2CCQ A;  3PHF 1;  3NZQ A;  5F8P A;  2XQY A;  2BBH A;  2X68 A;  3ZMV B;  5LJN A;  3RYC E;  2XPK A;  3R84 B;  5L3E B;  3WUR A;  4A5X A;  4PJM A;  4QXB B;  4L5G A;  3IHR A;  3ZSS A;  3N2O A;  4AIU A;  4UV8 B;  4PK4 A;  3PE0 A;  4YXD A;  3KV5 A;  1I6Z A;  2LSI A;  3E08 A;  2MTQ A;  3BQI A;  5AQL B;  2ZMA A;  2ODV A;  3FB2 A;  4HWH A;  1XZY A;  4UR9 A;  4N78 D;  3N2G E;  3ZMU B;  3SFE A;  1VOM A;  5L47 A;  4WBN E;  3T1H T;  4B3S T;  5JDQ A;  4H9O C;  2XSA A;  3IEE A;  2NWB A;  3PJA A;  4IE0 A;  5LBM A;  3S4U A;  2NR4 A;  4NXN T;  3ESL A;  2CBJ A;  3BQK A;  2W63 A;  5CGM A;  3AEF A;  3EAB A;  2CHO A;  1XNR T;  3AXJ A;  1D1B A;  5KX5 E;  4EZ4 A;  3RIF A;  3EAM A;  2AE9 A;  2V6Y B;  2ZM2 A;  2XM1 A;  1WCR A;  4K0U A;  2QYW A;  1OXZ A;  2XSB A;  4O4L E;  3CX6 B;  4CQI A;  5HXC A;  5CB4 E;  2JQQ A;  3RF1 A;  4ZOL E;  5L3C B;  3AEC A;  4KI0 F;  4YHJ A;  4ZI2 D;  2E9X D;  4QXC B;  3RPU A;  4UEM A;  4UVC B;  5AQJ B;  1KK7 A;  3Q9D A;  4A56 A;  3ZCI A;  3AY5 A;  2BG9 B;  2X0L B;  3JC6 D;  3ZMT B;  3ZYK A;  2L10 A;  4AKH A;  2W00 A;  3W15 B;  5LNK A;  1ZV4 X;  4P0B A;  4H9R C;  1SUM B;  2LOS A;  4HWC A;  3AEG A;  2X9H A;  3N9N A;  2ODU A;  2IUB A;  3LDQ B;  3RIU A;  1NEK A;  3PUZ F;  3FZH B;  1GQE A;  4C91 A;  4QH5 A;  4LF9 T;  4YT0 A;  1W0A A;  1X9B A;  4WBO A;  2CXF A;  4IDO A;  2CLY B;  3Q2M A;  1MMG A;  2I59 A;  4YJ2 E;  3L3P A;  2MYS A;  5EK2 A;  2BG9 C;  2V8S V;  2XQ4 A;  5L2L A;  4L9I A;  2M67 A;  5FZT A;  1M62 A;  2ZM0 A;  3PTR B;  1KEY A;  3UFE A;  3RLF F;  5L4H A;  4AQF C;  1FEW A;  4EV6 A;  2WS3 A;  4AIS A;  5FL0 A;  3UUX B;  4GK0 E;  5CJ5 A;  2KZ7 B;  5FYM A;  2KIN B;  4DND A;  3I9W A;  3C4W A;  3P8C D;  2BKN A;  2YU2 A;  4KUM B;  2J4G A;  3IA3 A;  4X5T A;  2KGX A;  2XUE A;  3GWH A;  4X1I E;  3AE2 A;  5JDL A;  2DWK A;  4JYA T;  1R8I A;  4GIW A;  4HN9 A;  3CPZ A;  3UU6 A;  2FJD A;  5AFU L;  5JR9 A;  3CKD A;  4IGU A;  3PUA A;  2WQY A;  3PUY F;  4IST A;  3MZK B;  4B3T T;  3PF0 A;  2WMN A;  3I0Q A;  4LF8 T;  3DP7 A;  2LJL A;  3AE8 A;  3GN5 B;  5LG3 A;  3PUS A;  4CI2 B;  2W4X A;  2Y8D A;  2PBI A;  4BJN A;  4X1K E;  5HWY A;  4AKI A;  4UF0 A;  4U31 A;  1YQ4 A;  4G63 A;  3TLU A;  2ACZ A;  1AJ3 A;  3JAF A;  2WU2 