5JDFA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 1mm ca2+
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
Knots found
sequence length
301
structure length
294
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Uncharacterized membrane protein MJ0091
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 121
structure length 294
sequence length 301
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdfA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdfA02
5JDNA 5JDLA 5HYAA 5HXSA 5HXRA 5JDGA 5HXCA 5HWXA 5HWYA 3V5UA 5HXHA 5HXEA 5JDQA 5JDMA 5JDHA 5JDFA 3V5SA
chains in the Genus database with same CATH superfamily
3ZEFB 4GOUA 2XPKA 2KWIB 4HFEA 2DI4A 3AE2A 2W67A 2LEHA 3AVSA 3ZYMA 4HFBA 3TKLB 2FUPA 1W09A 5J1GA 3AA7B 4B3TT 2MTQA 3PF0A 3PTRB 1OEDC 5C8YE 3KV4A 2K24A 4IE5A 4YY3T 3ANWB 3PURA 2XAJB 2W00A 4HFCA 3TLSA 4CN4A 2XQ9A 2CRBA 2CBJA 1N32T 3I1AA 5AQQB 4QH4A 5DABA 4ILAA 2VKHA 4X5TA 5AQSB 4NUVA 4YT0A 4U31A 4KI0F 2V5CA 5JDGA 3AEDA 5EK3A 3KV5A 2Q9QA 4QH5A 2CM0A 2HPJA 1ZEEA 2BKOA 3PJAA 4NXMT 3CPZA 4JYAT 4A97A 1Z0PA 4JEUB 3ZJ2A 1OEDB 1FMWA 1UUSA 5FVLA 2W63A 2X0YA 3OBVE 1IBKT 1IBMT 3JCFA 5HXHA 1LVFA 3N2GE 1L0VA 2K48A 2D0TA 2AE9A 4NXNT 3Q5WA 5LHGB 4EB6E 3N9NA 4LF8T 3PUQA 1NEKA 2WWUA 3WURA 5JDHA 4LFAT 2E5LT 4KHZF 1Y64B 2KLQA 3M65A 4HFDA 5H6RB 3F2EA 4MLKA 2JQKA 2JQ9A 1D0XA 4IL4A 1KEYA 3RC8A 4ZI7E 1US7B 3PU8A 4NPPA 4ANJA 4ILCA 4DV2T 3ONXA 4J2CA 3OYXA 2ZM2A 1OWAA 5FYMA 4COFA 5IHYA 5DJQC 5DQVA 1HF8A 4GK0E 2WSSV 1O3XA 5FNVE 3H3MA 2WQYA 2PFVA 2QA7A 2CBIA 3RPUA 2ZLYA 3RGLA 4I55E 2RA1A 3ZT7A 5LG4A 2EHOD 2HN1A 4EXTA 3N9MA 1FJGT 5JREA 2NOXA 4I0UA 3VJZA 2NW9A 3KINB 4A98A 3AEGA 1OXZA 2D0UA 5L3DB 4JI5T 4PAGA 2VQET 4DV0T 5JDQA 2DLRA 4U7YA 4HTEA 5LGNB 2RP4A 3Q5XA 4I50E 3O1JA 3ETUA 5JR9A 1EZ3A 3A8YC 2L8KA 2VKOA 2QRXA 3EAMA 4NIQA 2E9XB 2QGSA 1ZV4X 4P0BA 1KF6A 2YU2A 3MA9A 5ABEA 2X67A 4UVBB 4X1YE 2UXXB 1WCRA 1MNEA 3HA4A 2FJAA 4PJJA 2V7JA 3Q5EA 3K3NA 1T8BA 1ZOYA 4DBQA 1YD8G 2LT3A 3RIUA 4LF6T 3CIRA 4TN7B 1J1JA 4OFZA 1E2AA 4XAXB 4Z8XA 2XQ4A 4X62T 3EDUA 2BBJA 1MIYA 2XQ7A 1D1AA 2XM1A 4OK0A 3NKZA 5DQWA 2V7MA 3E08A 4HEAA 3RI5A 1JNRA 2PJQA 4DR2T 4AKLA 4U7IA 1W9RA 2JJ9A 3TLTA 2LSIA 5AQTB 3V5UA 2BBHA 4EAHA 1XMOT 4IREA 5FVKA 5HXSA 1QSDA 4X65T 3RQUA 3FZMB 2J1DG 1HS7A 5ABFB 1IAPA 3VKGA 2XQYA 3RHWA 4KP3C 2BKPA 3AEBA 5E0OA 4JI6T 2IC9A 4PFOA 4IE7A 2UUCT 3RIAA 2IAKA 3CVRA 1D0ZA 3AXJA 1SJ8A 2WDQA 3N9PA 1G8XA 4Q25A 1ZKEA 4HGAA 4H9SE 2XUEA 3I9YA 5J2TE 3QB5A 4TNWA 4MALA 3HKEE 4L5GA 3K3QC 5IUXA 2KT9A 4BJMA 1XNQT 3HL6A 3RKOA 4UIGA 1R8IA 3F31A 3UU6A 2IDOB 1NENA 1T98A 2BKNA 3T8OA 1UK5A 5LOVE 2YDQA 4KUMB 2ACXA 2EHOC 3U78A 5FP3A 1I6ZA 4IDZA 1HNXT 2A3DA 3G06A 2DNXA 2YOEA 3LFMA 3H37A 2HH7A 3HR0A 3ZYLA 4JI0T 3PUZF 4DR5T 4AKIA 5LXTE 3N2KE 2L9QA 2LSJA 2WDVA 3N2OA 1KFYA 1WYBA 1KK7A 3LDQB 4O4LE 3MACA 3KVAA 5IWAT 1MMDA 2LLYA 3HKBE 4WYVA 1YKHB 4HWCA 3EUHA 4YTPA 2IC6A 3CQCB 4E7SA 4PK6A 2JMKA 3QUJA 1UX5A 5EZYE 2Q9QD 3NBXX 2FJDA 5JDMA 2KXPB 3UUXB 4DR6T 2YDRA 3UQ7A 5JH7E 2WDRA 3PE0A 5JRCB 3ZMUB 4ONRA 3JADA 5LMNT 1E1HB 3P50A 4YFSA 4HWIB 3AA1B 3AB3B 4B3RT 2W4XA 3P8CD 2WS3A 5GONE 5A1LA 5L3EB 3HKDE 5KMGP 1CHUA 4DMWA 4KX6A 4U3CA 4P09A 4H9QC 1N33T 4DIDB 3E0ZA 3QC9A 3OKQA 2A9UA 2E5VA 4CXWA 1WRDA 2PTFA 1W0BA 4L0RA 1WR6A 3AE3A 4DUZT 2JRKA 2VK9A 3P7IA 3FBZA 4H9RC 5AQUB 3I9WA 2X0LB 3EI0A 3OVUA 5CA0E 1I94T 3GN5B 2ZM6T 2XAHB 4PJMA 4HWDA 4BA9A 3KV6A 1Z8UA 4LFBT 2BS4A 4CXYA 4EZHA 5CJ5A 4F7GB 1HX1B 4I43B 5FXZA 1JNZA 2CWOA 3FB2A 2NTYA 2KBBA 1SA0E 4QXHB 4B6XA 4AQGA 2BG9E 3PUYF 5AFUL 3FBLA 3GA8A 2GK9A 1GQEA 2VKJA 2XM2A 5H6QB 3ZJ1A 4AQFC 5FL1A 3NRYA 3CX8B 2XAFB 4ILBA 5FL0A 3OTOT 2ODUA 5ABHA 1HNZT 1M62A 5F3JA 2VASA 4U33A 3R84B 3FZFB 3ZYKA 3UU5A 1FEWA 4IDNA 3ZC0A 4K0KT 3GWHA 3Q9DA 4TWFA 3ZKRA 5LYJE 2X51A 4MBQA 3WI3A 3N9LA 5HAXA 4U74A 3ZMTB 2X66A 4LF5T 3ZMVB 3ONLC 2LM9A 5M4YA 2JIWA 3AE7A 5HCMA 4GK5E 5AQKB 3ESLA 4UR9A 3S4UA 5AQHB 4M1PA 2HHHT 4JI8T 4U2ZA 3RQWA 3N5LA 3O4XE 4JLEA 3ZT6A 5LJNA 2X68A 2XHEB 1DU2A 5HEJA 2UXDT 4TV9E 4Z90A 5FXVA 5FXWA 3A7MA 3N9QA 3FXDB 4LMLA 3AY5A 3B13A 3B5MA 2VQFT 4TV8E 5F5WA 3C50A 4JV5T 4K0UA 5F8PA 2D9DA 4ZI3D 2VKDA 2HPLA 2W62A 3ZCIA 2NR4A 2DHRA 2Q9QC 4JBWF 2SPCA 2E9XA 1VRBA 4C91A 2RPAA 2LSGA 1U5PA 1MMGA 2C0SA 4PFPA 3ZPOA 4G2AA 1LRZA 5EK2A 2YDSA 3CQXC 1XWMA 4PK4A 2YEVC 2D5UA 3PV0F 3QK6A 4JI2T 2A72A 2ZM8A 3QB5K 5LBQB 