5JDFA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 1mm ca2+
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
Knots found
sequence length
301
structure length
294
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized membrane protein MJ0091
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Membrane protein
total genus 121
structure length 294
sequence length 301
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdfA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdfA02
5JDGA 5JDHA 3V5SA 5HXRA 5HXCA 5HWYA 5HWXA 5JDMA 5JDQA 5HYAA 5JDLA 5HXHA 3V5UA 5HXEA 5JDFA 5JDNA 5HXSA
chains in the Genus database with same CATH superfamily
3O1IA 4GOUA 2P9BA 4NXMT 1LVFA 3O1HA 4IT4A 4OHFA 5LCYA 5JDMA 3E0ZA 2BS4A 2ZM2A 4X5TA 4COFA 3HA4A 3ONLC 5L4HA 1KNZA 3N9OA 4ISSA 2H7VC 2N2NA 2VQFT 4KHPT 5BR8T 3NBXX 3LJCA 3BK9A 5LBMA 2V26A 5L3EB 2D5UA 2XQAA 5HEGA 1U5PA 3N9NA 2WMOA 3PUZF 3UT5E 5F5WA 2W66A 4Z90A 2Z6EA 3K3OA 3KV6A 5CFBA 4TNVA 3NKZA 4QXBB 2ZLYA 2XQ7A 4MBQA 3WAJA 1CUNA 2NWBA 3JAEA 2CLYB 4TNWA 1OEDB 2BG9B 5LOVE 3RGLA 3KINB 5L47A 3UQ4A 5FVLA 2I59A 5BMVE 3ZYMA 4DV4T 4EOZB 2LEHA 2J62A 3AT7A 2ODVA 4LF4T 5AQQB 1VCSA 1W9RA 4EZ4A 2WZIA 5HXHA 3TLUA 3HKCE 2X9WA 4DV2T 3VU7H 3ONXA 5FYMA 2QGSA 2D9DA 2E8IA 3MA9A 4H9PC 1MIWA 3VHLA 3SFDA 4UEMA 2X0YA 3EHZA 2LRLA 5FXZA 2B76A 4X1KE 4JLEA 3SRZA 5AQVB 2X9YA 1NEKA 5JDNA 4YFSA 3EDVA 5L3CB 4AQGA 2CHNA 4X20E 4GIWA 2CCQA 5J2UE 2UUBT 5LGUB 2XQ8A 5AQJB 2XZEA 1AJ3A 3OBVE 2K48A 1ZV4X 3LK3B 3O9XA 2NR4A 3D0TA 4HWCA 3GWHA 4DV0T 3UFEA 2CBIA 3P4SA 2F4VT 2IC6A 2KZ7B 2BDEA 5IWAT 4JV5T 3BQKA 4CXXA 2LKHA 2V7MA 4EYYR 3N5LA 5FMNA 4IDZA 2V7JA 2C5IT 1Z0PA 2M6BA 3C50A 2XTLA 4AKHA 2YKSA 2IUBA 3FZLB 5JDLA 3QOFA 4A5XA 5IUXA 4UVCB 4ZXLA 1FIOA 2Q9QA 2V6YA 2JJ9A 2HPLA 2IIUA 4ZI3C 4XBFB 3R84B 1KK7A 2E2AA 4EXTA 2W00A 1D0XA 2VVSA 4AQYT 5CB4E 3RX6A 2LQUA 3B5MA 2OA5A 2K9AA 4X1IE 2CLYC 2BG9C 2C5KT 1MNDA 3AA7B 4IIJE 3KV5A 1XMOT 3PTRB 2PBIA 2ACXA 4LFBT 2X0LB 3UQ7A 5KX5E 2AE9A 3RHWA 2X9HA 1X79A 4XZCA 2NOXA 5HAXA 2HHHT 4EB6E 5J0ZA 4GK0E 2WS3A 3I1AA 2L3LA 2V7LA 4PK5A 1BR1A 2X51A 3RIUC 3EI0A 5C3JA 2XQ5A 3RYCE 5AFUL 1QLBA 2V6XA 3KBTA 1KNRA 3J9X1 2WU2A 5LMUT 4KBMB 4O2AE 3ZJ2A 5FP3A 2GK9A 2DWGA 2L8KA 4L9IA 4U72A 2ZM6T 1T8BA 2VKJA 4B3TT 2D0TA 2WMNA 4MALA 4ONRA 1VCTA 3AEBA 2XPKA 2LOPA 2E9XB 3ABVA 3UULA 1UCUA 2HH7A 4HFIA 3UUXB 3CX7B 2W67A 3AVSA 4YJ2E 3PUYF 1D1BA 2FJAA 3JADA 2JRKA 5EK2A 3P8CD 5FY1A 3NZPA 2BBJA 3CQGB 4EEDA 4JI7T 2KLQA 1FMWA 4TWHA 3V5UA 4ADZA 4U74A 5JREA 3AVRA 4DO0A 2UU9T 4IDOA 4DMVA 4U31A 4X64T 2MBGA 2J1DG 3ZKRA 3RPUA 1D1AA 2HN2A 5AQTB 4ZI2D 1B7TA 4WZXA 2MTQA 2V5CA 4J2CA 3H3AA 3F2EA 2LSJA 4GK5E 4IE0A 2NTYA 1IBKT 5JRCB 4MLKA 3L8RA 3OVUA 2XQ4A 3EAMA 3ZSTA 2XHEB 4PJJA 1WCRA 2XSBA 5LG4A 5DQWA 4ZOLE 2Q9QC 4JEHB 4U3CA 2M6IA 4ILAA 2UXDT 3NWIA 2BKPA 4GYSA 1NWMX 2I6HA 5F8PA 2YDRA 3CQXC 5LGNB 1R8IA 1WR6A 2C5JA 2PTFA 3ZSSA 3N2OA 3N9PA 3F57A 5L3GB 3VR9A 1M62A 4HTEA 1HX1B 2EHOD 3CVRA 2JMKA 3ZT6A 2AXDS 5ABHA 1WR0A 5CJ5A 4TZ4C 2J47A 4HWIB 4AQFC 4LF8T 2XAFB 3ZC0A 4O8SA 4HKAA 1MMNA 1EZ3A 4UF0B 4E7SA 3AA0B 5LMNT 3ANWA 3OKQA 3QUJA 1HX8A 3H3MA 1LKXA 4GYRA 3AE3A 4PJNA 4U33A 4YHJA 2QRXA 2C0SA 3AEAA 1WRDA 4U7IA 2E9XC 2WM9A 5FL1A 3MK7C 3AA1B 3UU6A 2XQ3A 3I9YA 2BS2A 3ZMVB 3OTOT 2RP4A 4FI5A 4EEBA 3UTKA 3VR8A 2M67A 1N36T 3P7IA 3AA6B 4LF7T 3AE2A 4JI0T 4YHHT 1W09A 3CK6A 3EVYA 3K1SA 2ES0A 4K0UA 3LFMA 5HEOA 5JH7E 5LBQB 3J7Yq 3UU5A 2KNDA 4JI6T 4KMCA 2LSYA 2H88A 3C4ZA 5AQMB 5JDFA 2FJDA 3CX8B 2PG8A 3O1JA 3FHNA 2H3RA 3G06A 3RC3A 3PF0A 1H7CA 2BZBA 5LJNA 3U3IA 1HNWT 4YY3T 3CWZB 4IE4A 3B57A 1OWAA 5F3JA 4H9SE 4CI2B 3LBXB 5FY7A 5DJQC 1SJ8A 2KXPB 3FZHB 2V1DB 3MXZA 4NPPA 2XAGB 2LHRA 3FBLA 3PJAA 4HGAA 3KDSE 3HKBE 5JVDE 4DV3T 2UUCT 4AKGA 2FBWA 5TAOA 3VJZA 4ASKA 4DR2T 3IBPA 5IHYA 3C64A 4U2YA 5AQLB 4V1Av 3PUGA 3N2KE 3KFWX 4UXNB 2HPJA 5HCMA 5EZYE 4LF9T 4NXNT 3SFEA 2SPCA 4YTMA 1W0AA 4HWHA 1OEDA 5LP6E 1XDPA 3CIRA 4HE8A 3C4WA 3N2GE 3IA3A 3PU8A 1XNRT 4U2ZA 4TV9E 2W62A 1UURA 1N34T 1FEWA 1HCIA 4KX6A 1M7KA 4QX8B 4JI5T 5LXTE 3PDYA 3LG7A 4PW8A 4JI2T 4O4IE 3AY5A 4X65T 4LFAT 1LRZA 3AECA 2N1GA 4YSYA 1IJ6A 4GKKT 4JBWF 3M65A 3BQIA 2LKGA 1DU2A 2LE8A 4A98A 4HWFA 4BA9A 3HL6A 1J1JA 1T72A 1V9DA 3ETUA 2NW8A 3IHRA 5JDGA 1S94A 2W61A 3ZEFB 2OLTA 3Q5XA 2WQYA 4ILCA 4BJMA 1MNEA 1CHUA 3QB5A 2UXBT 2WSSV 4JI1T 4KP3C 3RH3A 4IE7A 3AAIA 1HFAA 