A;  3QK6 A;  2HPL A;  5DQV A;  4EYU A;  3K8P C;  4DV1 T;  3WAJ A;  4KBM B;  3ONL C;  4DV6 T;  5LMN T;  4YTM A;  2H7O A;  1XDP A;  1J5W A;  3QOF A;  1ZKE A;  3O1I A;  4ZZB A;  4JI4 T;  2Q9Q B;  3A8Y C;  3JAE A;  3HL6 A;  4EIW A;  1YXR A;  3CQG B;  5LG4 A;  2VQF T;  2M6I A;  4PFO A;  5BR8 T;  1HR0 T;  1HF8 A;  4O8S A;  1BR2 A;  3P50 A;  2E5V A;  4UEL A;  3N9Q A;  4EEB A;  5FMN A;  3PJA J;  5LXT E;  2VL0 A;  4JEU B;  3P4Q A;  1OWA A;  1N32 T;  1E1H B;  5E0O A;  1ZOY A;  3AA1 B;  3MA9 A;  3ZT6 A;  2WBL A;  5AQS B;  3U3I A;  4C90 A;  1HNZ T;  1W09 A;  2MAW A;  2YDS A;  3CQX C;  4H9N C;  5HAX A;  2H89 A;  4LMK A;  2E2A A;  4NIQ A;  4DID B;  2Q9Q C;  4EAH A;  2OLT A;  2NW7 A;  4HFC A;  3ZN0 B;  3GA8 A;  3V5U A;  4MLK A;  1X79 A;  3PUQ A;  1KNP A;  1KNR A;  3AE6 A;  1UUR A;  3E0Z A;  3AB3 B;  3UU8 A;  4CXY A;  5HXH A;  2BZB A;  4YSX A;  1CHU A;  2UUA T;  4CI1 B;  2VAS A;  4HFB A;  1QSD A;  3B13 A;  2MBG A;  3KV9 A;  4OHF A;  1OED E;  4YFS A;  4ILC A;  2BS3 A;  1SHZ C;  2BS4 A;  2W67 A;  4TNV A;  3AA0 B;  2WY2 A;  2YOE A;  5HWX A;  1YD8 G;  3PUG A;  1EZ3 A;  5KDM C;  3CVR A;  4QHO A;  2CXD A;  2X9X A;  2A3D A;  5IYZ E;  3DJB A;  4TV9 E;  4DV2 T;  3ANW B;  5J1G A;  3FXD B;  2C5I T;  5BMV E;  2E9X B;  2JPF A;  3T1Y T;  5LHG B;  2CMR A;  3AEA A;  3MXZ A;  3RC3 A;  2LKG A;  2NP9 A;  3N9M A;  5HEO A;  2MPK A;  4X1Y E;  3CML A;  3ZMZ B;  4QH1 A;  4BGO A;  4JV5 T;  2H3R A;  2IC9 A;  4JI3 T;  4DV3 T;  3NWI A;  2IML A;  4GKJ T;  5JDF A;  2LQU A;  3ZT7 A;  2XAQ B;  3HI2 A;  2NTX A;  2CWO A;  2W61 A;  4IHJ E;  4QWN B;  4E7S A;  4X66 T;  2X51 A;  2XQ6 A;  3ABV A;  2Y6X A;  5JRC A;  3FHN A;  1YKE B;  4W8P A;  3SFD A;  1O3X A;  2HN2 A;  3ZYL A;  1S94 A;  3UT5 E;  3UUN A;  4U7Y A;  1MNE A;  5EZY E;  4Z90 A;  2LSG A;  1N36 T;  3C50 A;  3P4R A;  1MIY A;  2LE8 A;  1UX5 A;  2XM2 A;  4DVD A;  1OED A;  4AKR B;  2XY8 B;  2MOZ A;  3TLV A;  1MMN A;  4YJ3 E;  2DHR A;  3SRZ A;  3OVU A;  5A1L A;  2C0S A;  2KWH A;  2VKH A;  4UVB B;  2VKO A;  4LFB T;  2JMK A;  2WP9 A;  2DL1 A;  5HCJ A;  4MFR A;  1D1A A;  4ZI3 C;  1Y01 A;  4HFD A;  3VR9 A;  2BS2 A;  1MMD A;  3OYZ A;  2V7K A;  5AQN B;  5AQQ B;  1N34 T;  5LGN B;  2CRB A;  4EED A;  4TWF A;  