5HXEA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 100 mm na+ and zero ca2+
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
304
structure length
297
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRMGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
total genus 126
structure length 297
sequence length 304
ec nomenclature
pdb deposition date 2016-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hxeA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hxeA02
5JDHA 5HXRA 3V5UA 5HYAA 5JDMA 5JDQA 5HWXA 5HXEA 5JDNA 5JDFA 5JDGA 5HWYA 3V5SA 5JDLA 5HXHA 5HXSA 5HXCA
chains in the Genus database with same CATH superfamily
2WZIA 3VKHA 2GK9A 2WAUA 2XAGB 3UULA 2QVAA 2LSIA 2SPCA 3K8PC 4M1PA 2ODVA 3PE0A 5L4EA 1CHUA 2X9YA 5CGMA 1Y01A 4EEBA 2CCQA 2VKDA 4Z8XA 4DR7T 5JDLA 3P7IA 2NTXA 2CLYC 3UU3A 3P50A 3LK2B 5HCMA 3I0OA 4HWDA 3RIAA 2CHNA 4QXHB 2UUCT 4QX7B 4EOZB 2NR4A 1MNEA 2NWBA 1Y64B 1D1CA 4H9QC 2X9WA 4O4HE 2BG9E 3S4UA 2OV9A 2E9XA 2ZM6T 3TLUA 3SWHA 1MMGA 4IE0A 2VB6A 2WU2A 3AEDA 4MFRA 3KVBA 4ZZBA 2VL0A 1W0BA 2QGSA 2WSSV 3K3OA 2KVPA 4HWFA 2YDSA 4UELA 4P09A 4E7ZA 4HN9A 2YK0A 5LHHB 4QXBB 4HWHA 3ZSTA 1IJ6A 1OEDA 3NRXA 4EB6E 4CXYA 5FXWA 1W0AA 4KHZF 4DMWA 3N2GE 3O4XE 4ERRA 2XM1A 4IE4A 5L3EB 3QK6A 1YKHB 2XQ4A 3ZCJA 2BBHA 3L39A 3DP7A 3VJZA 4PW8A 4AQYT 5FNVE 3GMIA 1YW0A 5JDFA 4I43B 4WBNE 4FJOA 4DV5T 2B76A 1NEKA 1W9RA 1NWMX 2WBLA 2KNDA 1T98A 2V6YB 3AA6B 3QC9A 3PDYA 4HFCA 5LG3A 5DQVA 3FYQA 1XMOT 2XAQB 4GIWA 5KDMC 3F31A 3UUMA 3TKLB 1M62A 4IE6A 5FXXA 5CA0E 3CX6B 5AFUL 3FZLB 2M6IA 4AKRB 3LDQB 2I6HA 5HXEA 5HEHA 5JTGA 5AQGB 4E7SA 5ABFA 2Q9QD 2MBGA 5LMUT 3JCFA 5LGUB 2Q9QB 5HXCA 2XSAA 4ZI2D 4X62T 3CK6A 3ZMVB 4ZHQE 2YEVC 2V7IA 3AEEA 2LKHA 1XMQT 3CMLA 2AXDS 1J5WA 2W67A 3VR9A 4H63H 3I1AA 1WRDA 1S94A 3AE9A 2ZM0A 2LHNA 4IE7A 3UFEA 1LRZA 1UK5A 3ABVA 3R6NA 3RYHE 3P4SA 3AE2A 4NXNT 3CIRA 2VASA 2MAWA 5JDQA 5AQJB 4IDNA 4O4JE 2M67A 3L09A 5FY7A 2LSGA 4QKNA 1E2AA 1HG2A 2LM2A 3AAIA 5TAOA 4YJ2E 2X67A 2LSYA 1NENA 4EGWA 2Y48B 5JREA 4IDOA 5EK3A 5J0ZA 3SFDA 3J9X1 3WI3A 2ACZA 2LJLA 2XASB 4DR6T 4O4IE 4A98A 3T8OA 3VHLA 2D0TA 4HFIA 2LLYA 2WM9A 1YD8G 3P4PA 2I0MA 4JI7T 3KV9A 2WY2A 3AA1B 3AEFA 5L3CB 2V7KA 2X0CA 2D9DA 2PTFA 1D0ZA 2XSBA 3OKQA 3PHF1 1JNRA 4U3CA 4X66T 2PG8A 2FJAA 2Y8DA 4H9RC 2ZMAA 2V7MA 2L10A 4YLHA 1AJ3A 4H9PC 4CXWA 2J1DG 3PU3A 4YSZA 4GK0E 4QWNB 3SOLA 1YQ3A 4TN7B 5LB7B 1WYBA 5L3BB 2R6GF 3GN5B 5JVDE 2BS4A 3ZC1A 2I59A 5F5WA 1KF6A 3LSVA 2NP9A 4ILAA 1G8XA 5JDMA 5LCYA 4TV9E 2UXXB 1T72A 3HA4A 4UEMA 5DJQC 2DCFA 1UUSA 4X65T 3N9MA 4ECGA 4ZI3C 4HKAA 5LA6E 2DNXA 2YDQA 2CBIA 1HF8A 1QSDA 2IC6A 3AB3B 2BG9B 4TWHA 2BBJA 3PUYF 2PBIA 3L8RA 2X0HA 5LYJE 2K48A 2YINA 4U7YA 4EEDA 1FMWA 5HEJA 4AKLA 1IBMT 4DUYT 2W2UA 3KBUA 2CA5A 2EHOD 4JI3T 2EHOB 4CI1B 1T7SA 2A9UA 3N9LA 4XBFB 2W0GA 2KWHA 4UF0B 2VK9A 3AVRA 3CWZB 2YKSA 3N9OA 1HNXT 1XNRT 5ABHA 5HCJA 5FXZA 3OBVE 5JH7E 3SS1A 2XQ7A 2XHEB 3AE6A 4UIGA 3SFEA 3KVAA 3FBZA 3AEBA 3WURA 3LBXB 2V1DB 1DU2A 2C0SA 2V8SV 4EV6A 5LXTE 4DR5T 4XAXB 1M7KA 2CPTA 2UXDT 2NOXA 2JQ9A 4EAHA 3N9NA 2WB5A 3Q9DA 1HNZT 4KBMB 3UU8A 3ZYMA 5FP3A 1HX8A 4EIWA 5LJMA 2D2SA 3I9WA 3NRYA 4ILCA 3EI0A 1FEWA 3T1YT 3O1IA 2NW9A 1N33T 4UV8B 2YU2A 3M1CA 1MIYA 3CX8B 3A7MA 2E5VA 2W61A 2K3WA 2ES0A 3RYIE 2K9AA 3ETUA 4AXPA 3HKBE 4U31A 4LF4T 3UT5E 5HXRA 3NBXX 3EABA 3AE3A 3ANWA 4HFBA 4XZCA 3ZMTB 4DR4T 1MMNA 3G06A 3RKOA 3AECA 2XQ8A 5DABA 4KUMB 5HXSA 2JRKA 1XNQT 2UXNB 5KMGP 3ZJ2A 2J62A 4B3ST 3ZPOA 3ZC0A 2OLTA 5AQFB 3AE5A 2E8IA 3FZFB 3MACA 1WYCA 1HX1B 2WWUA 3KV5A 5GONE 4DV3T 4QH1A 3RX6A 5L3FB 4QHOA 2X9HA 1WFDA 4PJNA 2XZEA 3SRZA 4YTMA 4PK5A 3RYFE 2D0UA 2HPJA 2QRXA 1LKXA 4I55E 4YHHT 1SUMB 2DL1A 1X9BA 3AEAA 2ZM8A 3PF0A 4CN1A 3EDUA 2FUPA 3J7Yq 1OWAA 1N36T 