3ZMSB 3Q5DA 1XNQT 1L0VA 5FZTA 3RYFE 3P4RA 3QK6A 3W15B 1T7SA 2XY8B 5LYJE 3L39A 2D2SA 4PNIA 5FXWA 2XQYA 2X66A 4WW0A 4YSXA 3GN5A 5JDQA 4ZS2A 2CEAA 3GA8A 4JI8T 4LMJA 3FZKB 4IL4A 4YXDA 3O4XE 2CWYA 4LFCT 2V7IA 1FMVA 5AQPB 3SWHA 1JNRA 2Q9QB 4BJNA 2DL1A 1OEDE 4UVBB 5L2LA 2V6YB 3AXJA 3AEEA 2VL8A 3JAFA 2LJLA 5L3DB 4H63V 3CPZA 4NUVA 3ZYLA 1VOMA 3A7MA 2VB6A 5HXRA 3ZMZB 1UK5A 5DABA 2OV9A 4DVDA 5HEHA 3AB3B 5IYZE 1KEYA 5AQFB 2W0GA 3K3NA 1IZNB 1NENA 3N9QA 3RQUA 4G63A 3IF8B 1NAFA 2WWUA 3CMLA 3AEFA 4CN4A 4KUMB 1N33T 2NW7A 1YQ4A 1W0BA 2A72A 1Z8UA 4CN1A 2CBJA 2LM9A 4Z8XA 5AQOB 3RYHE 2ODUA 3JC6D 3ZYKA 1HG2A 2QVAA 5JR9A 3NRYA 2W2UA 5HCJA 5LNKA 4F6RC 4CXYA 4ERRA 3Q5EA 2E5VA 3RIAA 3C98B 1FJGT 3PUXF 3NZQA 4UV8B 4AKRB 2VURA 1IJ5A 4QHOA 4NUUA 4DR4T 2KBBA 5JQGE 2JQ9A 4Q25A 5L3BB 3UU8A 4DUYT 1MIYA 5EK4A 3BQLA 3KV4A 4BAYB 4WBOA 3ZC1A 2MYSA 3RKGA 4P09A 2KMFA 3ZCJA 5JTGA 2YDQA 2IHR1 2YU2A 2EHOA 1OXZA 2YEVC 1IAPA 5CA0E 2CHOA 1XMQT 4PJLA 3KV9A 2XAQB 4DBRA 4K0KT 4ILUA 3AE4A 4QXHB 2UXCT 2XAHB 4B3RT 4MFRA 2JIWA 4YT0A 4H9OC 3ZMUB 4IE5A 2UXNB 3VRBA 3AAEB 3DYJA 2DLRA 1IBMT 5ABFA 2NTXA 2XM2A 3MZKB 5LHHB 3ZMTB 2FUPA 2WCAA 3UUNA 3E08A 1YKHB 2CA5A 1KF6A 5FXXA 5EK3A 4OX9T 2YOEA 4TWDA 5HXSA 3QB5K 4UR9A 1ZOYA 4AISA 3V5SA 5T1DA 4AIUA 4HFBA 4DV5T 1SJ7A 1YW0A 4AI6A 1KNPA 4BGOA 3SOLA 2JPFA 2VL0A 1E7PA 2JMHA 3TLTA 2WBLA 4DR5T 2FJBA 3ZPOA 4WBNE 5ETWA 2LSIA 4ILBA 5J1GA 3L09A 4DV1T 4H9NC 2X0HA 4MHCA 4AXPA 2LLYA 4IGUA 3I9WA 5FKYA 3UFGA 4DV6T 4JYAT 3AAAB 2MOZA 4WNKA 5JR9C 2LSKA 5CA1E 5JDHA 2Y6XA 3ANWB 4JI3T 4IDQA 4I4TE 3P4WA 4DV7T 4L0RA 2CXLA 4UF0A 3KVAA 3Q5WA 5FVKA 4P0BA 2CWOA 2UXXB 2CPTA 5KMGP 5LGTB 4QWNB 5DQVA 2KGXA 3VRAA 3ZT7A 2WB5A 5HWXA 3RF1A 2KSRA 1D0YA 1VRBA 2WY2A 1ZEEA 1HS7A 2XASB 2CM0A 3ZJ1A 2XQ6A 3WI3A 1HR0T 4FJOA 1YQ3A 4I55E 5HXEA 4UIGA 4UVAB 4HWDA 1O3XA 2K3WA 2WDRA 4UV9B 3T1HT 4X62T 2VWAA 3UU3A 4OK0A 3FZMB 4UELA 1E1HB 5LA6E 3PUWF 4ZHQE 4C91A 1US7B 1KFYA 4ISTA 3X1DA 2CE7A 3M3ZB 2DHRA 1UX5A 4YSZA 5AQUB 2NP9A 1ZHCA 3PUVF 4PFOA 2KWIB 2WP9A 1D0ZA 3QC9A 3I0OA 3OYZA 2JQKA 3PJAJ 4TX5A 2W63A 5HYAA 3DP7A 5L4EA 4QXCB 1JNZA 1ZP0A 4TWFA 3PUSA 4O2BE 1HNXT 1G73A 2X0CA 4EYUA 3GMIA 2PJQA 2BS3A 2RPAA 5ABGA 2VKOA 2CMRA 4IL9A 4YTNA 3ZN1B 2BKOA 3LBXA 5A1LA 4HEAA 4CQIA 5KDMC 1SE7A 1ZKEA 2RA1A 2WZHA 3N9MA 5C2TA 2DWKA 4W8PA 4HFHA 5HEJA 3CKDA 4LMKA 3TLVA 4HFEA 4DR1T 5KXJA 3T1YT 1QSDA 5FL0A 1G8XA 3WAKA 1SHZC 3L3PA 2MPKA 4TN7B 2BKNA 2BG9A 4QKNA 4AKLA 3P4QA 2IC9A 4QH1A 2H89A 4JI4T 2YINA 4LF6T 3LK42 5LHIB 3FXDB 2CXDA 1WLXA 3F31A 4CXWA 2XJ7A 2H7OA 1HG5A 1BR4A 3AE1A 4IHJE 2V5DA 3RRCA 1U4QA 4TUYE 3RIUA 3DJBA 4EAHA 3HI2A 5ADXL 1QUUA 4YTPA 2KINB 2A2FX 3AE7A 3AEDA 3OPCA 1LVKA 4ZZCA 4ZEYA 4O4LE 2KT9A 4CN6A 2BVMA 3ZLIA 3PURA 3M1CA 3I0QA 3OYXA 2V8SV 2MAWA 3FBZA 4IREA 4ZI3D 4IDNA 1Y64B 2Y48B 3K8PC 3RI5A 2CXFA 2YU1A 4OFZA 4IE6A 3PU3A 4KHZF 2WDVA 2JQHA 2ZM0A 4QH4A 3ZCIA 2VQET 2IAKA 4L5GA 4LMLA 3TLSA 3GN5B 4GKJT 3RIFA 4YJ3E 4P1NA 4OYJA 2X67A 2YN6A 3ONJA 5L3FB 3VKHA 4M1PA 2VKHA 3R6NA 4ZI7E 4EIWA 2BG9E 3E22E 3AE8A 4PJMA 4LF5T 2DCFA 4YLHA 3AXJB 4H9QC 2QYWA 4EV6A 3A8YC 1WYCA 4O4HE 3RRWA 3UUMA 3UU4A 3FYQA 4DR6T 4X66T 2UUAT 2J4GA 4IDPA 2K5BB 2LSGA 2V7KA 1J5ET 5E0OA 2XQ9A 5H6QB 2Y8DA 3RQWA 1OEDC 1T98A 3A5XA 4AKIA 4B3MT 1UX4A 2XM1A 1Y01A 4HFDA 4C90A 2ZM8A 3PUQA 3MJXA 4XAXB 4DUZT 4H9RC 5LJMA 2ACZA 5HEUA 3KBUA 3P4PA 3ESLA 4O4JE 3C4XA 3UUBA 1HTJF 4AQFA 3C51A 3LSVA 4E7ZA 5JR9B 4F7GB 1YXRA 2B1EA 1MIVA 4DR7T 3Q2MA 3N9LA 5AQSB 2L10A 3OJAA 4ZS3A 2VK9A 5J2TE 4ZZBA 2Q9QD 2BVLA 1YD8G 1YKEB 4P0AA 3P50A 1X9BA 2DNXA 1IBLT 4A56A 5CGMA 3EUHA 1S35A 2L7NA 1HF8A 3AEGA 2CRBA 2QA7A 4HN9A 2E9XA 4QX7B 2BBHA 2KWHA 2XUEA 2W4XA 4ANJA 2DI4A 3PV0F 1XDOA 3RKOA 3HKEE 2X68A 3B13A 2A3DA 5AQIB 2EHOB 5LHGB 2I0MA 3KVBA 4HFCA 2JQQA 3IEEA 2X9XA 5C8YE 3HKDE 5AQHB 5M4YA 3S4UA 2E5LT 1SA0E 3NRXA 3JC6C 4NIQA 3SS1A 4I50E 4PK6A 4QH5A 3MKDA 2LT3A 5AQGB 5GONE 3RLFF 4N78D 2VASA 5JRCA 3FXEB 5ABFB 2L9QA 3TKLB 4I0UA 2ZMAA 2IDOB 2WAUA 4CI1B 1UGOA 1MMDA 3K3QC 3WURA 2E9XD 4DMWA 3NVOA 1E2AA 1D1CA 4DIDB 3ZN0B 2D0UA 5LB7B 1SUMB 2MTCA 5LG3A 1N32T 1J5WA 3FB2A 2WWVA 3H37A 3T8OA 2HN1A 2WDQA 5AQKB 2PFVA 2K24A 2N9DA 1GQEA 4F8HA 2LM2A 2YK0A 1I94T 2LRKA 1BR2A 4ZI2C 4DR3T 4DBQA 4CZZB 3PHF1 3AE9A 5AQRB 2WU5A 5HXCA 1UUSA 4PAGA 2A9UA 2LHNA 2YDSA 5FNVE 2LOSA 2IW5B 4CI3B 2VKDA 4OYKA 2NW9A 1WYBA 2VVNA 1HNZT 1XZYA 3DTOA 4JUYA 4U7YA 2G0UA 2XAJB 5FXVA 4B6XA 3MACA 4EGWA 2R6GF 4Z91A 4G2AA 4H63H 3RC8A 3CX6B 1XWMA 1I6ZA 3Q9DA 1BR0A 4EZHA 4KI0F 4I43B 3U78A 2XSAA 4X1YE 4B3ST 3AE6A 4PFPA 3QNUA 3ETVA 2FJEA 3RYIE 2EHOC 3TLWA 3PE0A 3WSCA 4DNDA 4A97A 5ABEA 3LK2B 4JEUB 3LDQB 5H6RB 2IMLA 4PK4A 4ECGA 3FZFB 1MMGA 3PUAA 4HFVA 4TV8E 3AE5A 3VKGA 3ZT5A 3EDUA 3CQCB 3EABA 5HWYA 3HR0A 2KVPA 5AQNB 4WYVA 1MMAA 5FY0A 3JCFA 1WFDA