4XBF B;  4PK5 A;  4QH4 A;  4FI5 A;  4PK6 A;  3KBU A;  4IRE A;  5C8Y E;  2EHO B;  3EHZ A;  3N2K E;  2H7V C;  4PJL A;  4OX9 T;  3FBZ A;  2V5C A;  3VRA A;  3CK6 A;  4EGW A;  2LSJ A;  4UXN B;  1G8X A;  3Q5E A;  1KNZ A;  2FBW A;  4PFP A;  3NVO A;  2LSK A;  4TNW A;  1MND A;  4A98 A;  3AAE B;  4DV7 T;  2CBI A;  3P4P A;  2LT3 A;  4U33 A;  3RQW A;  1HG2 A;  1N33 T;  2V7J A;  1D0Y A;  4JI2 T;  3EDU A;  3ZCJ A;  4DBR A;  4YHH T;  5L3D B;  2BVL A;  4HWD A;  2XAJ B;  1HNW T;  3QB5 K;  5AQI B;  2NW9 A;  3CIR A;  4H9S E;  4JBW F;  2UUC T;  2X9Y A;  2UU9 T;  1V9D A;  3RYI E;  4LF4 T;  2HHH T;  5ABH A;  3LBX A;  1JNZ A;  4B3R T;  5ABF A;  2XJ7 A;  2KMF A;  1WFD A;  2X0Y A;  3ZMS B;  5JDG A;  3H3M A;  3RI5 A;  1WLX A;  4ZI3 D;  2IAK A;  1BR1 A;  4XAX B;  4WW0 A;  2RP4 A;  4Z91 A;  4E7Z A;  2W66 A;  3LG7 A;  4JI8 T;  3OPC A;  3ZST A;  4F8H A;  2W0G A;  3CQC B;  1UX4 A;  2NOX A;  4Q25 A;  5HXS A;  3AXJ B;  4HFH A;  3K1S A;  3KDS E;  4G2A A;  5AQM B;  1IBL T;  3U78 A;  2I6H A;  5JVD E;  1KF6 A;  4QKN A;  4ZS2 A;  3AA7 B;  4ASK A;  5T1D A;  4P09 A;  3LFM A;  4FJO A;  3UFG A;  4XZC A;  4YSY A;  4I0U A;  4ERR A;  2CLY C;  4JLE A;  2LEH A;  4TN7 B;  5ETW A;  4DO0 A;  5LGU B;  2GK9 A;  2L9Q A;  3ZJ1 A;  4LF7 T;  3RHW A;  2VWA A;  4BA9 A;  2YN6 A;  4NPP A;  3AE9 A;  3NRY A;  4DV0 T;  4EYY R;  1W9R A;  3HA4 A;  3J7Y q;  5LP6 E;  2ES0 A;  4BAY B;  2QRX A;  2FJE A;  3HKD E;  4DR3 T;  5F5W A;  3HR0 A;  4DV4 T;  1YQ3 A;  1XDO A;  3V5S A;  2RPA A;  4JI7 T;  4IDN A;  3FZM B;  5GON E;  2V26 A;  1UUS A;  2LRL A;  3RKO A;  3UUL A;  4PJJ A;  1HFA A;  2XQ9 A;  5AQO B;  4ADZ A;  4PAG A;  4DUY T;  2H88 A;  3KVB A;  3JCF A;  2PFV A;  4ZZC A;  5F3J A;  4L0R A;  2VVN A;  3EI0 A;  2QVA A;  4LF5 T;  4I4T E;  2WB5 A;  2XQ3 A;  2RA1 A;  3HKC E;  1VCT A;  3UQ7 A;  4PNI A;  2DI4 A;  2UXX B;  3ZT5 A;  1HNX T;  2N2N A;  5FVL A;  1VCS A;  5DAB A;  4H9Q C;  3TKL B;  1I94 T;  2X0C A;  5FKY A;  4YLH A;  4HTE A;  3AE5 A;  4ZEY A;  1IAP A;  5LA6 E;  4EB6 E;  4GYS A;  1T72 A;  4CN4 A;  5LMU T;  3LJC A;  5HEU A;  3OTO T;  5C3J A;  3VRB A;  4HWF A;  2XTL A;  3UU5 A;  1D1C A;  1SJ7 A;  5JR9 B;  4DR1 T;  1UCU A;  2JMH A;  4AKL A;  4TWH A;  2KVP A;  4ONR A;  3QB5 A;  