5HXSA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 10mm sr2+
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
300
structure length
296
Chain Sequence
b'MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEENNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 122
structure length 296
sequence length 300
ec nomenclature
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hxsA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hxsA02
5JDHA 5HWYA 5HWXA 3V5UA 5HXHA 5HXSA 5HXEA 5JDGA 5JDNA 5JDMA 5JDFA 5HYAA 5JDLA 5HXCA 3V5SA 5HXRA 5JDQA
chains in the Genus database with same CATH superfamily
2WWVA 2Q9QA 3LFMA 2XAGB 3VRAA 5IUXA 4YLHA 2ZM6T 4ZEYA 2XSBA 4IDPA 1FEWA 3IF8B 4HKAA 2M67A 1D0ZA 4X65T 5H6RB 3BK9A 5J2TE 3PUAA 1G8XA 4EYUA 3PDYA 2FJBA 3GN5A 3KBTA 3ZN1B 1KK7A 3I0QA 2XM1A 2WZIA 4ILUA 2WU2A 4UVCB 4ERRA 4HFBA 2L9QA 5JR9A 3AEEA 3ANWB 1Y01A 2Z6EA 4KBMB 5JH7E 5CA0E 4HFIA 4TV9E 3RLFF 3OJAA 4DIDB 2RA1A 1HNZT 3MACA 2MOZA 3RKGA 5FVKA 3R84B 4CXYA 4B3MT 2X9WA 4X62T 3EAMA 3NZQA 3M65A 2PTFA 2Q9QB 2NW9A 5CJ5A 2K48A 3ZEFB 2LSYA 3K3QC 3AB3B 2LEHA 4CXXA 4B3RT 4HEAA 3P4RA 5AQHB 3KINB 3L3PA 3C98B 4UV8B 3AT7A 1VCTA 3UUNA 3GN5B 2X9XA 2ZMAA 3ZT7A 3U3IA 3ZMSB 4BGOA 5L4HA 2LSJA 3EUHA 3CMLA 5FY7A 1NAFA 2UXNB 2MTQA 3WURA 4L5GA 5LG3A 5JR9B 4JBWF 4HWIB 1IJ5A 3I0OA 5J2UE 1U4QA 4P1NA 1D0XA 4NXNT 1SHZC 2X51A 4P0BA 3PUVF 2AE9A 5LYJE 4A56A 2RPAA 5BMVE 1J1JA 2XZEA 4YHJA 3AA7B 2D9DA 3PUYF 4KP3C 4TNVA 2KNDA 5HEHA 2YOEA 3AY5A 2A72A 1FMWA 4OYKA 3O9XA 4PK6A 4TNWA 5HXSA 4ANJA 5AQMB 4AQGA 3ZMTB 3ZT6A 1MIVA 2VKOA 1VOMA 2X67A 3AE5A 3PUZF 3SS1A 2CCQA 3CX7B 2L8KA 2BS2A 4PFOA 1OXZA 4I50E 3FXEB 1XMQT 3EABA 2LOPA 1HG2A 2CHOA 1MMNA 2BVLA 2BKOA 1WYCA 3ONLC 2CLYB 1WR6A 4BA9A 1MMAA 4COFA 2V6YA 3HL6A 3KV9A 1US7B 1D0YA 2VK9A 2NW8A 5JRCA 2YKSA 3J9X1 1ZP0A 3CPZA 4EAHA 4AKIA 3A5XA 2CLYC 1HR0T 3L09A 2NR4A 3PV0F 2DHRA 2H88A 2W61A 3CX8B 3SOLA 4EEBA 2E9XA 4G63A 1U5PA 3QOFA 2LRKA 2X0LB 2YK0A 3RQUA 5F3JA 3B5MA 2KBBA 2YEVC 4IHJE 3UUBA 4TX5A 1WFDA 2JQQA 1KFYA 4HTEA 2DNXA 3P8CD 1KF6A 1N34T 5L3EB 3CQXC 3Q5WA 2FJAA 3C50A 4TUYE 4DR6T 2WB5A 4NPPA 1I6ZA 4ONRA 2V6YB 3RC3A 5KMGP 4AI6A 1YQ4A 3FBLA 3W15B 3HKDE 4K0KT 3ONXA 2NTXA 3RYCE 4N78D 5JRCB 4QXHB 4X1IE 3VRBA 1BR2A 3AE4A 2VL8A 4U2ZA 4JI0T 4H9NC 3TLTA 4Z8XA 3EHZA 3RX6A 3RF1A 4YJ3E 3FBZA 5F8PA 3T1HT 5AQFB 3UU6A 2E9XB 2V7MA 3PHF1 4UIGA 4DR1T 1VCSA 3UQ4A 3ZJ1A 1HNXT 3N2OA 5LHIB 2DWGA 2IDOB 1MNEA 1KEYA 4PK4A 4CI1B 3AE6A 4QKNA 4E7SA 4X20E 4JYAT 3KVAA 3ETUA 4AXPA 2E9XC 4AKLA 3VKGA 2X9YA 1KNPA 3IHRA 1XMOT 3N5LA 2LHRA 1HNWT 4ZI2C 3FB2A 3LDQB 3OYXA 5FYMA 4LF6T 2KLQA 3AA0B 1XDPA 2MBGA 4TWDA 3GMIA 2P9BA 5LMUT 2LHNA 4QH5A 2OV9A 4O4IE 1JNRA 3PUXF 2VWAA 4HWDA 1N33T 4ZZBA 2FUPA 3VHLA 5JDHA 1UK5A 1AJ3A 4HE8A 2KXPB 2KMFA 3TLVA 2EHOA 4WNKA 5LOVE 5KX5E 2IW5B 2WZHA 4IIJE 2X0HA 4HWFA 2XQAA 1GQEA 3UU8A 5E0OA 2V26A 3OBVE 1T98A 4LMKA 3WSCA 3LG7A 4QWNB 4E7ZA 3DJBA 2PBIA 2NW7A 5AQIB 5C8YE 4FJOA 4I0UA 2VKJA 2W67A 5KXJA 4CXWA 4ZI7E 5AQNB 4AQYT 2UXXB 3B13A 4UEMA 3ETVA 3PUSA 4KMCA 2CHNA 3TKLB 2WCAA 2E5VA 3PUQA 4PFPA 4YTNA 4X64T 5M4YA 3PJAJ 3HA4A 1HX1B 4JI4T 3WAKA 2W62A 2K9AA 1CHUA 2LSIA 2HPLA 4ADZA 3E08A 2BVMA 3UQ7A 1OEDA 2CBIA 4DV0T 1L0VA 5ADXL 2EHOB 2UXDT 1BR4A 4CN1A 2KINB 2W63A 3HKCE 4TZ4C 2VURA 4B3ST 2XPKA 2N1GA 4EV6A 3BQIA 3IBPA 3QK6A 4IL4A 2EHOC 2YU1A 2XAHB 1MMGA 5GONE 2WDQA 4QHOA 4U31A 2V8SV 1UURA 5FXVA 4PW8A 3AA6B 3ZPOA 4EYYR 4U7IA 5F5WA 2KWIB 2PJQA 2V7LA 3MA9A 4ISSA 5LJMA 1WRDA 4EZHA 2W0GA 3RQWA 5IYZE 1UUSA 4U2YA 3RIFA 1Y64B 4WW0A 5JREA 3UFGA 2A9UA 3RYIE 4HFVA 2X0CA 4YSXA 3QUJA 4IE7A 2IIUA 5JDFA 3JC6C 2E9XD 4YSYA 1OEDB 3ZKRA 5L4EA 4F8HA 5DQWA 4ZI2D 4GK0E 4U72A 5AQOB 2QA7A 2CEAA 3CX6B 4Q25A 3K3OA 2LM9A 4CN6A 3AEDA 2M6IA 1FJGT 4WBOA 3UU4A 4A97A 1D1CA 3R6NA 3L39A 2XUEA 3VKHA 4IT4A 3FZLB 4AIUA 3FZKB 2LOSA 4HFCA 1HX8A 3RIAA 2CXLA 4WBNE 2CXFA 3VR9A 2XTLA 2XAQB 2R6GF 4ZOLE 2V7KA 3VR8A 3S4UA 1W09A 3X1DA 4MBQA 4QX7B 1J5ET 4EOZB 4LF9T 3ZC0A 4AQFC 3F57A 4JV5T 2Q9QC 2CWOA 3CIRA 2LJLA 4LFAT 4KX6A 4JI2T 4BAYB 1SUMB 2GK9A 4MALA 2BKNA 2WS3A 2YDSA 2QYWA 4O2AE 1D1AA 4GOUA 5HXHA 2WMNA 4ZZCA 2E8IA 5FXXA 1IBKT 5CB4E 3T1YT 4IGUA 3VJZA 5FXWA 4H9SE 4ILCA 3ZYLA 4CI3B 3EI0A 4M1PA 5DJQC 4NIQA 5AQSB 4YSZA 3BQLA 3TLUA 3CVRA 3PU8A 3UUMA 4L0RA 2DWKA 3LK2B 4A5XA 1UX5A 3AE3A 3H3AA 1OEDE 5JR9C 5HCJA 2OA5A 2CBJA 4H9OC 1XDOA 