chains in the Genus database with same CATH topology
1WR6A 1Y64B 2C5JA 2Y48B 5JR9A 3NRYA 3O1IA 4GOUA 5LNKA 2P9BA 3K8PC 4F6RC 1LVFA 3O1HA 4OHFA 5LCYA 3N2OA 2CXFA 2YU1A 3N9PA 3F57A 4OFZA 5JDMA 5L3GB 3E0ZA 4CXYA 2ZM2A 4IE6A 4ERRA 3PU3A 3HA4A 4HTEA 1KNZA 3N9OA 2EHOD 3CVRA 2JMKA 4ISSA 2H7VC 3C98B 2N2NA 3NZQA 4TZ4C 4UV8B 4AKRB 4AQFC 3NBXX 3LJCA 3BK9A 5LBMA 1IJ5A 2V26A 4QHOA 5L3EB 4NUUA 2XAFB 2ZM0A 2D5UA 3ZC0A 3ZCIA 1U5PA 3N9NA 4O8SA 2WMOA 5JQGE 5L3BB 3UT5E 2IAKA 4L5GA 1MIYA 3GN5B 5EK4A 3BQLA 2Z6EA 4HKAA 3K3OA 1MMNA 1EZ3A 3KV4A 3KV6A 4UF0B 4BAYB 4YJ3E 4WBOA 4E7SA 3AA0B 4OYJA 2X67A 5L3FB 3ANWA 3OKQA 3QUJA 2MYSA 3ZC1A 1HX8A 4QXBB 4P09A 2ZLYA 1LKXA 2KMFA 3ZCJA 4GYRA 3VKHA 4MBQA 4M1PA 3WAJA 1CUNA 2VKHA 3R6NA 4ZI7E 2NWBA 4PJNA 4EIWA 2CLYB 2YU2A 5LOVE 3E22E 4PJMA 4YHJA 3KINB 2DCFA 2EHOA 4YLHA 1OXZA 2C0SA 4H9QC 2YEVC 1WRDA 2I59A 5BMVE 1IAPA 2E9XC 2WM9A 5CA0E 4PJLA 3ZYMA 3MK7C 3AA1B 3KV9A 1WYCA 4O4HE 4EOZB 2XAQB 2LEHA 3I9YA 3ZMVB 4DBRA 4ILUA 3AT7A 2ODVA 3RRWA 2RP4A 3UUMA 4FI5A 4QXHB 3UTKA 2M67A 2XAHB 4MFRA 3P7IA 3AA6B 4H9OC 3ZMUB 4EZ4A 4IE5A 2K5BB 2LSGA 2UXNB 3EVYA 5HXHA 2V7KA 3AAEB 2ES0A 3HKCE 5E0OA 4K0UA 2X9WA 3LFMA 5H6QB 3VU7H 2DLRA 3ONXA 5JH7E 5LBQB 3J7Yq 2KNDA 2Y8DA 4KMCA 5FYMA 2QGSA 2LSYA 1T98A 3C4ZA 3A5XA 2E8IA 2NTXA 3MA9A 5JDFA 4H9PC 1MIWA 3VHLA 3MZKB 5LHHB 4AKIA 3ZMTB 3CX8B 4UEMA 3UUNA 1UX4A 2PG8A 3E08A 3O1JA 4C90A 1YKHB 3FHNA 2ZM8A 3PUQA 3MJXA 4XAXB 2CA5A 4H9RC 2H3RA 5FXZA 5LJMA 5FXXA 5EK3A 4X1KE 3RC3A 3KBUA 4JLEA 3ESLA 1H7CA 4O4JE 3SRZA 5HXSA 3PF0A 2X9YA 3C4XA 2BZBA 5LJNA 3U3IA 1HTJF 4AQFA 3C51A 5JDNA 4YFSA 4E7ZA 5JR9B 3V5SA 5T1DA 3EDVA 3CWZB 2B1EA 1MIVA 4IE4A 5L3CB 4AQGA 1YW0A 3Q2MA 3B57A 3N9LA 1OWAA 4AI6A 4X20E 5F3JA 4GIWA 4H9SE 2CCQA 4BGOA 5J2UE 3SOLA 2JPFA 4CI2B 3LBXB 2JMHA 5LGUB 5FY7A 5DJQC 2KXPB 3OJAA 1AJ3A 3OBVE 2K48A 1ZV4X 3LK3B 4ZS3A 3O9XA 2WBLA 2V1DB 3MXZA 3D0TA 2XAGB 3GWHA 2LHRA 3UFEA 3FBLA 2VK9A 4HGAA 5J2TE 2Q9QD 3KDSE 3HKBE 3ZPOA 2BVLA 5ETWA 5JVDE 1YD8G 4WBNE 2IC6A 2KZ7B 4AKGA 2BDEA 2LSIA 1YKEB 5J1GA 3L09A 4H9NC 4P0AA 4MHCA 5TAOA 4AXPA 2DNXA 3BQKA 4IGUA 4CXXA 3I9WA 3VJZA 4A56A 2V7MA 3EUHA 4ASKA 1S35A 1HF8A 3IBPA 5IHYA 3AAAB 3C64A 4EYYR 2MOZA 3N5LA 2QA7A 4HN9A 2E9XA 4IDZA 5FMNA 4V1Av 4QX7B 4WNKA 5JR9C 2KWHA 2LSKA 3PUGA 5CA1E 2XUEA 2Y6XA 5JDHA 4ANJA 2V7JA 2DI4A 3N2KE 3KFWX 3ANWB 3RKOA 4UXNB 2C5IT 1Z0PA 3HKEE 4I4TE 2X68A 4L0RA 3C50A 3B13A 2HPJA 2CXLA 2A3DA 5EZYE 2XTLA 4AKHA 4UF0A 3KVAA 3Q5WA 4P0BA 2CWOA 5JDLA 2UXXB 2SPCA 5KMGP 2EHOB 5LHGB 5LGTB 4QWNB 5DQVA 4UVCB 1FIOA 3KVBA 2Q9QA 5HWXA 2JQQA 1D0YA 1VRBA 3IEEA 2X9XA 1ZEEA 1HS7A 5LP6E 2XASB 5C8YE 2CM0A 4HE8A 2JJ9A 3HKDE 5M4YA 3ZJ1A 3S4UA 2HPLA 3C4WA 3WI3A 1SA0E 3NRXA 3JC6C 4ZI3C 3N2GE 4XBFB 3R84B 4FJOA 1KK7A 3PU8A 4I55E 5HXEA 4UIGA 4EXTA 4TV9E 4UVAB 2W00A 2W62A 4I50E 1D0XA 4PK6A 1O3XA 3SS1A 1FEWA 5CB4E 3RX6A 3MKDA 2LT3A 2LQUA 1HCIA 2OA5A 4UV9B 5GONE 2K9AA 4X1IE 2VWAA 4QX8B 5LXTE 2CLYC 4OK0A 4N78D 3PDYA 2C5KT 3LG7A 2VASA 5JRCA 1MNDA 3AA7B 3FXEB 4IIJE 3KV5A 3PTRB 4UELA 2PBIA 2ACXA 1E1HB 4PW8A 2L9QA 5LA6E 2X0LB 5KX5E 4O4IE 3TKLB 2ZMAA 4ZHQE 4C91A 1US7B 2WAUA 2X9HA 1LRZA 1X79A 4CI1B 2N1GA 4XZCA 4ISTA 2NOXA 1MMDA 1IJ6A 2CE7A 5HAXA 3K3QC 4EB6E 3M65A 2DHRA 3WURA 1UX5A 3BQIA 2NP9A 1ZHCA 2E9XD 4GK0E 4PFOA 3I1AA 2LE8A 2L3LA 2V7LA 2KWIB 4DMWA 1D0ZA 1D1CA 4BA9A 3HL6A 3QC9A 4PK5A 3ZN0B 1BR1A 3I0OA 1V9DA 2X51A 2D0UA 3OYZA 5HYAA 4TX5A 2W63A 3ETUA 3DP7A 2MTCA 3RYCE 2NW8A 3IHRA 4QXCB 5JDGA 5AFUL 3KBTA 3PUSA 1S94A 2W61A 4O2BE 3ZEFB 3J9X1 1G73A 3Q5XA 3FB2A 4EYUA 3GMIA 3H37A 2PJQA 3T8OA 4KBMB 4O2AE 4BJMA 3ZJ2A 2VKOA 2CMRA 2PFVA 5FP3A 2GK9A 2DWGA 1MNEA 2L8KA 4L9IA 4U72A 2K24A 2N9DA 2VKJA 3ZN1B 3LBXA 2WSSV 5A1LA 4HEAA 2YK0A 2D0TA 4CQIA 5KDMC 4KP3C 1BR2A 3RH3A 1ZKEA 4IE7A 4ZI2C 3AAIA 2RA1A 1HFAA 2WMNA 4MALA 3ZMSB 4DBQA 4ONRA 4CZZB 3PHF1 3RYFE 3N9MA 2LOPA 2E9XB 3QK6A 3W15B 2DWKA 3UULA 1UCUA 5HXCA 5LYJE 2D2SA 2HH7A 4PNIA 4PAGA 3UUXB 3CX7B 5FXWA 3AVSA 2XQYA 2LHNA 2X66A 