1XMO T;  2NTY A;  1ZP0 A;  4P1N A;  4DBQ A;  3AE7 A;  2LHR A;  2HPJ A;  2PTF A;  2NW8 A;  3Q5X A;  4U2Z A;  5AQV B;  4IL4 A;  1Z8U A;  4DMW A;  3O9X A;  2HH7 A;  2OA5 A;  3LK3 B;  3VJZ A;  2W2U A;  2CM0 A;  3AEE A;  3G06 A;  4ILA A;  4UF0 B;  5JDN A;  1XNQ T;  5AQK B;  4IT4 A;  3F31 A;  5CA0 E;  3C64 A;  3SOL A;  4DMV A;  2LM9 A;  3B57 A;  3WI3 A;  4NUV A;  2L7N A;  2I0M A;  1S35 A;  4HE8 A;  5TAO A;  1XWM A;  4UV9 B;  2F4V T;  4TX5 A;  5AQH B;  4P0A A;  5CFB A;  5FL1 A;  4KP3 C;  3WSC A;  2XHE B;  2K24 A;  1YW0 A;  2K5B B;  5J0Z A;  2CA5 A;  5J2U E;  4X20 E;  5JR9 C;  3UU4 A;  3B5M A;  4DR2 T;  1UGO A;  2XQ7 A;  3OYX A;  3KV6 A;  4U3C A;  3N9L A;  2YDR A;  4IE4 A;  4O2B E;  2WAU A;  1HS7 A;  4U72 A;  5M4Y A;  2BG9 E;  3F2E A;  4DR5 T;  3FXE B;  3QNU A;  3CWZ B;  3I1A A;  3Q5W A;  4HGA A;  5JTG A;  5FY1 A;  2IHR 1;  2CWY A;  2WU5 A;  5ABG A;  3N5L A;  1T98 A;  1B7T A;  1U4Q A;  4K0K T;  1WYC A;  5LJM A;  2X66 A;  4LMJ A;  2K3W A;  4KX6 A;  1FJG T;  2LHN A;  2XQA A;  5L3F B;  1NWM X;  2BVM A;  3IBP A;  3PUW F;  2FJA A;  4HWI B;  2KSR A;  2XAG B;  5IWA T;  4HFI A;  5JQG E;  2N1G A;  5FXV A;  5AQT B;  1SE7 A;  2OV9 A;  5FY0 A;  2BKP A;  1H7C A;  4WYV A;  5KMG P;  3LSV A;  5L3B B;  4AQG A;  4ANJ A;  4LF6 T;  3UUB A;  2ZM6 T;  2BDE A;  3ZN1 B;  3UQ4 A;  3TLW A;  1T8B A;  4I43 B;  4A97 A;  3VU7 H;  3SS1 A;  3AT7 A;  2E9X C;  2V6Y A;  3MKD A;  2KT9 A;  2Q9Q D;  1FMV A;  2LM2 A;  3AA6 B;  2YEV C;  2A72 A;  3PU8 A;  1XMQ T;  2WM9 A;  3JC6 C;  2JJ9 A;  4V1A v;  4HKA A;  4ECG A;  1HG5 A;  3OJA A;  3L8R A;  3KVA A;  4JEH B;  3VKG A;  3AVR A;  2PJQ A;  5CA1 E;  5LYJ E;  2UXB T;  3M65 A;  5AQG B;  2DWG A;  2WWU A;  2BG9 A;  2JQ9 A;  2CE7 A;  1T7S A;  3KFW X;  1LKX A;  1YKH B;  2V6X A;  2D9D A;  4H63 V;  4IL9 A;  2WCA A;  4YTP A;  4AQF A;  4HFE A;  4DR4 T;  2ZLY A;  2VKD A;  5DQW A;  4YY3 T;  4B6X A;  1Z0P A;  3UTK A;  2IC6 A;  3DYJ A;  4JUY A;  3HKB E;  5ADX L;  2VUR A;  4YTN A;  1IBM T;  2YIN A;  4MAL A;  5AQU B;  4QX8 B;  3EDV A;  2YU1 A;  3TLS A;  2AXD S;  3ZLI A;  5LCY A;  3WAK A;  5ABE A;  2KXP B;  4ISS A;  2P9B A;  4Z8X A;  2X67 A;  3PUR A;  5HEJ A;  2K9A A;  3RYF E;  2ZM8 A;  3VKH A;  2JIW A;  3SWH A;  1ZEE