5HXSA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 10mm sr2+
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
300
structure length
296
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEENNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 122
structure length 296
sequence length 300
ec nomenclature
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hxsA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hxsA02
3V5SA 5HWYA 5JDLA 5HXHA 5JDGA 5HWXA 5HXEA 5HXSA 5HYAA 5JDFA 3V5UA 5HXCA 5JDMA 5JDNA 5HXRA 5JDHA 5JDQA
chains in the Genus database with same CATH superfamily
2CHOA 4YLHA 4I4TE 2W62A 2CA5A 4UVBB 2OA5A 5HEUA 1ZHCA 4L5GA 4AI6A 1L0VA 4QH1A 4GK5E 5FVLA 3JADA 3WAKA 2BBJA 2BG9E 3RLFF 2Z6EA 4DMVA 4EGWA 3DYJA 3HI2A 3DP7A 5HCMA 2W0GA 4IDQA 3RYHE 2L3LA 3AXJB 3CQCB 4IDZA 2I6HA 4IL9A 3QB5A 5HXRA 5L3EB 1VRBA 3RC3A 4O4HE 1MIVA 2XY8B 3AE3A 3PV0F 3AT7A 3AEBA 2XSAA 2YINA 2LRKA 3UUNA 4ZZCA 4EYYR 5L3GB 4NIQA 2JJ9A 4ERRA 2UXBT 3AAEB 4N78D 2CEAA 1YW0A 4CI2B 4YSZA 2X0HA 5HXCA 1Y01A 3AAIA 1S94A 1MNDA 3ZCJA 3RQWA 3QC9A 4DV4T 3B13A 5FY7A 2WM9A 5EK3A 4F7GB 4XAXB 5FXZA 3ETVA 1FJGT 4YFSA 4ZOLE 2VQET 3RC8A 4JEHB 3PDYA 4KI0F 4JI3T 2EHOA 2M6IA 4KX6A 2BS3A 5DJQC 2KVPA 2IAKA 4B3TT 3AE7A 5AQUB 4EZHA 3AE8A 2LEHA 1Y64B 4U74A 2VWAA 5CA0E 1UGOA 2CBIA 3VR9A 4QH4A 5CJ5A 1IBMT 4BA9A 5ABFB 3D0TA 3JC6D 4C90A 2CHNA 5LJNA 2RP4A 4UR9A 3L8RA 2WDRA 5ABGA 4HFVA 4OFZA 4Q25A 4AKLA 4ASKA 4UIGA 2BBHA 2V7KA 1IJ5A 1XMQT 4U33A 5LNKA 3OBVE 5KXJA 3CQXC 1XNRT 2KWHA 1OEDE 3FZFB 1H7CA 4AQGA 2WU2A 4F6RC 1ZOYA 3ZEFB 3BQKA 2UXDT 4L9IA 4WNKA 4DBRA 2NWBA 2E9XB 4A98A 2W63A 4H9OC 2XHEB 4OYJA 3F31A 3CMLA 4PK5A 2G0UA 4H9NC 3NVOA 5FY1A 4U2ZA 4QX7B 4DNDA 3S4UA 3M3ZB 5JVDE 5FXVA 3H37A 2W2UA 1JNRA 1XDPA 1UURA 5FY0A 4DMWA 3SRZA 1XNQT 3HL6A 1W0BA 5JRCB 2LOPA 5F3JA 1D0ZA 2LSKA 4IE7A 3UT5E 1QUUA 1S35A 2JQKA 2ODVA 2QRXA 4WW0A 2D0TA 2BZBA 3AA1B 2C5IT 3PUYF 2ACZA 1N34T 4DR6T 4PJMA 2YOEA 2BG9B 2MOZA 3U78A 1I6ZA 2H3RA 2XQ9A 1SJ8A 4B6XA 2W66A 2KGXA 5LHGB 4E7SA 5JDHA 2XJ7A 4Z90A 1HS7A 5IYZE 1MMAA 2KWIB 3AVSA 4YHJA 5LHIB 4H63H 1W09A 4L0RA 4EYUA 3BQLA 2WWVA 5CA1E 3P50A 3O1JA 3RHWA 2XTLA 5DQVA 3AECA 5L3BB 2P9BA 4IE4A 3KFWX 4GOUA 2DCFA 2HHHT 3E0ZA 5LG3A 1FMWA 3CPZA 3ZMZB 2WCAA 3UU8A 1QLBA 5HXSA 1T98A 2XPKA 1KNPA 4IL4A 3SFDA 5CB4E 2E5LT 3EAMA 2ES0A 3QK6A 1HX1B 4BJMA 4ISTA 3UFEA 3IEEA 1D1CA 4ZI3D 5H6QB 4LF4T 4O4IE 3PE0A 2HPJA 4HN9A 4PAGA 5AQGB 4DV3T 3NBXX 2MBGA 3N2KE 1N36T 3PU8A 3GA8A 4FJOA 2WY2A 3JAFA 4ZI2C 1HNZT 5HYAA 3B57A 3RKGA 3AEDA 3I0QA 2J62A 3L09A 3AB3B 3GN5A 4AXPA 4C91A 4KUMB 1D0YA 1MMGA 4A97A 2VKOA 2AE9A 3J7Yq 2ZM0A 2PBIA 5AQTB 2CXDA 4TN7B 2XQ5A 1HX8A 3NRYA 5A1LA 4K0UA 2DLRA 2VVSA 4IE5A 4X64T 4DV0T 4TNWA 5JH7E 3AVRA 3WAJA 2XQ8A 5IHYA 4ISSA 2HPLA 4TX5A 4OYKA 3OYZA 1X79A 4EEDA 1UX5A 2KT9A 1VOMA 2L8KA 4YXDA 2V5CA 2LQUA 3ZKRA 2BS2A 1HR0T 2YEVC 4FI5A 3C64A 2JIWA 4COFA 3N9MA 4CQIA 3T1HT 3K3NA 2KBBA 2XSBA 3N5LA 1D0XA 2CWOA 5ABEA 5L4HA 5HAXA 2XQYA 4QXCB 3KBTA 3QB5K 2WMOA 2V7JA 2E5VA 4PNIA 5HEOA 4KP3C 3RX6A 3C98B 5LGTB 2VURA 4LF7T 2LSIA 3AE6A 1I94T 3ESLA 3RIUA 2V6YB 3B5MA 3ETUA 4JI5T 4DBQA 2A9UA 5TAOA 2L10A 2X9WA 4LF8T 3AAAB 2KZ7B 4TWHA 4K0KT 5AQFB 2JQHA 1LRZA 3GWHA 2BVLA 2M6BA 5AQLB 4CXYA 4DUYT 3CKDA 4ZI7E 3JAEA 1O3XA 4PJJA 4IT4A 5JTGA 3ANWB 3P7IA 1CHUA 4O4LE 2KXPB 3ZPOA 2Y6XA 1OEDC 2KINB 5HWYA 3R6NA 3DTOA 3UULA 3JC6C 2NP9A 2VL0A 4XZCA 3VRBA 3LK3B 3FXEB 3ZMVB 2DWKA 1YQ3A 3AE9A 4UF0A 1M7KA 4TZ4C 4WYVA 2CXFA 2KLQA 4B3MT 3SFEA 4H9QC 3U3IA 4JI7T 3MJXA 2XM2A 3K8PC 3AA6B 4HWFA 2LOSA 5IWAT 4H9RC 3R84B 4ADZA 4UVAB 1Z8UA 4JI2T 3RF1A 1U4QA 2NOXA 4GIWA 4ILCA 5AQIB 3O1IA 3UUMA 3VR8A 3LBXA 1MNEA 2VASA 2V7LA 2WZHA 4EV6A 2B76A 3Q9DA 2UUBT 3AEAA 3NWIA 4JYAT 4EEBA 2X0YA 1B7TA 3KDSE 4YHHT 2EHOD 2LM9A 3LJCA 3N9NA 3K3OA 3PF0A 2Q9QD 3E22E 1EZ3A 2CE7A 2L7NA 2C5JA 1KFYA 3L3PA 2X0LB 4LFCT 2D2SA 2XM1A 2YK0A 5EK2A 2LKGA 3N2GE 3ABVA 2IUBA 3C4XA 3FZHB 3I0OA 4B3ST 4LMLA 4HE8A 3C4ZA 3AE5A 2UXNB 2K48A 5FP3A 4CXWA 4GKKT 1E1HB 4DV7T 4A56A 4IHJE 2H89A 3A8YC 4CI1B 2F4VT 3G06A 4YSXA 3ZT5A 3O1HA 3EVYA 2Q9QA 5LGUB 3PUGA 2C0SA 3FZMB 3RYFE 4Z91A 5JR9C 3F57A 5L47A 4U7IA 1D1AA 2VKDA 1SUMB 2XQAA 3UU3A 2DHRA 4B3RT 3EABA 3AY5A 4WZXA 1KNZA 2JRKA 5E0OA 5J2TE 3TLTA 5LBMA 2FBWA 1T7SA 2J1DG 4EXTA 2WMNA 2LRLA 2D0UA 3C51A 1WYCA 3GMIA 2CMRA 3AE2A 3FXDB 4LFBT 2XZEA 1XMOT 