4YSXA 1VCSA 2QVAA 3JC6D 4U72A 3EDVA 2XQ6A 4X20E 3RYHE 1HR0T 4B3MT 1NAFA 4LF4T 1YW0A 1MMAA 3EABA 3WAKA 3BK9A 2XQ5A 1WFDA 1YXRA 3AA6B 5HEOA 1XDOA 2H7VC 1HTJF 3CX7B 3PHF1 4CQIA 3SS1A 2A2FX 1QLBA 2F4VT 3AE8A 2AXDS 4HFHA 4YTNA 3GMIA 2BS2A 2QYWA 4HWFA 1N34T 3RIFA 4EOZB 5AQRB 4HE8A 4JI1T 5ABFA 3J9X1 1Y01A 3DYJA 3ETVA 2IIUA 2VVSA 3E22E 4H63V 3PDYA 4MFRA 1T72A 2E8IA 3D0TA 4YLHA 5LJMA 2MYSA 3I0OA 3CWZB 2WWVA 4TWHA 3TLWA 4UF0A 2XTLA 3CKDA 3ZLIA 5FKYA 4Z91A 4TUYE 3UULA 5ETWA 2VVNA 5LB7B 3HKCE 3RH3A 4DR7T 2KWHA 3OYZA 5EK4A 2XAGB 5J0ZA 3KVBA 4LMJA 3BQKA 4O8SA 3LBXA 3UUNA 1MNDA 2LOPA 4H9PC 2Y8DA 2V6YB 3P4SA 3IHRA 1KNZA 2DL1A 2WMNA 2L10A 4ASKA 5L3FB 5AQMB 1HNWT 2WU5A 4O4JE 5JDNA 4DNDA 3ZN0B 2J62A 2B76A 4X64T 4AQYT 4EV6A 3LG7A 2NW7A 2KZ7B 3UT5E 2XQ8A 3F57A 4CZZB 3WSCA 1HG5A 1WR0A 5LGUB 3A5XA 4JI3T 2X9XA 1BR1A 2H3RA 2BS3A 2C5IT 4LF7T 4GYRA 3RRWA 4BJNA 2DWKA 1YKEB 3LK42 4YTMA 4ZI3C 4I4TE 2BG9C 4ZOLE 3AE9A 5LBMA 1MMNA 3KFWX 2BVLA 2OA5A 4CI2B 3RIUC 1E7PA 4QX7B 2V6XA 2X0HA 1HG2A 4HKAA 3V5SA 4B3ST 2C5KT 2IMLA 2W0GA 4DMVA 1UURA 3UFEA 3IEEA 2BVMA 3AEEA 5CGMA 2IUBA 5LA6E 2MBGA 5HXEA 3FZHB 4DV3T 5FZTA 4YSYA 3JC6C 3IA3A 2N9DA 3ZN1B 3RX6A 2BG9B 2VL0A 3AEFA 4ECGA 2I59A 4IE4A 3UU8A 3RKGA 2V26A 4CI3B 4AKHA 4LMKA 3AAAB 2LSYA 3RLFF 4DV5T 4V1Av 3JAEA 2LJLA 4ISTA 2LKGA 4YXDA 2PG8A 4CN1A 3L3PA 4EIWA 5AQFB 4O2AE 1NWMX 5HYAA 4DBRA 3PU3A 1IZNB 4GYSA 5HWYA 4QXCB 1SUMB 2EHOB 4QXBB 2L3LA 2M6IA 5AQJB 3MKDA 4X1KE 3ANWA 3VHLA 5L4HA 2NP9A 2K9AA 1FIOA 3SWHA 4QH1A 5C2TA 3C64A 2L7NA 2CMRA 4AXPA 1M7KA 4E7ZA 3UQ4A 3EHZA 5JDFA 2XZEA 2NTXA 2XY8B 3U3IA 1J5WA 5HWXA 3KDSE 4IIJE 5BR8T 2LQUA 2E2AA 3ZT5A 3T1YT 3AT7A 3PUWF 1G73A 4QKNA 3VR9A 2WAUA 1SHZC 3ONJA 4EYUA 2M67A 5CB4E 4JEHB 1V9DA 1OEDA 4UVAB 1D1CA 4IHJE 4U2YA 2C5JA 4O4HE 2CLYC 5CA1E 1YQ4A 3KV9A 5JVDE 4DV4T 5L2LA 5HEHA 5FMNA 2G0UA 3ZCJA 4HWHA 3P4QA 3UFGA 2CHOA 2E9XD 3M3ZB 5FY1A 4ZHQE 5HEGA 1QUUA 3SFEA 3LSVA 2IW5B 4LFCT 3NVOA 2WCAA 3NWIA 2VURA 4XBFB 5LCYA 5AQLB 2V5DA 1BR2A 1UCUA 3FZLB 4ZZCA 3MXZA 3NZQA 4PK5A 2ZMAA 3L39A 1XZYA 4BGOA 2CLYB 1KNPA 2YK0A 4ZXLA 3MK7C 3IF8B 1HX8A 2J4GA 2XJ7A 5LG3A 3RYCE 4YJ2E 4HFVA 3HI2A 5CFBA 3PJAJ 4LF9T 4IGUA 2WM9A 4H63H 4ILUA 4ERRA 3H3AA 4QWNB 4DVDA 4OYKA 3CK6A 3AECA 2K3WA 4ZS3A 3O9XA 1S35A 3ZSTA 3KBTA 1D1BA 2H7OA 4WZXA 3T1HT 3ZMSB 2Y6XA 4IDQA 4ISSA 3UU4A 2LRLA 2LE8A 4AKGA 2N1GA 1CUNA 2OV9A 3RYIE 3UUMA 4EGWA 3KBUA 1UGOA 3RF1A 1SJ7A 2CXLA 5AQGB 3TLVA 3FZKB 1T7SA 3RRCA 1VOMA 4AI6A 2X0CA 4UVCB 2BDEA 3M1CA 3AE6A 2JPFA 4P1NA 2CA5A 1ZP0A 4EZ4A 5KDMC 1MIWA 4A5XA 2WZHA 4TNVA 2WP9A 2XSBA 4OYJA 4TZ4C 4PNIA 4AKRB 1MIVA 2X9WA 2J47A 4AISA 1W0AA 2UXCT 2JMHA 2W2UA 2WMOA 4JUYA 4DUYT 4ADZA 2V7LA 1N36T 2CPTA 1IJ6A 3J7Yq 3W15B 2UU9T 1B7TA 4H9OC 4QHOA 1XMQT 3B57A 4HFIA 3CX6B 4N78D 5AQIB 2DWGA 4HN9A 4IL9A 4FI5A 2KNDA 3MZKB 2H88A 4YHHT 2UXBT 2B1EA 5IYZE 1IBLT 5C3JA 4DR4T 2V6YA 4NUUA 2V7KA 3IBPA 5L3BB 2Q9QB 3BQLA 4UELA 2UUAT 1S94A 5ABGA 5J2UE 3N9OA 4FJOA 1BR4A 2XQAA 2D2SA 1SE7A 2E9XC 4GIWA 5KXJA 2NW8A 2ODVA 3VR8A 3JAFA 4TWDA 3PUVF 1UX4A 4CN6A 3CMLA 1XNRT 5FY0A 5HXCA 4DR3T 4KHPT 5JTGA 4WBNE 3AEAA 2Z6EA 2YN6A 3SOLA 4MHCA 2XAQB 1H7CA 3O1IA 2WU2A 3AAIA 5L4EA 2FBWA 4PW8A 2XSAA 3Q2MA 3ABVA 4CXXA 3DTOA 4BAYB 3PUGA 2YINA 2NWBA 2YKSA 4WW0A 3AAEB 2Y48B 4CI1B 4YSZA 2WY2A 3AE5A 4F6RC 3QNUA 5HEUA 2W66A 4ZZBA 4ZI2D 5BMVE 1X9BA 2FJEA 4ZEYA 1OEDE 2KGXA 2XQ3A 4C90A 4DV6T 4DV1T 4KBMB 2JQQA 3SFDA 3C4ZA 3L09A 4GKKT 3K8PC 3LJCA 4IDPA 2BG9A 1ZHCA 1U4QA 3MJXA 3AA0B 5JR9C 3FXEB 2WZIA 2WBLA 1HFAA 1BR0A 5JQGE 1LKXA 2UUBT 5L47A 2M6BA 5L3GB 4W8PA 1FMVA 3SRZA 3C4WA 2LHNA 4A56A 4AIUA 5AQVB 2X9HA 4H9NC 4OX9T 3ZSSA 2CCQA 5FXXA 1J5ET 3C4XA 4JI4T 2YU1A 2R6GF 2MPKA 1YQ3A 2EHOA 3X1DA 3OJAA 3UU3A 3I0QA 4P0AA 5JDLA 5JR9B 2LRKA 3PUSA 3L8RA 5LGTB 3OPCA 2BZBA 3C98B 2JQHA 4OHFA 4O2BE 4EEDA 5JRCA 3LK3B 2MOZA 5LHHB 4IT4A 4UF0B 3UTKA 4IE6A 3Q5DA 3BQIA 2LSKA 4X1IE 4WBOA 3DJBA 3PUAA 4DO0A 5AQPB 5FY7A 3VRBA 1VCTA 2DCFA 2MAWA 3WAJA 2PBIA 4EEBA 2K5BB 2VWAA 1IJ5A 2VL8A 1XDPA 3NZPA 2P9BA 3LBXB 4PJNA 3FYQA 4PJLA 2UXNB 5AQOB 4UV9B 3ZC1A 1LVKA 4UEMA 3PUXF 5L3CB 2CXFA 3AE4A 3R6NA 3GN5A 4IDOA 2ES0A 2LKHA 4O4IE 2CHNA 2KINB 4QX8B 5HXRA 4XZCA 4TX5A 4L9IA 5KX5E 2XASB 4DV7T 5T1DA 1D0YA 3FHNA 3UUBA 4YHJA 4EYYR 4YJ3E 4UV8B 4ZS2A 3VRAA 2H89A 5LP6E 1WLXA 5HCJA 4ZI2C 5LHIB 3P4RA 2N2NA 2WB5A 3AXJB 4UXNB 5LMUT 2HN2A 2CWYA 2KVPA 3ZMZB 3K1SA 2ZM0A 4G63A 3P4PA 3QOFA 2I6HA 2ACZA 3LK2B 4X66T 2FJBA 3RYFE 4IE0A 2VB6A 3RC3A 3C51A 2I0MA 2V1DB 5ADXL 5LNKA 2CE7A 4F8HA 2LHRA 2CXDA 3NRXA 1HCIA 4JI7T 2LOSA 1WYCA 3DP7A 2V8SV 3AE1A 3TLUA 4AQFA 4GKJT 2W61A 1AJ3A 2X9YA 2CEAA 1KNRA 2OLTA 5TAOA 4KMCA 2IHR1 3P4WA 3VU7H 2KMFA 3AVRA 3K3OA 2LM2A 3CQGB 2KSRA 4DR1T 3VKHA 4WNKA 5AQNB 1X79A 3EVYA 2V7IA 3O1HA 2MTCA