5ETWA 2CE7A 2W66A 2OLTA 3AXJA 5FNVE 2K5BB 4LF7T 4EIWA 1DU2A 2B76A 3C4ZA 4PK5A 1ZOYA 5HYAA 2UUBT 3NZPA 5FY1A 3JADA 4DBQA 1NWMX 3RYFE 3ZMVB 3G06A 4JI5T 4O4LE 2Y8DA 2VQET 3AECA 2CA5A 2EHOD 3FZMB 3O1HA 3E22E 5L2LA 3M3ZB 5LHHB 5AQJB 3ZJ2A 2WBLA 3P4WA 1E7PA 4CQIA 5LMNT 3QB5A 2NP9A 4JEHB 1QSDA 2A2FX 2AXDS 4OHFA 3OKQA 1UX4A 4TWHA 5L3DB 5J0ZA 5FMNA 4UF0A 3JC6D 4UELA 3SFEA 2MPKA 3BQKA 3AXJB 2BBHA 3QB5K 3N9NA 3IEEA 3AE2A 5HEJA 2LT3A 5JDMA 3UT5E 2KGXA 3CKDA 3WI3A 4H9RC 4EXTA 2BKPA 2B1EA 3Q9DA 3TLSA 4UR9A 5LBMA 1ZEEA 1FMVA 4DV2T 5LGUB 5FZTA 4YTMA 4YY3T 4OFZA 2V1DB 5ABHA 3PURA 3EDVA 5FXZA 2X9HA 2CRBA 1E1HB 2ZM0A 4JI3T 1WYBA 1ZKEA 2JQKA 3P7IA 1OWAA 4H9PC 1M62A 1MIYA 4YFSA 3A7MA 2WWUA 4DR4T 3MJXA 3ONJA 2C5KT 3O1JA 4LF8T 2V5CA 3NRYA 1Z0PA 4ILAA 1ZHCA 2HHHT 4B6XA 4Z90A 2Q9QD 4TWFA 3K8PC 4UF0B 4BJNA 1LVKA 5BR8T 1O3XA 4JEUB 1B7TA 2IMLA 4BJMA 5HXCA 3JCFA 5LHGB 1IJ6A 1SJ7A 2ODVA 4J2CA 4UXNB 2QGSA 2LRLA 2ACZA 5C3JA 2WAUA 1SE7A 2BG9A 3AAAB 4YHHT 3N9MA 5JDQA 5LP6E 2I0MA 3FZFB 4NUUA 2NWBA 2BS4A 5IWAT 1G73A 2XASB 4HFHA 5AFUL 1QLBA 2J1DG 3NKZA 2CXDA 1FIOA 2VKHA 5JTGA 2D5UA 2IHR1 2ZLYA 4H63V 5HEOA 3C64A 2CWYA 1W0BA 4PJJA 5AQPB 4L9IA 2VASA 4DV5T 2VL0A 4XAXB 3U78A 4G2AA 3RC8A 2QVAA 3AEFA 3OPCA 2X68A 4YT0A 4EGWA 4KI0F 2LSKA 2HN1A 4PJNA 2BDEA 3KDSE 2BZBA 4HWCA 4YTPA 4K0UA 3CQGB 4IE6A 1YW0A 2VQFT 4DV4T 1D1BA 3PUWF 5FL1A 1W0AA 4EB6E 3C51A 5EK4A 1UGOA 4GIWA 4Z91A 2X66A 2DCFA 4AKHA 2BBJA 5DQVA 4DR7T 1V9DA 2BG9B 2W4XA 4AKGA 2IAKA 2V7JA 2D0UA 4AISA 4DMWA 2WSSV 4DR5T 4QH4A 2XM2A 3RYHE 2XQ3A 1IBMT 4P0AA 4XBFB 3D0TA 2LKHA 1T7SA 3GWHA 1YKHB 1HG5A 2L10A 3AVSA 5H6QB 1XNQT 4QXBB 3KBUA 4IE4A 4MHCA 1SA0E 3MXZA 3ZCJA 4TN7B 2XQ7A 3P4PA 2ACXA 1SJ8A 3GA8A 2XSAA 5EZYE 3RKOA 2VB6A 1YXRA 2J4GA 5HEUA 2MAWA 4EEDA 1HS7A 1WR0A 1WCRA 2UU9T 3PU3A 1QUUA 3OVUA 5J1GA 3F2EA 1S94A 3ZSTA 5L47A 5IHYA 4YXDA 1S35A 2C5IT 3V5UA 3PJAA 3LK3B 1ZV4X 3AE8A 3KFWX 3WAJA 3B57A 3TLWA 3AAIA 4DV6T 2WY2A 2KT9A 5CFBA 5JDGA 3RGLA 1XZYA 3N9PA 3I9WA 2BG9E 2XQ9A 2NTYA 3KV6A 4IE0A 1E2AA 4DR2T 3AA1B 3ZN0B 2I6HA 3H3MA 3DP7A 2ZM8A 3KVBA 2W00A 5JDNA 1HCIA 5JDLA 4AKRB 3OTOT 2XQ4A 2PFVA 3VU7H 4UV9B 1XNRT 4IREA 3MK7C 1OEDC 4IDNA 3L8RA 3CWZB 4TV8E 4DMVA 4DNDA 5ABEA 4PAGA 4MLKA 2Y48B 4GK5E 5LGTB 3LK42 5AQGB 2K24A 1W9RA 4IE5A 4HN9A 2HH7A 2J47A 3CQCB 4IDZA 4ZS3A 2V7IA 3ZYMA 2L7NA 4O4JE 5JQGE 3NRXA 4CI2B 2VKDA 3FHNA 5AQKB 2JQ9A 4FI5A 2Y6XA 4DV7T 2ES0A 5HAXA 5FY0A 5KDMC 5LCYA 3O4XE 4KHZF 4W8PA 2N9DA 2UXCT 5AQQB 1WLXA 4HGAA 4CN4A 2A3DA 3ZLIA 2ODUA 3FZHB 2XHEB 2C0SA 4P09A 3Q5DA 3FXDB 4H63H 2FJDA 4WZXA 5HEGA 3P4QA 3ZSSA 4QXCB 2KWHA 3N9QA 4XZCA 5HWXA 3NBXX 2KSRA 3IA3A 3ZYKA 4DVDA 2YINA 1YD8G 5HCMA 4NUVA 4A98A 2FBWA 4ZI3C 3ZT5A 3K3NA 1T8BA 2I59A 2L3LA 4GYSA 5ABGA 1LKXA 4ISTA 2C5JA 3ZCIA 3MKDA 3AE9A 5FP3A 3UU3A 1LVFA 2WP9A 5HXEA 4DUZT 2IC9A 2WMOA 2SPCA 5T1DA 5L3GB 2PG8A 4I55E 2G0UA 1HFAA 5TAOA 4DBRA 4O2BE 3NVOA 4UVAB 5AQTB 5HXRA 1X9BA 1I94T 4HWHA 4QX8B 2M6BA 3AAEB 3QC9A 2LLYA 3H37A 3C4XA 4ECGA 2H89A 5LXTE 2UUAT 2CMRA 4DUYT 4HFEA 2WDVA 5DABA 4GYRA 2YN6A 2FJEA 3ESLA 3HKEE 1KNRA 4ZXLA 4KUMB 4DR3T 4GKKT 3RRWA 4MFRA 1VRBA 3QNUA 2H3RA 3UULA 1MMDA 4OX9T 1N36T 4IDQA 2YDRA 4O4HE 4U33A 2WU5A 5L3FB 5LNKA 2UXBT 4LMJA 2W2UA 2E2AA 3I1AA 2E5LT 2UUCT 4H9QC 2HPJA 5AQRB 4JI8T 5HWYA 2DL1A 5LA6E 2WM9A 2XQ6A 2N2NA 4WYVA 4ZHQE 2X0YA 2KVPA 1BR1A 1JNZA 4U7YA 1N32T 3P4SA 3PTRB 3JAEA 3HI2A 2D2SA 3N2GE 3UTKA 5EK2A 5EK3A 1H7CA 1R8IA 4GKJT 1YQ3A 2MYSA 4I4TE 3ZC1A 2NOXA 4QH1A 2LKGA 3HKBE 4EZ4A 2QRXA 4C90A 2JRKA 2VVNA 5LBQB 3N9OA 2DI4A 3T8OA 2HN2A 1M7KA 2K3WA 2JQHA 1IAPA 5AQUB 5AQVB 4OYJA 4PJMA 2LM2A 1J5WA 3UFEA 4LFBT 4O8SA 1MIWA 2LE8A 2JMHA 3OYZA 4LMLA 2V5DA 2RP4A 1IBLT 4YJ2E 2V6XA 4X1KE 2JPFA 1EZ3A 4LF4T 3V5SA 2J62A 3RHWA 3KV5A 3RI5A 4OK0A 3J7Yq 2ZM2A 3M1CA 2WQYA 4X5TA 3CK6A 3PUGA 5CGMA 4B3TT 2YU2A 4HFDA 2H7VC 4C91A 4LFCT 3AVRA 2XQYA 5LB7B 2XQ8A 1X79A 4PNIA 1BR0A 2YDQA 4ZI3D 3SRZA 4X66T 2MTCA 5CA1E 3AEGA 4KHPT 3LJCA 3FYQA 3AEBA 2XJ7A 4V1Av 3F31A 5ABFA 3RIUA 3UUXB 3AE7A 2CPTA 1YKEB 3AE1A 1NEKA 1NENA 1T72A 3Q5EA 3I9YA 3SFDA 1HTJF 2LSGA 3ABVA 3PF0A 1IZNB 3N2KE 4JUYA 4I43B 2JIWA 1UCUA 2WDRA 2CM0A 2LQUA 3ZMUB 4DO0A 4UVBB 3JAFA 4U74A 3Q5XA 2BS3A 2XY8B 5LGNB 2DLRA 2XQ5A 5FVLA 5FKYA 3RRCA 1LRZA 3Q2MA 3DTOA 5LJNA 1CUNA 5AQLB 1HF8A 5L3BB 2BG9C 3LBXA 3KV4A 4F7GB 5L3CB 3N9LA 5ABFB 4U3CA 4JI1T 3PE0A 4IDOA 2XAJB 1MNDA 3C4WA 2H7OA 4DV1T 4JI7T 1XWMA 3K1SA 2IUBA 4CZZB 3RIUC 4X1YE 3SWHA 5FL0A 4PJLA 3UU5A 4JLEA 3RPUA 3EDUA 4ZS2A 4NXMT 2JMKA 3O1IA 3E0ZA 3ZMZB 4F6RC 2D0TA 4LF5T 5LG4A 2F4VT 2VVSA 3A8YC 3EVYA 3ANWA 2JJ9A 5JVDE 3DYJA 3HR0A 2IC6A 1Z8UA 4ILBA 5A1LA 5C2TA 4DV3T 3LBXB 3P50A 3LSVA 3MZKB 4JI6T 3RH3A 2KZ7B 3NWIA 3AEAA 4IL9A 4ASKA 1KNZA 4AQFA 2XAFB