3RQUA 3OKQA 1OWAA 1YKHB 4KBMB 1UCUA 3K3QC 5HEJA 1NWMX 1E2AA 3IHRA 4NXNT 2HN1A 3CWZB 4DR3T 2Y8DA 2D9DA 3KINB 4LMJA 2WZIA 1J5ET 5J0ZA 4DR2T 4ZI3C 2WSSV 2VQFT 1IZNB 4DR5T 4EIWA 2XAFB 5LBQB 2NTYA 3RKOA 4J2CA 5LXTE 2UUAT 4DIDB 2CLYB 2MYSA 1SHZC 1N32T 1M62A 3BK9A 4QKNA 5KX5E 4LMKA 4EB6E 4AQYT 5HCJA 3CVRA 4UEMA 4MFRA 5EZYE 4YT0A 3ZSSA 5LYJE 4AIUA 1R8IA 5AQVB 5BR8T 1YXRA 5L4EA 4YJ2E 2H7VC 5AQRB 1ZEEA 3FZKB 2IHR1 4OX9T 3CIRA 3RIUC 4I55E 4JBWF 5HXHA 4IIJE 2LHNA 4U72A 2X9HA 1XWMA 4ANJA 5L3DB 3RI5A 5JDQA 3FZLB 3RPUA 3W15B 3OPCA 4AKHA 5LMNT 1SE7A 3RIFA 1YQ4A 4JI0T 3T1YT 1BR4A 1XZYA 4X20E 3WI3A 4YTNA 1T72A 4ZHQE 3ANWA 3Q2MA 2A72A 3IF8B 2VKHA 3LDQB 3PUSA 3I9YA 2BVMA 4HWCA 1CUNA 2JMKA 2I59A 5L3FB 1GQEA 3V5SA 4EZ4A 2H88A 3UQ7A 3KVAA 1MIYA 2QA7A 2CLYC 2QVAA 3PUWF 2N2NA 3P4RA 2LSJA 3PHF1 3MK7C 3PTRB 2IIUA 4DR7T 3KV9A 3ZJ1A 5LGNB 2R6GF 5LMUT 1OEDB 2YDQA 3AXJA 3CQGB 1MIWA 5FMNA 4YSYA 4PK6A 4AQFA 2KMFA 5M4YA 3HKDE 4HFHA 4HKAA 3O4XE 1NEKA 2GK9A 1SJ7A 5EK4A 2UXCT 5J1GA 4ILUA 1HFAA 4EAHA 2RPAA 4UVCB 1LVKA 3VRAA 4DO0A 5AQMB 3FB2A 2Y48B 4NUUA 3N9OA 4WBOA 2X9YA 4ILAA 3N9QA 3KBUA 4HGAA 2XUEA 5JQGE 4ZS2A 2A2FX 2X68A 3CX6B 4KHPT 2LKHA 1D1BA 5JDFA 3M1CA 3OYXA 2WQYA 3J9X1 2FJDA 1VCSA 4CN6A 5HEGA 1BR1A 2FUPA 2EHOC 1YKEB 4IE0A 2Q9QC 3H3AA 3L39A 2JPFA 2BKOA 1BR0A 5L3CB 3RGLA 1IBLT 4X5TA 4E7ZA 3PJAA 2E9XD 3RYIE 4CXXA 4G2AA 3M65A 3TKLB 5ABFA 3N9LA 1WYBA 5J2UE 3UUBA 2YU2A 2FJAA 1T8BA 1UX4A 4DV2T 3E08A 3VHLA 2PFVA 3HKBE 2V7MA 3OVUA 3BQIA 4IDNA 2B1EA 4U3CA 4MBQA 2WAUA 4TNVA 2ZLYA 3MACA 4ECGA 3ZCIA 3UUXB 2E9XA 5JREA 5C2TA 5JR9B 4ILBA 4AKIA 2V6XA 2L9QA 3P4PA 2BKNA 4IE6A 4DR1T 2XAQB 2LLYA 2HN2A 2OLTA 1AJ3A 2DNXA 3AEGA 5ADXL 4JV5T 4X1IE 3EI0A 5C3JA 3UFGA 2V1DB 2WS3A 5JRCA 1US7B 3MZKB 1G73A 1LVFA 1MMDA 1HTJF 4PK4A 4CI3B 4CN1A 4O2AE 3TLSA 5JDMA 2YKSA 5F5WA 4LFAT 1OXZA 3OJAA 4IREA 3GN5B 3P4WA 1ZKEA 3EUHA 4DUZT 4X1KE 5T1DA 4HFEA 1V9DA 3QUJA 4A5XA 2BG9A 4HFBA 1KF6A 4YTMA 4WBNE 3FBLA 2WDQA 4TWFA 2UU9T 5F8PA 5AQJB 3ZSTA 4HFIA 4YY3T 4GYSA 1E7PA 5AQOB 4U2YA 3ZJ2A 1HNXT 3ZYLA 2WB5A 3HKEE 1UUSA 3K1SA 3EHZA 4I43B 1WFDA 2V7IA 1IJ6A 3QOFA 2X0CA 2W00A 3NKZA 2PTFA 2E2AA 4JUYA 3ZYKA 3Q5DA 5JDNA 3LG7A 4V1Av 2J4GA 4HWIB 5FXXA 3NRXA 3RIAA 2V8SV 2VK9A 3AA0B 2UXXB 2WU5A 4KMCA 2CRBA 2IDOB 2W67A 3Q5WA 5C8YE 3AA7B 4IDOA 4PFPA 4LF5T 4I50E 5LCYA 3VKGA 5KDMC 4H63V 4JI4T 3NZPA 4U7YA 4DR4T 2JMHA 1J1JA 1QSDA 2CBJA 3ONLC 4ZXLA 4X62T 2QYWA 4MLKA 3X1DA 5HWXA 2V5DA 2WDVA 1WLXA 2LSYA 5AQPB 3T8OA 2CPTA 4DVDA 3TLWA 2LJLA 1ZP0A 2KSRA 2H7OA 4QHOA 3P4QA 4TV8E 4TV9E 3TLUA 2YN6A 2ZM6T 1HG5A 3EDUA 1WCRA 5FKYA 3PUAA 4QXBB 3ZC0A 3RRWA 3HR0A 2MPKA 2AXDS 2CXLA 5CFBA 2YU1A 2IMLA 1KK7A 4GK0E 3F2EA 3P4SA 4O8SA 3P8CD 1XDOA 1OEDA 3MXZA 4AQFC 3C50A 5FL0A 2YDSA 2LHRA 3AEEA 2K3WA 1SA0E 2WBLA 4UF0B 2NTXA 1FMVA 3AE4A 2XAHB 5H6RB 3JCFA 2M67A 2BDEA 2MAWA 2XQ7A 4HWDA 1WR0A 3UTKA 1FEWA 1J5WA 5JDLA 3ZN1B 4QXHB 3ZYMA 5LHHB 2WWUA 2WP9A 3KV5A 1U5PA 5ETWA 4JI6T 3ZMSB 5DABA 2LT3A 1FIOA 3ZT7A 2ZMAA 4O4JE 4X1YE 3WURA 5AQQB 1WR6A 4QH5A 3LBXB 5LOVE 3RRCA 4TUYE 3ZT6A 4ONRA 2JQ9A 4JLEA 4HEAA 5HXEA 3N9PA 5FYMA 3ONJA 5BMVE 1MMNA 3UU4A 4P1NA 3LK42 2BKPA 4GYRA 2MTQA 1IAPA 2LE8A 1UK5A 4H9SE 4UXNB 1BR2A 1G8XA 5FZTA 3HKCE 2NW7A 4X65T 3PUVF 4OHFA 2E8IA 3KVBA 2N9DA 4DV5T 5CGMA 3QNUA 2K5BB 2V6YA 4DV6T 3ZLIA 4ZS3A 5AQNB 3DJBA 2FJBA 2VVNA 3AE1A 3ZC1A 4LF6T 4HFDA 3RH3A 2XAGB 1WRDA 5KMGP 4QWNB 4AKGA 3UQ4A 4UV9B 2BS4A 3WSCA 3CX8B 2EHOB 3EDVA 4NXMT 4H9PC 2VB6A 4BGOA 1IBKT 2Q9QB 2LM2A 2XAJB 2CCQA 2DWGA 2XQ3A 2E9XC 3A5XA 5LA6E 2A3DA 1NENA 2IC9A 5JR9A 5DQWA 2IC6A 3VKHA 2C5KT 4UV8B 3SOLA 2V26A 2HH7A 3Q5EA 3PJAJ 4G63A 3FHNA 4U31A 3LK2B 2W61A 2DI4A 4CN4A 2MTCA 2LSGA 4XBFB 4OK0A 3ZMUB 1W9RA 2XQ6A 1HCIA 1Z0PA 3HA4A 3MKDA 4X66T 2RA1A 5FNVE 3H3MA 3RYCE 4ZEYA 3FBZA 4IDPA 4DV1T 3SWHA 3LSVA 4UELA 5FVKA 1JNZA 1W0AA 2NW9A 1ZV4X 4HFCA 3C4WA 1LKXA 2BG9C 4I0UA 1HNWT 4IGUA 2CM0A 2FJEA 3I9WA 2PG8A 2UUCT 4Z8XA 2ODUA 2X66A 2D5UA 5FXWA 3VU7H 4MHCA 2YDRA 3KV6A 1NAFA 3CX7B 3FYQA 5AFUL 2NW8A 3IBPA 2X51A 1N33T 5IUXA 2OV9A 5AQSB 3UU5A 5L2LA 4W8PA 4EOZB 4YTPA 3VJZA 3LFMA 3OTOT 3O9XA 3NZQA 1KNRA 2NR4A 3N2OA 5FL1A 4P0BA 2K9AA 2I0MA 2QGSA 5LJMA 5LP6E 4YJ3E 2XASB 5ABHA 5AQKB 3TLVA 4CZZB 2SPCA 3ZMTB 4GKJT 3SS1A 3A7MA 5HEHA 4AKRB 4M1PA 3Q5XA 4HTEA 3PUQA 4NPPA 3UU6A 4BJNA 4PFOA 2ZM2A 3AEFA 4P0AA 3PUZF 2ZM8A 1DU2A 3PURA 4F8HA 3V5UA 4MALA 4AISA 1HF8A 2VKJA 3MA9A 4PW8A 4BAYB 4JEUB 2KNDA 2JQQA 4JI8T 4TWDA 4P09A 3ONXA 2X67A 1VCTA 2W4XA 5GONE 2XQ4A 2J47A 3PU3A 4KHZF 5LB7B 4ZZBA 3IA3A 1KEYA 3KV4A 1YD8G 4ZI2D 5AQHB 3ZN0B 4HWHA 2K24A 2X9XA 2DL1A 2IW5B 4JI1T 2VL8A 4QX8B 1X9BA 3PUXF 2ACXA 2N1GA 4O2BE 2CWYA 5JDGA 4PJLA 4PJNA 1HG2A 4NUVA 3CK6A 4LF9T 2PJQA 5LG4A 3I1AA