chains in the Genus database with same CATH topology
3ZEFB 4GOUA 3LFMA 2KWIB 1IJ6A 3J7Yq 3BQKA 4O8SA 2DI4A 3H37A 2HH7A 3HR0A 3LBXA 2LEHA 3AVSA 3W15B 3ZYMA 3ZYLA 3TKLB 1B7TA 3UUNA 5J1GA 1MNDA 2LOPA 4H9PC 4H9OC 4QHOA 4AKIA 2Y8DA 3B57A 3N2KE 3AA7B 3IHRA 5LXTE 3CX6B 2L9QA 1KNZA 4N78D 2MTQA 2DWGA 2WMNA 4ASKA 5L3FB 4HN9A 2LSJA 3PF0A 3PTRB 4O4JE 5JDNA 4FI5A 2KNDA 4DNDA 3ZN0B 5C8YE 3KV4A 2K24A 3MZKB 3N2OA 4IE5A 1WYBA 3ANWB 2B1EA 5IYZE 1KK7A 2XAJB 3PURA 3LG7A 2NW7A 2KZ7B 4O4LE 3UT5E 3MACA 2W00A 3F57A 4CZZB 3WSCA 3KVAA 1HG5A 5LGUB 3A5XA 4NUUA 2V7KA 3IBPA 3I1AA 5L3BB 1MMDA 2Q9QB 2X9XA 3HKBE 1BR1A 3BQLA 2H3RA 1YKHB 4UELA 3EUHA 2IC6A 2C5IT 3CQCB 5DABA 1S94A 4E7SA 4GYRA 5J2UE 3RRWA 3N9OA 4FJOA 1BR4A 2DWKA 4BJNA 1YKEB 3LK42 2VKHA 2JMKA 2D2SA 4PK6A 3QUJA 4ZI3C 4I4TE 1UX5A 2E9XC 5EZYE 4GIWA 4NUVA 2Q9QD 3NBXX 5JDMA 4ZOLE 5LBMA 2KXPB 2NW8A 5JDGA 1MMNA 3KFWX 2ODVA 5EK3A 3UUXB 2BVLA 2OA5A 4CI2B 3KV5A 5JH7E 2Q9QA 3PE0A 2CM0A 4QX7B 2HPJA 5JRCB 1UX4A 3ZMUB 1ZEEA 3CMLA 4ONRA 1HG2A 5FY0A 3CPZA 4HKAA 5HXCA 1E1HB 1Z0PA 4JEUB 3ZJ2A 3V5SA 4WBNE 2C5KT 2Z6EA 1FMWA 2W0GA 4YFSA 3SOLA 4DMVA 3UFEA 4MHCA 2XAQB 1H7CA 3AA1B 3AB3B 2BVMA 3IEEA 3O1IA 3AAIA 2W63A 4PW8A 3P8CD 3Q2MA 5GONE 3OBVE 5A1LA 4CXXA 3DTOA 5LA6E 5L3EB 3HKDE 4BAYB 3PUGA 5KMGP 2YINA 2MBGA 5HXHA 5HXEA 2NWBA 1LVFA 4DMWA 3N2GE 4WW0A 4P09A 2K48A 3AAEB 4H9QC 2Y48B 2D0TA 4CI1B 3E0ZA 3JC6C 3Q5WA 3QC9A 5LHGB 4F6RC 3OKQA 4EB6E 3N9NA 4CXWA 3PUQA 2N9DA 1WRDA 2WWUA 4ZI2D 3ZN1B 3WURA 5BMVE 3RX6A 5JDHA 4L0RA 1WR6A 2JRKA 1Y64B 2KLQA 2VK9A 3M65A 3FBZA 3P7IA 4H9RC 2I59A 4ECGA 4IE4A 2V26A 5H6RB 4CI3B 3I9WA 4C90A 4AKHA 3F2EA 2X0LB 3AAAB 4KBMB 4MLKA 5CA0E 2JQQA 3C4ZA 3L09A 1D0XA 3GN5B 3K8PC 3LJCA 2XAHB 2LSYA 4PJMA 4BA9A 3KV6A 4V1Av 2LJLA 4ISTA 3RC8A 4ZI7E 4CXYA 4EZHA 2PG8A 1US7B 1ZHCA 1U4QA 3PU8A 4I43B 4ANJA 5FXZA 3MJXA 3AA0B 3ONXA 4J2CA 5JR9C 3FXEB 2CWOA 2WBLA 3FB2A 3L3PA 3OYXA 1HFAA 2ZM2A 4EIWA 2NTYA 1OWAA 5FYMA 1BR0A 5JQGE 1LKXA 4O2AE 1SA0E 4QXHB 4B6XA 4AQGA 1NWMX 5L3GB 5IHYA 5HYAA 5DJQC 5AFUL 5DQVA 4DBRA 1FMVA 3FBLA 3GA8A 2GK9A 3C4WA 3SRZA 2LHNA 1HF8A 4A56A 4GK0E 3PU3A 1IZNB 2WSSV 4GYSA 1O3XA 2VKJA 5H6QB 3ZJ1A 4AQFC 3NRYA 5HWYA 5FNVE 4QXCB 3CX8B 2XAFB 2X9HA 2ODUA 2PFVA 4H9NC 2EHOB 2QA7A 5EK4A 4QXBB 2L3LA 5F3JA 3MKDA 4X1KE 3RPUA 2VASA 3ANWA 3R84B 2ZLYA 3VHLA 3ZYKA 2CCQA 2NP9A 5FXXA 2K9AA 1FIOA 3SWHA 3C64A 4I55E 1FEWA 3ZC0A 2RA1A 3GWHA 5LG4A 2CMRA 3Q9DA 2EHOD 3C4XA 4EXTA 3N9MA 5LYJE 4AXPA 5JREA 4E7ZA 2YU1A 2X51A 2NOXA 2NTXA 4MBQA 2EHOA 5JDFA 3WI3A 3N9LA 5HAXA 3U3IA 3VJZA 2NW9A 3KINB 4U74A 5HWXA 1OXZA 2D0UA 3OJAA 5L3DB 3KDSE 4IIJE 3I0QA 4PAGA 3ZMTB 4P0AA 2X66A 5JDLA 5JR9B 3ZMVB 2LM9A 5JDQA 2LQUA 5M4YA 2DLRA 3PUSA 4GK5E 4HTEA 5LGTB 5LGNB 3AT7A 1G73A 2BZBA 4QKNA 3C98B 3ESLA 2RP4A 4OHFA 4O2BE 3S4UA 3Q5XA 5JRCA 4M1PA 3LK3B 4I50E 2WAUA 3O1JA 1SHZC 4EYUA 2M67A 5CB4E 3N5LA 3ETUA 2MOZA 3O4XE 5LHHB 4JEHB 4JLEA 1V9DA 5LJNA 2X68A 2XHEB 5JR9A 1EZ3A 2L8KA 4UVAB 4UF0B 1D1CA 2VKOA 3UTKA 4IHJE 4IE6A 2C5JA 3BQIA 4TV9E 5FXVA 4O4HE 2LSKA 2CLYC 5FXWA 5CA1E 4X1IE 4WBOA 3DJBA 2E9XB 3N9QA 3KV9A 3PUAA 3FXDB 5JVDE 2QGSA 4DO0A 1ZV4X 4P0BA 5L2LA 5FMNA 5FY7A 3B13A 2G0UA 2YU2A 2DCFA 3MA9A 3ZCJA 3WAJA 2PBIA 2X67A 4TV8E 3C50A 4UVBB 4X1YE 4K0UA 2K5BB 5F8PA 2VWAA 2UXXB 1IJ5A 4ZI3D 2VKDA 2E9XD 2VL8A 1MNEA 2HPLA 3HA4A 5FY1A 4ZHQE 1QUUA 2W62A 3NZPA 3ZCIA 4PJJA 2P9BA 3LBXB 4PJNA 4PJLA 2DHRA 2Q9QC 2SPCA 2UXNB 2IW5B 2E9XA 1VRBA 2V7JA 4C91A 4UV9B 3K3NA 3ZC1A 1LVKA 2LSGA 4UEMA 1U5PA 4DBQA 1MMGA 1YD8G 2LT3A 2C0SA 5L3CB 2CXFA 4PFPA 3ZPOA 4TN7B 4G2AA 4XBFB 1LRZA 4OFZA 4XAXB 5LCYA 3R6NA 4Z8XA 5EK2A 3GN5A 1BR2A 3EDUA 2ES0A 3CQXC 1UCUA 4O4IE 4PK4A 1MIYA 2YEVC 3MXZA 3NZQA 2D5UA 2KINB 1D1AA 3QK6A 4QX8B 4PK5A 2ZMAA 4BGOA 4OK0A 2A72A 5HXRA 2CLYB 2ZM8A 4XZCA 4TX5A 5LBQB 2YK0A 4L9IA 5KX5E 2XASB 5DQWA 2V7MA 3MK7C 3E08A 3IF8B 1HX8A 4HEAA 5T1DA 3RYCE 2PJQA 1D0YA 3JC6D 4U72A 4YJ2E 4HFVA 3FHNA 4AKLA 3EDVA 4YHJA 4YJ3E 4EYYR 2JJ9A 3HI2A 4UV8B 4X20E 3RYHE 1NAFA 