chains in the Genus database with same CATH topology
2KWHA 5JDHA 2V1DB 1AJ3A 4HE8A 3PURA 2KXPB 3EDVA 2KMFA 2Q9QA 3N9QA 5FXZA 2X9HA 4XZCA 2EHOA 4WNKA 5HWXA 3NBXX 5LOVE 1E1HB 2ZM0A 3LFMA 2XAGB 5KX5E 1WYBA 1ZKEA 2IW5B 3ZYKA 4DVDA 2YINA 4YLHA 1YD8G 4IIJE 4NUVA 3P7IA 1OWAA 1FEWA 4H9PC 1MIYA 3IF8B 4YFSA 4ZI3C 4HKAA 2WWUA 3MJXA 2C5KT 2M67A 1D0ZA 3K3NA 3O1JA 5H6RB 3BK9A 2I59A 2V26A 5E0OA 3OBVE 5J2TE 1T98A 2L3LA 3PUAA 1G8XA 4GYSA 3NRYA 3WSCA 1LKXA 1Z0PA 4ISTA 4EYUA 3LG7A 4QWNB 3PDYA 3KBTA 3GN5A 1ZHCA 3ZN1B 2C5JA 4B6XA 1KK7A 4E7ZA 3ZCIA 2Q9QD 3MKDA 3I0QA 3DJBA 3K8PC 2PBIA 4UF0B 2NW7A 5FP3A 1LVFA 4BJNA 1LVKA 5C8YE 4ILUA 1O3XA 4FJOA 5HXEA 4JEUB 4UVCB 1B7TA 4ERRA 4BJMA 2VKJA 2IC9A 2WMOA 5HXCA 2L9QA 5JR9A 4CXWA 4ZI7E 2SPCA 3ANWB 5T1DA 5L3GB 2PG8A 2Z6EA 2UXXB 4KBMB 5LHGB 3B13A 4I55E 2G0UA 3ETVA 4UEMA 1HFAA 3PUSA 5TAOA 5JH7E 5CA0E 4DBRA 4KMCA 4O2BE 4TV9E 1IJ6A 3OJAA 3TKLB 4UVAB 2RA1A 3PUQA 5HXRA 4PFPA 2ODVA 4J2CA 4UXNB 3MACA 2QGSA 4QX8B 2MOZA 5M4YA 3HA4A 3AAEB 3QC9A 3R84B 3H37A 4CXYA 3WAKA 2W62A 3C4XA 2X9WA 2K9AA 4ECGA 2WAUA 3AAAB 2LSIA 2HPLA 3N9MA 4ADZA 5LXTE 3E08A 3NZQA 2BVMA 3M65A 5JDQA 5LP6E 2CMRA 2Q9QB 2NW9A 5ADXL 2EHOB 4NUUA 2K48A 5DABA 3ZEFB 4GYRA 2LSYA 3ESLA 2NWBA 1BR4A 1G73A 2XASB 3HKEE 2KINB 4KUMB 2W63A 3HKCE 3K3QC 4TZ4C 5AFUL 2J1DG 3AB3B 2CXDA 2LEHA 3RRWA 4MFRA 1FIOA 1VRBA 2VKHA 4CXXA 2D5UA 2ZLYA 2H3RA 4HEAA 2N1GA 3BQIA 3UULA 4H63V 3C64A 2CWYA 4PJJA 4L9IA 3KINB 2VASA 3IBPA 3L3PA 1MMDA 3C98B 4UV8B 3AT7A 4XAXB 3U78A 4O4HE 3QK6A 3UUNA 3GN5B 2EHOC 5L3FB 2X9XA 2XAHB 1MMGA 2YU1A 2ZMAA 4G2AA 5LNKA 3RC8A 3U3IA 3ZMSB 5GONE 4BGOA 4QHOA 2LSJA 3EUHA 3CMLA 5FXVA 5FY7A 3I1AA 2X68A 4H9QC 2HPJA 4PW8A 1NAFA 3AA6B 2LSKA 3ZPOA 4EYYR 4PJNA 5HWYA 2UXNB 2MTQA 2BDEA 5LA6E 3WURA 2KWIB 2WM9A 3KDSE 2BZBA 4L5GA 2PJQA 2V7LA 3MA9A 5JR9B 4ISSA 5LJMA 2N2NA 4K0UA 1IJ5A 3I0OA 1WRDA 3CQGB 4EZHA 2W0GA 4IE6A 5J2UE 4ZHQE 1YW0A 5IYZE 1U4QA 1BR1A 1D0XA 1D1BA 4EB6E 1SHZC 3C51A 2X51A 1Y64B 3PTRB 4P0BA 5EK4A 4WW0A 4GIWA 5JREA 3HI2A 2X66A 2D2SA 5LYJE 3N2GE 2DCFA 3RYIE 3UTKA 5EK2A 4HFVA 4AKHA 4A56A 5EK3A 1H7CA 5BMVE 5DQVA 3QUJA 1V9DA 4IE7A 2MYSA 4YHJA 3AA7B 4I4TE 4AKGA 2IAKA 2V7JA 4KP3C 5JDFA 3ZC1A 2NOXA 2D0UA 3JC6C 2E9XD 2KNDA 3HKBE 4EZ4A 4C90A 2JRKA 4DMWA 2WSSV 5LBQB 3N9OA 5DQWA 2DI4A 3T8OA 3RYHE 4ZI2D 4GK0E 4U72A 2A72A 1FMWA 4OYKA 3O9XA 1IAPA 2QA7A 2CEAA 4OYJA 4PK6A 4PJMA 4P0AA 4XBFB 3CX6B 3D0TA 3K3OA 5HXSA 2LM9A 4ANJA 3UFEA 3GWHA 1YKHB 1HG5A 4O8SA 1MIWA 2LE8A 4WBOA 1D1CA 3AVSA 4AQGA 2JMHA 5H6QB 3R6NA 3ZMTB 3OYZA 1MIVA 4QXBB 3KBUA 2XUEA 3VKHA 4IE4A 2RP4A 2VKOA 4YJ2E 1VOMA 2X67A 4X1KE 2JPFA 4MHCA 3SS1A 1EZ3A 2CCQA 3CX7B 3V5SA 1SA0E 2L8KA 3MXZA 3ZCJA 3KV5A 4PFOA 4TN7B 2LOSA 1HX8A 1OXZA 4I50E 3FXEB 4OK0A 3J7Yq 2CXLA 2ZM2A 3M1CA 4WBNE 2CXFA 2LOPA 1HG2A 2XTLA 3PUGA 2ACXA 1MMNA 2BVLA 1WYCA 2XAQB 3GA8A 2CLYB 1WR6A 5EZYE 2YU2A 4BA9A 2H7VC 3RKOA 1MMAA 4C91A 2VB6A 2XQYA 3AVRA 4ZOLE 1X79A 2V7KA 4PNIA 3HL6A 1BR0A 3KV9A 3S4UA 4ZI3D 1US7B 3SRZA 2MTCA 4MBQA 1D0YA 4QX7B 5CA1E 4EOZB 1HS7A 2VK9A 2NW8A 3ZC0A 5JRCA 4AQFC 3LJCA 3PU3A 1QUUA 3F57A 5J1GA 4V1Av 3F2EA 3J9X1 3F31A 2Q9QC 2CWOA 3CPZA 4EAHA 2LJLA 4AKIA 3A5XA 2CLYC 1S94A 3UUXB 4BAYB 2GK9A 3L09A 5IHYA 4MALA 2DHRA 4O2AE 1D1AA 1S35A 2C5IT 4GOUA 5HXHA 2WMNA 1YKEB 3V5UA 2W61A 3CX8B 3SOLA 2E8IA 5FXXA 5CB4E 3LK3B 1ZV4X 2E9XA 4G63A 4IGUA 1U5PA 3I9YA 3VJZA 5FXWA 4H9SE 3KFWX 3WAJA 3B57A 1HTJF 2LSGA 3AAIA 3PF0A 1IZNB 2KT9A 2X0LB 2YK0A 3N2KE 5JDGA 3ZYLA 4CI3B 5F3JA 4JUYA 4M1PA 4I43B 1UCUA 5DJQC 2YEVC 3N9PA 3BQLA 3I9WA 4IHJE 3CVRA 2CM0A 3PU8A 3UUMA 4TX5A 4L0RA 2JQQA 2DWKA 2LQUA 3LK2B 3ZMUB 4DO0A 4UVBB 4HTEA 1UX5A 2DNXA 3H3AA 4U74A 3P8CD 5JR9C 3Q5XA 5L3EB 2OA5A 3CQXC 4H9OC 5LGNB 2DLRA 3Q5WA 2NTYA 5ETWA 3KV6A 4IE0A 2CE7A 3C50A 4TUYE 3AA1B 5FNVE 2K5BB 3ZN0B 4EIWA 3RRCA 1LRZA 3C4ZA 3Q2MA 4PK5A 3DTOA 5LJNA 3DP7A 5HYAA 4ONRA 1CUNA 2ZM8A 3NZPA 3RC3A 5FY1A 5KMGP 4AI6A 3FBLA 1NWMX 3RYFE 3ZMVB 4DBQA 3KVBA 2W00A 3W15B 3HKDE 5JDNA 4O4LE 3ONXA 1HCIA 5JDLA 1HF8A 