chains in the Genus database with same CATH topology
4DVDA 3WAJA 5IHYA 1ZEEA 4YLHA 4ISSA 4I4TE 2LJLA 2W62A 2HPLA 4TX5A 4OYKA 2CA5A 4I55E 3OYZA 5HXHA 1X79A 4UVBB 1UX5A 4IIJE 2H7OA 2KT9A 2OA5A 4QHOA 1VOMA 1ZHCA 4L5GA 2LHNA 4U72A 4AI6A 2L8KA 2LQUA 2X9HA 4GK5E 4ANJA 4TV8E 4TV9E 5L3DB 3WAKA 2YEVC 5JDQA 4FI5A 1HG5A 3C64A 3RPUA 3W15B 3EDUA 3PUAA 4QXBB 3N9MA 4CQIA 4AKHA 2Z6EA 4DMVA 3ZC0A 3RRWA 3HR0A 3HI2A 3K3NA 3DP7A 2CXLA 2W0GA 2YU1A 3RYHE 2L3LA 1KK7A 4GK0E 3CQCB 3N5LA 4IDZA 3F2EA 1BR4A 1D0XA 4X20E 2CWOA 5HAXA 4O8SA 3P8CD 5HXRA 3WI3A 2XQYA 4QXCB 3MXZA 3KBTA 5L3EB 1VRBA 2WMOA 2V7JA 4O4HE 4PNIA 3ANWA 3RC3A 4AQFC 4ZHQE 1MIVA 3C50A 3Q2MA 4KP3C 3AT7A 3RX6A 2A72A 2LHRA 2YINA 3IF8B 3UUNA 4EYYR 3C98B 5L3GB 1SA0E 2JJ9A 2VKHA 4ERRA 5LGTB 2WBLA 3PUSA 4UF0B 3AAEB 4N78D 2CEAA 1YW0A 4CI2B 2NTXA 3I9YA 1FMVA 2BVMA 2XAHB 1CUNA 5H6RB 2JMKA 2I59A 2LSIA 5L3FB 2M67A 2BDEA 5HXCA 3ESLA 3V5SA 4EZ4A 3AAIA 3ETUA 1S94A 3UTKA 1FEWA 3KVAA 1MIYA 2QA7A 5JDLA 3ZN1B 4DBQA 1MNDA 4QXHB 2CLYC 3ZYMA 5TAOA 3ZCJA 5LHHB 2WWUA 3KV5A 2X9WA 1U5PA 5ETWA 3ZMSB 3AAAB 5DABA 2N2NA 2LT3A 3QC9A 2LSJA 1FIOA 2KZ7B 3B13A 2ZMAA 5FY7A 3PHF1 3MK7C 4O4JE 4X1YE 3WURA 3PTRB 1WR6A 2WM9A 3LBXB 5LOVE 3RRCA 1LRZA 4TUYE 3GWHA 5EK3A 2BVLA 4ONRA 3KV9A 4JLEA 4HEAA 3ZJ1A 3N9PA 5HXEA 5LGNB 4CXYA 3CKDA 4XAXB 5FXZA 4ZI7E 3ETVA 5FYMA 1O3XA 4PJJA 4YFSA 4ZOLE 3RC8A 4JEHB 3PDYA 3CQGB 1MIWA 3ANWB 3P7IA 2EHOA 5FMNA 5BMVE 1MMNA 4PK6A 5DJQC 4O4LE 4AQFA 2KXPB 2KMFA 3ZPOA 2Y6XA 2IAKA 5M4YA 2KINB 3LK42 4GYRA 5HWYA 3HKDE 4EZHA 3R6NA 2MTQA 3DTOA 1IAPA 2LEHA 3UULA 3JC6C 2NP9A 2LE8A 3O4XE 1Y64B 4HKAA 4XZCA 4H9SE 4U74A 2VWAA 2GK9A 4UXNB 5EK4A 5CA0E 3LK3B 3FXEB 5J1GA 3ZMVB 1BR2A 2DWKA 4ILUA 1G8XA 3HKCE 4UF0A 4BA9A 2NW7A 1HFAA 4TZ4C 4EAHA 3D0TA 3JC6D 2CXFA 4C90A 5LJNA 4OHFA 2KLQA 2E8IA 4UVCB 2RP4A 1LVKA 3KVBA 4H9QC 4DO0A 3U3IA 2N9DA 3FB2A 3MJXA 2Y48B 3K8PC 4HFVA 2K5BB 4OFZA 4AKLA 4ASKA 4NUUA 3N9OA 3AA6B 4WBOA 2X9YA 3ZLIA 2LOSA 4UIGA 3N9QA 4H9RC 2V7KA 3KBUA 4HGAA 1IJ5A 4ZS3A 5LNKA 2XUEA 3DJBA 3R84B 4ADZA 5JQGE 4UVAB 3ZC1A 1U4QA 3OBVE 2NOXA 3CQXC 4GIWA 3RH3A 2KWHA 4ZS2A 2A2FX 2XAGB 1WRDA 1H7CA 2X68A 3CX6B 3O1IA 3UUMA 4AQGA 5KMGP 3LBXA 1MNEA 4QWNB 4F6RC 4AKGA 1D1BA 5JDFA 3M1CA 4UV9B 3OYXA 3WSCA 3J9X1 3CX8B 3ZEFB 2EHOB 3EDVA 3BQKA 4H9PC 2VB6A 2VASA 2V7LA 4L9IA 4WNKA 4BGOA 4DBRA 2Q9QB 2NWBA 3Q9DA 2E9XB 1BR1A 2EHOC 2XAJB 2W63A 2CCQA 4H9OC 1YKEB 2DWGA 2XHEB 4IE0A 4OYJA 2Q9QC 2E9XC 3A5XA 3F31A 3CMLA 5LA6E 3H3AA 1B7TA 4PK5A 2A3DA 3KDSE 2G0UA 2JPFA 4H9NC 5FY1A 2IC9A 5JR9A 2EHOD 2LM9A 1BR0A 5DQWA 3LJCA 3N9NA 2IC6A 3K3OA 4QX7B 5L3CB 3VKHA 3PF0A 2Q9QD 4E7ZA 4DNDA 2E9XD 3E22E 1EZ3A 3RYIE 2CE7A 3S4UA 4CXXA 2C5KT 5JVDE 4G2AA 5FXVA 2C5JA 3M65A 3L3PA 3TKLB 3N9LA 2X0LB 4UV8B 3H37A 2D2SA 2YK0A 5EK2A 1WYBA 3SOLA 3N2GE 2V26A 3C4XA 5J2UE 2HH7A 5FY0A 3I0OA 4DMWA 3SRZA 4G63A 3FHNA 2YU2A 3HL6A 4HE8A 3C4ZA 5JRCB 3LK2B 2LOPA 2W61A 2DI4A 5JH7E 5F3JA 1D0ZA 2LSKA 2UXNB 4IE7A 2MTCA 2K48A 5FP3A 2LSGA 1UX4A 4CXWA 4OK0A 4XBFB 3ZMUB 1E1HB 3E08A 3UT5E 3VHLA 1QUUA 1HCIA 1S35A 1Z0PA 2PFVA 3HA4A 3MKDA 4A56A 4IHJE 3HKBE 2ODVA 2V7MA 2RA1A 3BQIA 4WW0A 2D0TA 2BZBA 3AA1B 5FNVE 4CI1B 2C5IT 3RYCE 2B1EA 4MBQA 2WAUA 3O1HA 3FBZA 2ZLYA 3MACA 3EVYA 4ECGA 3ZCIA 2Q9QA 3UUXB 4PJMA 3SWHA 2E9XA 5JREA 5LGUB 5JR9B 4UELA 4AKIA 3PUGA 2L9QA 2C0SA 2MOZA 2NW9A 1ZV4X 3RYFE 3U78A 5JR9C 3C4WA 2H3RA 3F57A 4IE6A 1LKXA 2XAQB 4B6XA 4IGUA 1D1AA 2VKDA 5LHGB 4E7SA 1AJ3A 2CM0A 2DNXA 5JDHA 2DHRA 3I9WA 1KNZA 2PG8A 2JRKA 4Z8XA 5E0OA 5J2TE 5ADXL 1HS7A 2ODUA 2X66A 1MMAA 5IYZE 2D5UA 2J1DG 2KWIB 3AVSA 4YHJA 5FXWA 5LBMA 4EXTA 2WMNA 4X1IE 2D0UA 3C51A 5LHIB 4H63H 4L0RA 3VU7H 2V1DB 4MHCA 4EYUA 3BQLA 1WYCA 3GMIA 2CMRA 5CA1E 3KV6A 5JRCA 1NAFA 1US7B 3MZKB 3CX7B 3O1JA 3FXDB 2XTLA 5DQVA 5AFUL 1G73A 1LVFA 2NW8A 1MMDA 3IBPA 1HTJF 5L3BB 2X51A 4PK4A 4CI3B 3OKQA 2P9BA 4IE4A 3KFWX 1OWAA 1YKHB 4KBMB 4O2AE 1UCUA 5L2LA 5JDMA 4GOUA 2DCFA 3K3QC 1OXZA 4EOZB 3VJZA 3LFMA 1NWMX 3O9XA 3E0ZA 3OJAA 3GN5B 3NZQA 3IHRA 3N2OA 1ZKEA 3CWZB 