2LSIA 4ZS2A 5LP6E 1WLXA 1YW0A 1MMAA 3V5UA 4IGUA 3WAKA 4ZI2C 3BK9A 4EAHA 5LHIB 2WM9A 4H63H 2N2NA 4ILUA 3AA6B 4ERRA 3H3AA 2H7VC 4QWNB 4UXNB 4DVDA 1HTJF 3CX7B 4OYKA 3PHF1 4ZS3A 4CQIA 5HXSA 1QSDA 3SS1A 3O9XA 2A2FX 1S35A 2CWYA 3ZMZB 3KBTA 2J1DG 1D1BA 2ZM0A 1HS7A 4G63A 2H7OA 1IAPA 3VKGA 2XQYA 3ZMSB 4KP3C 3LK2B 5E0OA 2Y6XA 3RYFE 4IE0A 3GMIA 4ISSA 2IC9A 4PFOA 2VB6A 4IE7A 3RC3A 3C51A 2LE8A 2IAKA 4AKGA 2V1DB 3CVRA 1D0ZA 5ADXL 2N1GA 5LNKA 1CUNA 3N9PA 1G8XA 3RYIE 1ZKEA 4HGAA 4EOZB 4H9SE 2XUEA 3I9YA 3UUMA 5J2TE 3KBUA 4MALA 4HE8A 3HKEE 2CXLA 4L5GA 3J9X1 2CE7A 3RRCA 3K3QC 2KT9A 1VOMA 4BJMA 2LHRA 4AI6A 2CXDA 3ETVA 3NRXA 1HCIA 3E22E 2BDEA 4UVCB 3HL6A 2JPFA 4H63V 3M1CA 2LOSA 3PDYA 1WYCA 2CA5A 3DP7A 3RKOA 4MFRA 4UIGA 4EZ4A 5KDMC 2E8IA 3D0TA 4YLHA 1MIWA 3F31A 5LJMA 4AQFA 2W61A 2MYSA 1AJ3A 2X9YA 2CEAA 3I0OA 3CWZB 4OYJA 4TZ4C 4UF0A 5TAOA 2XTLA 4PNIA 4AKRB 1T98A 4KMCA 3CKDA 1MIVA 2X9WA 3T8OA 3ZLIA 3VU7H 5LOVE 2KMFA 4TUYE 3AVRA 4KUMB 3UULA 3K3OA 2ACXA 2EHOC 5ETWA 3U78A 5FP3A 3HKCE 3RH3A 2JMHA 2WMOA 3CQGB 4JUYA 3VKHA 4IDZA 4WNKA 4ADZA 1X79A 3EVYA 2KWHA 3OYZA 2V7IA 2A3DA 2DNXA 2V7LA 3O1HA 2MTCA 2XAGB 3KVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDN A;  5JDL A;  5HYA A;  5HXS A;  5HXR A;  5JDG A;  5HXC A;  5HWX A;  5HWY A;  3V5U A;  5HXH A;  5HXE A;  5JDQ A;  5JDM A;  5JDH A;  5JDF A;  3V5S A; 
#chains in the Genus database with same CATH topology
 3ZEF B;  4GOU A;  2XPK A;  2KWI B;  4HFE A;  2DI4 A;  3AE2 A;  2W67 A;  2LEH A;  3AVS A;  3ZYM A;  4HFB A;  3TKL B;  2FUP A;  1W09 A;  5J1G A;  3AA7 B;  4B3T T;  2MTQ A;  3PF0 A;  3PTR B;  1OED C;  5C8Y E;  3KV4 A;  2K24 A;  4IE5 A;  4YY3 T;  3ANW B;  3PUR A;  2XAJ B;  2W00 A;  4HFC A;  3TLS A;  4CN4 A;  2XQ9 A;  2CRB A;  2CBJ A;  1N32 T;  3I1A A;  5AQQ B;  4QH4 A;  5DAB A;  4ILA A;  2VKH A;  4X5T A;  5AQS B;  4NUV A;  4YT0 A;  4U31 A;  4KI0 F;  2V5C A;  5JDG A;  3AED A;  5EK3 A;  3KV5 A;  2Q9Q A;  4QH5 A;  2CM0 A;  2HPJ A;  1ZEE A;  2BKO A;  3PJA A;  4NXM T;  3CPZ A;  4JYA T;  4A97 A;  1Z0P A;  4JEU B;  3ZJ2 A;  1OED B;  1FMW A;  1UUS A;  5FVL A;  2W63 A;  2X0Y A;  3OBV E;  1IBK T;  1IBM T;  3JCF A;  5HXH A;  1LVF A;  3N2G E;  1L0V A;  2K48 A;  2D0T A;  2AE9 A;  4NXN T;  3Q5W A;  5LHG B;  4EB6 E;  3N9N A;  4LF8 T;  3PUQ A;  1NEK A;  2WWU A;  3WUR A;  5JDH A;  4LFA T;  2E5L T;  4KHZ F;  1Y64 B;  2KLQ A;  3M65 A;  4HFD A;  5H6R B;  3F2E A;  4MLK A;  2JQK A;  2JQ9 A;  1D0X A;  4IL4 A;  1KEY A;  3RC8 A;  4ZI7 E;  1US7 B;  3PU8 A;  4NPP A;  4ANJ A;  4ILC A;  4DV2 T;  3ONX A;  4J2C A;  3OYX A;  2ZM2 A;  1OWA A;  5FYM A;  4COF A;  5IHY A;  5DJQ C;  5DQV A;  1HF8 A;  4GK0 E;  2WSS V;  1O3X A;  5FNV E;  3H3M A;  2WQY A;  2PFV A;  2QA7 A;  2CBI A;  3RPU A;  2ZLY A;  3RGL A;  4I55 E;  2RA1 A;  3ZT7 A;  5LG4 A;  2EHO D;  2HN1 A;  4EXT A;  3N9M A;  1FJG T;  5JRE A;  2NOX A;  4I0U A;  3VJZ A;  2NW9 A;  3KIN B;  4A98 A;  3AEG A;  1OXZ A;  2D0U A;  5L3D B;  4JI5 T;  4PAG A;  2VQE T;  4DV0 T;  5JDQ A;  2DLR A;  4U7Y A;  4HTE A;  5LGN B;  2RP4 A;  3Q5X A;  4I50 E;  3O1J A;  3ETU A;  5JR9 A;  1EZ3 A;  3A8Y C;  2L8K A;  2VKO A;  2QRX A;  3EAM A;  4NIQ A;  2E9X B;  2QGS A;  1ZV4 X;  4P0B A;  1KF6 A;  2YU2 A;  3MA9 A;  5ABE A;  2X67 A;  4UVB B;  4X1Y E;  2UXX B;  1WCR A;  1MNE A;  3HA4 A;  2FJA A;  4PJJ A;  2V7J A;  3Q5E A;  3K3N A;  1T8B A;  1ZOY A;  4DBQ A;  1YD8 G;  2LT3 A;  3RIU A;  4LF6 T;  3CIR A;  4TN7 B;  1J1J A;  4OFZ A;  1E2A A;  4XAX B;  4Z8X A;  2XQ4 A;  4X62 T;  3EDU A;  2BBJ A;  1MIY A;  2XQ7 A;  1D1A A;  2XM1 A;  4OK0 A;  3NKZ A;  5DQW A;  2V7M A;  3E08 A;  4HEA A;  3RI5 A;  1JNR A;  2PJQ A;  4DR2 T;  4AKL A;  4U7I A;  1W9R A;  2JJ9 A;  3TLT A;  2LSI A;  5AQT B;  3V5U A;  2BBH A;  4EAH A;  1XMO T;  4IRE A;  5FVK A;  5HXS A;  1QSD A;  4X65 T;  3RQU A;  3FZM B;  2J1D G;  1HS7 A;  5ABF B;  1IAP A;  3VKG A;  2XQY A;  3RHW A;  4KP3 C;  2BKP A;  3AEB A;  5E0O A;  4JI6 T;  2IC9 A;  4PFO A;  4IE7 A;  2UUC T;  3RIA A;  2IAK A;  3CVR A;  1D0Z A;  3AXJ A;  1SJ8 A;  2WDQ A;  3N9P A;  1G8X A;  4Q25 A;  1ZKE A;  4HGA A;  4H9S E;  2XUE A;  3I9Y A;  5J2T E;  3QB5 A;  4TNW A;  4MAL A;  3HKE E;  4L5G A;  3K3Q C;  5IUX A;  2KT9 A;  4BJM A;  1XNQ T;  3HL6 A;  3RKO A;  4UIG A;  1R8I A;  3F31 A;  3UU6 A;  2IDO B;  1NEN A;  1T98 A;  2BKN A;  3T8O A;  1UK5 A;  5LOV