A;  3T8O A;  3FZF B;  4AKG A;  3EVY A;  2KLQ A;  5HYA A;  5IUX A;  3C51 A;  2XAH B;  3MAC A;  3RKG A;  4I55 E;  5FXW A;  2WDR A;  1ZHC A;  1U5P A;  4KHZ F;  5JRC B;  4CZZ B;  1WYB A;  2HN1 A;  3P4W A;  4CXW A;  3AE1 A;  2E8I A;  2DCF A;  3KIN B;  2V7L A;  3RRW A;  4YSZ A;  3I9Y A;  1HX8 A;  1FMW A;  2Z6E A;  3NZP A;  3IF8 B;  1OED B;  2J1D G;  1D0Z A;  3VHL A;  1MMA A;  4TZ4 C;  2D0T A;  2V5D A;  2EHO C;  4ILB A;  2D5U A;  4ZXL A;  5HXE A;  3FBL A;  4X64 T;  3GN5 A;  1HCI A;  3RC8 A;  5FY7 A;  3N9O A;  1SJ8 A;  5AQP B;  5IHY A;  3ONX A;  5FP3 A;  4TWD A;  5FNV E;  2JRK A;  2FJB A;  3LK4 2;  1VRB A;  2LRK A;  2LLY A;  2WZI A;  3ZC1 A;  3PDY A;  2KBB A;  1WRD A;  1NEN A;  4H63 H;  3K3Q C;  4OK0 A;  4OYJ A;  3EUH A;  2K48 A;  2YKS A;  2G0U A;  4I50 E;  4WZX A;  3HKE E;  3MJX A;  5LOV E;  2BBJ A;  1OED C;  4O4J E;  5HCM A;  1CUN A;  4NUU A;  4IE6 A;  5LBQ B;  4H9P C;  2Q9Q A;  3KBT A;  5HEG A;  4O2A E;  2J47 A;  5H6R B;  2A9U A;  4EXT A;  2WDQ A;  2VB6 A;  4J2C A;  3TLT A;  3RH3 A;  2LSY A;  2UXN B;  3C98 B;  3RQU A;  1HTJ F;  4AI6 A;  1IBK T;  3NKZ A;  1J5E T;  5JDM A;  2V7I A;  4TV8 E;  4DR7 T;  2JQK A;  2B1E A;  4EOZ B;  3GMI A;  2WWV A;  3ZEF B;  1QUU A;  1WR0 A;  1SA0 E;  5HEH A;  4F7G B; 
#chains in the Genus database with same CATH homology
 4YHJ A;  4OYK A;  4ZI2 D;  1MNE A;  2E9X D;  5EZY E;  2LSG A;  3BQL A;  1WR6 A;  4QXC B;  3RPU A;  2VL8 A;  4UEM A;  4UVC B;  3F31 A;  5CA0 E;  3C64 A;  3C50 A;  3SOL A;  2XAS B;  1KK7 A;  4DMV A;  4UIG A;  3Q9D A;  1MIY A;  2LM9 A;  3B57 A;  2LE8 A;  3I0O A;  3WI3 A;  1UX5 A;  3F57 A;  3ZCI A;  4A56 A;  4NUV A;  4DVD A;  4AKR B;  1S35 A;  2X0L B;  2L3L A;  3JC6 D;  2MOZ A;  4HE8 A;  5TAO A;  3ZMT B;  4UV9 B;  4TX5 A;  1MMN A;  3ZYK A;  4YJ3 E;  1US7 B;  2KWI B;  4AKH A;  4P0A A;  2EHO D;  3LBX B;  4GOU A;  2W00 A;  4KP3 C;  3WSC A;  2DHR A;  2XHE B;  2K24 A;  3W15 B;  1YW0 A;  3SRZ A;  4O4H E;  2K5B B;  5LNK A;  4ZHQ E;  1ZV4 X;  3AAA B;  2CA5 A;  4P0B A;  4X20 E;  5J2U E;  5JR9 C;  4H9R C;  2LOS A;  5A1L A;  2C0S A;  2X9H A;  3N9N A;  3OYX A;  3KV6 A;  2ODU A;  2KWH A;  3N9L A;  2VKH A;  4UVB B;  2VKO A;  4IE4 A;  5LGT B;  4O2B E;  4IE5 A;  2JMK A;  2WAU A;  