2L8KA 2XY8B 1X79A 2MTCA 2DWGA 3NZPA 5AQOB 4PFPA 2QA7A 3AE1A 3RPUA 4Z91A 5ETWA 3IF8B 5FXVA 4IREA 4JI1T 2W62A 4GK5E 3ONXA 2IDOB 2LM9A 2LOSA 2LRKA 4ZXLA 4DR3T 3FBLA 4JBWF 3ZLIA 2HHHT 3AE8A 2K5BB 3ZEFB 5LOVE 2XAJB 4MHCA 4YTPA 1W09A 3QB5A 4ONRA 4TUYE 3PUXF 4JYAT 3V5SA 4BJMA 3PUQA 1YQ4A 4QX8B 4BAYB 3ESLA 3C64A 1I6ZA 4G63A 2XPKA 3VR8A 4F8HA 5KX5E 3P4WA 3E0ZA 1FJGT 1WR0A 3MKDA 4YFSA 3AAAB 4NUVA 4WW0A 4BGOA 1JNZA 2XAHB 3JAEA 3C4WA 2VL8A 4AQFA 4DV7T 3UTKA 5FY1A 1MMAA 3C51A 3PUAA 1KEYA 1KNPA 2IAKA 1KK7A 5JR9B 4LF8T 3K3QC 4IT4A 3AEGA 4DUZT 5ADXL 2LRLA 3NVOA 2VVNA 5EK2A 4AQGA 1IJ5A 3Q5EA 3B57A 5CJ5A 2H3RA 3N2OA 3AA0B 1EZ3A 2UUAT 5CFBA 2DHRA 3AVSA 1N32T 3KFWX 4JLEA 1D1BA 3MA9A 4KI0F 4AKIA 1SHZC 5AQLB 3AE4A 1UURA 4O8SA 4A56A 4LFCT 3CPZA 3IBPA 4TX5A 1MNDA 3UFGA 5FY0A 5JDGA 3EDVA 1OXZA 4OYJA 2Z6EA 2K24A 4IDPA 2BG9C 2V6YA 2CLYB 2CWYA 4LF9T 2VKJA 2XJ7A 4OYKA 3A5XA 4X1KE 3OYZA 4LF5T 4DV1T 2CEAA 4L9IA 4KMCA 3DYJA 3MZKB 4YT0A 1D0XA 1L0VA 4YXDA 2V5DA 4HE8A 5JRCB 5IHYA 3RLFF 1ZEEA 2KLQA 5CA1E 3Q5DA 4IL4A 4HEAA 5FKYA 2EHOC 4DMVA 2X9XA 4JI4T 2JQHA 2MOZA 2Q9QA 1BR0A 2CM0A 2WDRA 3OJAA 3MJXA 4DNDA 4IDZA 4X5TA 3U78A 2XQAA 5FL0A 3TLVA 1SJ7A 4PJJA 4BA9A 5A1LA 4V1Av 1UCUA 4CQIA 3UU4A 1OEDE 3IEEA 2WCAA 4P0BA 3N2KE 3VKGA 2A72A 3FZHB 5C8YE 3K1SA 4NIQA 3MXZA 5L3DB 2V26A 2IW5B 2JJ9A 3TLSA 1ZOYA 2IC9A 4U72A 2KXPB 4LMJA 5T1DA 3GWHA 4GYSA 1IBKT 4X20E 4TWFA 5JDNA 5L47A 3ZN1B 4LMKA 4A97A 2N1GA 4LMLA 4L5GA 3Q5XA 5FVKA 3KBTA 3VU7H 4AKGA 4AISA 1LVFA 4C90A 4F6RC 3OTOT 2UXBT 1I94T 3AXJB 1WLXA 1J1JA 3AE7A 3UUXB 3HKEE 3ZT6A 3PU8A 4PJMA 5HXHA 2ODUA 4O4LE 4UR9A 2X66A 3H3MA 2JQKA 5HEOA 1ZV4X 1FIOA 2LT3A 2VKHA 4U2YA 5AQTB 5FMNA 4NXMT 2WZHA 4LF7T 3RRCA 3DTOA 4NPPA 4YTNA 3GN5A 4CN4A 4LFAT 1IAPA 4OX9T 3PUGA 3EVYA 3I0QA 5ABEA 4JI8T 2CBJA 2J47A 3ZT5A 2OA5A 3WAKA 2LE8A 4HFEA 5LJNA 3CQXC 3KV6A 4AIUA 3B13A 2XTLA 2VQFT 1SJ8A 2PFVA 4Q25A 1ZKEA 2XQ5A 1GQEA 3CVRA 3CX7B 2DLRA 2VKOA 3ONLC 3R84B 5J2TE 3FXDB 2BG9A 2XUEA 3P8CD 1KFYA 4AKHA 3ZN0B 2WMOA 3ZMUB 4AQFC 4MLKA 4EYUA 2C5IT 2JMKA 1HR0T 2KMFA 5LP6E 4OHFA 5F3JA 2UXCT 2N2NA 1WCRA 4YHJA 2WDQA 4WBOA 3O9XA 3UUNA 4HWCA 2XAFB 3BQLA 4ZEYA 4EXTA 4IIJE 2L7NA 4X1YE 2EHOA 3E22E 3H37A 2XM2A 5KXJA 4UVAB 2A3DA 5AQVB 5HWYA 3X1DA 5LGNB 4UF0A 1US7B 4U2ZA 3RYCE 2YU1A 1HTJF 1HG5A 4MALA 1BR2A 2HH7A 3HL6A 3DJBA 3JC6D 4H63V 3U3IA 4IGUA 1IZNB 3RHWA 3T1HT 2KSRA 2XQ6A 3LBXA 3RH3A 3PV0F 2QYWA 4HFHA 4U7IA 1XZYA 2IUBA 4LF6T 5JR9C 4JI0T 4JEHB 2WQYA 2CE7A 3HKDE 2KT9A 1SE7A 4JI5T 2MTQA 4ADZA 2A2FX 3EHZA 4IE5A 5LBQB 2V7LA 1HCIA 4WNKA 5FVLA 1VOMA 3RC3A 4IL9A 5C2TA 2HPLA 3V5UA 3OYXA 2E9XD 4KX6A 3PUSA 4GKKT 3HKCE 3H3AA 3QOFA 2E9XB 2DWKA 5LG4A 5C3JA 2BKNA 2JMHA 2Q9QC 5AQQB 4A5XA 2F4VT 3RIUC 5AQUB 3RI5A 2B1EA 4GKJT 5LHIB 2CRBA 3I9YA 4DO0A 4ZI2C 4UV9B 2ZLYA 1FMVA 5FYMA 2KWIB 3UUBA 2VURA 3UU5A 1OEDB 5J1GA 2JPFA 3RIFA 5AQNB 3RGLA 3BQIA 4JI6T 5LBMA 4PK4A 3K3NA 4PNIA 2NTYA 1QUUA 1E7PA 4TZ4C 4GYRA 2LSKA 4O2AE 5FL1A 2FJEA 4DR1T 4UXNB 4DBRA 3LG7A 4DV4T 4GOUA 4TV8E 3ZKRA 1ZHCA 2CXLA 2JQQA 5L2LA 5AQPB 5IWAT 5HAXA 2IMLA 4PK6A 4CXXA 3QNUA 3CQGB 3Q5WA 5AQKB 5AQRB 2PJQA 4MBQA 3PUWF 1E1HB 2LOPA 4X1IE 1YXRA 5BR8T 1BR1A 4HTEA 3P4QA 3PURA 4JI2T 5ABFB 4DVDA 5L3GB 1H7CA 3NWIA 4WYVA 4DV0T 2NW7A 3ETVA 2KINB 3QUJA 4HFVA 2W00A 5HYAA 3AAEB 2BS2A 2KZ7B 3ZJ1A 4ILBA 4DV2T 4B3MT 4P1NA 2BKOA 4DIDB 4ISTA 5JQGE 3ZCIA 4G2AA 3PTRB 3NZQA 2M6BA 5H6QB 3WSCA 5IYZE 2LEHA 2V7JA 4ZS3A 3ONJA 2CMRA 1VCTA 4JUYA 3F2EA 2W63A 3RRWA 3ZT7A 4YSYA 2BKPA 1MMDA 2VVSA 4FI5A 4ILUA 4H9SE 2FJDA 5LGTB 1Z8UA 2H7OA 1ZP0A 2D5UA 1NAFA 4WZXA 5JR9A 3AY5A 2KGXA 2E5LT 2H89A 2WP9A 2UU9T 4X64T 3ZYKA 2WU5A 2G0UA 2NW8A 2WMNA 4YJ3E 1U4QA 3E08A 4HWIB 3FB2A 5ABGA 5DQWA 2C5JA 2VWAA 2H7VC 3FZKB 2L9QA 4HFDA 3LFMA 