4WW0A 4YJ2E 3GN5A 3CKDA 1D1BA 5FNVE 2JRKA 5JDQA 2LOSA 2IW5B 4CI3B 4ZS2A 3P8CD 2VKDA 5FY1A 5EK2A 2CEAA 3GA8A 3NZPA 4OYKA 2NW9A 3CQGB 1WYBA 1QSDA 2KLQA 1FMWA 1G8XA 3V5UA 3WAKA 1SHZC 3L3PA 3O4XE 4ADZA 4U74A 4JUYA 2CWYA 3DTOA 2V7IA 4TN7B 2G0UA 2XAJB 5JREA 5FXVA 3AVRA 1FMVA 4B6XA 3MACA 3SWHA 2Q9QB 4QKNA 4DO0A 4AKLA 4BJNA 4DMVA 4G2AA 2IC9A 2MBGA 4H63H 2J1DG 4UVBB 3CX6B 3RPUA 5L2LA 3RC8A 2YINA 1D1AA 3LK42 3Q9DA 3FXDB 5LHIB 2CXDA 2VL8A 1WLXA 2LJLA 5L3DB 3F31A 1BR0A 4H63V 3CPZA 4NUVA 4EZHA 4CXWA 3ZYLA 4I43B 3U78A 4ZI2D 1VOMA 2H7OA 1B7TA 2MTQA 2VB6A 1HG5A 1BR4A 5HXRA 4J2CA 4IHJE 4X1YE 3ZMZB 3H3AA 3RRCA 1U4QA 3F2EA 5DABA 4PFPA 2LSJA 4GK5E 3ETVA 4TUYE 4IE0A 4DVDA 3DJBA 2NTYA 5JRCB 4MLKA 3AB3B 3RYIE 5IYZE 4EAHA 2EHOC 3PE0A 3HI2A 5ADXL 1QUUA 3WSCA 4DNDA 2XHEB 4PJJA 2W0GA 2KINB 3K3NA 5LG4A 5DQWA 1IZNB 2A2FX 4ZOLE 3N9QA 3LK2B 4JEUB 2Q9QC 4G63A 3IF8B 1NAFA 1LVKA 4JEHB 5H6RB 4PK4A 4ECGA 2WWUA 3CMLA 1MMGA 4O4LE 3PUAA 4HFVA 4KUMB 4TV8E 2KT9A 2BVMA 3ZLIA 4GYSA 3VKGA 3PURA 1NWMX 3M1CA 2NW7A 2A72A 3EDUA 3I0QA 3OYXA 5F8PA 3CQCB 5HWYA 3HR0A 2LM9A 4Z8XA 3RYHE 2ODUA 3FBZA 3JC6D 4ZI3D 1MMAA 3ZYKA 1HG2A 5FY0A 3CQXC 5LGNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDG A;  5JDH A;  3V5S A;  5HXR A;  5HXC A;  5HWY A;  5HWX A;  5JDM A;  5JDQ A;  5HYA A;  5JDL A;  5HXH A;  3V5U A;  5HXE A;  5JDF A;  5JDN A;  5HXS A; 
#chains in the Genus database with same CATH topology
 3O1I A;  4GOU A;  2P9B A;  4NXM T;  1LVF A;  3O1H A;  4IT4 A;  4OHF A;  5LCY A;  5JDM A;  3E0Z A;  2BS4 A;  2ZM2 A;  4X5T A;  4COF A;  3HA4 A;  3ONL C;  5L4H A;  1KNZ A;  3N9O A;  4ISS A;  2H7V C;  2N2N A;  2VQF T;  4KHP T;  5BR8 T;  3NBX X;  3LJC A;  3BK9 A;  5LBM A;  2V26 A;  5L3E B;  2D5U A;  2XQA A;  5HEG A;  1U5P A;  3N9N A;  2WMO A;  3PUZ F;  3UT5 E;  5F5W A;  2W66 A;  4Z90 A;  2Z6E A;  3K3O A;  3KV6 A;  5CFB A;  4TNV A;  3NKZ A;  4QXB B;  2ZLY A;  2XQ7 A;  4MBQ A;  3WAJ A;  1CUN A;  2NWB A;  3JAE A;  2CLY B;  4TNW A;  1OED B;  2BG9 B;  5LOV E;  3RGL A;  3KIN B;  5L47 A;  3UQ4 A;  5FVL A;  2I59 A;  5BMV E;  3ZYM A;  4DV4 T;  4EOZ B;  2LEH A;  2J62 A;  3AT7 A;  2ODV A;  4LF4 T;  5AQQ B;  1VCS A;  1W9R A;  4EZ4 A;  2WZI A;  5HXH A;  3TLU A;  3HKC E;  2X9W A;  4DV2 T;  3VU7 H;  3ONX A;  5FYM A;  2QGS A;  2D9D A;  2E8I A;  3MA9 A;  4H9P C;  1MIW A;  3VHL A;  3SFD A;  4UEM A;  2X0Y A;  3EHZ A;  2LRL A;  5FXZ A;  2B76 A;  4X1K E;  4JLE A;  3SRZ A;  5AQV B;  2X9Y A;  1NEK A;  5JDN A;  4YFS A;  3EDV A;  5L3C B;  4AQG A;  2CHN A;  4X20 E;  4GIW A;  2CCQ A;  5J2U E;  2UUB T;  5LGU B;  2XQ8 A;  5AQJ B;  2XZE A;  1AJ3 A;  3OBV E;  2K48 A;  1ZV4 X;  3LK3 B;  3O9X A;  2NR4 A;  3D0T A;  4HWC A;  3GWH A;  4DV0 T;  3UFE A;  2CBI A;  3P4S A;  2F4V T;  2IC6 A;  2KZ7 B;  2BDE A;  5IWA T;  4JV5 T;  3BQK A;  4CXX A;  2LKH A;  2V7M A;  4EYY R;  3N5L A;  5FMN A;  4IDZ A;  2V7J A;  2C5I T;  1Z0P A;  2M6B A;  3C50 A;  2XTL A;  4AKH A;  2YKS A;  2IUB A;  3FZL B;  5JDL A;  3QOF A;  4A5X A;  5IUX A;  4UVC B;  4ZXL A;  1FIO A;  2Q9Q A;  2V6Y A;  2JJ9 A;  2HPL A;  2IIU A;  4ZI3 C;  4XBF B;  3R84 B;  1KK7 A;  2E2A A;  4EXT A;  2W00 A;  1D0X A;  2VVS A;  4AQY T;  5CB4 E;  3RX6 A;  2LQU A;  3B5M A;  2OA5 A;  2K9A A;  4X1I E;  2CLY C;  2BG9 C;  2C5K T;  1MND A;  3AA7 B;  4IIJ E;  3KV5 A;  1XMO T;  3PTR B;  2PBI A;  2ACX A;  4LFB T;  2X0L B;  3UQ7 A;  5KX5 E;  2AE9 A;  3RHW A;  2X9H A;  1X79 A;  4XZC A;  2NOX A;  5HAX A;  2HHH T;  4EB6 E;  5J0Z A;  4GK0 E;  2WS3 A;  3I1A A;  2L3L A;  2V7L A;  4PK5 A;  1BR1 A;  2X51 A;  3RIU C;  3EI0 A;  5C3J A;  2XQ5 A;  3RYC E;  5AFU L;  1QLB A;  2V6X A;  3KBT A;  1KNR A;  3J9X 1;  2WU2 A;  5LMU T;  4KBM B;  4O2A E;  3ZJ2 A;  5FP3 A;  2GK9 A;  2DWG A;  2L8K A;  4L9I A;  4U72 A;  2ZM6 T;  1T8B A;  2VKJ A;  4B3T T;  2D0T A;  2WMN A;  4MAL A;  4ONR A;  1VCT A;  3AEB A;  2XPK A;  2LOP A;  2E9X B;  3ABV A;  3UUL A;  1UCU A;  2HH7 A;  4HFI A;  3UUX B;  3CX7 B;  2W67 A;  3AVS A;  4YJ2 E;  3PUY F;  1D1B A;  2FJA A;  3JAD A;  2JRK A;  5EK2 A;  3P8C D;  5FY1 A;  3NZP A;  2BBJ A;  3CQG B;  4EED A;  4JI7 T;  2KLQ A;  1FMW A;  4TWH A;  3V5U A;  4ADZ A;  4U74 A;  5JRE A;  3AVR A;  4DO0 A;  2UU9 T;  4IDO A;  4DMV A;  4U31 A;  4X64 T;  2MBG A;  2J1D G;  3ZKR A;  3RPU A;  1D1A A;  2HN2 A;  5AQT B;  4ZI2 D;  1B7T A;  4WZX A;  2MTQ A;  2V5C