4P0BA 2K9AA 1FMWA 3CPZA 3EUHA 3ZMZB 4X1KE 5T1DA 2Y8DA 2QGSA 5LJMA 5LP6E 4YJ3E 1V9DA 2XASB 5HXSA 3KINB 3QUJA 1T98A 4CZZB 2SPCA 3ZMTB 3SS1A 5CB4E 4AKRB 4WBNE 3FBLA 4ZI3C 4M1PA 3Q5XA 4HTEA 2WSSV 3PUQA 2ES0A 1IZNB 5F8PA 3QK6A 4BJNA 4PFOA 2ZM2A 4EIWA 4BJMA 2XAFB 5LBQB 4P0AA 2NTYA 4ISTA 3RKOA 3UFEA 3IEEA 1D1CA 2ZM8A 4J2CA 4ZI3D 4GYSA 3PURA 5H6QB 3V5UA 4MALA 4O4IE 1HF8A 2VKJA 3MA9A 3PE0A 2HPJA 4HN9A 4PW8A 3ZJ2A 5LXTE 4PAGA 3ZYLA 4BAYB 4JEUB 2KNDA 3HKEE 2JQQA 4I43B 3NBXX 2MBGA 4P09A 3N2KE 3ONXA 2CLYB 2V7IA 3PU8A 2X67A 3GA8A 1IJ6A 4FJOA 2W00A 2MYSA 4ZI2C 5GONE 4JUYA 5HYAA 3ZYKA 3B57A 1SHZC 3LG7A 3PU3A 5JDNA 4V1Av 5FXXA 3NRXA 2VK9A 3KV4A 1YD8G 2UXXB 3AA0B 4ZI2D 3BK9A 3ZN0B 4KMCA 3I0QA 4QKNA 3L09A 3AB3B 2K24A 5KX5E 2X9XA 3GN5A 3Q5WA 5C8YE 4AXPA 4EB6E 3AA7B 4C91A 4KUMB 4PFPA 2IW5B 4I50E 5LCYA 3VKGA 5KDMC 2VL8A 4QX8B 1D0YA 1MMGA 4H63V 3CVRA 3NZPA 4UEMA 2VKOA 4MFRA 5EZYE 2JMHA 3J7Yq 2ZM0A 2PBIA 1QSDA 2CXDA 2ACXA 2N1GA 4O2BE 4TN7B 2CWYA 5JDGA 4PJLA 5LYJE 4MLKA 1HX8A 3NRYA 4PJNA 5A1LA 1HG2A 4K0UA 5HWXA 4NUVA 2DLRA 1WLXA 2LSYA 2PJQA 3T8OA 4IE5A 5LG4A 3I1AA 3AVRA 4YJ2E 2H7VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5S A;  5HWY A;  5JDL A;  5HXH A;  5JDG A;  5HWX A;  5HXE A;  5HXS A;  5HYA A;  5JDF A;  3V5U A;  5HXC A;  5JDM A;  5JDN A;  5HXR A;  5JDH A;  5JDQ A; 
#chains in the Genus database with same CATH topology
 2CHO A;  4YLH A;  4I4T E;  2W62 A;  2CA5 A;  4UVB B;  2OA5 A;  5HEU A;  1ZHC A;  4L5G A;  4AI6 A;  1L0V A;  4QH1 A;  4GK5 E;  5FVL A;  3JAD A;  3WAK A;  2BBJ A;  2BG9 E;  3RLF F;  2Z6E A;  4DMV A;  4EGW A;  3DYJ A;  3HI2 A;  3DP7 A;  5HCM A;  2W0G A;  4IDQ A;  3RYH E;  2L3L A;  3AXJ B;  3CQC B;  4IDZ A;  2I6H A;  4IL9 A;  3QB5 A;  5HXR A;  5L3E B;  1VRB A;  3RC3 A;  4O4H E;  1MIV A;  2XY8 B;  3AE3 A;  3PV0 F;  3AT7 A;  3AEB A;  2XSA A;  2YIN A;  2LRK A;  3UUN A;  4ZZC A;  4EYY R;  5L3G B;  4NIQ A;  2JJ9 A;  4ERR A;  2UXB T;  3AAE B;  4N78 D;  2CEA A;  1YW0 A;  4CI2 B;  4YSZ A;  2X0H A;  5HXC A;  1Y01 A;  3AAI A;  1S94 A;  1MND A;  3ZCJ A;  3RQW A;  3QC9 A;  4DV4 T;  3B13 A;  5FY7 A;  2WM9 A;  5EK3 A;  4F7G B;  4XAX B;  5FXZ A;  3ETV A;  1FJG T;  4YFS A;  4ZOL E;  2VQE T;  3RC8 A;  4JEH B;  3PDY A;  4KI0 F;  4JI3 T;  2EHO A;  2M6I A;  4KX6 A;  2BS3 A;  5DJQ C;  2KVP A;  2IAK A;  4B3T T;  3AE7 A;  5AQU B;  4EZH A;  3AE8 A;  2LEH A;  1Y64 B;  4U74 A;  2VWA A;  5CA0 E;  1UGO A;  2CBI A;  3VR9 A;  4QH4 A;  5CJ5 A;  1IBM T;  4BA9 A;  5ABF B;  3D0T A;  3JC6 D;  4C90 A;  2CHN A;  5LJN A;  2RP4 A;  4UR9 A;  3L8R A;  2WDR A;  5ABG A;  4HFV A;  4OFZ A;  4Q25 A;  4AKL A;  4ASK A;  4UIG A;  2BBH A;  2V7K A;  1IJ5 A;  1XMQ T;  4U33 A;  5LNK A;  3OBV E;  5KXJ A;  3CQX C;  1XNR T;  2KWH A;  1OED E;  3FZF B;  1H7C A;  4AQG A;  2WU2 A;  4F6R C;  1ZOY A;  3ZEF B;  3BQK A;  2UXD T;  4L9I A;  4WNK A;  4DBR A;  2NWB A;  2E9X B;  4A98 A;  2W63 A;  4H9O C;  2XHE B;  4OYJ A;  3F31 A;  3CML A;  4PK5 A;  2G0U A;  4H9N C;  3NVO A;  5FY1 A;  4U2Z A;  4QX7 B;  4DND A;  3S4U A;  3M3Z B;  5JVD E;  5FXV A;  3H37 A;  2W2U A;  1JNR A;  1XDP A;  1UUR A;  5FY0 A;  4DMW A;  3SRZ A;  1XNQ T;  3HL6 A;  1W0B A;  5JRC B;  2LOP A;  5F3J A;  1D0Z A;  2LSK A;  4IE7 A;  3UT5 E;  1QUU A;  1S35 A;  2JQK A;  2ODV A;  2QRX A;  4WW0 A;  2D0T A;  2BZB A;  3AA1 B;  2C5I T;  3PUY F;  2ACZ A;  1N34 T;  4DR6 T;  4PJM A;  2YOE A;  2BG9 B;  2MOZ A;  3U78 A;  1I6Z A;  2H3R A;  2XQ9 A;  1SJ8 A;  4B6X A;  2W66 A;  2KGX A;  5LHG B;  4E7S A;  5JDH A;  2XJ7 A;  4Z90 A;  1HS7 A;  5IYZ E;  1MMA A;  2KWI B;  3AVS A;  4YHJ A;  5LHI B;  4H63 H;  1W09 A;  4L0R A;  4EYU A;  3BQL A;  2WWV A;  5CA1 E;  3P50 A;  3O1J A;  3RHW A;  2XTL A;  5DQV A;  3AEC A;  5L3B B;  2P9B A;  4IE4 A;  3KFW X;  4GOU A;  2DCF A;  2HHH T;  3E0Z A;  5LG3 A;  1FMW A;  3CPZ A;  3ZMZ B;  2WCA A;  3UU8 A;  1QLB A;  5HXS A;  1T98 A;  2XPK A;  1KNP A;  4IL4 A;  3SFD A;  5CB4 E;  2E5L T;  3EAM A;  2ES0 A;  3QK6 A;  1HX1 B;  4BJM A;  4IST A;  3UFE A;  3IEE A;  1D1C A;  4ZI3 D;  5H6Q B;  4LF4 T;  4O4I E;  3PE0 A;  2HPJ A;  4HN9 A;  4PAG A;  5AQG B;  4DV3 T;  3NBX X;  2MBG A;  3N2K E;  1N36 T;  3PU8 A;  3GA8 A;  4FJO A;  2WY2 A;  3JAF A;  4ZI2 C;  1HNZ T;  5HYA A;  3B57 A;  3RKG A;  3AED A;  3I0Q A;  2J62 A;  3L09 A;  3AB3 B;  3GN5 A;  4AXP A;  4C91 A;  4KUM B;  