4UVBB 2V6XA 2HN2A 2KBBA 2JIWA 3N9PA 1WR6A 2J4GA 3N9QA 3C50A 2BS3A 1N34T 2H88A 3M65A 3NKZA 3RIUA 1IBLT 4DV6T 5L4HA 3TLWA 3P4RA 1UX5A 3FZMB 3QB5K 4UVCB 5F8PA 4CI3B 2LQUA 3C98B 5M4YA 2FJBA 1MIWA 2HN1A 3OPCA 1O3XA 1UX4A 1LVKA 4U33A 1Z0PA 5E0OA 3RQUA 1T8BA 1XWMA 5LHGB 4H9OC 1J5ET 1U5PA 3RC8A 3N5LA 5H6RB 5CB4E 4L0RA 2XQ9A 1XDOA 5JRCA 4CI2B 1VRBA 4P0AA 5EZYE 4U74A 4ISSA 4IHJE 3RQWA 3WAJA 1V9DA 3PUZF 2X0YA 3EAMA 5HEGA 5AQHB 3PUVF 2IIUA 4QH4A 2BVMA 5AQSB 1G73A 2W66A 2MPKA 3CKDA 5BMVE 4H9NC 3BK9A 4F7GB 3JC6C 3A8YC 2WWVA 3TLTA 4JEUB 2YDRA 3VRBA 1HS7A 3LK42 4B3RT 4NUUA 4W8PA 1XDPA 3O1HA 3EUHA 2C5KT 1HFAA 4ASKA 4EZ4A 3AA7B 3BQKA 4N78D 4PJLA 1UGOA 3PJAJ 5LMNT 2BVLA 3FXEB 2FBWA 3MK7C 4PAGA 3M3ZB 3JAFA 1HNWT 2N9DA 4B6XA 3CQCB 1CUNA 3FHNA 4QH5A 4YY3T 2DI4A 4COFA 2E9XC 3LK3B 3ZSSA 5AQIB 4OK0A 2Y6XA 1B7TA 4I4TE 4JV5T 3PJAA 3UQ4A 3IA3A 3JADA 3ZYLA 4YSXA 5AQMB 1SA0E 3HI2A 2P9BA 3RKGA 4OFZA 3KINB 4TWDA 4ZOLE 2CXFA 2XQ3A 3AXJA 4ANJA 1OEDC 3F57A 2RA1A 4KHPT 2CWOA 4QXCB 3RF1A 2VQET 2LHRA 4K0UA 3W15B 4TNVA 4DBQA 4C91A 4LFBT 3ZMZB 2X68A 2BDEA 3ANWB 5HEUA 3ZMSB 4EZHA 2V5CA 2WS3A 1BR4A 2X51A 5JDHA 5LNKA 2L3LA 4ZZCA 1D0YA 2RPAA 2ACXA 4Z90A 1VCSA 2WDVA 1KNZA 3UU6A 5FZTA 3O1JA 4I0UA 5HWXA 4K0KT 3C4XA 2UUBT 4J2CA 2YOEA 3C4ZA 2IHR1 1D1AA 3VRAA 2RP4A 3Q2MA 2YN6A 2BZBA 4CZZB 3HR0A 4I50E 2XQYA 4ZS2A 4KP3C 3B5MA 4ZI7E 2LKGA 5IUXA 3UQ7A 2E2AA 3LJCA 3OVUA 2ZM2A 4AI6A 1S35A 1MIVA 4HGAA 2W4XA 2CHOA 4IDQA 3KV4A 3AT7A 1QLBA 4ZI3D 3IHRA 4B3TT 4O2BE 1YKEB 2LSJA 2MYSA 4BJNA 1R8IA 5J2UE 3GA8A 2AE9A 3KDSE 4CN6A 2CXDA 3D0TA 4EYYR 4TNWA 4DR2T 4PFOA 2X0LB 5EK4A 1KNRA 3L3PA
chains in the Genus database with same CATH topology
2W0GA 2KWHA 4BA9A 3ZJ1A 4UF0B 5A1LA 2VK9A 3VKHA 4V1Av 2GK9A 1UCUA 3AVRA 3CWZB 3N9OA 4CQIA 2WAUA 2XAGB 4ISTA 3UULA 3IEEA 5JQGE 5FXZA 3ZCIA 3OBVE 2LSIA 2SPCA 4P0BA 4G2AA 3N2KE 3K8PC 3PTRB 4M1PA 2A72A 3VKGA 2ODVA 3PE0A 3NZQA 5JH7E 3SS1A 5C8YE 2X9YA 2XHEB 4UIGA 2CCQA 3KVAA 5H6QB 3WSCA 5IYZE 3FBZA 3MXZA 2VKDA 3WURA 2LEHA 3LBXB 2V1DB 2V7JA 4Z8XA 4ZS3A 2C0SA 2V26A 5L3DB 2CMRA 5LXTE 2IW5B 4XAXB 5JDLA 3P7IA 2NTXA 2JJ9A 2CLYC 4JUYA 3LK2B 3F2EA 2W63A 3RRWA 2NOXA 4EAHA 3N9NA 3I0OA 3Q9DA 1MMDA 4FI5A 4QXHB 2IC9A 4ILUA 4H9SE 4U72A 4KBMB 2KXPB 5LGTB 4QX7B 3ZYMA 5FP3A 5T1DA 4EOZB 1HX8A 2H7OA 4EIWA 5LJMA 2D2SA 2D5UA 1NAFA 3GWHA 4GYSA 1MNEA 4X20E 5JR9A 3I9WA 2NWBA 3NRYA 5JDNA 1Y64B 1D1CA 4H9QC 2X9WA 4O4HE 3ZN1B 1FEWA 3O1IA 2NW9A 4UV8B 2N1GA 2YU2A 3M1CA 1MIYA 3S4UA 3CX8B 2E9XA 3ZYKA 2G0UA 4L5GA 2W61A 3Q5XA 2NW8A 2WMNA 4YJ3E 3KBTA 3SWHA 2ES0A 3RYIE 1U4QA 2K9AA 3VU7H 4AKGA 1MMGA 4IE0A 3E08A 3ETUA 4AXPA 1LVFA 3FB2A 4C90A 2VB6A 4F6RC 5DQWA 4MFRA 3KVBA 3HKBE 2C5JA 2VWAA 3UT5E 5HXRA 2QGSA 2WSSV 3K3OA 2H7VC 1WLXA 4UELA 4P09A 2L9QA 4E7ZA 3NBXX 3LFMA 4UVBB 3UUXB 3HKEE 4HN9A 3ANWA 2YK0A 4XZCA 3ZMTB 5LHHB 3PU8A 4QXBB 3N9PA 1WR6A 4PJMA 5HXHA 3N9QA 1MMNA 2ODUA 4O4LE 3C50A 3RKOA 1IJ6A 3NRXA 5DABA 4EB6E 2X66A 4KUMB 5HXSA 4CXYA 2JRKA 3M65A 5FXWA 1ZV4X 1FIOA 2LT3A 2UXNB 2VKHA 3ZJ2A 5KMGP 3ZPOA 5FMNA 4DMWA 3N2GE 3O4XE 3ZC0A 4ERRA 1UX5A 4IE4A 5L3EB 2E8IA 3QK6A 1YKHB 3MACA 4UVCB 3RRCA 3DTOA 1WYCA 3GN5A 3ZCJA 1IAPA 2WWUA 3PUGA 3DP7A 3KV5A 5F8PA 3EVYA 5GONE 3I0QA 4CI3B 3VJZA 2LQUA 4PW8A 3C98B 3RX6A 5L3FB 4QHOA 2X9HA 5FNVE 5M4YA 3GMIA 4PJNA 1YW0A 5JDFA 4I43B 1MIWA 3SRZA 4WBNE 1O3XA 4FJOA 2OA5A 4PK5A 3WAKA 2LE8A 2D0UA 3CQXC 1UX4A 2HPJA 3KV6A 1LVKA 5E0OA 1Z0PA 3RYFE 5LJNA 1NWMX 1LKXA 3B13A 2WBLA 4I55E 2KNDA 2XTLA 2PFVA 1ZKEA 5LHGB 1T98A 4H9OC 1U5PA 3RC8A 3CVRA 3CX7B 2DLRA 2VKOA 3AA6B 3N5LA 2ZM8A 5H6RB 3PF0A 3QC9A 3PDYA 3EDUA 5CB4E 5DQVA 4L0RA 3R84B 5J2TE 5JRCA 3FXDB 3J7Yq 1OWAA 4CI2B 2XAQB 2XUEA 4GIWA 3P8CD 2L8KA 1VRBA 4P0AA 5EZYE 3ZN0B 4AKHA 5KDMC 1X79A 3F31A 2DWGA 