4AKRB 5L3BB 2NTXA 2Y8DA 3RYCE 4N78D 2PFVA 3LBXA 5JRCB 4QXHB 3VU7H 4UV9B 3KV4A 2CA5A 2EHOD 4X1IE 3MK7C 3O1HA 5L3CB 3N9LA 3E22E 3CWZB 5L2LA 4TV8E 1BR2A 4DMVA 4DNDA 2VL8A 4PAGA 3PE0A 5LHHB 4H9NC 4MLKA 2Y48B 4GK5E 5LGTB 2XAJB 4Z8XA 3LK42 3RX6A 1MNDA 2K24A 4YJ3E 3FBZA 3ZJ2A 3C4WA 4IE5A 5F8PA 2H7OA 2WBLA 4HN9A 4CQIA 2HH7A 2E9XB 3CQCB 2V7MA 4IDZA 4ZS3A 3PHF1 4UIGA 2V7IA 3ZYMA 2NP9A 3ZJ1A 4O4JE 3N2OA 4JEHB 5JQGE 3NRXA 1QSDA 4CI2B 5LHIB 2VKDA 4CZZB 2A2FX 2DWGA 3FHNA 4OHFA 1MNEA 4X1YE 4FI5A 2Y6XA 3SWHA 4PK4A 4CI1B 4PJLA 3OKQA 4QKNA 1UX4A 4E7SA 2ES0A 4X20E 4JLEA 3KVAA 5HAXA 3RPUA 3EDUA 4ZS2A 2JMKA 3ETUA 5L3DB 3O1IA 4AXPA 3E0ZA 5FY0A 5FMNA 2E9XC 4AKLA 4UF0A 3JC6D 4UELA 3ZMZB 5LCYA 5KDMC 3VKGA 4F6RC 2D0TA 3O4XE 2X9YA 2N9DA 3IHRA 3N5LA 2LHRA 5LG4A 3BQKA 3EVYA 4ZI2C 3N9NA 3FB2A 3ANWA 3IEEA 3OYXA 5FYMA 1WLXA 4HGAA 2JJ9A 2LT3A 2KLQA 5JVDE 2A3DA 3AA0B 5JDMA 3UT5E 3ZLIA 2ODUA 3HR0A 2MBGA 2IC6A 3CKDA 4H9RC 3WI3A 4EXTA 2B1EA 2XHEB 2C0SA 3GMIA 2P9BA 2LHNA 3Q9DA 5A1LA 4P09A 3LBXB 4O4IE 5LBMA 3FXDB 4H63H 1ZEEA 1FMVA 2VWAA 3MZKB 3RH3A 2KZ7B 5LGUB 4ASKA 1KNZA 4AQFA 3VHLA 4QXCB 4OFZA 2XAFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDH A;  5HWY A;  5HWX A;  3V5U A;  5HXH A;  5HXS A;  5HXE A;  5JDG A;  5JDN A;  5JDM A;  5JDF A;  5HYA A;  5JDL A;  5HXC A;  3V5S A;  5HXR A;  5JDQ A; 
#chains in the Genus database with same CATH topology
 2WWV A;  2Q9Q A;  3LFM A;  2XAG B;  3VRA A;  5IUX A;  4YLH A;  2ZM6 T;  4ZEY A;  2XSB A;  4IDP A;  1FEW A;  3IF8 B;  4HKA A;  2M67 A;  1D0Z A;  4X65 T;  5H6R B;  3BK9 A;  5J2T E;  3PUA A;  1G8X A;  4EYU A;  3PDY A;  2FJB A;  3GN5 A;  3KBT A;  3ZN1 B;  1KK7 A;  3I0Q A;  2XM1 A;  2WZI A;  4ILU A;  2WU2 A;  4UVC B;  4ERR A;  4HFB A;  2L9Q A;  5JR9 A;  3AEE A;  3ANW B;  1Y01 A;  2Z6E A;  4KBM B;  5JH7 E;  5CA0 E;  4HFI A;  4TV9 E;  3RLF F;  3OJA A;  4DID B;  2RA1 A;  1HNZ T;  3MAC A;  2MOZ A;  3RKG A;  5FVK A;  3R84 B;  4CXY A;  4B3M T;  2X9W A;  4X62 T;  3EAM A;  3NZQ A;  3M65 A;  2PTF A;  2Q9Q B;  2NW9 A;  5CJ5 A;  2K48 A;  3ZEF B;  2LSY A;  3K3Q C;  3AB3 B;  2LEH A;  4CXX A;  4B3R T;  4HEA A;  3P4R A;  5AQH B;  3KIN B;  3L3P A;  3C98 B;  4UV8 B;  3AT7 A;  1VCT A;  3UUN A;  3GN5 B;  2X9X A;  2ZMA A;  3ZT7 A;  3U3I A;  3ZMS B;  4BGO A;  5L4H A;  2LSJ A;  3EUH A;  3CML A;  5FY7 A;  1NAF A;  2UXN B;  2MTQ A;  3WUR A;  4L5G A;  5LG3 A;  5JR9 B;  4JBW F;  4HWI B;  1IJ5 A;  3I0O A;  5J2U E;  1U4Q A;  4P1N A;  1D0X A;  4NXN T;  1SHZ C;  2X51 A;  4P0B A;  3PUV F;  2AE9 A;  5LYJ E;  4A56 A;  2RPA A;  5BMV E;  1J1J A;  2XZE A;  4YHJ A;  3AA7 B;  2D9D A;  3PUY F;  4KP3 C;  4TNV A;  2KND A;  5HEH A;  2YOE A;  3AY5 A;  2A72 A;  1FMW A;  4OYK A;  3O9X A;  4PK6 A;  4TNW A;  5HXS A;  4ANJ A;  5AQM B;  4AQG A;  3ZMT B;  3ZT6 A;  1MIV A;  2VKO A;  1VOM A;  2X67 A;  3AE5 A;  3PUZ F;  3SS1 A;  2CCQ A;  3CX7 B;  2L8K A;  2BS2 A;  4PFO A;  1OXZ A;  4I50 E;  3FXE B;  1XMQ T;  3EAB A;  2LOP A;  1HG2 A;  2CHO A;  1MMN A;  2BVL A;  2BKO A;  1WYC A;  3ONL C;  2CLY B;  1WR6 A;  4BA9 A;  1MMA A;  4COF A;  2V6Y A;  3HL6 A;  3KV9 A;  1US7 B;  1D0Y A;  2VK9 A;  2NW8 A;  5JRC A;  2YKS A;  3J9X 1;  1ZP0 A;  3CPZ A;  4EAH A;  4AKI A;  3A5X A;  2CLY C;  1HR0 T;  3L09 A;  2NR4 A;  3PV0 F;  2DHR A;  2H88 A;  2W61 A;  3CX8 B;  3SOL A;  4EEB A;  2E9X A;  4G63 A;  1U5P A;  3QOF A;  2LRK A;  2X0L B;  2YK0 A;  3RQU A;  5F3J A;  3B5M A;  2KBB A;  2YEV C;  4IHJ E;  3UUB A;  4TX5 A;  1WFD A;  2JQQ A;  1KFY A;  4HTE A;  2DNX A;  3P8C D;  1KF6 A;  1N34 T;  5L3E B;  3CQX C;  3Q5W A;  2FJA A;  3C50 A;  4TUY E;  4DR6 T;  2WB5 A;  4NPP A;  1I6Z A;  4ONR A;  2V6Y B;  3RC3 A;  5KMG P;  4AI6 A;  1YQ4 A;  3FBL A;  3W15 B;  3HKD E;  4K0K T;  3ONX A;  2NTX A;  3RYC E;  4N78 D;  5JRC B;  4QXH B;  4X1I E;  3VRB A;  1BR2 A;  3AE4 A;  2VL8 A;  4U2Z A;  4JI0 T;  4H9N C;  3TLT A;  4Z8X A;  3EHZ A;  3RX6 A;  3RF1 A;  4YJ3 E;  3FBZ A;  5F8P A;  3T1H T;  5AQF B;  3UU6 A;  2E9X B;  2V7M A;  3PHF 1;  4UIG A;  4DR1 T;  1VCS A;  3UQ4 A;  3ZJ1 A;  1HNX T;  3N2O A;  5LHI B;  2DWG A;  2IDO B;  1MNE A;  1KEY A;  4PK4 A;  4CI1 B;  3AE6 A;  4QKN A;  4E7S A;  4X20 E;  4JYA T;  3KVA A;  3ETU A;  4AXP A;  2E9X C;  4AKL A;  3VKG A;  2X9Y A;  1KNP A;  3IHR A;  1XMO T;  3N5L A;  2LHR A;  1HNW T;  4ZI2 C;  3FB2 A;  3LDQ B;  3OYX A;  