1HS7 A;  4BJM A;  3OBV E;  4C91 A;  4U72 A;  4MFR A;  5M4Y A;  3F2E A;  3H37 A;  1D1A A;  5JH7 E;  4ZI3 C;  3FXE B;  3CWZ B;  3I1A A;  5JRE A;  3Q5W A;  4HGA A;  1MMD A;  3OYZ A;  2V7K A;  4WNK A;  1MIV A;  3E22 E;  2KND A;  5FY1 A;  2CWY A;  4WBO A;  2CXF A;  5FXX A;  5LGN B;  2CLY B;  3N5L A;  3Q2M A;  1T98 A;  2PG8 A;  1MMG A;  1B7T A;  1U4Q A;  4XBF B;  2I59 A;  1WYC A;  1IJ5 A;  4PK5 A;  1G73 A;  2MYS A;  2X66 A;  3L3P A;  4YJ2 E;  5EK2 A;  5LJM A;  5L2L A;  4L9I A;  2M67 A;  2LHN A;  4HFV A;  4QXH B;  1NWM X;  2BVM A;  4MBQ A;  4FI5 A;  2ZM0 A;  3PTR B;  4PK6 A;  3R6N A;  5L3F B;  3P7I A;  3IBP A;  4HEA A;  4CI3 B;  3UFE A;  3C4X A;  2LOP A;  4F6R C;  3KBU A;  2XAG B;  3L09 A;  3ANW A;  4AQF C;  5C8Y E;  2EHO B;  1FEW A;  3N2K E;  2H7V C;  2V1D B;  2XAF B;  4PJL A;  2E9X A;  3FBZ A;  5JQG E;  3J9X 1;  3UUX B;  4GK0 E;  2N1G A;  5FXV A;  2VKJ A;  3OKQ A;  2KZ7 B;  2LSJ A;  5FYM A;  4UXN B;  5FY0 A;  2KIN B;  3O1J A;  4DND A;  3I9W A;  3K3N A;  3C4W A;  3P8C D;  3A5X A;  2YU2 A;  1G8X A;  4KUM B;  1KNZ A;  1H7C A;  4PFP A;  2MTC A;  2LSK A;  2XUE A;  3GWH A;  4X1I E;  3NRX A;  5KMG P;  1IJ6 A;  1MND A;  5JDL A;  4IIJ E;  2DWK A;  3AAE B;  3ZYM A;  5L3B B;  4GIW A;  4AQG A;  4ANJ A;  3D0T A;  2LT3 A;  3C4Z A;  3CPZ A;  4HN9 A;  4OFZ A;  5AFU L;  5JR9 A;  2BDE A;  1HG2 A;  3CKD A;  3ZN1 B;  2V7J A;  4IGU A;  3ETV A;  1D0Y A;  3KV4 A;  3EDU A;  3O1H A;  3QC9 A;  3PUA A;  4IST A;  3MZK B;  3O4X E;  3ZCJ A;  4DBR A;  3PF0 A;  2WMN A;  4I43 B;  3VU7 H;  3I0Q A;  3SS1 A;  1D0X A;  3ZC0 A;  2E9X C;  3DP7 A;  3AT7 A;  2LJL A;  3MKD A;  3AVS A;  4M1P A;  2KT9 A;  3GN5 B;  2Q9Q D;  1FMV A;  4GK5 E;  4GYR A;  3PUS A;  3AA6 B;  5L3D B;  2BVL A;  3H3A A;  2YEV C;  4PJN A;  2WMO A;  2A72 A;  4CI2 B;  3PU8 A;  3BK9 A;  2Y8D A;  2WM9 A;  3JC6 C;  2JJ9 A;  2XAJ B;  2PBI A;  4HKA A;  4V1A v;  4ECG A;  1HG5 A;  4BJN A;  4X1K E;  3OJA A;  3CX8 B;  4ZI7 E;  3UUM A;  3KVA A;  5HWY A;  3LK2 B;  4AKI A;  4JEH B;  4EZH A;  4UF0 A;  3VKG A;  2NW9 A;  4G63 A;  4H9S E;  3AVR A;  5EK4 A;  2PJQ A;  5CA1 E;  5LYJ E;  1AJ3 A;  3M65 A;  4O4I E;  4CXX A;  3QK6 A;  2DWG A;  2A2F X;  4AXP A;  2WWU A;  2X9Y A;  2HPL A;  5DQV A;  1V9D