E;  2YDQ A;  4KUM B;  2ACX A;  2EHO C;  3U78 A;  5FP3 A;  1I6Z A;  4IDZ A;  1HNX T;  2A3D A;  3G06 A;  2DNX A;  2YOE A;  3LFM A;  3H37 A;  2HH7 A;  3HR0 A;  3ZYL A;  4JI0 T;  3PUZ F;  4DR5 T;  4AKI A;  5LXT E;  3N2K E;  2L9Q A;  2LSJ A;  2WDV A;  3N2O A;  1KFY A;  1WYB A;  1KK7 A;  3LDQ B;  4O4L E;  3MAC A;  3KVA A;  5IWA T;  1MMD A;  2LLY A;  3HKB E;  4WYV A;  1YKH B;  4HWC A;  3EUH A;  4YTP A;  2IC6 A;  3CQC B;  4E7S A;  4PK6 A;  2JMK A;  3QUJ A;  1UX5 A;  5EZY E;  2Q9Q D;  3NBX X;  2FJD A;  5JDM A;  2KXP B;  3UUX B;  4DR6 T;  2YDR A;  3UQ7 A;  5JH7 E;  2WDR A;  3PE0 A;  5JRC B;  3ZMU B;  4ONR A;  3JAD A;  5LMN T;  1E1H B;  3P50 A;  4YFS A;  4HWI B;  3AA1 B;  3AB3 B;  4B3R T;  2W4X A;  3P8C D;  2WS3 A;  5GON E;  5A1L A;  5L3E B;  3HKD E;  5KMG P;  1CHU A;  4DMW A;  4KX6 A;  4U3C A;  4P09 A;  4H9Q C;  1N33 T;  4DID B;  3E0Z A;  3QC9 A;  3OKQ A;  2A9U A;  2E5V A;  4CXW A;  1WRD A;  2PTF A;  1W0B A;  4L0R A;  1WR6 A;  3AE3 A;  4DUZ T;  2JRK A;  2VK9 A;  3P7I A;  3FBZ A;  4H9R C;  5AQU B;  3I9W A;  2X0L B;  3EI0 A;  3OVU A;  5CA0 E;  1I94 T;  3GN5 B;  2ZM6 T;  2XAH B;  4PJM A;  4HWD A;  4BA9 A;  3KV6 A;  1Z8U A;  4LFB T;  2BS4 A;  4CXY A;  4EZH A;  5CJ5 A;  4F7G B;  1HX1 B;  4I43 B;  5FXZ A;  1JNZ A;  2CWO A;  3FB2 A;  2NTY A;  2KBB A;  1SA0 E;  4QXH B;  4B6X A;  4AQG A;  2BG9 E;  3PUY F;  5AFU L;  3FBL A;  3GA8 A;  2GK9 A;  1GQE A;  2VKJ A;  2XM2 A;  5H6Q B;  3ZJ1 A;  4AQF C;  5FL1 A;  3NRY A;  3CX8 B;  2XAF B;  4ILB A;  5FL0 A;  3OTO T;  2ODU A;  5ABH A;  1HNZ T;  1M62 A;  5F3J A;  2VAS A;  4U33 A;  3R84 B;  3FZF B;  3ZYK A;  3UU5 A;  1FEW A;  4IDN A;  3ZC0 A;  4K0K T;  3GWH A;  3Q9D A;  4TWF A;  3ZKR A;  5LYJ E;  2X51 A;  4MBQ A;  3WI3 A;  3N9L A;  5HAX A;  4U74 A;  3ZMT B;  2X66 A;  4LF5 T;  3ZMV B;  3ONL C;  2LM9 A;  5M4Y A;  2JIW A;  3AE7 A;  5HCM A;  4GK5 E;  5AQK B;  3ESL A;  4UR9 A;  3S4U A;  5AQH B;  4M1P A;  2HHH T;  4JI8 T;  4U2Z A;  3RQW A;  3N5L A;  3O4X E;  4JLE A;  3ZT6 A;  5LJN A;  2X68 A;  2XHE B;  1DU2 A;  5HEJ A;  2UXD T;  4TV9 E;  4Z90 A;  5FXV A;  5FXW A;  3A7M A;  3N9Q A;  3FXD B;  4LML A;  3AY5 A;  3B13 A;  3B5M A;  2VQF T;  4TV8 E;  5F5W A;  3C50 A;  4JV5 T;  4K0U A;  5F8P A;  2D9D A;  4ZI3 D;  2VKD A;  2HPL A;  2W62 A;  3ZCI A;  2NR4 A;  2DHR A;  2Q9Q C;  4JBW F;  2SPC A;  2E9X A;  1VRB A;  4C91 A;  2RPA A;  2LSG A;  1U5P A;  1MMG A;  2C0S A;  4PFP A;  3ZPO A;  4G2A A;  1LRZ A;  5EK2 A;  2YDS A;  3CQX C;  1XWM A;  4PK4 A;  2YEV C;  2D5U A;  3PV0 F;  3QK6 A;  4JI2 T;  2A72 A;  2ZM8 A;  3QB5 K;  5LBQ B;  4YSX A;  1VCS A;  2QVA A;  3JC6 D;  4U72 A;  3EDV A;  2XQ6 A;  4X20 E;  3RYH E;  1HR0 T;  4B3M T;  1NAF A;  4LF4 T;  1YW0 A;  1MMA A;  3EAB A;  3WAK A;  3BK9 A;  2XQ5 A;  1WFD A;  1YXR A;  3AA6 B;  5HEO A;  1XDO A;  2H7V C;  1HTJ F;  3CX7 B;  3PHF 1;  4CQI A;  3SS1 A;  2A2F X;  1QLB A;  2F4V T;  3AE8 A;  2AXD S;  4HFH A;  4YTN A;  3GMI A;  2BS2 A;  2QYW A;  4HWF A;  1N34 T;  3RIF A;  4EOZ B;  5AQR B;  4HE8 A;  4JI1 T;  5ABF A;  3J9X 1;  1Y01 A;  3DYJ A;  3ETV A;  2IIU A;  2VVS A;  3E22 E;  4H63 V;  3PDY A;  4MFR A;  1T72 A;  2E8I A;  3D0T A;  4YLH A;  5LJM A;  2MYS A;  3I0O A;  3CWZ B;  2WWV A;  4TWH A;  3TLW A;  4UF0 A;  2XTL A;  3CKD A;  3ZLI A;  5FKY A;  4Z91 A;  4TUY E;  3UUL A;  5ETW A;  2VVN A;  5LB7 B;  3HKC E;  3RH3 A;  4DR7 T;  2KWH A;  3OYZ A;  5EK4 A;  2XAG B;  5J0Z A;  3KVB A;  4LMJ A;  3BQK A;  4O8S A;  3LBX A;  3UUN A;  1MND A;  2LOP A;  4H9P C;  2Y8D A;  2V6Y B;  3P4S A;  3IHR A;  1KNZ A;  2DL1 A;  2WMN A;  2L10 A;  4ASK A;  5L3F B;  5AQM B;  1HNW T;  2WU5 A;  4O4J E;  5JDN A;  4DND A;  3ZN0 B;  2J62 A;  2B76 A;  4X64 T;  4AQY T;  4EV6 A;  3LG7 A;  2NW7 A;  2KZ7 B;  3UT5 E;  2XQ8 A;  3F57 A;  4CZZ B;  3WSC A;  1HG5 A;  1WR0 A;  5LGU B;  3A5X A;  4JI3 T;  2X9X A;  1BR1 A;  2H3R A;  2BS3 A;  2C5I T;  4LF7 T;  4GYR A;  3RRW A;  4BJN A;  2DWK A;  1YKE B;  3LK4 2;  4YTM A;  4ZI3 C;  4I4T E;  2BG9 C;  4ZOL E;  3AE9 A;  5LBM A;  1MMN A;  3KFW X;  2BVL A;  2OA5 A;  4CI2 B;  3RIU C;  1E7P A;  4QX7 B;  2V6X A;  2X0H A;  1HG2 A;  4HKA A;  3V5S A;  4B3S T;  2C5K T;  2IML A;  2W0G A;  4DMV A;  1UUR A;  3UFE A;  3IEE A;  2BVM A;  3AEE A;  5CGM A;  2IUB A;  5LA6 E;  2MBG A;  5HXE A;  3FZH B;  4DV3 T;  5FZT A;  4YSY A;  3JC6 C;  3IA3 A;  2N9D A;  