A;  4J2C A;  3H3A A;  3F2E A;  2LSJ A;  4GK5 E;  4IE0 A;  2NTY A;  1IBK T;  5JRC B;  4MLK A;  3L8R A;  3OVU A;  2XQ4 A;  3EAM A;  3ZST A;  2XHE B;  4PJJ A;  1WCR A;  2XSB A;  5LG4 A;  5DQW A;  4ZOL E;  2Q9Q C;  4JEH B;  4U3C A;  2M6I A;  4ILA A;  2UXD T;  3NWI A;  2BKP A;  4GYS A;  1NWM X;  2I6H A;  5F8P A;  2YDR A;  3CQX C;  5LGN B;  1R8I A;  1WR6 A;  2C5J A;  2PTF A;  3ZSS A;  3N2O A;  3N9P A;  3F57 A;  5L3G B;  3VR9 A;  1M62 A;  4HTE A;  1HX1 B;  2EHO D;  3CVR A;  2JMK A;  3ZT6 A;  2AXD S;  5ABH A;  1WR0 A;  5CJ5 A;  4TZ4 C;  2J47 A;  4HWI B;  4AQF C;  4LF8 T;  2XAF B;  3ZC0 A;  4O8S A;  4HKA A;  1MMN A;  1EZ3 A;  4UF0 B;  4E7S A;  3AA0 B;  5LMN T;  3ANW A;  3OKQ A;  3QUJ A;  1HX8 A;  3H3M A;  1LKX A;  4GYR A;  3AE3 A;  4PJN A;  4U33 A;  4YHJ A;  2QRX A;  2C0S A;  3AEA A;  1WRD A;  4U7I A;  2E9X C;  2WM9 A;  5FL1 A;  3MK7 C;  3AA1 B;  3UU6 A;  2XQ3 A;  3I9Y A;  2BS2 A;  3ZMV B;  3OTO T;  2RP4 A;  4FI5 A;  4EEB A;  3UTK A;  3VR8 A;  2M67 A;  1N36 T;  3P7I A;  3AA6 B;  4LF7 T;  3AE2 A;  4JI0 T;  4YHH T;  1W09 A;  3CK6 A;  3EVY A;  3K1S A;  2ES0 A;  4K0U A;  3LFM A;  5HEO A;  5JH7 E;  5LBQ B;  3J7Y q;  3UU5 A;  2KND A;  4JI6 T;  4KMC A;  2LSY A;  2H88 A;  3C4Z A;  5AQM B;  5JDF A;  2FJD A;  3CX8 B;  2PG8 A;  3O1J A;  3FHN A;  2H3R A;  3G06 A;  3RC3 A;  3PF0 A;  1H7C A;  2BZB A;  5LJN A;  3U3I A;  1HNW T;  4YY3 T;  3CWZ B;  4IE4 A;  3B57 A;  1OWA A;  5F3J A;  4H9S E;  4CI2 B;  3LBX B;  5FY7 A;  5DJQ C;  1SJ8 A;  2KXP B;  3FZH B;  2V1D B;  3MXZ A;  4NPP A;  2XAG B;  2LHR A;  3FBL A;  3PJA A;  4HGA A;  3KDS E;  3HKB E;  5JVD E;  4DV3 T;  2UUC T;  4AKG A;  2FBW A;  5TAO A;  3VJZ A;  4ASK A;  4DR2 T;  3IBP A;  5IHY A;  3C64 A;  4U2Y A;  5AQL B;  4V1A v;  3PUG A;  3N2K E;  3KFW X;  4UXN B;  2HPJ A;  5HCM A;  5EZY E;  4LF9 T;  4NXN T;  3SFE A;  2SPC A;  4YTM A;  1W0A A;  4HWH A;  1OED A;  5LP6 E;  1XDP A;  3CIR A;  4HE8 A;  3C4W A;  3N2G E;  3IA3 A;  3PU8 A;  1XNR T;  4U2Z A;  4TV9 E;  2W62 A;  1UUR A;  1N34 T;  1FEW A;  1HCI A;  4KX6 A;  1M7K A;  4QX8 B;  4JI5 T;  5LXT E;  3PDY A;  3LG7 A;  4PW8 A;  4JI2 T;  4O4I E;  3AY5 A;  4X65 T;  4LFA T;  1LRZ A;  3AEC A;  2N1G A;  4YSY A;  1IJ6 A;  4GKK T;  4JBW F;  3M65 A;  3BQI A;  2LKG A;  1DU2 A;  2LE8 A;  4A98 A;  4HWF A;  4BA9 A;  3HL6 A;  1J1J A;  1T72 A;  1V9D A;  3ETU A;  2NW8 A;  3IHR A;  5JDG A;  1S94 A;  2W61 A;  3ZEF B;  2OLT A;  3Q5X A;  2WQY A;  4ILC A;  4BJM A;  1MNE A;  1CHU A;  3QB5 A;  2UXB T;  2WSS V;  4JI1 T;  4KP3 C;  3RH3 A;  4IE7 A;  3AAI A;  1HFA A;  3ZMS B;  3Q5D A;  1XNQ T;  1L0V A;  5FZT A;  3RYF E;  3P4R A;  3QK6 A;  3W15 B;  1T7S A;  2XY8 B;  5LYJ E;  3L39 A;  2D2S A;  4PNI A;  5FXW A;  2XQY A;  2X66 A;  4WW0 A;  4YSX A;  3GN5 A;  5JDQ A;  4ZS2 A;  2CEA A;  3GA8 A;  4JI8 T;  4LMJ A;  3FZK B;  4IL4 A;  4YXD A;  3O4X E;  2CWY A;  4LFC T;  2V7I A;  1FMV A;  5AQP B;  3SWH A;  1JNR A;  2Q9Q B;  4BJN A;  2DL1 A;  1OED E;  4UVB B;  5L2L A;  2V6Y B;  3AXJ A;  3AEE A;  2VL8 A;  3JAF A;  2LJL A;  5L3D B;  4H63 V;  3CPZ A;  4NUV A;  3ZYL A;  1VOM A;  3A7M A;  2VB6 A;  5HXR A;  3ZMZ B;  1UK5 A;  5DAB A;  2OV9 A;  4DVD A;  5HEH A;  3AB3 B;  5IYZ E;  1KEY A;  5AQF B;  2W0G A;  3K3N A;  1IZN B;  1NEN A;  3N9Q A;  3RQU A;  4G63 A;  3IF8 B;  1NAF A;  2WWU A;  3CML A;  3AEF A;  4CN4 A;  4KUM B;  1N33 T;  2NW7 A;  1YQ4 A;  1W0B A;  2A72 A;  1Z8U A;  4CN1 A;  2CBJ A;  2LM9 A;  4Z8X A;  5AQO B;  3RYH E;  2ODU A;  3JC6 D;  3ZYK A;  1HG2 A;  2QVA A;  5JR9 A;  3NRY A;  2W2U A;  5HCJ A;  5LNK A;  4F6R C;  4CXY A;  4ERR A;  3Q5E A;  2E5V A;  3RIA A;  3C98 B;  1FJG T;  3PUX F;  3NZQ A;  4UV8 B;  4AKR B;  2VUR A;  1IJ5 A;  4QHO A;  4NUU A;  4DR4 T;  2KBB A;  5JQG E;  2JQ9 A;  4Q25 A;  5L3B B;  3UU8 A;  4DUY T;  1MIY A;  5EK4 A;  3BQL A;  3KV4 A;  4BAY B;  4WBO A;  3ZC1 A;  2MYS A;  3RKG A;  4P09 A;  2KMF A;  3ZCJ A;  5JTG A;  2YDQ A;  2IHR 1;  2YU2 A;  2EHO A;  1OXZ A;  2YEV C;  1IAP A;  5CA0 E;  2CHO A;  1XMQ T;  4PJL A;  3KV9 A;  2XAQ B;  4DBR A;  4K0K T;  4ILU A;  3AE4 A;  4QXH B;  2UXC T;  2XAH B;  4B3R T;  4MFR A;  2JIW A;  4YT0 A;  4H9O C;  3ZMU B;  4IE5 A;  2UXN B;  3VRB A;  3AAE B;  3DYJ A;  2DLR A;  1IBM T;  5ABF A;  2NTX A;  2XM2 A;  3MZK B;  5LHH B;  3ZMT B;  2FUP A;  2WCA A;  3UUN A;  3E08 A;  1YKH B;  2CA5 A;  1KF6 A;  