1D0Y A;  1MMG A;  4A97 A;  2VKO A;  2AE9 A;  3J7Y q;  2ZM0 A;  2PBI A;  5AQT B;  2CXD A;  4TN7 B;  2XQ5 A;  1HX8 A;  3NRY A;  5A1L A;  4K0U A;  2DLR A;  2VVS A;  4IE5 A;  4X64 T;  4DV0 T;  4TNW A;  5JH7 E;  3AVR A;  3WAJ A;  2XQ8 A;  5IHY A;  4ISS A;  2HPL A;  4TX5 A;  4OYK A;  3OYZ A;  1X79 A;  4EED A;  1UX5 A;  2KT9 A;  1VOM A;  2L8K A;  4YXD A;  2V5C A;  2LQU A;  3ZKR A;  2BS2 A;  1HR0 T;  2YEV C;  4FI5 A;  3C64 A;  2JIW A;  4COF A;  3N9M A;  4CQI A;  3T1H T;  3K3N A;  2KBB A;  2XSB A;  3N5L A;  1D0X A;  2CWO A;  5ABE A;  5L4H A;  5HAX A;  2XQY A;  4QXC B;  3KBT A;  3QB5 K;  2WMO A;  2V7J A;  2E5V A;  4PNI A;  5HEO A;  4KP3 C;  3RX6 A;  3C98 B;  5LGT B;  2VUR A;  4LF7 T;  2LSI A;  3AE6 A;  1I94 T;  3ESL A;  3RIU A;  2V6Y B;  3B5M A;  3ETU A;  4JI5 T;  4DBQ A;  2A9U A;  5TAO A;  2L10 A;  2X9W A;  4LF8 T;  3AAA B;  2KZ7 B;  4TWH A;  4K0K T;  5AQF B;  2JQH A;  1LRZ A;  3GWH A;  2BVL A;  2M6B A;  5AQL B;  4CXY A;  4DUY T;  3CKD A;  4ZI7 E;  3JAE A;  1O3X A;  4PJJ A;  4IT4 A;  5JTG A;  3ANW B;  3P7I A;  1CHU A;  4O4L E;  2KXP B;  3ZPO A;  2Y6X A;  1OED C;  2KIN B;  5HWY A;  3R6N A;  3DTO A;  3UUL A;  3JC6 C;  2NP9 A;  2VL0 A;  4XZC A;  3VRB A;  3LK3 B;  3FXE B;  3ZMV B;  2DWK A;  1YQ3 A;  3AE9 A;  4UF0 A;  1M7K A;  4TZ4 C;  4WYV A;  2CXF A;  2KLQ A;  4B3M T;  3SFE A;  4H9Q C;  3U3I A;  4JI7 T;  3MJX A;  2XM2 A;  3K8P C;  3AA6 B;  4HWF A;  2LOS A;  5IWA T;  4H9R C;  3R84 B;  4ADZ A;  4UVA B;  1Z8U A;  4JI2 T;  3RF1 A;  1U4Q A;  2NOX A;  4GIW A;  4ILC A;  5AQI B;  3O1I A;  3UUM A;  3VR8 A;  3LBX A;  1MNE A;  2VAS A;  2V7L A;  2WZH A;  4EV6 A;  2B76 A;  3Q9D A;  2UUB T;  3AEA A;  3NWI A;  4JYA T;  4EEB A;  2X0Y A;  1B7T A;  3KDS E;  4YHH T;  2EHO D;  2LM9 A;  3LJC A;  3N9N A;  3K3O A;  3PF0 A;  2Q9Q D;  3E22 E;  1EZ3 A;  2CE7 A;  2L7N A;  2C5J A;  1KFY A;  3L3P A;  2X0L B;  4LFC T;  2D2S A;  2XM1 A;  2YK0 A;  5EK2 A;  2LKG A;  3N2G E;  3ABV A;  2IUB A;  3C4X A;  3FZH B;  3I0O A;  4B3S T;  4LML A;  4HE8 A;  3C4Z A;  3AE5 A;  2UXN B;  2K48 A;  5FP3 A;  4CXW A;  4GKK T;  1E1H B;  4DV7 T;  4A56 A;  4IHJ E;  2H89 A;  3A8Y C;  4CI1 B;  2F4V T;  3G06 A;  4YSX A;  3ZT5 A;  3O1H A;  3EVY A;  2Q9Q A;  5LGU B;  3PUG A;  2C0S A;  3FZM B;  3RYF E;  4Z91 A;  5JR9 C;  3F57 A;  5L47 A;  4U7I A;  1D1A A;  2VKD A;  1SUM B;  2XQA A;  3UU3 A;  2DHR A;  4B3R T;  3EAB A;  3AY5 A;  4WZX A;  1KNZ A;  2JRK A;  5E0O A;  5J2T E;  3TLT A;  5LBM A;  2FBW A;  1T7S A;  2J1D G;  4EXT A;  2WMN A;  2LRL A;  2D0U A;  3C51 A;  1WYC A;  3GMI A;  2CMR A;  3AE2 A;  3FXD B;  4LFB T;  2XZE A;  1XMO T;  3RQU A;  3OKQ A;  1OWA A;  1YKH B;  4KBM B;  1UCU A;  3K3Q C;  5HEJ A;  1NWM X;  1E2A A;  3IHR A;  4NXN T;  2HN1 A;  3CWZ B;  4DR3 T;  2Y8D A;  2D9D A;  3KIN B;  4LMJ A;  2WZI A;  1J5E T;  5J0Z A;  4DR2 T;  4ZI3 C;  2WSS V;  2VQF T;  1IZN B;  4DR5 T;  4EIW A;  2XAF B;  5LBQ B;  2NTY A;  3RKO A;  4J2C A;  5LXT E;  2UUA T;  4DID B;  2CLY B;  2MYS A;  1SHZ C;  1N32 T;  1M62 A;  3BK9 A;  4QKN A;  5KX5 E;  4LMK A;  4EB6 E;  4AQY T;  5HCJ A;  3CVR A;  4UEM A;  4MFR A;  5EZY E;  4YT0 A;  3ZSS A;  5LYJ E;  4AIU A;  1R8I A;  5AQV B;  5BR8 T;  1YXR A;  5L4E A;  4YJ2 E;  2H7V C;  5AQR B;  1ZEE A;  3FZK B;  2IHR 1;  4OX9 T;  3CIR A;  3RIU C;  4I55 E;  4JBW F;  5HXH A;  4IIJ E;  2LHN A;  4U72 A;  2X9H A;  1XWM A;  4ANJ A;  5L3D B;  3RI5 A;  5JDQ A;  3FZL B;  3RPU A;  3W15 B;  3OPC A;  4AKH A;  5LMN T;  1SE7 A;  3RIF A;  1YQ4 A;  4JI0 T;  3T1Y T;  1BR4 A;  1XZY A;  4X20 E;  3WI3 A;  4YTN A;  1T72 A;  4ZHQ E;  3ANW A;  3Q2M A;  2A72 A;  3IF8 B;  2VKH A;  3LDQ B;  3PUS A;  3I9Y A;  2BVM A;  4HWC A;  1CUN A;  2JMK A;  2I59 A;  5L3F B;  1GQE A;  3V5S A;  4EZ4 A;  2H88 A;  3UQ7 A;  3KVA A;  1MIY A;  2QA7 A;  2CLY C;  2QVA A;  3PUW F;  2N2N A;  3P4R A;  2LSJ A;  3PHF 1;  3MK7 C;  3PTR B;  2IIU A;  4DR7 T;  3KV9 A;  3ZJ1 A;  5LGN B;  2R6G F;  5LMU T;  1OED B;  2YDQ A;  3AXJ A;  3CQG B;  1MIW A;  5FMN A;  4YSY A;  4PK6 A;  4AQF A;  2KMF A;  5M4Y A;  3HKD E;  4HFH A;  4HKA A;  3O4X E;  1NEK A;  2GK9 A;  1SJ7 A;  5EK4 A;  2UXC T;  5J1G A;  4ILU A;  1HFA A;  4EAH A;  2RPA A;  4UVC B;  1LVK A;  3VRA A;  4DO0 A;  5AQM B;  3FB2 A;  2Y48 B;  4NUU A;  3N9O A;  4WBO A;  2X9Y A;  4ILA A;  3N9Q A;  3KBU A;  4HGA A;  2XUE A;  5JQG E;  4ZS2 