2WMOA 3UUMA 4U74A 4ISSA 2MTCA 3TKLB 3NZPA 3ZMUB 4IHJE 4AQFC 4IE6A 5FXXA 5CA0E 3CX6B 4MLKA 4PFPA 5AFUL 3WAJA 4EYUA 2C5IT 2JMKA 1V9DA 2QA7A 4AKRB 3RPUA 2KMFA 5LP6E 5HXEA 4OHFA 5ETWA 5F3JA 2N2NA 3IF8B 5FXVA 4E7SA 2W62A 4GK5E 2Q9QD 3ONXA 2MBGA 4YHJA 2LM9A 4WBOA 3O9XA 2LOSA 2BVMA 3UUNA 2XAFB 5LGUB 3BQLA 2Q9QB 5HXCA 1G73A 4ZI2D 4EXTA 3CKDA 4IIJE 3ZMVB 3FBLA 4X1YE 4ZHQE 5BMVE 2EHOA 2YEVC 3E22E 4H9NC 3BK9A 3H37A 2V7IA 3ZLIA 3JC6C 4UVAB 3CMLA 2A3DA 2K5BB 5HWYA 3ZEFB 5LOVE 5LGNB 2XAJB 4UF0A 4H63H 1US7B 4MHCA 4JEUB 3RYCE 3I1AA 1HS7A 2YU1A 1WRDA 1S94A 1HTJF 1HG5A 2ZM0A 3LK42 4MALA 1BR2A 4ONRA 2HH7A 4TUYE 3HL6A 3V5SA 4BJMA 3DJBA 4NUUA 3PUQA 2LHNA 3JC6D 4IE7A 3UFEA 4QX8B 1LRZA 3O1HA 4H63V 3EUHA 4BAYB 3U3IA 2C5KT 3ESLA 3R6NA 4IGUA 1HFAA 3RYHE 4ASKA 1IZNB 4EZ4A 3AA7B 3C64A 3BQKA 2VASA 4N78D 4G63A 4PJLA 5KX5E 3LBXA 3E0ZA 3RH3A 5JDQA 4O4JE 2M67A 2BVLA 3L09A 5FY7A 3FXEB 2LSGA 3MKDA 3MK7C 4QKNA 4YFSA 4PAGA 2N9DA 3AAAB 4B6XA 5JR9C 3CQCB 1HG2A 3AAIA 5TAOA 4YJ2E 4NUVA 1CUNA 4WW0A 3FHNA 4BGOA 4JEHB 2X67A 2DI4A 2CE7A 2XAHB 2LSYA 2KT9A 3HKDE 2Y48B 2MTQA 2E9XC 4ADZA 3LK3B 3C4WA 4OK0A 2Y6XA 2VL8A 5JREA 1B7TA 4AQFA 4I4TE 3UTKA 2A2FX 5EK3A 4IE5A 5LBQB 3J9X1 5FY1A 1MMAA 3C51A 2LJLA 2V7LA 3PUAA 3WI3A 2XASB 1HCIA 2IAKA 4O4IE 1KK7A 4WNKA 3T8OA 3ZYLA 3RC3A 1VOMA 3VHLA 5JR9B 2D0TA 1SA0E 2WM9A 2P9BA 2HPLA 3HI2A 3K3QC 3V5UA 3OYXA 1YD8G 2E9XD 5ADXL 3PUSA 3KV9A 3HKCE 3H3AA 4OFZA 3KINB 4ZOLE 2E9XB 2CXFA 2DWKA 5LG4A 3AA1B 4ANJA 5EK2A 3F57A 4AQGA 2JMHA 2Q9QC 5L3CB 1IJ5A 2RA1A 2V7KA 2CWOA 4QXCB 3B57A 2H3RA 2B1EA 2LHRA 5LHIB 3I9YA 4DO0A 4K0UA 3W15B 4ZI2C 1D0ZA 4DBQA 3OKQA 3PHF1 4UV9B 3N2OA 2ZLYA 4C91A 1FMVA 3AA0B 2PG8A 2KWIB 5FYMA 3ZMZB 2X68A 2BDEA 2Y8DA 3ANWB 4H9RC 2ZMAA 2V7MA 3ZMSB 4EZHA 4YLHA 1EZ3A 1AJ3A 2DHRA 1BR4A 3AVSA 4H9PC 2X51A 4CXWA 5J1GA 2JPFA 3KFWX 2J1DG 3PU3A 5JDHA 5LNKA 4JLEA 1D1BA 4GK0E 3BQIA 3MA9A 4QWNB 2L3LA 4AKIA 1SHZC 5LBMA 4PK4A 3SOLA 1D0YA 4O8SA 2ACXA 4A56A 3K3NA 4PNIA 3CPZA 3IBPA 4TN7B 4TX5A 1WYBA 1MNDA 5L3BB 3GN5B 5FY0A 2NTYA 5JDGA 1KNZA 3EDVA 5JVDE 1OXZA 4OYJA 2Z6EA 2K24A 3O1JA 5HWXA 3C4XA 1QUUA 4J2CA 3C4ZA 3ZC1A 1D1AA 2CLYB 2CWYA 2I59A 4TZ4C 2VKJA 4OYKA 2NP9A 2RP4A 3A5XA 4X1KE 4GYRA 2LSKA 1G8XA 3Q2MA 4O2AE 5JDMA 3OYZA 5LCYA 4TV9E 2BZBA 4CZZB 4UXNB 2UXXB 3HR0A 4I50E 4DBRA 3LG7A 4GOUA 2CEAA 3HA4A 4TV8E 4L9IA 2XQYA 4KMCA 4UEMA 5DJQC 4KP3C 4ZS2A 3MZKB 1ZHCA 2DCFA 4ZI7E 1D0XA 2CXLA 3N9MA 2JQQA 4ZI3C 4HKAA 4ECGA 5LA6E 2DNXA 5L2LA 1HF8A 1QSDA 3LJCA 4HE8A 2IC6A 5JRCB 3AB3B 5IHYA 1ZEEA 2KLQA 5CA1E 2ZM2A 5HAXA 4PK6A 1S35A 4AI6A 4HEAA 2PBIA 4CXXA 1MIVA 4HGAA 3CQGB 3Q5WA 5LYJE 3KV4A 2EHOC 2PJQA 2K48A 4DMVA 4MBQA 2X9XA 3AT7A 1E1HB 4ZI3D 2LOPA 3IHRA 4X1IE 2MOZA 2Q9QA 4O2BE 2YINA 2CM0A 1BR0A 1BR1A 1YKEB 4HTEA 2LSJA 2MYSA 3OJAA 3PURA 1FMWA 4BJNA 3MJXA 4AKLA 4DNDA 4DVDA 5L3GB 4IDZA 5J2UE 1H7CA 3GA8A 2NW7A 3KBUA 2CA5A 2EHOD 3U78A 3ETVA 2KINB 3KDSE 3QUJA 2CXDA 3D0TA 4EYYR 4HFVA 2EHOB 4PJJA 2W00A 5HYAA 3AAEB 4CI1B 4PFOA 2X0LB 5EK4A 2KZ7B 3N9LA 4XBFB 3L3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDH A;  5HXR A;  3V5U A;  5HYA A;  5JDM A;  5JDQ A;  5HWX A;  5HXE A;  5JDN A;  5JDF A;  5JDG A;  5HWY A;  3V5S A;  5JDL A;  5HXH A;  5HXS A;  5HXC A; 
#chains in the Genus database with same CATH topology