5FXX A;  5EK3 A;  4OX9 T;  2YOE A;  4TWD A;  5HXS A;  3QB5 K;  4UR9 A;  1ZOY A;  4AIS A;  3V5S A;  5T1D A;  4AIU A;  4HFB A;  4DV5 T;  1SJ7 A;  1YW0 A;  4AI6 A;  1KNP A;  4BGO A;  3SOL A;  2JPF A;  2VL0 A;  1E7P A;  2JMH A;  3TLT A;  2WBL A;  4DR5 T;  2FJB A;  3ZPO A;  4WBN E;  5ETW A;  2LSI A;  4ILB A;  5J1G A;  3L09 A;  4DV1 T;  4H9N C;  2X0H A;  4MHC A;  4AXP A;  2LLY A;  4IGU A;  3I9W A;  5FKY A;  3UFG A;  4DV6 T;  4JYA T;  3AAA B;  2MOZ A;  4WNK A;  5JR9 C;  2LSK A;  5CA1 E;  5JDH A;  2Y6X A;  3ANW B;  4JI3 T;  4IDQ A;  4I4T E;  3P4W A;  4DV7 T;  4L0R A;  2CXL A;  4UF0 A;  3KVA A;  3Q5W A;  5FVK A;  4P0B A;  2CWO A;  2UXX B;  2CPT A;  5KMG P;  5LGT B;  4QWN B;  5DQV A;  2KGX A;  3VRA A;  3ZT7 A;  2WB5 A;  5HWX A;  3RF1 A;  2KSR A;  1D0Y A;  1VRB A;  2WY2 A;  1ZEE A;  1HS7 A;  2XAS B;  2CM0 A;  3ZJ1 A;  2XQ6 A;  3WI3 A;  1HR0 T;  4FJO A;  1YQ3 A;  4I55 E;  5HXE A;  4UIG A;  4UVA B;  4HWD A;  1O3X A;  2K3W A;  2WDR A;  4UV9 B;  3T1H T;  4X62 T;  2VWA A;  3UU3 A;  4OK0 A;  3FZM B;  4UEL A;  1E1H B;  5LA6 E;  3PUW F;  4ZHQ E;  4C91 A;  1US7 B;  1KFY A;  4IST A;  3X1D A;  2CE7 A;  3M3Z B;  2DHR A;  1UX5 A;  4YSZ A;  5AQU B;  2NP9 A;  1ZHC A;  3PUV F;  4PFO A;  2KWI B;  2WP9 A;  1D0Z A;  3QC9 A;  3I0O A;  3OYZ A;  2JQK A;  3PJA J;  4TX5 A;  2W63 A;  5HYA A;  3DP7 A;  5L4E A;  4QXC B;  1JNZ A;  1ZP0 A;  4TWF A;  3PUS A;  4O2B E;  1HNX T;  1G73 A;  2X0C A;  4EYU A;  3GMI A;  2PJQ A;  2BS3 A;  2RPA A;  5ABG A;  2VKO A;  2CMR A;  4IL9 A;  4YTN A;  3ZN1 B;  2BKO A;  3LBX A;  5A1L A;  4HEA A;  4CQI A;  5KDM C;  1SE7 A;  1ZKE A;  2RA1 A;  2WZH A;  3N9M A;  5C2T A;  2DWK A;  4W8P A;  4HFH A;  5HEJ A;  3CKD A;  4LMK A;  3TLV A;  4HFE A;  4DR1 T;  5KXJ A;  3T1Y T;  1QSD A;  5FL0 A;  1G8X A;  3WAK A;  1SHZ C;  3L3P A;  2MPK A;  4TN7 B;  2BKN A;  2BG9 A;  4QKN A;  4AKL A;  3P4Q A;  2IC9 A;  4QH1 A;  2H89 A;  4JI4 T;  2YIN A;  4LF6 T;  3LK4 2;  5LHI B;  3FXD B;  2CXD A;  1WLX A;  3F31 A;  4CXW A;  2XJ7 A;  2H7O A;  1HG5 A;  1BR4 A;  3AE1 A;  4IHJ E;  2V5D A;  3RRC A;  1U4Q A;  4TUY E;  3RIU A;  3DJB A;  4EAH A;  3HI2 A;  5ADX L;  1QUU A;  4YTP A;  2KIN B;  2A2F X;  3AE7 A;  3AED A;  3OPC A;  1LVK A;  4ZZC A;  4ZEY A;  4O4L E;  2KT9 A;  4CN6 A;  2BVM A;  3ZLI A;  3PUR A;  3M1C A;  3I0Q A;  3OYX A;  2V8S V;  2MAW A;  3FBZ A;  4IRE A;  4ZI3 D;  4IDN A;  1Y64 B;  2Y48 B;  3K8P C;  3RI5 A;  2CXF A;  2YU1 A;  4OFZ A;  4IE6 A;  3PU3 A;  4KHZ F;  2WDV A;  2JQH A;  2ZM0 A;  4QH4 A;  3ZCI A;  2VQE T;  2IAK A;  4L5G A;  4LML A;  3TLS A;  3GN5 B;  4GKJ T;  3RIF A;  4YJ3 E;  4P1N A;  4OYJ A;  2X67 A;  2YN6 A;  3ONJ A;  5L3F B;  3VKH A;  4M1P A;  2VKH A;  3R6N A;  4ZI7 E;  4EIW A;  2BG9 E;  3E22 E;  3AE8 A;  4PJM A;  4LF5 T;  2DCF A;  4YLH A;  3AXJ B;  4H9Q C;  2QYW A;  4EV6 A;  3A8Y C;  1WYC A;  4O4H E;  3RRW A;  3UUM A;  3UU4 A;  3FYQ A;  4DR6 T;  4X66 T;  2UUA T;  2J4G A;  4IDP A;  2K5B B;  2LSG A;  2V7K A;  1J5E T;  5E0O A;  2XQ9 A;  5H6Q B;  2Y8D A;  3RQW A;  1OED C;  1T98 A;  3A5X A;  4AKI A;  4B3M T;  1UX4 A;  2XM1 A;  1Y01 A;  4HFD A;  4C90 A;  2ZM8 A;  3PUQ A;  3MJX A;  4XAX B;  4DUZ T;  4H9R C;  5LJM A;  2ACZ A;  5HEU A;  3KBU A;  3P4P A;  3ESL A;  4O4J E;  3C4X A;  3UUB A;  1HTJ F;  4AQF A;  3C51 A;  3LSV A;  4E7Z A;  5JR9 B;  4F7G B;  1YXR A;  2B1E A;  1MIV A;  4DR7 T;  3Q2M A;  3N9L A;  5AQS B;  2L10 A;  3OJA A;  4ZS3 A;  2VK9 A;  5J2T E;  4ZZB A;  2Q9Q D;  2BVL A;  1YD8 G;  1YKE B;  4P0A A;  3P50 A;  1X9B A;  2DNX A;  1IBL T;  4A56 A;  5CGM A;  3EUH A;  1S35 A;  2L7N A;  1HF8 A;  3AEG A;  2CRB A;  2QA7 A;  4HN9 A;  2E9X A;  4QX7 B;  2BBH A;  2KWH A;  2XUE A;  2W4X A;  4ANJ A;  2DI4 A;  3PV0 F;  1XDO A;  3RKO A;  3HKE E;  2X68 A;  3B13 A;  2A3D A;  5AQI B;  2EHO B;  5LHG B;  2I0M A;  3KVB A;  4HFC A;  2JQQ A;  3IEE A;  2X9X A;  5C8Y E;  3HKD E;  5AQH B;  5M4Y A;  3S4U A;  2E5L T;  1SA0 E;  3NRX A;  3JC6 C;  4NIQ A;  3SS1 A;  4I50 E;  4PK6 A;  4QH5 A;  3MKD A;  2LT3 A;  5AQG B;  5GON E;  3RLF F;  4N78 D;  2VAS A;  5JRC A;  3FXE B;  5ABF B;  2L9Q A;  3TKL B;  4I0U A;  2ZMA A;  2IDO B;  2WAU A;  4CI1 B;  1UGO A;  1MMD A;  3K3Q C;  3WUR A;  2E9X D;  4DMW A;  3NVO A;  1E2A A;  1D1C A;  4DID B;  3ZN0 B;  2D0U A;  5LB7 B;  1SUM B;  2MTC A;  5LG3 A;  1N32 T;  1J5W A;  3FB2 A;  2WWV A;  3H37 