5FYM A;  4LF6 T;  2KLQ A;  3AA0 B;  1XDP A;  2MBG A;  4TWD A;  3GMI A;  2P9B A;  5LMU T;  2LHN A;  4QH5 A;  2OV9 A;  4O4I E;  1JNR A;  3PUX F;  2VWA A;  4HWD A;  1N33 T;  4ZZB A;  2FUP A;  3VHL A;  5JDH A;  1UK5 A;  1AJ3 A;  4HE8 A;  2KXP B;  2KMF A;  3TLV A;  2EHO A;  4WNK A;  5LOV E;  5KX5 E;  2IW5 B;  2WZH A;  4IIJ E;  2X0H A;  4HWF A;  2XQA A;  1GQE A;  3UU8 A;  5E0O A;  2V26 A;  3OBV E;  1T98 A;  4LMK A;  3WSC A;  3LG7 A;  4QWN B;  4E7Z A;  3DJB A;  2PBI A;  2NW7 A;  5AQI B;  5C8Y E;  4FJO A;  4I0U A;  2VKJ A;  2W67 A;  5KXJ A;  4CXW A;  4ZI7 E;  5AQN B;  4AQY T;  2UXX B;  3B13 A;  4UEM A;  3ETV A;  3PUS A;  4KMC A;  2CHN A;  3TKL B;  2WCA A;  2E5V A;  3PUQ A;  4PFP A;  4YTN A;  4X64 T;  5M4Y A;  3PJA J;  3HA4 A;  1HX1 B;  4JI4 T;  3WAK A;  2W62 A;  2K9A A;  1CHU A;  2LSI A;  2HPL A;  4ADZ A;  3E08 A;  2BVM A;  3UQ7 A;  1OED A;  2CBI A;  4DV0 T;  1L0V A;  5ADX L;  2EHO B;  2UXD T;  1BR4 A;  4CN1 A;  2KIN B;  2W63 A;  3HKC E;  4TZ4 C;  2VUR A;  4B3S T;  2XPK A;  2N1G A;  4EV6 A;  3BQI A;  3IBP A;  3QK6 A;  4IL4 A;  2EHO C;  2YU1 A;  2XAH B;  1MMG A;  5GON E;  2WDQ A;  4QHO A;  4U31 A;  2V8S V;  1UUR A;  5FXV A;  4PW8 A;  3AA6 B;  3ZPO A;  4EYY R;  4U7I A;  5F5W A;  2KWI B;  2PJQ A;  2V7L A;  3MA9 A;  4ISS A;  5LJM A;  1WRD A;  4EZH A;  2W0G A;  3RQW A;  5IYZ E;  1UUS A;  4U2Y A;  3RIF A;  1Y64 B;  4WW0 A;  5JRE A;  3UFG A;  2A9U A;  3RYI E;  4HFV A;  2X0C A;  4YSX A;  3QUJ A;  4IE7 A;  2IIU A;  5JDF A;  3JC6 C;  2E9X D;  4YSY A;  1OED B;  3ZKR A;  5L4E A;  4F8H A;  5DQW A;  4ZI2 D;  4GK0 E;  4U72 A;  5AQO B;  2QA7 A;  2CEA A;  3CX6 B;  4Q25 A;  3K3O A;  2LM9 A;  4CN6 A;  3AED A;  2M6I A;  1FJG T;  4WBO A;  3UU4 A;  4A97 A;  1D1C A;  3R6N A;  3L39 A;  2XUE A;  3VKH A;  4IT4 A;  3FZL B;  4AIU A;  3FZK B;  2LOS A;  4HFC A;  1HX8 A;  3RIA A;  2CXL A;  4WBN E;  2CXF A;  3VR9 A;  2XTL A;  2XAQ B;  2R6G F;  4ZOL E;  2V7K A;  3VR8 A;  3S4U A;  1W09 A;  3X1D A;  4MBQ A;  4QX7 B;  1J5E T;  4EOZ B;  4LF9 T;  3ZC0 A;  4AQF C;  3F57 A;  4JV5 T;  2Q9Q C;  2CWO A;  3CIR A;  2LJL A;  4LFA T;  4KX6 A;  4JI2 T;  4BAY B;  1SUM B;  2GK9 A;  4MAL A;  2BKN A;  2WS3 A;  2YDS A;  2QYW A;  4O2A E;  1D1A A;  4GOU A;  5HXH A;  2WMN A;  4ZZC A;  2E8I A;  5FXX A;  1IBK T;  5CB4 E;  3T1Y T;  4IGU A;  3VJZ A;  5FXW A;  4H9S E;  4ILC A;  3ZYL A;  4CI3 B;  3EI0 A;  4M1P A;  5DJQ C;  4NIQ A;  5AQS B;  4YSZ A;  3BQL A;  3TLU A;  3CVR A;  3PU8 A;  3UUM A;  4L0R A;  2DWK A;  3LK2 B;  4A5X A;  1UX5 A;  3AE3 A;  3H3A A;  1OED E;  5JR9 C;  5HCJ A;  2OA5 A;  2CBJ A;  4H9O C;  1XDO A;  5ETW A;  2CE7 A;  2W66 A;  2OLT A;  3AXJ A;  5FNV E;  2K5B B;  4LF7 T;  4EIW A;  1DU2 A;  2B76 A;  3C4Z A;  4PK5 A;  1ZOY A;  5HYA A;  2UUB T;  3NZP A;  5FY1 A;  3JAD A;  4DBQ A;  1NWM X;  3RYF E;  3ZMV B;  3G06 A;  4JI5 T;  4O4L E;  2Y8D A;  2VQE T;  3AEC A;  2CA5 A;  2EHO D;  3FZM B;  3O1H A;  3E22 E;  5L2L A;  3M3Z B;  5LHH B;  5AQJ B;  3ZJ2 A;  2WBL A;  3P4W A;  1E7P A;  4CQI A;  5LMN T;  3QB5 A;  2NP9 A;  4JEH B;  1QSD A;  2A2F X;  2AXD S;  4OHF A;  3OKQ A;  1UX4 A;  4TWH A;  5L3D B;  5J0Z A;  5FMN A;  4UF0 A;  3JC6 D;  4UEL A;  3SFE A;  2MPK A;  3BQK A;  3AXJ B;  2BBH A;  3QB5 K;  3N9N A;  3IEE A;  3AE2 A;  5HEJ A;  2LT3 A;  5JDM A;  3UT5 E;  2KGX A;  3CKD A;  3WI3 A;  4H9R C;  4EXT A;  2BKP A;  2B1E A;  3Q9D A;  3TLS A;  4UR9 A;  5LBM A;  1ZEE A;  1FMV A;  4DV2 T;  5LGU B;  5FZT A;  4YTM A;  4YY3 T;  4OFZ A;  2V1D B;  5ABH A;  3PUR A;  3EDV A;  5FXZ A;  2X9H A;  2CRB A;  1E1H B;  2ZM0 A;  4JI3 T;  1WYB A;  1ZKE A;  2JQK A;  3P7I A;  1OWA A;  4H9P C;  1M62 A;  1MIY A;  4YFS A;  3A7M A;  2WWU A;  4DR4 T;  3MJX A;  3ONJ A;  2C5K T;  3O1J A;  4LF8 T;  2V5C A;  3NRY A;  1Z0P A;  4ILA A;  1ZHC A;  2HHH T;  4B6X A;  4Z90 A;  2Q9Q D;  4TWF A;  3K8P C;  4UF0 B;  4BJN A;  1LVK A;  5BR8 T;  1O3X A;  4JEU B;  1B7T A;  2IML A;  4BJM A;  5HXC A;  3JCF A;  5LHG B;  1IJ6 A;  1SJ7 A;  2ODV A;  4J2C A;  4UXN B;  2QGS A;  2LRL A;  2ACZ A;  5C3J A;  2WAU A;  1SE7 A;  2BG9 A;  3AAA B;  4YHH T;  3N9M A;  5JDQ A;  5LP6 E;  2I0M A;  3FZF B;  4NUU A;  2NWB A;  2BS4 A;  5IWA T;  1G73 A;  2XAS B;  4HFH A;  5AFU L;  1QLB A;  2J1D G;  3NKZ A;  2CXD A;  1FIO A;  2VKH A;  5JTG A;  2D5U A;  2IHR 1;  2ZLY A;  4H63 V;  5HEO A;  3C64 A;  2CWY A;  