 2WZI A;  3VKH A;  2GK9 A;  2WAU A;  2XAG B;  3UUL A;  2QVA A;  2LSI A;  2SPC A;  3K8P C;  4M1P A;  2ODV A;  3PE0 A;  5L4E A;  1CHU A;  2X9Y A;  5CGM A;  1Y01 A;  4EEB A;  2CCQ A;  2VKD A;  4Z8X A;  4DR7 T;  5JDL A;  3P7I A;  2NTX A;  2CLY C;  3UU3 A;  3P50 A;  3LK2 B;  5HCM A;  3I0O A;  4HWD A;  3RIA A;  2CHN A;  4QXH B;  2UUC T;  4QX7 B;  4EOZ B;  2NR4 A;  1MNE A;  2NWB A;  1Y64 B;  1D1C A;  4H9Q C;  2X9W A;  4O4H E;  2BG9 E;  3S4U A;  2OV9 A;  2E9X A;  2ZM6 T;  3TLU A;  3SWH A;  1MMG A;  4IE0 A;  2VB6 A;  2WU2 A;  3AED A;  4MFR A;  3KVB A;  4ZZB A;  2VL0 A;  1W0B A;  2QGS A;  2WSS V;  3K3O A;  2KVP A;  4HWF A;  2YDS A;  4UEL A;  4P09 A;  4E7Z A;  4HN9 A;  2YK0 A;  5LHH B;  4QXB B;  4HWH A;  3ZST A;  1IJ6 A;  1OED A;  3NRX A;  4EB6 E;  4CXY A;  5FXW A;  1W0A A;  4KHZ F;  4DMW A;  3N2G E;  3O4X E;  4ERR A;  2XM1 A;  4IE4 A;  5L3E B;  3QK6 A;  1YKH B;  2XQ4 A;  3ZCJ A;  2BBH A;  3L39 A;  3DP7 A;  3VJZ A;  4PW8 A;  4AQY T;  5FNV E;  3GMI A;  1YW0 A;  5JDF A;  4I43 B;  4WBN E;  4FJO A;  4DV5 T;  2B76 A;  1NEK A;  1W9R A;  1NWM X;  2WBL A;  2KND A;  1T98 A;  2V6Y B;  3AA6 B;  3QC9 A;  3PDY A;  4HFC A;  5LG3 A;  5DQV A;  3FYQ A;  1XMO T;  2XAQ B;  4GIW A;  5KDM C;  3F31 A;  3UUM A;  3TKL B;  1M62 A;  4IE6 A;  5FXX A;  5CA0 E;  3CX6 B;  5AFU L;  3FZL B;  2M6I A;  4AKR B;  3LDQ B;  2I6H A;  5HXE A;  5HEH A;  5JTG A;  5AQG B;  4E7S A;  5ABF A;  2Q9Q D;  2MBG A;  5LMU T;  3JCF A;  5LGU B;  2Q9Q B;  5HXC A;  2XSA A;  4ZI2 D;  4X62 T;  3CK6 A;  3ZMV B;  4ZHQ E;  2YEV C;  2V7I A;  3AEE A;  2LKH A;  1XMQ T;  3CML A;  2AXD S;  1J5W A;  2W67 A;  3VR9 A;  4H63 H;  3I1A A;  1WRD A;  1S94 A;  3AE9 A;  2ZM0 A;  2LHN A;  4IE7 A;  3UFE A;  1LRZ A;  1UK5 A;  3ABV A;  3R6N A;  3RYH E;  3P4S A;  3AE2 A;  4NXN T;  3CIR A;  2VAS A;  2MAW A;  5JDQ A;  5AQJ B;  4IDN A;  4O4J E;  2M67 A;  3L09 A;  5FY7 A;  2LSG A;  4QKN A;  1E2A A;  1HG2 A;  2LM2 A;  3AAI A;  5TAO A;  4YJ2 E;  2X67 A;  2LSY A;  1NEN A;  4EGW A;  2Y48 B;  5JRE A;  4IDO A;  5EK3 A;  5J0Z A;  3SFD A;  3J9X 1;  3WI3 A;  2ACZ A;  2LJL A;  2XAS B;  4DR6 T;  4O4I E;  4A98 A;  3T8O A;  3VHL A;  2D0T A;  4HFI A;  2LLY A;  2WM9 A;  1YD8 G;  3P4P A;  2I0M A;  4JI7 T;  3KV9 A;  2WY2 A;  3AA1 B;  3AEF A;  5L3C B;  2V7K A;  2X0C A;  2D9D A;  2PTF A;  1D0Z A;  2XSB A;  3OKQ A;  3PHF 1;  1JNR A;  4U3C A;  4X66 T;  2PG8 A;  2FJA A;  2Y8D A;  4H9R C;  2ZMA A;  2V7M A;  2L10 A;  4YLH A;  1AJ3 A;  4H9P C;  4CXW A;  2J1D G;  3PU3 A;  4YSZ A;  4GK0 E;  4QWN B;  3SOL A;  1YQ3 A;  4TN7 B;  5LB7 B;  1WYB A;  5L3B B;  2R6G F;  3GN5 B;  5JVD E;  2BS4 A;  3ZC1 A;  2I59 A;  5F5W A;  1KF6 A;  3LSV A;  2NP9 A;  4ILA A;  1G8X A;  5JDM A;  5LCY A;  4TV9 E;  2UXX B;  1T72 A;  3HA4 A;  4UEM A;  5DJQ C;  2DCF A;  1UUS A;  4X65 T;  3N9M A;  4ECG A;  4ZI3 C;  4HKA A;  5LA6 E;  2DNX A;  2YDQ A;  2CBI A;  1HF8 A;  1QSD A;  2IC6 A;  3AB3 B;  2BG9 B;  4TWH A;  2BBJ A;  3PUY F;  2PBI A;  3L8R A;  2X0H A;  5LYJ E;  2K48 A;  2YIN A;  4U7Y A;  4EED A;  1FMW A;  5HEJ A;  4AKL A;  1IBM T;  4DUY T;  2W2U A;  3KBU A;  2CA5 A;  2EHO D;  4JI3 T;  2EHO B;  4CI1 B;  1T7S A;  2A9U A;  3N9L A;  4XBF B;  2W0G A;  2KWH A;  4UF0 B;  2VK9 A;  3AVR A;  3CWZ B;  2YKS A;  3N9O A;  1HNX T;  1XNR T;  5ABH A;  5HCJ A;  5FXZ A;  3OBV E;  5JH7 E;  3SS1 A;  2XQ7 A;  2XHE B;  3AE6 A;  4UIG A;  3SFE A;  3KVA A;  3FBZ A;  3AEB A;  3WUR A;  3LBX B;  2V1D B;  1DU2 A;  2C0S A;  2V8S V;  4EV6 A;  5LXT E;  4DR5 T;  4XAX B;  1M7K A;  2CPT A;  2UXD T;  2NOX A;  2JQ9 A;  4EAH A;  3N9N A;  2WB5 A;  3Q9D A;  1HNZ T;  4KBM B;  3UU8 A;  3ZYM A;  5FP3 A;  1HX8 A;  4EIW A;  5LJM A;  2D2S A;  3I9W A;  3NRY A;  4ILC A;  3EI0 A;  1FEW A;  3T1Y T;  3O1I A;  2NW9 A;  1N33 T;  4UV8 B;  2YU2 A;  3M1C A;  1MIY A;  3CX8 B;  3A7M A;  2E5V A;  2W61 A;  2K3W A;  2ES0 A;  3RYI E;  2K9A A;  3ETU A;  4AXP A;  3HKB E;  4U31 A;  4LF4 T;  3UT5 E;  5HXR A;  3NBX X;  3EAB A;  3AE3 A;  3ANW A;  4HFB A;  4XZC A;  3ZMT B;  4DR4 T;  1MMN A;  3G06 A;  3RKO A;  3AEC A;  2XQ8 A;  5DAB A;  4KUM B;  5HXS A;  2JRK A;  1XNQ T;  2UXN B;  5KMG P;  3ZJ2 A;  2J62 A;  4B3S T;  3ZPO A;  3ZC0 