A;  2A2F X;  2X68 A;  3CX6 B;  4KHP T;  2LKH A;  1D1B A;  5JDF A;  3M1C A;  3OYX A;  2WQY A;  3J9X 1;  2FJD A;  1VCS A;  4CN6 A;  5HEG A;  1BR1 A;  2FUP A;  2EHO C;  1YKE B;  4IE0 A;  2Q9Q C;  3H3A A;  3L39 A;  2JPF A;  2BKO A;  1BR0 A;  5L3C B;  3RGL A;  1IBL T;  4X5T A;  4E7Z A;  3PJA A;  2E9X D;  3RYI E;  4CXX A;  4G2A A;  3M65 A;  3TKL B;  5ABF A;  3N9L A;  1WYB A;  5J2U E;  3UUB A;  2YU2 A;  2FJA A;  1T8B A;  1UX4 A;  4DV2 T;  3E08 A;  3VHL A;  2PFV A;  3HKB E;  2V7M A;  3OVU A;  3BQI A;  4IDN A;  2B1E A;  4U3C A;  4MBQ A;  2WAU A;  4TNV A;  2ZLY A;  3MAC A;  4ECG A;  3ZCI A;  3UUX B;  2E9X A;  5JRE A;  5C2T A;  5JR9 B;  4ILB A;  4AKI A;  2V6X A;  2L9Q A;  3P4P A;  2BKN A;  4IE6 A;  4DR1 T;  2XAQ B;  2LLY A;  2HN2 A;  2OLT A;  1AJ3 A;  2DNX A;  3AEG A;  5ADX L;  4JV5 T;  4X1I E;  3EI0 A;  5C3J A;  3UFG A;  2V1D B;  2WS3 A;  5JRC A;  1US7 B;  3MZK B;  1G73 A;  1LVF A;  1MMD A;  1HTJ F;  4PK4 A;  4CI3 B;  4CN1 A;  4O2A E;  3TLS A;  5JDM A;  2YKS A;  5F5W A;  4LFA T;  1OXZ A;  3OJA A;  4IRE A;  3GN5 B;  3P4W A;  1ZKE A;  3EUH A;  4DUZ T;  4X1K E;  5T1D A;  4HFE A;  1V9D A;  3QUJ A;  4A5X A;  2BG9 A;  4HFB A;  1KF6 A;  4YTM A;  4WBN E;  3FBL A;  2WDQ A;  4TWF A;  2UU9 T;  5F8P A;  5AQJ B;  3ZST A;  4HFI A;  4YY3 T;  4GYS A;  1E7P A;  5AQO B;  4U2Y A;  3ZJ2 A;  1HNX T;  3ZYL A;  2WB5 A;  3HKE E;  1UUS A;  3K1S A;  3EHZ A;  4I43 B;  1WFD A;  2V7I A;  1IJ6 A;  3QOF A;  2X0C A;  2W00 A;  3NKZ A;  2PTF A;  2E2A A;  4JUY A;  3ZYK A;  3Q5D A;  5JDN A;  3LG7 A;  4V1A v;  2J4G A;  4HWI B;  5FXX A;  3NRX A;  3RIA A;  2V8S V;  2VK9 A;  3AA0 B;  2UXX B;  2WU5 A;  4KMC A;  2CRB A;  2IDO B;  2W67 A;  3Q5W A;  5C8Y E;  3AA7 B;  4IDO A;  4PFP A;  4LF5 T;  4I50 E;  5LCY A;  3VKG A;  5KDM C;  4H63 V;  4JI4 T;  3NZP A;  4U7Y A;  4DR4 T;  2JMH A;  1J1J A;  1QSD A;  2CBJ A;  3ONL C;  4ZXL A;  4X62 T;  2QYW A;  4MLK A;  3X1D A;  5HWX A;  2V5D A;  2WDV A;  1WLX A;  2LSY A;  5AQP B;  3T8O A;  2CPT A;  4DVD A;  3TLW A;  2LJL A;  1ZP0 A;  2KSR A;  2H7O A;  4QHO A;  3P4Q A;  4TV8 E;  4TV9 E;  3TLU A;  2YN6 A;  2ZM6 T;  1HG5 A;  3EDU A;  1WCR A;  5FKY A;  3PUA A;  4QXB B;  3ZC0 A;  3RRW A;  3HR0 A;  2MPK A;  2AXD S;  2CXL A;  5CFB A;  2YU1 A;  2IML A;  1KK7 A;  4GK0 E;  3F2E A;  3P4S A;  4O8S A;  3P8C D;  1XDO A;  1OED A;  3MXZ A;  4AQF C;  3C50 A;  5FL0 A;  2YDS A;  2LHR A;  3AEE A;  2K3W A;  1SA0 E;  2WBL A;  4UF0 B;  2NTX A;  1FMV A;  3AE4 A;  2XAH B;  5H6R B;  3JCF A;  2M67 A;  2BDE A;  2MAW A;  2XQ7 A;  4HWD A;  1WR0 A;  3UTK A;  1FEW A;  1J5W A;  5JDL A;  3ZN1 B;  4QXH B;  3ZYM A;  5LHH B;  2WWU A;  2WP9 A;  3KV5 A;  1U5P A;  5ETW A;  4JI6 T;  3ZMS B;  5DAB A;  2LT3 A;  1FIO A;  3ZT7 A;  2ZMA A;  4O4J E;  4X1Y E;  3WUR A;  5AQQ B;  1WR6 A;  4QH5 A;  3LBX B;  5LOV E;  3RRC A;  4TUY E;  3ZT6 A;  4ONR A;  2JQ9 A;  4JLE A;  4HEA A;  5HXE A;  3N9P A;  5FYM A;  3ONJ A;  5BMV E;  1MMN A;  3UU4 A;  4P1N A;  3LK4 2;  2BKP A;  4GYR A;  2MTQ A;  1IAP A;  2LE8 A;  1UK5 A;  4H9S E;  4UXN B;  1BR2 A;  1G8X A;  5FZT A;  3HKC E;  2NW7 A;  4X65 T;  3PUV F;  4OHF A;  2E8I A;  3KVB A;  2N9D A;  4DV5 T;  5CGM A;  3QNU A;  2K5B B;  2V6Y A;  4DV6 T;  3ZLI A;  4ZS3 A;  5AQN B;  3DJB A;  2FJB A;  2VVN A;  3AE1 A;  3ZC1 A;  4LF6 T;  4HFD A;  3RH3 A;  2XAG B;  1WRD A;  5KMG P;  4QWN B;  4AKG A;  3UQ4 A;  4UV9 B;  2BS4 A;  3WSC A;  3CX8 B;  2EHO B;  3EDV A;  4NXM T;  4H9P C;  2VB6 A;  4BGO A;  1IBK T;  2Q9Q B;  2LM2 A;  2XAJ B;  2CCQ A;  2DWG A;  2XQ3 A;  2E9X C;  3A5X A;  5LA6 E;  2A3D A;  1NEN A;  2IC9 A;  5JR9 A;  5DQW A;  2IC6 A;  3VKH A;  2C5K T;  4UV8 B;  3SOL A;  2V26 A;  2HH7 A;  3Q5E A;  3PJA J;  4G63 A;  3FHN A;  4U31 A;  3LK2 B;  2W61 A;  2DI4 A;  4CN4 A;  2MTC A;  2LSG A;  4XBF B;  4OK0 A;  3ZMU B;  1W9R A;  2XQ6 A;  1HCI A;  1Z0P A;  3HA4 A;  3MKD A;  4X66 T;  2RA1 A;  5FNV E;  3H3M A;  3RYC E;  4ZEY A;  3FBZ A;  4IDP A;  4DV1 T;  3SWH A;  3LSV A;  4UEL A;  5FVK A;  1JNZ A;  1W0A A;  2NW9 A;  1ZV4 X;  4HFC A;  3C4W A;  1LKX A;  2BG9 C;  4I0U A;  1HNW T;  4IGU A;  2CM0 A;  2FJE A;  3I9W A;  2PG8 A;  2UUC T;  4Z8X A;  2ODU A;  2X66 A;  2D5U A;  5FXW A;  3VU7 H;  4MHC A;  2YDR A;  3KV6 A;  1NAF A;  3CX7 B;  3FYQ A;  5AFU L;  2NW8 A;  3IBP A;  2X51 A;  1N33 T;  5IUX A;  2OV9 A;  5AQS B;  3UU5 A;  5L2L