1W0B A;  4PJJ A;  5AQP B;  4L9I A;  2VAS A;  4DV5 T;  2VL0 A;  4XAX B;  3U78 A;  4G2A A;  3RC8 A;  2QVA A;  3AEF A;  3OPC A;  2X68 A;  4YT0 A;  4EGW A;  4KI0 F;  2LSK A;  2HN1 A;  4PJN A;  2BDE A;  3KDS E;  2BZB A;  4HWC A;  4YTP A;  4K0U A;  3CQG B;  4IE6 A;  1YW0 A;  2VQF T;  4DV4 T;  1D1B A;  3PUW F;  5FL1 A;  1W0A A;  4EB6 E;  3C51 A;  5EK4 A;  1UGO A;  4GIW A;  4Z91 A;  2X66 A;  2DCF A;  4AKH A;  2BBJ A;  5DQV A;  4DR7 T;  1V9D A;  2BG9 B;  2W4X A;  4AKG A;  2IAK A;  2V7J A;  2D0U A;  4AIS A;  4DMW A;  2WSS V;  4DR5 T;  4QH4 A;  2XM2 A;  3RYH E;  2XQ3 A;  1IBM T;  4P0A A;  4XBF B;  3D0T A;  2LKH A;  1T7S A;  3GWH A;  1YKH B;  1HG5 A;  2L10 A;  3AVS A;  5H6Q B;  1XNQ T;  4QXB B;  3KBU A;  4IE4 A;  4MHC A;  1SA0 E;  3MXZ A;  3ZCJ A;  4TN7 B;  2XQ7 A;  3P4P A;  2ACX A;  1SJ8 A;  3GA8 A;  2XSA A;  5EZY E;  3RKO A;  2VB6 A;  1YXR A;  2J4G A;  5HEU A;  2MAW A;  4EED A;  1HS7 A;  1WR0 A;  1WCR A;  2UU9 T;  3PU3 A;  1QUU A;  3OVU A;  5J1G A;  3F2E A;  1S94 A;  3ZST A;  5L47 A;  5IHY A;  4YXD A;  1S35 A;  2C5I T;  3V5U A;  3PJA A;  3LK3 B;  1ZV4 X;  3AE8 A;  3KFW X;  3WAJ A;  3B57 A;  3TLW A;  3AAI A;  4DV6 T;  2WY2 A;  2KT9 A;  5CFB A;  5JDG A;  3RGL A;  1XZY A;  3N9P A;  3I9W A;  2BG9 E;  2XQ9 A;  2NTY A;  3KV6 A;  4IE0 A;  1E2A A;  4DR2 T;  3AA1 B;  3ZN0 B;  2I6H A;  3H3M A;  3DP7 A;  2ZM8 A;  3KVB A;  2W00 A;  5JDN A;  1HCI A;  5JDL A;  4AKR B;  3OTO T;  2XQ4 A;  2PFV A;  3VU7 H;  4UV9 B;  1XNR T;  4IRE A;  3MK7 C;  1OED C;  4IDN A;  3L8R A;  3CWZ B;  4TV8 E;  4DMV A;  4DND A;  5ABE A;  4PAG A;  4MLK A;  2Y48 B;  4GK5 E;  5LGT B;  3LK4 2;  5AQG B;  2K24 A;  1W9R A;  4IE5 A;  4HN9 A;  2HH7 A;  2J47 A;  3CQC B;  4IDZ A;  4ZS3 A;  2V7I A;  3ZYM A;  2L7N A;  4O4J E;  5JQG E;  3NRX A;  4CI2 B;  2VKD A;  3FHN A;  5AQK B;  2JQ9 A;  4FI5 A;  2Y6X A;  4DV7 T;  2ES0 A;  5HAX A;  5FY0 A;  5KDM C;  5LCY A;  3O4X E;  4KHZ F;  4W8P A;  2N9D A;  2UXC T;  5AQQ B;  1WLX A;  4HGA A;  4CN4 A;  2A3D A;  3ZLI A;  2ODU A;  3FZH B;  2XHE B;  2C0S A;  4P09 A;  3Q5D A;  3FXD B;  4H63 H;  2FJD A;  4WZX A;  5HEG A;  3P4Q A;  3ZSS A;  4QXC B;  2KWH A;  3N9Q A;  4XZC A;  5HWX A;  3NBX X;  2KSR A;  3IA3 A;  3ZYK A;  4DVD A;  2YIN A;  1YD8 G;  5HCM A;  4NUV A;  4A98 A;  2FBW A;  4ZI3 C;  3ZT5 A;  3K3N A;  1T8B A;  2I59 A;  2L3L A;  4GYS A;  5ABG A;  1LKX A;  4IST A;  2C5J A;  3ZCI A;  3MKD A;  3AE9 A;  5FP3 A;  3UU3 A;  1LVF A;  2WP9 A;  5HXE A;  4DUZ T;  2IC9 A;  2WMO A;  2SPC A;  5T1D A;  5L3G B;  2PG8 A;  4I55 E;  2G0U A;  1HFA A;  5TAO A;  4DBR A;  4O2B E;  3NVO A;  4UVA B;  5AQT B;  5HXR A;  1X9B A;  1I94 T;  4HWH A;  4QX8 B;  2M6B A;  3AAE B;  3QC9 A;  2LLY A;  3H37 A;  3C4X A;  4ECG A;  2H89 A;  5LXT E;  2UUA T;  2CMR A;  4DUY T;  4HFE A;  2WDV A;  5DAB A;  4GYR A;  2YN6 A;  2FJE A;  3ESL A;  3HKE E;  1KNR A;  4ZXL A;  4KUM B;  4DR3 T;  4GKK T;  3RRW A;  4MFR A;  1VRB A;  3QNU A;  2H3R A;  3UUL A;  1MMD A;  4OX9 T;  1N36 T;  4IDQ A;  2YDR A;  4O4H E;  4U33 A;  2WU5 A;  5L3F B;  5LNK A;  2UXB T;  4LMJ A;  2W2U A;  2E2A A;  3I1A A;  2E5L T;  2UUC T;  4H9Q C;  2HPJ A;  5AQR B;  4JI8 T;  5HWY A;  2DL1 A;  5LA6 E;  2WM9 A;  2XQ6 A;  2N2N A;  4WYV A;  4ZHQ E;  2X0Y A;  2KVP A;  1BR1 A;  1JNZ A;  4U7Y A;  1N32 T;  3P4S A;  3PTR B;  3JAE A;  3HI2 A;  2D2S A;  3N2G E;  3UTK A;  5EK2 A;  5EK3 A;  1H7C A;  1R8I A;  4GKJ T;  1YQ3 A;  2MYS A;  4I4T E;  3ZC1 A;  2NOX A;  4QH1 A;  2LKG A;  3HKB E;  4EZ4 A;  2QRX A;  4C90 A;  2JRK A;  2VVN A;  5LBQ B;  3N9O A;  2DI4 A;  3T8O A;  2HN2 A;  1M7K A;  2K3W A;  2JQH A;  1IAP A;  5AQU B;  5AQV B;  4OYJ A;  4PJM A;  2LM2 A;  1J5W A;  3UFE A;  4LFB T;  4O8S A;  1MIW A;  2LE8 A;  2JMH A;  3OYZ A;  4LML A;  2V5D A;  2RP4 A;  1IBL T;  4YJ2 E;  2V6X A;  4X1K E;  2JPF A;  1EZ3 A;  4LF4 T;  3V5S A;  2J62 A;  3RHW A;  3KV5 A;  3RI5 A;  4OK0 A;  3J7Y q;  2ZM2 A;  3M1C A;  2WQY A;  4X5T A;  3CK6 A;  3PUG A;  5CGM A;  4B3T T;  2YU2 A;  4HFD A;  2H7V C;  4C91 A;  4LFC T;  3AVR A;  2XQY A;  5LB7 B;  2XQ8 A;  1X79 A;  4PNI A;  1BR0 A;  2YDQ A;  4ZI3 D;  3SRZ A;  4X66 T;  2MTC A;  5CA1 E;  3AEG A;  4KHP T;  3LJC A;  3FYQ A;  3AEB A;  2XJ7 A;  4V1A v;  3F31 A;  5ABF A;  3RIU A;  3UUX B;  3AE7 A;  2CPT A;  1YKE B;  3AE1 A;  1NEK A;  1NEN A;  1T72 A;  3Q5E A;  3I9Y A;  3SFD A;  