A;  2OLT A;  5AQF B;  3AE5 A;  2E8I A;  3FZF B;  3MAC A;  1WYC A;  1HX1 B;  2WWU A;  3KV5 A;  5GON E;  4DV3 T;  4QH1 A;  3RX6 A;  5L3F B;  4QHO A;  2X9H A;  1WFD A;  4PJN A;  2XZE A;  3SRZ A;  4YTM A;  4PK5 A;  3RYF E;  2D0U A;  2HPJ A;  2QRX A;  1LKX A;  4I55 E;  4YHH T;  1SUM B;  2DL1 A;  1X9B A;  3AEA A;  2ZM8 A;  3PF0 A;  4CN1 A;  3EDU A;  2FUP A;  3J7Y q;  1OWA A;  1N36 T;  2L8K A;  2XY8 B;  1X79 A;  2MTC A;  2DWG A;  3NZP A;  5AQO B;  4PFP A;  2QA7 A;  3AE1 A;  3RPU A;  4Z91 A;  5ETW A;  3IF8 B;  5FXV A;  4IRE A;  4JI1 T;  2W62 A;  4GK5 E;  3ONX A;  2IDO B;  2LM9 A;  2LOS A;  2LRK A;  4ZXL A;  4DR3 T;  3FBL A;  4JBW F;  3ZLI A;  2HHH T;  3AE8 A;  2K5B B;  3ZEF B;  5LOV E;  2XAJ B;  4MHC A;  4YTP A;  1W09 A;  3QB5 A;  4ONR A;  4TUY E;  3PUX F;  4JYA T;  3V5S A;  4BJM A;  3PUQ A;  1YQ4 A;  4QX8 B;  4BAY B;  3ESL A;  3C64 A;  1I6Z A;  4G63 A;  2XPK A;  3VR8 A;  4F8H A;  5KX5 E;  3P4W A;  3E0Z A;  1FJG T;  1WR0 A;  3MKD A;  4YFS A;  3AAA B;  4NUV A;  4WW0 A;  4BGO A;  1JNZ A;  2XAH B;  3JAE A;  3C4W A;  2VL8 A;  4AQF A;  4DV7 T;  3UTK A;  5FY1 A;  1MMA A;  3C51 A;  3PUA A;  1KEY A;  1KNP A;  2IAK A;  1KK7 A;  5JR9 B;  4LF8 T;  3K3Q C;  4IT4 A;  3AEG A;  4DUZ T;  5ADX L;  2LRL A;  3NVO A;  2VVN A;  5EK2 A;  4AQG A;  1IJ5 A;  3Q5E A;  3B57 A;  5CJ5 A;  2H3R A;  3N2O A;  3AA0 B;  1EZ3 A;  2UUA T;  5CFB A;  2DHR A;  3AVS A;  1N32 T;  3KFW X;  4JLE A;  1D1B A;  3MA9 A;  4KI0 F;  4AKI A;  1SHZ C;  5AQL B;  3AE4 A;  1UUR A;  4O8S A;  4A56 A;  4LFC T;  3CPZ A;  3IBP A;  4TX5 A;  1MND A;  3UFG A;  5FY0 A;  5JDG A;  3EDV A;  1OXZ A;  4OYJ A;  2Z6E A;  2K24 A;  4IDP A;  2BG9 C;  2V6Y A;  2CLY B;  2CWY A;  4LF9 T;  2VKJ A;  2XJ7 A;  4OYK A;  3A5X A;  4X1K E;  3OYZ A;  4LF5 T;  4DV1 T;  2CEA A;  4L9I A;  4KMC A;  3DYJ A;  3MZK B;  4YT0 A;  1D0X A;  1L0V A;  4YXD A;  2V5D A;  4HE8 A;  5JRC B;  5IHY A;  3RLF F;  1ZEE A;  2KLQ A;  5CA1 E;  3Q5D A;  4IL4 A;  4HEA A;  5FKY A;  2EHO C;  4DMV A;  2X9X A;  4JI4 T;  2JQH A;  2MOZ A;  2Q9Q A;  1BR0 A;  2CM0 A;  2WDR A;  3OJA A;  3MJX A;  4DND A;  4IDZ A;  4X5T A;  3U78 A;  2XQA A;  5FL0 A;  3TLV A;  1SJ7 A;  4PJJ A;  4BA9 A;  5A1L A;  4V1A v;  1UCU A;  4CQI A;  3UU4 A;  1OED E;  3IEE A;  2WCA A;  4P0B A;  3N2K E;  3VKG A;  2A72 A;  3FZH B;  5C8Y E;  3K1S A;  4NIQ A;  3MXZ A;  5L3D B;  2V26 A;  2IW5 B;  2JJ9 A;  3TLS A;  1ZOY A;  2IC9 A;  4U72 A;  2KXP B;  4LMJ A;  5T1D A;  3GWH A;  4GYS A;  1IBK T;  4X20 E;  4TWF A;  5JDN A;  5L47 A;  3ZN1 B;  4LMK A;  4A97 A;  2N1G A;  4LML A;  4L5G A;  3Q5X A;  5FVK A;  3KBT A;  3VU7 H;  4AKG A;  4AIS A;  1LVF A;  4C90 A;  4F6R C;  3OTO T;  2UXB T;  1I94 T;  3AXJ B;  1WLX A;  1J1J A;  3AE7 A;  3UUX B;  3HKE E;  3ZT6 A;  3PU8 A;  4PJM A;  5HXH A;  2ODU A;  4O4L E;  4UR9 A;  2X66 A;  3H3M A;  2JQK A;  5HEO A;  1ZV4 X;  1FIO A;  2LT3 A;  2VKH A;  4U2Y A;  5AQT B;  5FMN A;  4NXM T;  2WZH A;  4LF7 T;  3RRC A;  3DTO A;  4NPP A;  4YTN A;  3GN5 A;  4CN4 A;  4LFA T;  1IAP A;  4OX9 T;  3PUG A;  3EVY A;  3I0Q A;  5ABE A;  4JI8 T;  2CBJ A;  2J47 A;  3ZT5 A;  2OA5 A;  3WAK A;  2LE8 A;  4HFE A;  5LJN A;  3CQX C;  3KV6 A;  4AIU A;  3B13 A;  2XTL A;  2VQF T;  1SJ8 A;  2PFV A;  4Q25 A;  1ZKE A;  2XQ5 A;  1GQE A;  3CVR A;  3CX7 B;  2DLR A;  2VKO A;  3ONL C;  3R84 B;  5J2T E;  3FXD B;  2BG9 A;  2XUE A;  3P8C D;  1KFY A;  4AKH A;  3ZN0 B;  2WMO A;  3ZMU B;  4AQF C;  4MLK A;  4EYU A;  2C5I T;  2JMK A;  1HR0 T;  2KMF A;  5LP6 E;  4OHF A;  5F3J A;  2UXC T;  2N2N A;  1WCR A;  4YHJ A;  2WDQ A;  4WBO A;  3O9X A;  3UUN A;  4HWC A;  2XAF B;  3BQL A;  4ZEY A;  4EXT A;  4IIJ E;  2L7N A;  4X1Y E;  2EHO A;  3E22 E;  3H37 A;  2XM2 A;  5KXJ A;  4UVA B;  2A3D