A;  4IE7 A;  3RYI E;  1MIW A;  4EYU A;  3K8P C;  2CE7 A;  3KFW X;  3ZJ2 A;  1LKX A;  2QGS A;  4TUY E;  1YKH B;  4H63 V;  3WAJ A;  4KBM B;  3LBX A;  2QA7 A;  4AQF A;  2ZLY A;  2VKD A;  5DQW A;  4B6X A;  1Z0P A;  2N9D A;  2Y48 B;  5HXR A;  3UTK A;  2IC6 A;  2KMF A;  2H7O A;  2VK9 A;  3K3O A;  4JUY A;  4PW8 A;  3ZMS B;  4KMC A;  3HKB E;  5ADX L;  3CX7 B;  5L3G B;  5FXZ A;  5JDG A;  1NAF A;  1ZKE A;  3O1I A;  2YIN A;  4MAL A;  3RRC A;  4QX8 B;  3EDV A;  2YU1 A;  2Q9Q B;  3ZLI A;  5LCY A;  3WAK A;  1WLX A;  4ZI3 D;  4MHC A;  3ZPO A;  2IAK A;  1BR1 A;  2V7M A;  4XAX B;  3HL6 A;  4EIW A;  3CQG B;  2KXP B;  4WW0 A;  4ISS A;  2P9B A;  2RP4 A;  5LG4 A;  4Z8X A;  2X67 A;  3PUR A;  2K9A A;  3RYF E;  2W62 A;  2DNX A;  1BR4 A;  2ZM8 A;  4PFO A;  5J2T E;  4E7Z A;  5LHH B;  3VKH A;  1LVF A;  4U74 A;  3LG7 A;  2SPC A;  2YK0 A;  1HF8 A;  3SWH A;  4IDZ A;  1ZEE A;  4O8S A;  3T8O A;  4AKG A;  2CEA A;  1BR2 A;  2W0G A;  2KLQ A;  3CQC B;  1UX4 A;  3EVY A;  5HYA A;  5EK3 A;  3C51 A;  2XAH B;  2NOX A;  1IZN B;  4UEL A;  5HXS A;  3N9Q A;  2X9W A;  3MAC A;  5FMN A;  3MK7 C;  3AAI A;  4QX7 B;  5LXT E;  5JDH A;  4I55 E;  3KDS E;  4G2A A;  4JEU B;  5FXW A;  3RX6 A;  3U78 A;  1OWA A;  5JVD E;  3ETU A;  2DLR A;  1E1H B;  3QUJ A;  5E0O A;  2EHO A;  2D0U A;  3AA1 B;  3MA9 A;  1ZHC A;  4QKN A;  1U5P A;  2WBL A;  4ZS2 A;  3U3I A;  5JRC B;  3M1C A;  4CZZ B;  1WYB A;  4CXW A;  4C90 A;  2E8I A;  2C5J A;  2DCF A;  3AA7 B;  3KIN B;  4ASK A;  4P09 A;  3LFM A;  5T1D A;  3DTO A;  5DJQ C;  4FJO A;  3NBX X;  4XZC A;  1LRZ A;  4H9N C;  3CQX C;  3RYH E;  2V7L A;  3RRW A;  5HAX A;  4ERR A;  2ACX A;  2CLY C;  4JLE A;  3I9Y A;  4ZS3 A;  1HX8 A;  4ZI2 C;  2LEH A;  4TN7 B;  2D2S A;  5ETW A;  1FMW A;  4DO0 A;  2Z6E A;  5LGU B;  2Q9Q C;  3N9P A;  2GK9 A;  4EAH A;  2L9Q A;  2NW7 A;  4ILU A;  3PU3 A;  3ZJ1 A;  2L8K A;  3NZP A;  3IF8 B;  2C5K T;  2WSS V;  3ZN0 B;  2VWA A;  3GA8 A;  3V5U A;  2CXL A;  4MLK A;  2J1D G;  5H6Q B;  1X79 A;  1D0Z A;  1Y64 B;  3VHL A;  1MMA A;  3NRY A;  4TZ4 C;  4EYY R;  3HA4 A;  2D0T A;  3PUQ A;  3J7Y q;  1BR0 A;  5LP6 E;  2ES0 A;  2EHO C;  4BAY B;  2D5U A;  5HXE A;  3HKD E;  1FIO A;  3FBL A;  3HR0 A;  5LHI B;  2IW5 B;  3E0Z A;  