1HTJ F;  2LSG A;  3ABV A;  3PF0 A;  1IZN B;  3N2K E;  4JUY A;  4I43 B;  2JIW A;  1UCU A;  2WDR A;  2CM0 A;  2LQU A;  3ZMU B;  4DO0 A;  4UVB B;  3JAF A;  4U74 A;  3Q5X A;  2BS3 A;  2XY8 B;  5LGN B;  2DLR A;  2XQ5 A;  5FVL A;  5FKY A;  3RRC A;  1LRZ A;  3Q2M A;  3DTO A;  5LJN A;  1CUN A;  5AQL B;  1HF8 A;  5L3B B;  2BG9 C;  3LBX A;  3KV4 A;  4F7G B;  5L3C B;  3N9L A;  5ABF B;  4U3C A;  4JI1 T;  3PE0 A;  4IDO A;  2XAJ B;  1MND A;  3C4W A;  2H7O A;  4DV1 T;  4JI7 T;  1XWM A;  3K1S A;  2IUB A;  4CZZ B;  3RIU C;  4X1Y E;  3SWH A;  5FL0 A;  4PJL A;  3UU5 A;  4JLE A;  3RPU A;  3EDU A;  4ZS2 A;  4NXM T;  2JMK A;  3O1I A;  3E0Z A;  3ZMZ B;  4F6R C;  2D0T A;  4LF5 T;  5LG4 A;  2F4V T;  2VVS A;  3A8Y C;  3EVY A;  3ANW A;  2JJ9 A;  5JVD E;  3DYJ A;  3HR0 A;  2IC6 A;  1Z8U A;  4ILB A;  5A1L A;  5C2T A;  4DV3 T;  3LBX B;  3P50 A;  3LSV A;  3MZK B;  4JI6 T;  3RH3 A;  2KZ7 B;  3NWI A;  3AEA A;  4IL9 A;  4ASK A;  1KNZ A;  4AQF A;  2XAF B; 
#chains in the Genus database with same CATH homology
 2KWH A;  5JDH A;  2V1D B;  1AJ3 A;  4HE8 A;  3PUR A;  2KXP B;  3EDV A;  2KMF A;  2Q9Q A;  3N9Q A;  5FXZ A;  2X9H A;  4XZC A;  2EHO A;  4WNK A;  5HWX A;  3NBX X;  5LOV E;  1E1H B;  2ZM0 A;  3LFM A;  2XAG B;  5KX5 E;  1WYB A;  1ZKE A;  2IW5 B;  3ZYK A;  4DVD A;  2YIN A;  4YLH A;  1YD8 G;  4IIJ E;  4NUV A;  3P7I A;  1OWA A;  1FEW A;  4H9P C;  1MIY A;  3IF8 B;  4YFS A;  4ZI3 C;  4HKA A;  2WWU A;  3MJX A;  2C5K T;  2M67 A;  1D0Z A;  3K3N A;  3O1J A;  5H6R B;  3BK9 A;  2I59 A;  2V26 A;  5E0O A;  3OBV E;  5J2T E;  1T98 A;  2L3L A;  3PUA A;  1G8X A;  4GYS A;  3NRY A;  3WSC A;  1LKX A;  1Z0P A;  4IST A;  4EYU A;  3LG7 A;  4QWN B;  3PDY A;  3KBT A;  3GN5 A;  1ZHC A;  3ZN1 B;  2C5J A;  4B6X A;  1KK7 A;  4E7Z A;  3ZCI A;  2Q9Q D;  3MKD A;  3I0Q A;  3DJB A;  3K8P C;  2PBI A;  4UF0 B;  2NW7 A;  5FP3 A;  1LVF A;  4BJN A;  1LVK A;  5C8Y E;  4ILU A;  1O3X A;  4FJO A;  5HXE A;  4JEU B;  4UVC B;  1B7T A;  4ERR A;  4BJM A;  2VKJ A;  2IC9 A;  2WMO A;  5HXC A;  2L9Q A;  5JR9 A;  4CXW A;  4ZI7 E;  2SPC A;  3ANW B;  5T1D A;  5L3G B;  2PG8 A;  2Z6E A;  2UXX B;  4KBM B;  5LHG B;  3B13 A;  4I55 E;  2G0U A;  3ETV A;  4UEM A;  1HFA A;  3PUS A;  5TAO A;  5JH7 E;  5CA0 E;  4DBR A;  4KMC A;  4O2B E;  4TV9 E;  1IJ6 A;  3OJA A;  3TKL B;  4UVA B;  2RA1 A;  3PUQ A;  5HXR A;  4PFP A;  2ODV A;  4J2C A;  4UXN B;  3MAC A;  2QGS A;  4QX8 B;  2MOZ A;  5M4Y A;  3HA4 A;  3AAE B;  3QC9 A;  3R84 B;  3H37 A;  4CXY A;  3WAK A;  2W62 A;  3C4X A;  2X9W A;  2K9A A;  4ECG A;  2WAU A;  3AAA B;  2LSI A;  2HPL A;  3N9M A;  4ADZ A;  5LXT E;  3E08 A;  3NZQ A;  2BVM A;  3M65 A;  5JDQ A;  5LP6 E;  2CMR A;  2Q9Q B;  2NW9 A;  5ADX L;  2EHO B;  4NUU A;  2K48 A;  5DAB A;  3ZEF B;  4GYR A;  2LSY A;  3ESL A;  2NWB A;  1BR4 A;  1G73 A;  2XAS B;  3HKE E;  2KIN B;  4KUM B;  2W63 A;  3HKC E;  3K3Q C;  4TZ4 C;  5AFU L;  2J1D G;  3AB3 B;  2CXD A;  2LEH A;  3RRW A;  4MFR A;  1FIO A;  1VRB A;  2VKH A;  4CXX A;  2D5U A;  2ZLY A;  2H3R A;  4HEA A;  2N1G A;  3BQI A;  3UUL A;  4H63 V;  3C64 A;  2CWY A;  4PJJ A;  4L9I A;  3KIN B;  2VAS A;  3IBP A;  3L3P A;  1MMD A;  3C98 B;  4UV8 B;  3AT7 A;  4XAX B;  3U78 A;  4O4H E;  3QK6 A;  3UUN A;  3GN5 B;  2EHO C;  5L3F B;  2X9X A;  2XAH B;  1MMG A;  2YU1 A;  2ZMA A;  4G2A A;  5LNK A;  3RC8 A;  3U3I A;  3ZMS B;  5GON E;  4BGO A;  4QHO A;  2LSJ A;  3EUH A;  3CML A;  5FXV A;  5FY7 A;  3I1A A;  2X68 A;  4H9Q C;  2HPJ A;  4PW8 A;  1NAF A;  3AA6 B;  2LSK A;  3ZPO A;  4EYY R;  4PJN A;  5HWY A;  2UXN B;  2MTQ A;  2BDE A;  5LA6 E;  3WUR A;  2KWI B;  2WM9 A;  3KDS E;  2BZB A;  4L5G A;  2PJQ A;  2V7L A;  3MA9 A;  5JR9 B;  4ISS A;  5LJM A;  2N2N A;  4K0U A;  1IJ5 A;  3I0O A;  1WRD A;  3CQG B;  4EZH A;  2W0G A;  4IE6 A;  5J2U E;  4ZHQ E;  1YW0 A;  5IYZ E;  1U4Q A;  1BR1 A;  1D0X A;  1D1B A;  4EB6 E;  1SHZ C;  3C51 A;  2X51 A;  1Y64 B;  3PTR B;  4P0B A;  5EK4 A;  4WW0 A;  4GIW A;  5JRE A;  3HI2 A;  2X66 A;  2D2S A;  5LYJ E;  3N2G E;  2DCF A;  3RYI E;  3UTK A;  5EK2 A;  4HFV A;  4AKH A;  4A56 A;  5EK3 A;  1H7C A;  5BMV E;  5DQV A;  3QUJ A;  1V9D A;  4IE7 A;  2MYS A;  4YHJ A;  3AA7 B;  4I4T E;  4AKG A;  2IAK A;  2V7J A;  4KP3 C;  5JDF A;  3ZC1 A;  2NOX A;  2D0U A;  3JC6 C;  2E9X D;  2KND A;  3HKB E;  4EZ4 A;  4C90 A;  2JRK A;  4DMW A;  2WSS