3ZN1 B;  3RX6 A;  2BG9 B;  2VL0 A;  3AEF A;  4ECG A;  2I59 A;  4IE4 A;  3UU8 A;  3RKG A;  2V26 A;  4CI3 B;  4AKH A;  4LMK A;  3AAA B;  2LSY A;  3RLF F;  4DV5 T;  4V1A v;  3JAE A;  2LJL A;  4IST A;  2LKG A;  4YXD A;  2PG8 A;  4CN1 A;  3L3P A;  4EIW A;  5AQF B;  4O2A E;  1NWM X;  5HYA A;  4DBR A;  3PU3 A;  1IZN B;  4GYS A;  5HWY A;  4QXC B;  1SUM B;  2EHO B;  4QXB B;  2L3L A;  2M6I A;  5AQJ B;  3MKD A;  4X1K E;  3ANW A;  3VHL A;  5L4H A;  2NP9 A;  2K9A A;  1FIO A;  3SWH A;  4QH1 A;  5C2T A;  3C64 A;  2L7N A;  2CMR A;  4AXP A;  1M7K A;  4E7Z A;  3UQ4 A;  3EHZ A;  5JDF A;  2XZE A;  2NTX A;  2XY8 B;  3U3I A;  1J5W A;  5HWX A;  3KDS E;  4IIJ E;  5BR8 T;  2LQU A;  2E2A A;  3ZT5 A;  3T1Y T;  3AT7 A;  3PUW F;  1G73 A;  4QKN A;  3VR9 A;  2WAU A;  1SHZ C;  3ONJ A;  4EYU A;  2M67 A;  5CB4 E;  4JEH B;  1V9D A;  1OED A;  4UVA B;  1D1C A;  4IHJ E;  4U2Y A;  2C5J A;  4O4H E;  2CLY C;  5CA1 E;  1YQ4 A;  3KV9 A;  5JVD E;  4DV4 T;  5L2L A;  5HEH A;  5FMN A;  2G0U A;  3ZCJ A;  4HWH A;  3P4Q A;  3UFG A;  2CHO A;  2E9X D;  3M3Z B;  5FY1 A;  4ZHQ E;  5HEG A;  1QUU A;  3SFE A;  3LSV A;  2IW5 B;  4LFC T;  3NVO A;  2WCA A;  3NWI A;  2VUR A;  4XBF B;  5LCY A;  5AQL B;  2V5D A;  1BR2 A;  1UCU A;  3FZL B;  4ZZC A;  3MXZ A;  3NZQ A;  4PK5 A;  2ZMA A;  3L39 A;  1XZY A;  4BGO A;  2CLY B;  1KNP A;  2YK0 A;  4ZXL A;  3MK7 C;  3IF8 B;  1HX8 A;  2J4G A;  2XJ7 A;  5LG3 A;  3RYC E;  4YJ2 E;  4HFV A;  3HI2 A;  5CFB A;  3PJA J;  4LF9 T;  4IGU A;  2WM9 A;  4H63 H;  4ILU A;  4ERR A;  3H3A A;  4QWN B;  4DVD A;  4OYK A;  3CK6 A;  3AEC A;  2K3W A;  4ZS3 A;  3O9X A;  1S35 A;  3ZST A;  3KBT A;  1D1B A;  2H7O A;  4WZX A;  3T1H T;  3ZMS B;  2Y6X A;  4IDQ A;  4ISS A;  3UU4 A;  2LRL A;  2LE8 A;  4AKG A;  2N1G A;  1CUN A;  2OV9 A;  3RYI E;  3UUM A;  4EGW A;  3KBU A;  1UGO A;  3RF1 A;  1SJ7 A;  2CXL A;  5AQG B;  3TLV A;  3FZK B;  1T7S A;  3RRC A;  1VOM A;  4AI6 A;  2X0C A;  4UVC B;  2BDE A;  3M1C A;  3AE6 A;  2JPF A;  4P1N A;  2CA5 A;  1ZP0 A;  4EZ4 A;  5KDM C;  1MIW A;  4A5X A;  2WZH A;  4TNV A;  2WP9 A;  2XSB A;  4OYJ A;  4TZ4 C;  4PNI A;  4AKR B;  1MIV A;  2X9W A;  2J47 A;  4AIS A;  1W0A A;  2UXC T;  2JMH A;  2W2U A;  2WMO A;  4JUY A;  4DUY T;  4ADZ A;  2V7L A;  1N36 T;  2CPT A;  1IJ6 A;  3J7Y q;  3W15 B;  2UU9 T;  1B7T A;  4H9O C;  4QHO A;  1XMQ T;  3B57 A;  4HFI A;  3CX6 B;  4N78 D;  5AQI B;  2DWG A;  4HN9 A;  4IL9 A;  4FI5 A;  2KND A;  3MZK B;  2H88 A;  4YHH T;  2UXB T;  2B1E A;  5IYZ E;  1IBL T;  5C3J A;  4DR4 T;  2V6Y A;  4NUU A;  2V7K A;  3IBP A;  5L3B B;  2Q9Q B;  3BQL A;  4UEL A;  2UUA T;  1S94 A;  5ABG A;  5J2U E;  3N9O A;  4FJO A;  1BR4 A;  2XQA A;  2D2S A;  1SE7 A;  2E9X C;  4GIW A;  5KXJ A;  2NW8 A;  2ODV A;  3VR8 A;  3JAF A;  4TWD A;  3PUV F;  1UX4 A;  4CN6 A;  3CML A;  1XNR T;  5FY0 A;  5HXC A;  4DR3 T;  4KHP T;  5JTG A;  4WBN E;  3AEA A;  2Z6E A;  2YN6 A;  3SOL A;  4MHC A;  2XAQ B;  1H7C A;  3O1I A;  2WU2 A;  3AAI A;  5L4E A;  2FBW A;  4PW8 A;  2XSA A;  3Q2M A;  3ABV A;  4CXX A;  3DTO A;  4BAY B;  3PUG A;  2YIN A;  2NWB A;  2YKS A;  4WW0 A;  3AAE B;  2Y48 B;  4CI1 B;  4YSZ A;  2WY2 A;  3AE5 A;  4F6R C;  3QNU A;  5HEU A;  2W66 A;  4ZZB A;  4ZI2 D;  5BMV E;  1X9B A;  2FJE A;  4ZEY A;  1OED E;  2KGX A;  2XQ3 A;  4C90 A;  4DV6 T;  4DV1 T;  4KBM B;  2JQQ A;  3SFD A;  3C4Z A;  3L09 A;  4GKK T;  3K8P C;  3LJC A;  4IDP A;  2BG9 A;  1ZHC A;  1U4Q A;  3MJX A;  3AA0 B;  5JR9 C;  3FXE B;  2WZI A;  2WBL A;  1HFA A;  1BR0 A;  5JQG E;  1LKX A;  2UUB T;  5L47 A;  2M6B A;  5L3G B;  4W8P A;  1FMV A;  3SRZ A;  3C4W A;  2LHN A;  4A56 A;  4AIU A;  5AQV B;  2X9H A;  4H9N C;  4OX9 T;  3ZSS A;  2CCQ A;  5FXX A;  1J5E T;  3C4X A;  4JI4 T;  2YU1 A;  2R6G F;  2MPK A;  1YQ3 A;  2EHO A;  3X1D A;  3OJA A;  3UU3 A;  3I0Q A;  4P0A A;  5JDL A;  5JR9 B;  2LRK A;  3PUS A;  3L8R A;  5LGT B;  3OPC A;  2BZB A;  3C98 B;  2JQH A;  4OHF A;  4O2B E;  4EED A;  5JRC A;  3LK3 B;  2MOZ A;  5LHH B;  4IT4 A;  4UF0 B;  3UTK A;  4IE6 A;  3Q5D A;  3BQI A;  2LSK A;  4X1I E;  4WBO A;  3DJB A;  3PUA A;  4DO0 A;  5AQP B;  5FY7 A;  3VRB A;  1VCT A;  2DCF A;  2MAW A;  3WAJ A;  2PBI A;  4EEB A;  2K5B B;  2VWA A;  1IJ5 A;  2VL8 A;  1XDP A;  3NZP A;  2P9B A;  3LBX B;  4PJN A;  3FYQ A;  4PJL A;  2UXN B;  5AQO B;  4UV9 B;  3ZC1 A;  1LVK A;  4UEM A;  3PUX F;  