A;  5AQV B;  5HWY A;  3X1D A;  5LGN B;  4UF0 A;  1US7 B;  4U2Z A;  3RYC E;  2YU1 A;  1HTJ F;  1HG5 A;  4MAL A;  1BR2 A;  2HH7 A;  3HL6 A;  3DJB A;  3JC6 D;  4H63 V;  3U3I A;  4IGU A;  1IZN B;  3RHW A;  3T1H T;  2KSR A;  2XQ6 A;  3LBX A;  3RH3 A;  3PV0 F;  2QYW A;  4HFH A;  4U7I A;  1XZY A;  2IUB A;  4LF6 T;  5JR9 C;  4JI0 T;  4JEH B;  2WQY A;  2CE7 A;  3HKD E;  2KT9 A;  1SE7 A;  4JI5 T;  2MTQ A;  4ADZ A;  2A2F X;  3EHZ A;  4IE5 A;  5LBQ B;  2V7L A;  1HCI A;  4WNK A;  5FVL A;  1VOM A;  3RC3 A;  4IL9 A;  5C2T A;  2HPL A;  3V5U A;  3OYX A;  2E9X D;  4KX6 A;  3PUS A;  4GKK T;  3HKC E;  3H3A A;  3QOF A;  2E9X B;  2DWK A;  5LG4 A;  5C3J A;  2BKN A;  2JMH A;  2Q9Q C;  5AQQ B;  4A5X A;  2F4V T;  3RIU C;  5AQU B;  3RI5 A;  2B1E A;  4GKJ T;  5LHI B;  2CRB A;  3I9Y A;  4DO0 A;  4ZI2 C;  4UV9 B;  2ZLY A;  1FMV A;  5FYM A;  2KWI B;  3UUB A;  2VUR A;  3UU5 A;  1OED B;  5J1G A;  2JPF A;  3RIF A;  5AQN B;  3RGL A;  3BQI A;  4JI6 T;  5LBM A;  4PK4 A;  3K3N A;  4PNI A;  2NTY A;  1QUU A;  1E7P A;  4TZ4 C;  4GYR A;  2LSK A;  4O2A E;  5FL1 A;  2FJE A;  4DR1 T;  4UXN B;  4DBR A;  3LG7 A;  4DV4 T;  4GOU A;  4TV8 E;  3ZKR A;  1ZHC A;  2CXL A;  2JQQ A;  5L2L A;  5AQP B;  5IWA T;  5HAX A;  2IML A;  4PK6 A;  4CXX A;  3QNU A;  3CQG B;  3Q5W A;  5AQK B;  5AQR B;  2PJQ A;  4MBQ A;  3PUW F;  1E1H B;  2LOP A;  4X1I E;  1YXR A;  5BR8 T;  1BR1 A;  4HTE A;  3P4Q A;  3PUR A;  4JI2 T;  5ABF B;  4DVD A;  5L3G B;  1H7C A;  3NWI A;  4WYV A;  4DV0 T;  2NW7 A;  3ETV A;  2KIN B;  3QUJ A;  4HFV A;  2W00 A;  5HYA A;  3AAE B;  2BS2 A;  2KZ7 B;  3ZJ1 A;  4ILB A;  4DV2 T;  4B3M T;  4P1N A;  2BKO A;  4DID B;  4IST A;  5JQG E;  3ZCI A;  4G2A A;  3PTR B;  3NZQ A;  2M6B A;  5H6Q B;  3WSC A;  5IYZ E;  2LEH A;  2V7J A;  4ZS3 A;  3ONJ A;  2CMR A;  1VCT A;  4JUY A;  3F2E A;  2W63 A;  3RRW A;  3ZT7 A;  4YSY A;  2BKP A;  1MMD A;  2VVS A;  4FI5 A;  4ILU A;  4H9S E;  2FJD A;  5LGT B;  1Z8U A;  2H7O A;  1ZP0 A;  2D5U A;  1NAF A;  4WZX A;  5JR9 A;  3AY5 A;  2KGX A;  2E5L T;  2H89 A;  2WP9 A;  2UU9 T;  4X64 T;  3ZYK A;  2WU5 A;  2G0U A;  2NW8 A;  2WMN A;  4YJ3 E;  1U4Q A;  3E08 A;  4HWI B;  3FB2 A;  5ABG A;  5DQW A;  2C5J A;  2VWA A;  2H7V C;  3FZK B;  2L9Q A;  4HFD A;  3LFM A;  4UVB B;  2V6X A;  2HN2 A;  2KBB A;  2JIW A;  3N9P A;  1WR6 A;  2J4G A;  3N9Q A;  3C50 A;  2BS3 A;  1N34 T;  2H88 A;  3M65 A;  3NKZ A;  3RIU A;  1IBL T;  4DV6 T;  5L4H A;  3TLW A;  3P4R A;  1UX5 A;  3FZM B;  3QB5 K;  4UVC B;  5F8P A;  4CI3 B;  2LQU A;  3C98 B;  5M4Y A;  2FJB A;  1MIW A;  2HN1 A;  3OPC A;  1O3X A;  1UX4 A;  1LVK A;  4U33 A;  1Z0P A;  5E0O A;  3RQU A;  1T8B A;  1XWM A;  5LHG B;  4H9O C;  1J5E T;  1U5P A;  3RC8 A;  3N5L A;  5H6R B;  5CB4 E;  4L0R A;  2XQ9 A;  1XDO A;  5JRC A;  4CI2 B;  1VRB A;  4P0A A;  5EZY E;  4U74 A;  4ISS A;  4IHJ E;  3RQW A;  3WAJ A;  1V9D A;  3PUZ F;  2X0Y A;  3EAM A;  5HEG A;  5AQH B;  3PUV F;  2IIU A;  4QH4 A;  2BVM A;  5AQS B;  1G73 A;  2W66 A;  2MPK A;  3CKD A;  5BMV E;  4H9N C;  3BK9 A;  4F7G B;  3JC6 C;  3A8Y C;  2WWV A;  3TLT A;  4JEU B;  2YDR A;  3VRB A;  1HS7 A;  3LK4 2;  4B3R T;  4NUU A;  4W8P A;  1XDP A;  3O1H A;  3EUH A;  2C5K T;  1HFA A;  4ASK A;  4EZ4 A;  3AA7 B;  3BQK A;  4N78 D;  4PJL A;  1UGO A;  3PJA J;  5LMN T;  2BVL A;  3FXE B;  2FBW A;  3MK7 C;  4PAG A;  3M3Z B;  3JAF A;  1HNW T;  2N9D A;  4B6X A;  3CQC B;  1CUN A;  3FHN A;  4QH5 A;  4YY3 T;  2DI4 A;  4COF A;  2E9X C;  3LK3 B;  3ZSS A;  5AQI B;  4OK0 A;  2Y6X A;  1B7T A;  4I4T E;  4JV5 T;  3PJA A;  3UQ4 A;  3IA3 A;  3JAD A;  3ZYL A;  4YSX A;  5AQM B;  1SA0 E;  3HI2 A;  2P9B A;  3RKG A;  4OFZ A;  3KIN B;  4TWD A;  4ZOL E;  2CXF A;  2XQ3 A;  3AXJ A;  4ANJ A;  1OED C;  3F57 