V;  5LBQ B;  3N9O A;  5DQW A;  2DI4 A;  3T8O A;  3RYH E;  4ZI2 D;  4GK0 E;  4U72 A;  2A72 A;  1FMW A;  4OYK A;  3O9X A;  1IAP A;  2QA7 A;  2CEA A;  4OYJ A;  4PK6 A;  4PJM A;  4P0A A;  4XBF B;  3CX6 B;  3D0T A;  3K3O A;  5HXS A;  2LM9 A;  4ANJ A;  3UFE A;  3GWH A;  1YKH B;  1HG5 A;  4O8S A;  1MIW A;  2LE8 A;  4WBO A;  1D1C A;  3AVS A;  4AQG A;  2JMH A;  5H6Q B;  3R6N A;  3ZMT B;  3OYZ A;  1MIV A;  4QXB B;  3KBU A;  2XUE A;  3VKH A;  4IE4 A;  2RP4 A;  2VKO A;  4YJ2 E;  1VOM A;  2X67 A;  4X1K E;  2JPF A;  4MHC A;  3SS1 A;  1EZ3 A;  2CCQ A;  3CX7 B;  3V5S A;  1SA0 E;  2L8K A;  3MXZ A;  3ZCJ A;  3KV5 A;  4PFO A;  4TN7 B;  2LOS A;  1HX8 A;  1OXZ A;  4I50 E;  3FXE B;  4OK0 A;  3J7Y q;  2CXL A;  2ZM2 A;  3M1C A;  4WBN E;  2CXF A;  2LOP A;  1HG2 A;  2XTL A;  3PUG A;  2ACX A;  1MMN A;  2BVL A;  1WYC A;  2XAQ B;  3GA8 A;  2CLY B;  1WR6 A;  5EZY E;  2YU2 A;  4BA9 A;  2H7V C;  3RKO A;  1MMA A;  4C91 A;  2VB6 A;  2XQY A;  3AVR A;  4ZOL E;  1X79 A;  2V7K A;  4PNI A;  3HL6 A;  1BR0 A;  3KV9 A;  3S4U A;  4ZI3 D;  1US7 B;  3SRZ A;  2MTC A;  4MBQ A;  1D0Y A;  4QX7 B;  5CA1 E;  4EOZ B;  1HS7 A;  2VK9 A;  2NW8 A;  3ZC0 A;  5JRC A;  4AQF C;  3LJC A;  3PU3 A;  1QUU A;  3F57 A;  5J1G A;  4V1A v;  3F2E A;  3J9X 1;  3F31 A;  2Q9Q C;  2CWO A;  3CPZ A;  4EAH A;  2LJL A;  4AKI A;  3A5X A;  2CLY C;  1S94 A;  3UUX B;  4BAY B;  2GK9 A;  3L09 A;  5IHY A;  4MAL A;  2DHR A;  4O2A E;  1D1A A;  1S35 A;  2C5I T;  4GOU A;  5HXH A;  2WMN A;  1YKE B;  3V5U A;  2W61 A;  3CX8 B;  3SOL A;  2E8I A;  5FXX A;  5CB4 E;  3LK3 B;  1ZV4 X;  2E9X A;  4G63 A;  4IGU A;  1U5P A;  3I9Y A;  3VJZ A;  5FXW A;  4H9S E;  3KFW X;  3WAJ A;  3B57 A;  1HTJ F;  2LSG A;  3AAI A;  3PF0 A;  1IZN B;  2KT9 A;  2X0L B;  2YK0 A;  3N2K E;  5JDG A;  3ZYL A;  4CI3 B;  5F3J A;  4JUY A;  4M1P A;  4I43 B;  1UCU A;  5DJQ C;  2YEV C;  3N9P A;  3BQL A;  3I9W A;  4IHJ E;  3CVR A;  2CM0 A;  3PU8 A;  3UUM A;  4TX5 A;  4L0R A;  2JQQ A;  2DWK A;  2LQU A;  3LK2 B;  3ZMU B;  4DO0 A;  4UVB B;  4HTE A;  1UX5 A;  2DNX A;  3H3A A;  4U74 A;  3P8C D;  5JR9 C;  3Q5X A;  5L3E B;  2OA5 A;  3CQX C;  4H9O C;  5LGN B;  2DLR A;  3Q5W A;  2NTY A;  5ETW A;  3KV6 A;  4IE0 A;  2CE7 A;  3C50 A;  4TUY E;  3AA1 B;  5FNV E;  2K5B B;  3ZN0 B;  4EIW A;  3RRC A;  1LRZ A;  3C4Z A;  3Q2M A;  4PK5 A;  3DTO A;  5LJN A;  3DP7 A;  5HYA A;  4ONR A;  1CUN A;  2ZM8 A;  3NZP A;  3RC3 A;  5FY1 A;  5KMG P;  4AI6 A;  3FBL A;  1NWM X;  3RYF E;  3ZMV B;  4DBQ A;  3KVB A;  2W00 A;  3W15 B;  3HKD E;  5JDN A;  4O4L E;  3ONX A;  1HCI A;  5JDL A;  1HF8 A;  4AKR B;  5L3B B;  2NTX A;  2Y8D A;  3RYC E;  4N78 D;  2PFV A;  3LBX A;  5JRC B;  4QXH B;  3VU7 H;  4UV9 B;  3KV4 A;  2CA5 A;  2EHO D;  4X1I E;  3MK7 C;  3O1H A;  5L3C B;  3N9L A;  3E22 E;  3CWZ B;  5L2L A;  4TV8 E;  1BR2 A;  4DMV A;  4DND A;  2VL8 A;  4PAG A;  3PE0 A;  5LHH B;  4H9N C;  4MLK A;  2Y48 B;  4GK5 E;  5LGT B;  2XAJ B;  4Z8X A;  3LK4 2;  3RX6 A;  1MND A;  2K24 A;  4YJ3 E;  3FBZ A;  3ZJ2 A;  3C4W A;  4IE5 A;  5F8P A;  2H7O A;  2WBL A;  4HN9 A;  4CQI A;  2HH7 A;  2E9X B;  3CQC B;  2V7M A;  4IDZ A;  4ZS3 A;  3PHF 1;  4UIG A;  2V7I A;  3ZYM A;  2NP9 A;  3ZJ1 A;  4O4J E;  3N2O A;  4JEH B;  5JQG E;  3NRX A;  1QSD A;  4CI2 B;  5LHI B;  2VKD A;  4CZZ B;  2A2F X;  2DWG A;  3FHN A;  4OHF A;  1MNE A;  4X1Y E;  4FI5 A;  2Y6X A;  3SWH A;  4PK4 A;  4CI1 B;  4PJL A;  3OKQ A;  4QKN A;  1UX4 A;  4E7S A;  2ES0 A;  4X20 E;  4JLE A;  3KVA A;  5HAX A;  3RPU A;  3EDU A;  4ZS2 A;  2JMK A;  3ETU A;  5L3D B;  3O1I A;  4AXP A;  3E0Z A;  5FY0 A;  5FMN A;  2E9X C;  4AKL A;  4UF0 A;  3JC6 D;  4UEL A;  3ZMZ B;  5LCY A;  5KDM C;  3VKG A;  4F6R C;  2D0T A;  3O4X E;  2X9Y A;  2N9D A;  3IHR A;  3N5L A;  2LHR A;  5LG4 A;  3BQK A;  3EVY A;  4ZI2 C;  3N9N A;  3FB2 A;  3ANW A;  3IEE A;  3OYX A;  5FYM A;  1WLX A;  4HGA A;  2JJ9 A;  2LT3 A;  2KLQ A;  5JVD E;  2A3D A;  3AA0 B;  5JDM A;  3UT5 E;  3ZLI A;  2ODU A;  3HR0 A;  2MBG A;  2IC6 A;  3CKD A;  4H9R C;  3WI3 A;  4EXT A;  2B1E A;  2XHE B;  2C0S A;  3GMI A;  2P9B A;  2LHN A;  3Q9D A;  5A1L A;  4P09 A;  3LBX B;  4O4I E;  5LBM A;  3FXD B;  4H63 H;  1ZEE A;  1FMV A;  2VWA A;  3MZK B;  3RH3 A;  2KZ7 B;  5LGU B;  4ASK A;  1KNZ A;  4AQF A;  3VHL A;  4QXC B;  4OFZ A;  2XAF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...