A;  4W8P A;  4EOZ B;  4YTP A;  3VJZ A;  3LFM A;  3OTO T;  3O9X A;  3NZQ A;  1KNR A;  2NR4 A;  3N2O A;  5FL1 A;  4P0B A;  2K9A A;  2I0M A;  2QGS A;  5LJM A;  5LP6 E;  4YJ3 E;  2XAS B;  5ABH A;  5AQK B;  3TLV A;  4CZZ B;  2SPC A;  3ZMT B;  4GKJ T;  3SS1 A;  3A7M A;  5HEH A;  4AKR B;  4M1P A;  3Q5X A;  4HTE A;  3PUQ A;  4NPP A;  3UU6 A;  4BJN A;  4PFO A;  2ZM2 A;  3AEF A;  4P0A A;  3PUZ F;  2ZM8 A;  1DU2 A;  3PUR A;  4F8H A;  3V5U A;  4MAL A;  4AIS A;  1HF8 A;  2VKJ A;  3MA9 A;  4PW8 A;  4BAY B;  4JEU B;  2KND A;  2JQQ A;  4JI8 T;  4TWD A;  4P09 A;  3ONX A;  2X67 A;  1VCT A;  2W4X A;  5GON E;  2XQ4 A;  2J47 A;  3PU3 A;  4KHZ F;  5LB7 B;  4ZZB A;  3IA3 A;  1KEY A;  3KV4 A;  1YD8 G;  4ZI2 D;  5AQH B;  3ZN0 B;  4HWH A;  2K24 A;  2X9X A;  2DL1 A;  2IW5 B;  4JI1 T;  2VL8 A;  4QX8 B;  1X9B A;  3PUX F;  2ACX A;  2N1G A;  4O2B E;  2CWY A;  5JDG A;  4PJL A;  4PJN A;  1HG2 A;  4NUV A;  3CK6 A;  4LF9 T;  2PJQ A;  5LG4 A;  3I1A A; 
#chains in the Genus database with same CATH homology
 4DVD A;  3WAJ A;  5IHY A;  1ZEE A;  4YLH A;  4ISS A;  4I4T E;  2LJL A;  2W62 A;  2HPL A;  4TX5 A;  4OYK A;  2CA5 A;  4I55 E;  3OYZ A;  5HXH A;  1X79 A;  4UVB B;  1UX5 A;  4IIJ E;  2H7O A;  2KT9 A;  2OA5 A;  4QHO A;  1VOM A;  1ZHC A;  4L5G A;  2LHN A;  4U72 A;  4AI6 A;  2L8K A;  2LQU A;  2X9H A;  4GK5 E;  4ANJ A;  4TV8 E;  4TV9 E;  5L3D B;  3WAK A;  2YEV C;  5JDQ A;  4FI5 A;  1HG5 A;  3C64 A;  3RPU A;  3W15 B;  3EDU A;  3PUA A;  4QXB B;  3N9M A;  4CQI A;  4AKH A;  2Z6E A;  4DMV A;  3ZC0 A;  3RRW A;  3HR0 A;  3HI2 A;  3K3N A;  3DP7 A;  2CXL A;  2W0G A;  2YU1 A;  3RYH E;  2L3L A;  1KK7 A;  4GK0 E;  3CQC B;  3N5L A;  4IDZ A;  3F2E A;  1BR4 A;  1D0X A;  4X20 E;  2CWO A;  5HAX A;  4O8S A;  3P8C D;  5HXR A;  3WI3 A;  2XQY A;  4QXC B;  3MXZ A;  3KBT A;  5L3E B;  1VRB A;  2WMO A;  2V7J A;  4O4H E;  4PNI A;  3ANW A;  3RC3 A;  4AQF C;  4ZHQ E;  1MIV A;  3C50 A;  3Q2M A;  4KP3 C;  3AT7 A;  3RX6 A;  2A72 A;  2LHR A;  2YIN A;  3IF8 B;  3UUN A;  4EYY R;  3C98 B;  5L3G B;  1SA0 E;  2JJ9 A;  2VKH A;  4ERR A;  5LGT B;  2WBL A;  3PUS A;  4UF0 B;  3AAE B;  4N78 D;  2CEA A;  1YW0 A;  4CI2 B;  2NTX A;  3I9Y A;  1FMV A;  2BVM A;  2XAH B;  1CUN A;  5H6R B;  2JMK A;  2I59 A;  2LSI A;  5L3F B;  2M67 A;  2BDE A;  5HXC A;  3ESL A;  3V5S A;  4EZ4 A;  3AAI A;  3ETU A;  1S94 A;  3UTK A;  1FEW A;  3KVA A;  1MIY A;  2QA7 A;  5JDL A;  3ZN1 B;  4DBQ A;  1MND A;  4QXH B;  2CLY C;  3ZYM A;  5TAO A;  3ZCJ A;  5LHH B;  2WWU A;  3KV5 A;  2X9W A;  1U5P A;  5ETW A;  3ZMS B;  3AAA B;  5DAB A;  2N2N A;  2LT3 A;  3QC9 A;  2LSJ A;  1FIO A;  2KZ7 B;  3B13 A;  2ZMA A;  5FY7 A;  3PHF 1;  3MK7 C;  4O4J E;  4X1Y E;  3WUR A;  3PTR B;  1WR6 A;  2WM9 A;  3LBX B;  5LOV E;  3RRC A;  1LRZ A;  4TUY E;  3GWH A;  5EK3 A;  2BVL A;  4ONR A;  3KV9 A;  4JLE A;  4HEA A;  3ZJ1 A;  3N9P A;  5HXE A;  5LGN B;  4CXY A;  3CKD A;  4XAX B;  5FXZ A;  4ZI7 E;  3ETV A;  5FYM A;  1O3X A;  4PJJ A;  4YFS A;  4ZOL E;  3RC8 A;  4JEH B;  3PDY A;  3CQG B;  1MIW A;  3ANW B;  3P7I A;  2EHO A;  5FMN A;  5BMV E;  1MMN A;  4PK6 A;  5DJQ C;  4O4L E;  4AQF A;  2KXP B;  2KMF A;  3ZPO A;  2Y6X A;  2IAK A;  5M4Y A;  2KIN B;  3LK4 2;  4GYR A;  5HWY A;  3HKD E;  4EZH A;  3R6N A;  2MTQ A;  3DTO A;  1IAP A;  2LEH A;  3UUL A;  3JC6 C;  2NP9 A;  2LE8 A;  3O4X E;  1Y64 B;  4HKA A;  4XZC A;  4H9S E;  4U74 A;  2VWA A;  2GK9 A;  4UXN B;  5EK4 A;  5CA0 E;  3LK3 B;  3FXE B;  5J1G A;  3ZMV B;  1BR2 A;  2DWK A;  4ILU A;  1G8X A;  3HKC E;  4UF0 A;  4BA9 A;  2NW7 A;  1HFA A;  4TZ4 C;  4EAH A;  3D0T A;  3JC6 D;  2CXF A;  4C90 A;  5LJN A;  4OHF A;  2KLQ A;  2E8I A;  4UVC B;  2RP4 A;  1LVK A;  3KVB A;  4H9Q C;  4DO0 A;  3U3I A;  2N9D A;  3FB2 A;  3MJX A;  2Y48 B;  3K8P C;  4HFV A;  2K5B B;  4OFZ A;  4AKL A;  4ASK A;  4NUU A;  3N9O A;  3AA6 B;  4WBO A;  2X9Y A;  3ZLI A;  2LOS A;  4UIG A;  3N9Q A;  4H9R C;  2V7K A;  3KBU A;  4HGA A;  1IJ5 A;  4ZS3 A;  5LNK A;  2XUE A;  3DJB A;  3R84 B;  4ADZ A;  5JQG E;  4UVA B;  3ZC1 A;  1U4Q A;  3OBV E;  2NOX A;  3CQX C;  4GIW A;  3RH3 A;  2KWH A;  4ZS2 A;  2A2F X;  2XAG B;  1WRD A;  1H7C A;  2X68 A;  3CX6 B;  3O1I A;  3UUM A;  4AQG A;  5KMG P;  3LBX A;  1MNE A;  4QWN B;  4F6R C;  4AKG A;  1D1B A;  5JDF A;  3M1C A;  4UV9 B;  3OYX A;  3WSC A;  3J9X 1;  3CX8 B;  3ZEF B;  