3AB3 B;  3GN5 A;  4UVA B;  4CXY A;  1HCI A;  3RC8 A;  5FY7 A;  5HXH A;  3V5S A;  3N9O A;  1LVK A;  2BZB A;  4CI1 B;  5IHY A;  2VAS A;  3ONX A;  5FP3 A;  2CCQ A;  5FNV E;  2JRK A;  3PHF 1;  1QSD A;  3NZQ A;  5F8P A;  2XQY A;  3LK4 2;  2X68 A;  3B13 A;  3ZMV B;  2MBG A;  5GON E;  5LJN A;  1VRB A;  2V26 A;  3RYC E;  3KV9 A;  4OHF A;  4YFS A;  3RKO A;  3UUL A;  4PJJ A;  1HFA A;  3R84 B;  1SHZ C;  5L3E B;  3ZC1 A;  4ADZ A;  3WUR A;  4PJM A;  3PDY A;  4L5G A;  4PAG A;  4QXB B;  1WRD A;  3IHR A;  3AA0 B;  3N2O A;  4UV8 B;  4H63 H;  3KVB A;  3K3Q C;  4OK0 A;  4PK4 A;  4OYJ A;  3EUH A;  2K48 A;  5HWX A;  2PFV A;  1YD8 G;  5F3J A;  2G0U A;  4L0R A;  4I50 E;  3PUG A;  1EZ3 A;  5KDM C;  3HKE E;  3MJX A;  3PE0 A;  3KV5 A;  5LOV E;  4I4T E;  3CVR A;  2LSI A;  3E08 A;  4O4J E;  2RA1 A;  2MTQ A;  4QHO A;  3HKC E;  2CXD A;  3BQI A;  4PNI A;  2DI4 A;  2UXX B;  2X9X A;  2A3D A;  1CUN A;  2ZMA A;  2ODV A;  4NUU A;  3FB2 A;  3DJB A;  4IE6 A;  5IYZ E;  4TV9 E;  4N78 D;  2N2N A;  3ANW B;  3N2G E;  3ZMU B;  5J1G A;  3FXD B;  5DAB A;  2C5I T;  5LBQ B;  5BMV E;  1VOM A;  4H9Q C;  3TKL B;  2E9X B;  2JPF A;  4H9P C;  4WBN E;  2Q9Q A;  4YLH A;  3KBT A;  5JDQ A;  5LHG B;  4O2A E;  2CMR A;  4H9O C;  4HTE A;  3RC3 A;  1IAP A;  3MXZ A;  5H6R B;  3IEE A;  2NWB A;  4IE0 A;  5LA6 E;  2NP9 A;  4EB6 E;  3N9M A;  5LBM A;  4GYS A;  4X1Y E;  4BA9 A;  3CML A;  3ZMZ B;  3LJC A;  3S4U A;  4EXT A;  2VB6 A;  4J2C A;  4BGO A;  3ESL A;  2H3R A;  3RH3 A;  2XTL A;  2IC9 A;  3BQK A;  2W63 A;  1D1C A;  2LSY A;  2UXN B;  3C98 B;  5JR9 B;  5JDF A;  1HTJ F;  1UCU A;  2JMH A;  4AI6 A;  4AKL A;  1D1B A;  5KX5 E;  4ONR A;  4EZ4 A;  2LQU A;  2NTY A;  2XAQ B;  4DBQ A;  3HI2 A;  2NTX A;  2LHR A;  2CWO A;  2W61 A;  4IHJ E;  2HPJ A;  4QWN B;  2ZM2 A;  4E7S A;  2NW8 A;  3Q5X A;  2X51 A;  5JDM A;  2V7I A;  2Y6X A;  4K0U A;  4TV8 E;  5JRC A;  3FHN A;  4DMW A;  1OXZ A;  2HH7 A;  3O9X A;  2B1E A;  4EOZ B;  1YKE B;  2OA5 A;  3LK3 B;  3GMI A;  1O3X A;  4O4L E;  3CX6 B;  3VJZ A;  3ZYL A;  2CM0 A;  4CQI A;  3ZEF B;  1QUU A;  1S94 A;  3UT5 E;  5HXC A;  1SA0 E;  5CB4 E;  2JQQ A;  4UF0 B;  3UUN A;  5JDN A;  4ZOL E;  5L3C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...