5L3C B;  2CXF A;  3AE4 A;  3R6N A;  3GN5 A;  4IDO A;  2ES0 A;  2LKH A;  4O4I E;  2CHN A;  2KIN B;  4QX8 B;  5HXR A;  4XZC A;  4TX5 A;  4L9I A;  5KX5 E;  2XAS B;  4DV7 T;  5T1D A;  1D0Y A;  3FHN A;  3UUB A;  4YHJ A;  4EYY R;  4YJ3 E;  4UV8 B;  4ZS2 A;  3VRA A;  2H89 A;  5LP6 E;  1WLX A;  5HCJ A;  4ZI2 C;  5LHI B;  3P4R A;  2N2N A;  2WB5 A;  3AXJ B;  4UXN B;  5LMU T;  2HN2 A;  2CWY A;  2KVP A;  3ZMZ B;  3K1S A;  2ZM0 A;  4G63 A;  3P4P A;  3QOF A;  2I6H A;  2ACZ A;  3LK2 B;  4X66 T;  2FJB A;  3RYF E;  4IE0 A;  2VB6 A;  3RC3 A;  3C51 A;  2I0M A;  2V1D B;  5ADX L;  5LNK A;  2CE7 A;  4F8H A;  2LHR A;  2CXD A;  3NRX A;  1HCI A;  4JI7 T;  2LOS A;  1WYC A;  3DP7 A;  2V8S V;  3AE1 A;  3TLU A;  4AQF A;  4GKJ T;  2W61 A;  1AJ3 A;  2X9Y A;  2CEA A;  1KNR A;  2OLT A;  5TAO A;  4KMC A;  2IHR 1;  3P4W A;  3VU7 H;  2KMF A;  3AVR A;  3K3O A;  2LM2 A;  3CQG B;  2KSR A;  4DR1 T;  3VKH A;  4WNK A;  5AQN B;  1X79 A;  3EVY A;  2V7I A;  3O1H A;  2MTC A; 
#chains in the Genus database with same CATH homology
 3ZEF B;  4GOU A;  3LFM A;  2KWI B;  1IJ6 A;  3J7Y q;  3BQK A;  4O8S A;  2DI4 A;  3H37 A;  2HH7 A;  3HR0 A;  3LBX A;  2LEH A;  3AVS A;  3W15 B;  3ZYM A;  3ZYL A;  3TKL B;  1B7T A;  3UUN A;  5J1G A;  1MND A;  2LOP A;  4H9P C;  4H9O C;  4QHO A;  4AKI A;  2Y8D A;  3B57 A;  3N2K E;  3AA7 B;  3IHR A;  5LXT E;  3CX6 B;  2L9Q A;  1KNZ A;  4N78 D;  2MTQ A;  2DWG A;  2WMN A;  4ASK A;  5L3F B;  4HN9 A;  2LSJ A;  3PF0 A;  3PTR B;  4O4J E;  5JDN A;  4FI5 A;  2KND A;  4DND A;  3ZN0 B;  5C8Y E;  3KV4 A;  2K24 A;  3MZK B;  3N2O A;  4IE5 A;  1WYB A;  3ANW B;  2B1E A;  5IYZ E;  1KK7 A;  2XAJ B;  3PUR A;  3LG7 A;  2NW7 A;  2KZ7 B;  4O4L E;  3UT5 E;  3MAC A;  2W00 A;  3F57 A;  4CZZ B;  3WSC A;  3KVA A;  1HG5 A;  5LGU B;  3A5X A;  4NUU A;  2V7K A;  3IBP A;  3I1A A;  5L3B B;  1MMD A;  2Q9Q B;  2X9X A;  3HKB E;  1BR1 A;  3BQL A;  2H3R A;  1YKH B;  4UEL A;  3EUH A;  2IC6 A;  2C5I T;  3CQC B;  5DAB A;  1S94 A;  4E7S A;  4GYR A;  5J2U E;  3RRW A;  3N9O A;  4FJO A;  1BR4 A;  2DWK A;  4BJN A;  1YKE B;  3LK4 2;  2VKH A;  2JMK A;  2D2S A;  4PK6 A;  3QUJ A;  4ZI3 C;  4I4T E;  1UX5 A;  2E9X C;  5EZY E;  4GIW A;  4NUV A;  2Q9Q D;  3NBX X;  5JDM A;  4ZOL E;  5LBM A;  2KXP B;  2NW8 A;  5JDG A;  1MMN A;  3KFW X;  2ODV A;  5EK3 A;  3UUX B;  2BVL A;  2OA5 A;  4CI2 B;  3KV5 A;  5JH7 E;  2Q9Q A;  3PE0 A;  2CM0 A;  4QX7 B;  2HPJ A;  5JRC B;  1UX4 A;  3ZMU B;  1ZEE A;  3CML A;  4ONR A;  1HG2 A;  5FY0 A;  3CPZ A;  4HKA A;  5HXC A;  1E1H B;  1Z0P A;  4JEU B;  3ZJ2 A;  3V5S A;  4WBN E;  2C5K T;  2Z6E A;  1FMW A;  2W0G A;  4YFS A;  3SOL A;  4DMV A;  3UFE A;  4MHC A;  2XAQ B;  1H7C A;  3AA1 B;  3AB3 B;  2BVM A;  3IEE A;  3O1I A;  3AAI A;  2W63 A;  4PW8 A;  3P8C D;  3Q2M A;  5GON E;  3OBV E;  5A1L A;  4CXX A;  3DTO A;  5LA6 E;  5L3E B;  3HKD E;  4BAY B;  3PUG A;  5KMG P;  2YIN A;  2MBG A;  5HXH A;  5HXE A;  2NWB A;  1LVF A;  4DMW A;  3N2G E;  4WW0 A;  4P09 A;  2K48 A;  3AAE B;  4H9Q C;  2Y48 B;  2D0T A;  4CI1 B;  3E0Z A;  3JC6 C;  3Q5W A;  3QC9 A;  5LHG B;  4F6R C;  3OKQ A;  4EB6 E;  3N9N A;  4CXW A;  3PUQ A;  2N9D A;  1WRD A;  2WWU A;  4ZI2 D;  3ZN1 B;  3WUR A;  5BMV E;  3RX6 A;  5JDH A;  4L0R A;  1WR6 A;  2JRK A;  1Y64 B;  2KLQ A;  2VK9 A;  3M65 A;  3FBZ A;  3P7I A;  4H9R C;  2I59 A;  4ECG A;  4IE4 A;  2V26 A;  5H6R B;  4CI3 B;  3I9W A;  4C90 A;  4AKH A;  3F2E A;  2X0L B;  3AAA B;  4KBM B;  4MLK A;  5CA0 E;  2JQQ A;  3C4Z A;  3L09 A;  1D0X A;  3GN5 B;  3K8P C;  3LJC A;  2XAH B;  2LSY A;  4PJM A;  4BA9 A;  3KV6 A;  4V1A v;  2LJL A;  4IST A;  3RC8 A;  4ZI7 E;  4CXY A;  4EZH A;  2PG8 A;  1US7 B;  1ZHC A;  1U4Q A;  3PU8 A;  4I43 B;  4ANJ A;  5FXZ A;  3MJX A;  3AA0 B;  3ONX A;  4J2C A;  5JR9 C;  3FXE B;  2CWO A;  2WBL A;  3FB2 A;  3L3P A;  3OYX A;  1HFA A;  2ZM2 A;  4EIW A;  2NTY A;  1OWA A;  5FYM A;  1BR0 A;  5JQG E;  1LKX A;  4O2A E;  1SA0 E;  4QXH B;  4B6X A;  4AQG A;  1NWM X;  5L3G B;  5IHY A;  5HYA A;  5DJQ C;  5AFU L;  5DQV A;  4DBR A;  1FMV A;  3FBL A;  3GA8 A;  2GK9 A;  3C4W A;  3SRZ A;  2LHN A;  1HF8 A;  4A56 A;  4GK0 E;  3PU3 A;  1IZN B;  2WSS V;  4GYS A;  1O3X A;  2VKJ A;  5H6Q B;  3ZJ1 A;  4AQF C;  3NRY A;  5HWY A;  5FNV E;  4QXC B;  3CX8 B;  2XAF B;  2X9H A;  2ODU A;  2PFV A;  4H9N C;  2EHO B;  2QA7 A;  5EK4 A;  4QXB B;  2L3L