A;  3T8O A;  2HN1 A;  2WDQ A;  5AQK B;  2PFV A;  2K24 A;  2N9D A;  1GQE A;  4F8H A;  2LM2 A;  2YK0 A;  1I94 T;  2LRK A;  1BR2 A;  4ZI2 C;  4DR3 T;  4DBQ A;  4CZZ B;  3PHF 1;  3AE9 A;  5AQR B;  2WU5 A;  5HXC A;  1UUS A;  4PAG A;  2A9U A;  2LHN A;  2YDS A;  5FNV E;  2LOS A;  2IW5 B;  4CI3 B;  2VKD A;  4OYK A;  2NW9 A;  1WYB A;  2VVN A;  1HNZ T;  1XZY A;  3DTO A;  4JUY A;  4U7Y A;  2G0U A;  2XAJ B;  5FXV A;  4B6X A;  3MAC A;  4EGW A;  2R6G F;  4Z91 A;  4G2A A;  4H63 H;  3RC8 A;  3CX6 B;  1XWM A;  1I6Z A;  3Q9D A;  1BR0 A;  4EZH A;  4KI0 F;  4I43 B;  3U78 A;  2XSA A;  4X1Y E;  4B3S T;  3AE6 A;  4PFP A;  3QNU A;  3ETV A;  2FJE A;  3RYI E;  2EHO C;  3TLW A;  3PE0 A;  3WSC A;  4DND A;  4A97 A;  5ABE A;  3LK2 B;  4JEU B;  3LDQ B;  5H6R B;  2IML A;  4PK4 A;  4ECG A;  3FZF B;  1MMG A;  3PUA A;  4HFV A;  4TV8 E;  3AE5 A;  3VKG A;  3ZT5 A;  3EDU A;  3CQC B;  3EAB A;  5HWY A;  3HR0 A;  2KVP A;  5AQN B;  4WYV A;  1MMA A;  5FY0 A;  3JCF A;  1WFD A; 
#chains in the Genus database with same CATH homology
 1WR6 A;  1Y64 B;  2C5J A;  2Y48 B;  5JR9 A;  3NRY A;  3O1I A;  4GOU A;  5LNK A;  2P9B A;  3K8P C;  4F6R C;  1LVF A;  3O1H A;  4OHF A;  5LCY A;  3N2O A;  2CXF A;  2YU1 A;  3N9P A;  3F57 A;  4OFZ A;  5JDM A;  5L3G B;  3E0Z A;  4CXY A;  2ZM2 A;  4IE6 A;  4ERR A;  3PU3 A;  3HA4 A;  4HTE A;  1KNZ A;  3N9O A;  2EHO D;  3CVR A;  2JMK A;  4ISS A;  2H7V C;  3C98 B;  2N2N A;  3NZQ A;  4TZ4 C;  4UV8 B;  4AKR B;  4AQF C;  3NBX X;  3LJC A;  3BK9 A;  5LBM A;  1IJ5 A;  2V26 A;  4QHO A;  5L3E B;  4NUU A;  2XAF B;  2ZM0 A;  2D5U A;  3ZC0 A;  3ZCI A;  1U5P A;  3N9N A;  4O8S A;  2WMO A;  5JQG E;  5L3B B;  3UT5 E;  2IAK A;  4L5G A;  1MIY A;  3GN5 B;  5EK4 A;  3BQL A;  2Z6E A;  4HKA A;  3K3O A;  1MMN A;  1EZ3 A;  3KV4 A;  3KV6 A;  4UF0 B;  4BAY B;  4YJ3 E;  4WBO A;  4E7S A;  3AA0 B;  4OYJ A;  2X67 A;  5L3F B;  3ANW A;  3OKQ A;  3QUJ A;  2MYS A;  3ZC1 A;  1HX8 A;  4QXB B;  4P09 A;  2ZLY A;  1LKX A;  2KMF A;  3ZCJ A;  4GYR A;  3VKH A;  4MBQ A;  4M1P A;  3WAJ A;  1CUN A;  2VKH A;  3R6N A;  4ZI7 E;  2NWB A;  4PJN A;  4EIW A;  2CLY B;  2YU2 A;  5LOV E;  3E22 E;  4PJM A;  4YHJ A;  3KIN B;  2DCF A;  2EHO A;  4YLH A;  1OXZ A;  2C0S A;  4H9Q C;  2YEV C;  1WRD A;  2I59 A;  5BMV E;  1IAP A;  2E9X C;  2WM9 A;  5CA0 E;  4PJL A;  3ZYM A;  3MK7 C;  3AA1 B;  3KV9 A;  1WYC A;  4O4H E;  4EOZ B;  2XAQ B;  2LEH A;  3I9Y A;  3ZMV B;  4DBR A;  4ILU A;  3AT7 A;  2ODV A;  3RRW A;  2RP4 A;  3UUM A;  4FI5 A;  4QXH B;  3UTK A;  2M67 A;  2XAH B;  4MFR A;  3P7I A;  3AA6 B;  4H9O C;  3ZMU B;  4EZ4 A;  4IE5 A;  2K5B B;  2LSG A;  2UXN B;  3EVY A;  5HXH A;  2V7K A;  3AAE B;  2ES0 A;  3HKC E;  5E0O A;  4K0U A;  2X9W A;  3LFM A;  5H6Q B;  3VU7 H;  2DLR A;  3ONX A;  5JH7 E;  5LBQ B;  3J7Y q;  2KND A;  2Y8D A;  4KMC A;  5FYM A;  2QGS A;  2LSY A;  1T98 A;  3C4Z A;  3A5X A;  2E8I A;  2NTX A;  3MA9 A;  5JDF A;  4H9P C;  1MIW A;  3VHL A;  3MZK B;  5LHH B;  4AKI A;  3ZMT B;  3CX8 B;  4UEM A;  3UUN A;  1UX4 A;  2PG8 A;  3E08 A;  3O1J A;  4C90 A;  1YKH B;  3FHN A;  2ZM8 A;  3PUQ A;  3MJX A;  4XAX B;  2CA5 A;  4H9R C;  2H3R A;  5FXZ A;  5LJM A;  5FXX A;  5EK3 A;  4X1K E;  3RC3 A;  3KBU A;  4JLE A;  3ESL A;  1H7C A;  4O4J E;  3SRZ A;  5HXS A;  3PF0 A;  2X9Y A;  3C4X A;  2BZB A;  5LJN A;  3U3I A;  1HTJ F;  4AQF A;  3C51 A;  5JDN A;  4YFS A;  4E7Z A;  5JR9 B;  3V5S A;  5T1D A;  3EDV A;  3CWZ B;  2B1E A;  1MIV A;  4IE4 A;  5L3C B;  4AQG A;  1YW0 A;  3Q2M A;  3B57 A;  3N9L A;  1OWA A;  4AI6 A;  4X20 E;  5F3J A;  4GIW A;  4H9S E;  2CCQ A;  4BGO A;  5J2U E;  3SOL A;  2JPF A;  4CI2 B;  3LBX B;  2JMH A;  5LGU B;  5FY7 A;  5DJQ C;  2KXP B;  3OJA A;  1AJ3 A;  3OBV E;  2K48 A;  1ZV4 X;  3LK3 B;  4ZS3 A;  3O9X A;  2WBL A;  2V1D B;  3MXZ A;  3D0T A;  2XAG B;  3GWH A;  2LHR A;  3UFE A;  3FBL A;  2VK9 A;  4HGA A;  5J2T E;  2Q9Q D;  3KDS E;  3HKB E;  3ZPO A;  2BVL A;  5ETW A;  5JVD E;  1YD8 G;  4WBN E;  2IC6 A;  2KZ7 B;  4AKG A;  2BDE A;  2LSI A;  1YKE B;  5J1G A;  3L09 A;  4H9N C;  4P0A A;  4MHC A;  5TAO A;  4AXP A;  2DNX A;  3BQK A;  4IGU A;  4CXX A;  3I9W A;  3VJZ A;  4A56 A;  2V7M A;  3EUH A;  4ASK A;  1S35 A;  1HF8 A;  3IBP A;  5IHY A;  3AAA B;  3C64 A;  4EYY R;  2MOZ A;  3N5L A;  2QA7 A;  4HN9 A;  2E9X A;  4IDZ A;  5FMN A;  4V1A v;  4QX7 B;  4WNK A;  5JR9 C;  