2EHO B;  3EDV A;  3BQK A;  4H9P C;  2VB6 A;  2VAS A;  2V7L A;  4L9I A;  4WNK A;  4BGO A;  4DBR A;  2Q9Q B;  2NWB A;  3Q9D A;  2E9X B;  1BR1 A;  2EHO C;  2XAJ B;  2W63 A;  2CCQ A;  4H9O C;  1YKE B;  2DWG A;  2XHE B;  4IE0 A;  4OYJ A;  2Q9Q C;  2E9X C;  3A5X A;  3F31 A;  3CML A;  5LA6 E;  3H3A A;  1B7T A;  4PK5 A;  2A3D A;  3KDS E;  2G0U A;  2JPF A;  4H9N C;  5FY1 A;  2IC9 A;  5JR9 A;  2EHO D;  2LM9 A;  1BR0 A;  5DQW A;  3LJC A;  3N9N A;  2IC6 A;  3K3O A;  4QX7 B;  5L3C B;  3VKH A;  3PF0 A;  2Q9Q D;  4E7Z A;  4DND A;  2E9X D;  3E22 E;  1EZ3 A;  3RYI E;  2CE7 A;  3S4U A;  4CXX A;  2C5K T;  5JVD E;  4G2A A;  5FXV A;  2C5J A;  3M65 A;  3L3P A;  3TKL B;  3N9L A;  2X0L B;  4UV8 B;  3H37 A;  2D2S A;  2YK0 A;  5EK2 A;  1WYB A;  3SOL A;  3N2G E;  2V26 A;  3C4X A;  5J2U E;  2HH7 A;  5FY0 A;  3I0O A;  4DMW A;  3SRZ A;  4G63 A;  3FHN A;  2YU2 A;  3HL6 A;  4HE8 A;  3C4Z A;  5JRC B;  3LK2 B;  2LOP A;  2W61 A;  2DI4 A;  5JH7 E;  5F3J A;  1D0Z A;  2LSK A;  2UXN B;  4IE7 A;  2MTC A;  2K48 A;  5FP3 A;  2LSG A;  1UX4 A;  4CXW A;  4OK0 A;  4XBF B;  3ZMU B;  1E1H B;  3E08 A;  3UT5 E;  3VHL A;  1QUU A;  1HCI A;  1S35 A;  1Z0P A;  2PFV A;  3HA4 A;  3MKD A;  4A56 A;  4IHJ E;  3HKB E;  2ODV A;  2V7M A;  2RA1 A;  3BQI A;  4WW0 A;  2D0T A;  2BZB A;  3AA1 B;  5FNV E;  4CI1 B;  2C5I T;  3RYC E;  2B1E A;  4MBQ A;  2WAU A;  3O1H A;  3FBZ A;  2ZLY A;  3MAC A;  3EVY A;  4ECG A;  3ZCI A;  2Q9Q A;  3UUX B;  4PJM A;  3SWH A;  2E9X A;  5JRE A;  5LGU B;  5JR9 B;  4UEL A;  4AKI A;  3PUG A;  2L9Q A;  2C0S A;  2MOZ A;  2NW9 A;  1ZV4 X;  3RYF E;  3U78 A;  5JR9 C;  3C4W A;  2H3R A;  3F57 A;  4IE6 A;  1LKX A;  2XAQ B;  4B6X A;  4IGU A;  1D1A A;  2VKD A;  5LHG B;  4E7S A;  1AJ3 A;  2CM0 A;  2DNX A;  5JDH A;  2DHR A;  3I9W A;  1KNZ A;  2PG8 A;  2JRK A;  4Z8X A;  5E0O A;  5J2T E;  5ADX L;  1HS7 A;  2ODU A;  2X66 A;  1MMA A;  5IYZ E;  2D5U A;  2J1D G;  2KWI B;  3AVS A;  4YHJ A;  5FXW A;  5LBM A;  4EXT A;  2WMN A;  4X1I E;  2D0U A;  3C51 A;  5LHI B;  4H63 H;  4L0R A;  3VU7 H;  2V1D B;  4MHC A;  4EYU A;  3BQL A;  1WYC A;  3GMI A;  2CMR A;  5CA1 E;  3KV6 A;  5JRC A;  1NAF A;  1US7 B;  3MZK B;  3CX7 B;  3O1J A;  3FXD B;  2XTL A;  5DQV A;  5AFU L;  1G73 A;  1LVF A;  2NW8 A;  1MMD A;  3IBP A;  1HTJ F;  5L3B B;  2X51 A;  4PK4 A;  4CI3 B;  3OKQ A;  2P9B A;  4IE4 A;  3KFW X;  1OWA A;  1YKH B;  4KBM B;  4O2A E;  1UCU A;  5L2L A;  5JDM A;  4GOU A;  2DCF A;  3K3Q C;  1OXZ A;  4EOZ B;  3VJZ A;  3LFM A;  1NWM X;  3O9X A;  3E0Z A;  3OJA A;  3GN5 B;  3NZQ A;  3IHR A;  3N2O A;  1ZKE A;  3CWZ B;  4P0B A;  2K9A A;  1FMW A;  3CPZ A;  3EUH A;  3ZMZ B;  4X1K E;  5T1D A;  2Y8D A;  2QGS A;  5LJM A;  5LP6 E;  4YJ3 E;  1V9D A;  2XAS B;  5HXS A;  3KIN B;  3QUJ A;  1T98 A;  4CZZ B;  2SPC A;  3ZMT B;  3SS1 A;  5CB4 E;  4AKR B;  4WBN E;  3FBL A;  4ZI3 C;  4M1P A;  3Q5X A;  4HTE A;  2WSS V;  3PUQ A;  2ES0 A;  1IZN B;  5F8P A;  3QK6 A;  4BJN A;  4PFO A;  2ZM2 A;  4EIW A;  4BJM A;  2XAF B;  5LBQ B;  4P0A A;  2NTY A;  4IST A;  3RKO A;  3UFE A;  3IEE A;  1D1C A;  2ZM8 A;  4J2C A;  4ZI3 D;  4GYS A;  3PUR A;  5H6Q B;  3V5U A;  4MAL A;  4O4I E;  1HF8 A;  2VKJ A;  3MA9 A;  3PE0 A;  2HPJ A;  4HN9 A;  4PW8 A;  3ZJ2 A;  5LXT E;  4PAG A;  3ZYL A;  4BAY B;  4JEU B;  2KND A;  3HKE E;  2JQQ A;  4I43 B;  3NBX X;  2MBG A;  4P09 A;  3N2K E;  3ONX A;  2CLY B;  2V7I A;  3PU8 A;  2X67 A;  3GA8 A;  1IJ6 A;  4FJO A;  2W00 A;  2MYS A;  4ZI2 C;  5GON E;  4JUY A;  5HYA A;  3ZYK A;  3B57 A;  1SHZ C;  3LG7 A;  3PU3 A;  5JDN A;  4V1A v;  5FXX A;  3NRX A;  2VK9 A;  3KV4 A;  1YD8 G;  2UXX B;  3AA0 B;  4ZI2 D;  3BK9 A;  3ZN0 B;  4KMC A;  3I0Q A;  4QKN A;  3L09 A;  3AB3 B;  2K24 A;  5KX5 E;  2X9X A;  3GN5 A;  3Q5W A;  5C8Y E;  4AXP A;  4EB6 E;  3AA7 B;  4C91 A;  4KUM B;  4PFP A;  2IW5 B;  4I50 E;  5LCY A;  3VKG A;  5KDM C;  2VL8 A;  4QX8 B;  1D0Y A;  1MMG A;  4H63 V;  3CVR A;  3NZP A;  4UEM A;  2VKO A;  4MFR A;  5EZY E;  2JMH A;  3J7Y q;  2ZM0 A;  2PBI A;  1QSD A;  2CXD A;  2ACX A;  2N1G A;  4O2B E;  4TN7 B;  2CWY A;  5JDG A;  4PJL A;  5LYJ E;  4MLK A;  1HX8 A;  3NRY A;  4PJN A;  5A1L A;  1HG2 A;  4K0U A;  5HWX A;  4NUV A;  2DLR A;  1WLX A;  2LSY A;  2PJQ A;  3T8O A;  4IE5 A;  5LG4 A;  3I1A A;  3AVR A;  4YJ2 E;  2H7V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...