A;  5F3J A;  3MKD A;  4X1K E;  3RPU A;  2VAS A;  3ANW A;  3R84 B;  2ZLY A;  3VHL A;  3ZYK A;  2CCQ A;  2NP9 A;  5FXX A;  2K9A A;  1FIO A;  3SWH A;  3C64 A;  4I55 E;  1FEW A;  3ZC0 A;  2RA1 A;  3GWH A;  5LG4 A;  2CMR A;  3Q9D A;  2EHO D;  3C4X A;  4EXT A;  3N9M A;  5LYJ E;  4AXP A;  5JRE A;  4E7Z A;  2YU1 A;  2X51 A;  2NOX A;  2NTX A;  4MBQ A;  2EHO A;  5JDF A;  3WI3 A;  3N9L A;  5HAX A;  3U3I A;  3VJZ A;  2NW9 A;  3KIN B;  4U74 A;  5HWX A;  1OXZ A;  2D0U A;  3OJA A;  5L3D B;  3KDS E;  4IIJ E;  3I0Q A;  4PAG A;  3ZMT B;  4P0A A;  2X66 A;  5JDL A;  5JR9 B;  3ZMV B;  2LM9 A;  5JDQ A;  2LQU A;  5M4Y A;  2DLR A;  3PUS A;  4GK5 E;  4HTE A;  5LGT B;  5LGN B;  3AT7 A;  1G73 A;  2BZB A;  4QKN A;  3C98 B;  3ESL A;  2RP4 A;  4OHF A;  4O2B E;  3S4U A;  3Q5X A;  5JRC A;  4M1P A;  3LK3 B;  4I50 E;  2WAU A;  3O1J A;  1SHZ C;  4EYU A;  2M67 A;  5CB4 E;  3N5L A;  3ETU A;  2MOZ A;  3O4X E;  5LHH B;  4JEH B;  4JLE A;  1V9D A;  5LJN A;  2X68 A;  2XHE B;  5JR9 A;  1EZ3 A;  2L8K A;  4UVA B;  4UF0 B;  1D1C A;  2VKO A;  3UTK A;  4IHJ E;  4IE6 A;  2C5J A;  3BQI A;  4TV9 E;  5FXV A;  4O4H E;  2LSK A;  2CLY C;  5FXW A;  5CA1 E;  4X1I E;  4WBO A;  3DJB A;  2E9X B;  3N9Q A;  3KV9 A;  3PUA A;  3FXD B;  5JVD E;  2QGS A;  4DO0 A;  1ZV4 X;  4P0B A;  5L2L A;  5FMN A;  5FY7 A;  3B13 A;  2G0U A;  2YU2 A;  2DCF A;  3MA9 A;  3ZCJ A;  3WAJ A;  2PBI A;  2X67 A;  4TV8 E;  3C50 A;  4UVB B;  4X1Y E;  4K0U A;  2K5B B;  5F8P A;  2VWA A;  2UXX B;  1IJ5 A;  4ZI3 D;  2VKD A;  2E9X D;  2VL8 A;  1MNE A;  2HPL A;  3HA4 A;  5FY1 A;  4ZHQ E;  1QUU A;  2W62 A;  3NZP A;  3ZCI A;  4PJJ A;  2P9B A;  3LBX B;  4PJN A;  4PJL A;  2DHR A;  2Q9Q C;  2SPC A;  2UXN B;  2IW5 B;  2E9X A;  1VRB A;  2V7J A;  4C91 A;  4UV9 B;  3K3N A;  3ZC1 A;  1LVK A;  2LSG A;  4UEM A;  1U5P A;  4DBQ A;  1MMG A;  1YD8 G;  2LT3 A;  2C0S A;  5L3C B;  2CXF A;  4PFP A;  3ZPO A;  4TN7 B;  4G2A A;  4XBF B;  1LRZ A;  4OFZ A;  4XAX B;  5LCY A;  3R6N A;  4Z8X A;  5EK2 A;  3GN5 A;  1BR2 A;  3EDU A;  2ES0 A;  3CQX C;  1UCU A;  4O4I E;  4PK4 A;  1MIY A;  2YEV C;  3MXZ A;  3NZQ A;  2D5U A;  2KIN B;  1D1A A;  3QK6 A;  4QX8 B;  4PK5 A;  2ZMA A;  4BGO A;  4OK0 A;  2A72 A;  5HXR A;  2CLY B;  2ZM8 A;  4XZC A;  4TX5 A;  5LBQ B;  2YK0 A;  4L9I A;  5KX5 E;  2XAS B;  5DQW A;  2V7M A;  3MK7 C;  3E08 A;  3IF8 B;  1HX8 A;  4HEA A;  5T1D A;  3RYC E;  2PJQ A;  1D0Y A;  3JC6 D;  4U72 A;  4YJ2 E;  4HFV A;  3FHN A;  4AKL A;  3EDV A;  4YHJ A;  4YJ3 E;  4EYY R;  2JJ9 A;  3HI2 A;  4UV8 B;  4X20 E;  3RYH E;  1NAF A;  2LSI A;  4ZS2 A;  5LP6 E;  1WLX A;  1YW0 A;  1MMA A;  3V5U A;  4IGU A;  3WAK A;  4ZI2 C;  3BK9 A;  4EAH A;  5LHI B;  2WM9 A;  4H63 H;  2N2N A;  4ILU A;  3AA6 B;  4ERR A;  3H3A A;  2H7V C;  4QWN B;  4UXN B;  4DVD A;  1HTJ F;  3CX7 B;  4OYK A;  3PHF 1;  4ZS3 A;  4CQI A;  5HXS A;  1QSD A;  3SS1 A;  3O9X A;  2A2F X;  1S35 A;  2CWY A;  3ZMZ B;  3KBT A;  2J1D G;  1D1B A;  2ZM0 A;  1HS7 A;  4G63 A;  2H7O A;  1IAP A;  3VKG A;  2XQY A;  3ZMS B;  4KP3 C;  3LK2 B;  5E0O A;  2Y6X A;  3RYF E;  4IE0 A;  3GMI A;  4ISS A;  2IC9 A;  4PFO A;  2VB6 A;  4IE7 A;  3RC3 A;  3C51 A;  2LE8 A;  2IAK A;  4AKG A;  2V1D B;  3CVR A;  1D0Z A;  5ADX L;  2N1G A;  5LNK A;  1CUN A;  3N9P A;  1G8X A;  3RYI E;  1ZKE A;  4HGA A;  4EOZ B;  4H9S E;  2XUE A;  3I9Y A;  3UUM A;  5J2T E;  3KBU A;  4MAL A;  4HE8 A;  3HKE E;  2CXL A;  4L5G A;  3J9X 1;  2CE7 A;  3RRC A;  3K3Q C;  2KT9 A;  1VOM A;  4BJM A;  2LHR A;  4AI6 A;  2CXD A;  3ETV A;  3NRX A;  1HCI A;  3E22 E;  2BDE A;  4UVC B;  3HL6 A;  2JPF A;  4H63 V;  3M1C A;  2LOS A;  3PDY A;  1WYC A;  2CA5 A;  3DP7 A;  3RKO A;  4MFR A;  4UIG A;  4EZ4 A;  5KDM C;  2E8I A;  3D0T A;  4YLH A;  1MIW A;  3F31 A;  5LJM A;  4AQF A;  2W61 A;  2MYS A;  1AJ3 A;  2X9Y A;  2CEA A;  3I0O A;  3CWZ B;  4OYJ A;  4TZ4 C;  4UF0 A;  5TAO A;  2XTL A;  4PNI A;  4AKR B;  1T98 A;  4KMC A;  3CKD A;  1MIV A;  2X9W A;  3T8O A;  3ZLI A;  3VU7 H;  5LOV E;  2KMF A;  4TUY E;  3AVR A;  4KUM B;  3UUL A;  3K3O A;  2ACX A;  2EHO C;  5ETW A;  3U78 A;  5FP3 A;  3HKC E;  3RH3 A;  2JMH A;  2WMO A;  3CQG B;  4JUY A;  3VKH A;  4IDZ A;  4WNK A;  4ADZ A;  1X79 A;  3EVY A;  2KWH A;  3OYZ A;  2V7I A;  2A3D A;  2DNX A;  2V7L A;  3O1H A;  2MTC A;  2XAG B;  3KVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...