2KWH A;  2LSK A;  3PUG A;  5CA1 E;  2XUE A;  2Y6X A;  5JDH A;  4ANJ A;  2V7J A;  2DI4 A;  3N2K E;  3KFW X;  3ANW B;  3RKO A;  4UXN B;  2C5I T;  1Z0P A;  3HKE E;  4I4T E;  2X68 A;  4L0R A;  3C50 A;  3B13 A;  2HPJ A;  2CXL A;  2A3D A;  5EZY E;  2XTL A;  4AKH A;  4UF0 A;  3KVA A;  3Q5W A;  4P0B A;  2CWO A;  5JDL A;  2UXX B;  2SPC A;  5KMG P;  2EHO B;  5LHG B;  5LGT B;  4QWN B;  5DQV A;  4UVC B;  1FIO A;  3KVB A;  2Q9Q A;  5HWX A;  2JQQ A;  1D0Y A;  1VRB A;  3IEE A;  2X9X A;  1ZEE A;  1HS7 A;  5LP6 E;  2XAS B;  5C8Y E;  2CM0 A;  4HE8 A;  2JJ9 A;  3HKD E;  5M4Y A;  3ZJ1 A;  3S4U A;  2HPL A;  3C4W A;  3WI3 A;  1SA0 E;  3NRX A;  3JC6 C;  4ZI3 C;  3N2G E;  4XBF B;  3R84 B;  4FJO A;  1KK7 A;  3PU8 A;  4I55 E;  5HXE A;  4UIG A;  4EXT A;  4TV9 E;  4UVA B;  2W00 A;  2W62 A;  4I50 E;  1D0X A;  4PK6 A;  1O3X A;  3SS1 A;  1FEW A;  5CB4 E;  3RX6 A;  3MKD A;  2LT3 A;  2LQU A;  1HCI A;  2OA5 A;  4UV9 B;  5GON E;  2K9A A;  4X1I E;  2VWA A;  4QX8 B;  5LXT E;  2CLY C;  4OK0 A;  4N78 D;  3PDY A;  2C5K T;  3LG7 A;  2VAS A;  5JRC A;  1MND A;  3AA7 B;  3FXE B;  4IIJ E;  3KV5 A;  3PTR B;  4UEL A;  2PBI A;  2ACX A;  1E1H B;  4PW8 A;  2L9Q A;  5LA6 E;  2X0L B;  5KX5 E;  4O4I E;  3TKL B;  2ZMA A;  4ZHQ E;  4C91 A;  1US7 B;  2WAU A;  2X9H A;  1LRZ A;  1X79 A;  4CI1 B;  2N1G A;  4XZC A;  4IST A;  2NOX A;  1MMD A;  1IJ6 A;  2CE7 A;  5HAX A;  3K3Q C;  4EB6 E;  3M65 A;  2DHR A;  3WUR A;  1UX5 A;  3BQI A;  2NP9 A;  1ZHC A;  2E9X D;  4GK0 E;  4PFO A;  3I1A A;  2LE8 A;  2L3L A;  2V7L A;  2KWI B;  4DMW A;  1D0Z A;  1D1C A;  4BA9 A;  3HL6 A;  3QC9 A;  4PK5 A;  3ZN0 B;  1BR1 A;  3I0O A;  1V9D A;  2X51 A;  2D0U A;  3OYZ A;  5HYA A;  4TX5 A;  2W63 A;  3ETU A;  3DP7 A;  2MTC A;  3RYC E;  2NW8 A;  3IHR A;  4QXC B;  5JDG A;  5AFU L;  3KBT A;  3PUS A;  1S94 A;  2W61 A;  4O2B E;  3ZEF B;  3J9X 1;  1G73 A;  3Q5X A;  3FB2 A;  4EYU A;  3GMI A;  3H37 A;  2PJQ A;  3T8O A;  4KBM B;  4O2A E;  4BJM A;  3ZJ2 A;  2VKO A;  2CMR A;  2PFV A;  5FP3 A;  2GK9 A;  2DWG A;  1MNE A;  2L8K A;  4L9I A;  4U72 A;  2K24 A;  2N9D A;  2VKJ A;  3ZN1 B;  3LBX A;  2WSS V;  5A1L A;  4HEA A;  2YK0 A;  2D0T A;  4CQI A;  5KDM C;  4KP3 C;  1BR2 A;  3RH3 A;  1ZKE A;  4IE7 A;  4ZI2 C;  3AAI A;  2RA1 A;  1HFA A;  2WMN A;  4MAL A;  3ZMS B;  4DBQ A;  4ONR A;  4CZZ B;  3PHF 1;  3RYF E;  3N9M A;  2LOP A;  2E9X B;  3QK6 A;  3W15 B;  2DWK A;  3UUL A;  1UCU A;  5HXC A;  5LYJ E;  2D2S A;  2HH7 A;  4PNI A;  4PAG A;  3UUX B;  3CX7 B;  5FXW A;  3AVS A;  2XQY A;  2LHN A;  2X66 A;  4WW0 A;  4YJ2 E;  3GN5 A;  3CKD A;  1D1B A;  5FNV E;  2JRK A;  5JDQ A;  2LOS A;  2IW5 B;  4CI3 B;  4ZS2 A;  3P8C D;  2VKD A;  5FY1 A;  5EK2 A;  2CEA A;  3GA8 A;  3NZP A;  4OYK A;  2NW9 A;  3CQG B;  1WYB A;  1QSD A;  2KLQ A;  1FMW A;  1G8X A;  3V5U A;  3WAK A;  1SHZ C;  3L3P A;  3O4X E;  4ADZ A;  4U74 A;  4JUY A;  2CWY A;  3DTO A;  2V7I A;  4TN7 B;  2G0U A;  2XAJ B;  5JRE A;  5FXV A;  3AVR A;  1FMV A;  4B6X A;  3MAC A;  3SWH A;  2Q9Q B;  4QKN A;  4DO0 A;  4AKL A;  4BJN A;  4DMV A;  4G2A A;  2IC9 A;  2MBG A;  4H63 H;  2J1D G;  4UVB B;  3CX6 B;  3RPU A;  5L2L A;  3RC8 A;  2YIN A;  1D1A A;  3LK4 2;  3Q9D A;  3FXD B;  5LHI B;  2CXD A;  2VL8 A;  1WLX A;  2LJL A;  5L3D B;  3F31 A;  1BR0 A;  4H63 V;  3CPZ A;  4NUV A;  4EZH A;  4CXW A;  3ZYL A;  4I43 B;  3U78 A;  4ZI2 D;  1VOM A;  2H7O A;  1B7T A;  2MTQ A;  2VB6 A;  1HG5 A;  1BR4 A;  5HXR A;  4J2C A;  4IHJ E;  4X1Y E;  3ZMZ B;  3H3A A;  3RRC A;  1U4Q A;  3F2E A;  5DAB A;  4PFP A;  2LSJ A;  4GK5 E;  3ETV A;  4TUY E;  4IE0 A;  4DVD A;  3DJB A;  2NTY A;  5JRC B;  4MLK A;  3AB3 B;  3RYI E;  5IYZ E;  4EAH A;  2EHO C;  3PE0 A;  3HI2 A;  5ADX L;  1QUU A;  3WSC A;  4DND A;  2XHE B;  4PJJ A;  2W0G A;  2KIN B;  3K3N A;  5LG4 A;  5DQW A;  1IZN B;  2A2F X;  4ZOL E;  3N9Q A;  3LK2 B;  4JEU B;  2Q9Q C;  4G63 A;  3IF8 B;  1NAF A;  1LVK A;  4JEH B;  5H6R B;  4PK4 A;  4ECG A;  2WWU A;  3CML A;  1MMG A;  4O4L E;  3PUA A;  4HFV A;  4KUM B;  4TV8 E;  2KT9 A;  2BVM A;  3ZLI A;  4GYS A;  3VKG A;  3PUR A;  1NWM X;  3M1C A;  2NW7 A;  2A72 A;  3EDU A;  3I0Q A;  3OYX A;  5F8P A;  3CQC B;  5HWY A;  3HR0 A;  2LM9 A;  4Z8X A;  3RYH E;  2ODU A;  3FBZ A;  3JC6 D;  4ZI3 D;  1MMA A;  3ZYK A;  1HG2 A;  5FY0 A;  3CQX C;  5LGN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...