A;  2RA1 A;  4KHP T;  2CWO A;  4QXC B;  3RF1 A;  2VQE T;  2LHR A;  4K0U A;  3W15 B;  4TNV A;  4DBQ A;  4C91 A;  4LFB T;  3ZMZ B;  2X68 A;  2BDE A;  3ANW B;  5HEU A;  3ZMS B;  4EZH A;  2V5C A;  2WS3 A;  1BR4 A;  2X51 A;  5JDH A;  5LNK A;  2L3L A;  4ZZC A;  1D0Y A;  2RPA A;  2ACX A;  4Z90 A;  1VCS A;  2WDV A;  1KNZ A;  3UU6 A;  5FZT A;  3O1J A;  4I0U A;  5HWX A;  4K0K T;  3C4X A;  2UUB T;  4J2C A;  2YOE A;  3C4Z A;  2IHR 1;  1D1A A;  3VRA A;  2RP4 A;  3Q2M A;  2YN6 A;  2BZB A;  4CZZ B;  3HR0 A;  4I50 E;  2XQY A;  4ZS2 A;  4KP3 C;  3B5M A;  4ZI7 E;  2LKG A;  5IUX A;  3UQ7 A;  2E2A A;  3LJC A;  3OVU A;  2ZM2 A;  4AI6 A;  1S35 A;  1MIV A;  4HGA A;  2W4X A;  2CHO A;  4IDQ A;  3KV4 A;  3AT7 A;  1QLB A;  4ZI3 D;  3IHR A;  4B3T T;  4O2B E;  1YKE B;  2LSJ A;  2MYS A;  4BJN A;  1R8I A;  5J2U E;  3GA8 A;  2AE9 A;  3KDS E;  4CN6 A;  2CXD A;  3D0T A;  4EYY R;  4TNW A;  4DR2 T;  4PFO A;  2X0L B;  5EK4 A;  1KNR A;  3L3P A; 
#chains in the Genus database with same CATH homology
 2W0G A;  2KWH A;  4BA9 A;  3ZJ1 A;  4UF0 B;  5A1L A;  2VK9 A;  3VKH A;  4V1A v;  2GK9 A;  1UCU A;  3AVR A;  3CWZ B;  3N9O A;  4CQI A;  2WAU A;  2XAG B;  4IST A;  3UUL A;  3IEE A;  5JQG E;  5FXZ A;  3ZCI A;  3OBV E;  2LSI A;  2SPC A;  4P0B A;  4G2A A;  3N2K E;  3K8P C;  3PTR B;  4M1P A;  2A72 A;  3VKG A;  2ODV A;  3PE0 A;  3NZQ A;  5JH7 E;  3SS1 A;  5C8Y E;  2X9Y A;  2XHE B;  4UIG A;  2CCQ A;  3KVA A;  5H6Q B;  3WSC A;  5IYZ E;  3FBZ A;  3MXZ A;  2VKD A;  3WUR A;  2LEH A;  3LBX B;  2V1D B;  2V7J A;  4Z8X A;  4ZS3 A;  2C0S A;  2V26 A;  5L3D B;  2CMR A;  5LXT E;  2IW5 B;  4XAX B;  5JDL A;  3P7I A;  2NTX A;  2JJ9 A;  2CLY C;  4JUY A;  3LK2 B;  3F2E A;  2W63 A;  3RRW A;  2NOX A;  4EAH A;  3N9N A;  3I0O A;  3Q9D A;  1MMD A;  4FI5 A;  4QXH B;  2IC9 A;  4ILU A;  4H9S E;  4U72 A;  4KBM B;  2KXP B;  5LGT B;  4QX7 B;  3ZYM A;  5FP3 A;  5T1D A;  4EOZ B;  1HX8 A;  2H7O A;  4EIW A;  5LJM A;  2D2S A;  2D5U A;  1NAF A;  3GWH A;  4GYS A;  1MNE A;  4X20 E;  5JR9 A;  3I9W A;  2NWB A;  3NRY A;  5JDN A;  1Y64 B;  1D1C A;  4H9Q C;  2X9W A;  4O4H E;  3ZN1 B;  1FEW A;  3O1I A;  2NW9 A;  4UV8 B;  2N1G A;  2YU2 A;  3M1C A;  1MIY A;  3S4U A;  3CX8 B;  2E9X A;  3ZYK A;  2G0U A;  4L5G A;  2W61 A;  3Q5X A;  2NW8 A;  2WMN A;  4YJ3 E;  3KBT A;  3SWH A;  2ES0 A;  3RYI E;  1U4Q A;  2K9A A;  3VU7 H;  4AKG A;  1MMG A;  4IE0 A;  3E08 A;  3ETU A;  4AXP A;  1LVF A;  3FB2 A;  4C90 A;  2VB6 A;  4F6R C;  5DQW A;  4MFR A;  3KVB A;  3HKB E;  2C5J A;  2VWA A;  3UT5 E;  5HXR A;  2QGS A;  2WSS V;  3K3O A;  2H7V C;  1WLX A;  4UEL A;  4P09 A;  2L9Q A;  4E7Z A;  3NBX X;  3LFM A;  4UVB B;  3UUX B;  3HKE E;  4HN9 A;  3ANW A;  2YK0 A;  4XZC A;  3ZMT B;  5LHH B;  3PU8 A;  4QXB B;  3N9P A;  1WR6 A;  4PJM A;  5HXH A;  3N9Q A;  1MMN A;  2ODU A;  4O4L E;  3C50 A;  3RKO A;  1IJ6 A;  3NRX A;  5DAB A;  4EB6 E;  2X66 A;  4KUM B;  5HXS A;  4CXY A;  2JRK A;  3M65 A;  5FXW A;  1ZV4 X;  1FIO A;  2LT3 A;  2UXN B;  2VKH A;  3ZJ2 A;  5KMG P;  3ZPO A;  5FMN A;  4DMW A;  3N2G E;  3O4X E;  3ZC0 A;  4ERR A;  1UX5 A;  4IE4 A;  5L3E B;  2E8I A;  3QK6 A;  1YKH B;  3MAC A;  4UVC B;  3RRC A;  3DTO A;  1WYC A;  3GN5 A;  3ZCJ A;  1IAP A;  2WWU A;  3PUG A;  3DP7 A;  3KV5 A;  5F8P A;  3EVY A;  5GON E;  3I0Q A;  4CI3 B;  3VJZ A;  2LQU A;  4PW8 A;  3C98 B;  3RX6 A;  5L3F B;  4QHO A;  2X9H A;  5FNV E;  5M4Y A;  3GMI A;  4PJN A;  1YW0 A;  5JDF A;  4I43 B;  1MIW A;  3SRZ A;  4WBN E;  1O3X A;  4FJO A;  2OA5 A;  4PK5 A;  3WAK A;  2LE8 A;  2D0U A;  3CQX C;  1UX4 A;  2HPJ A;  3KV6 A;  1LVK A;  5E0O A;  1Z0P A;  3RYF E;  5LJN A;  1NWM X;  1LKX A;  3B13 A;  2WBL A;  4I55 E;  2KND A;  2XTL A;  2PFV A;  1ZKE A;  5LHG B;  1T98 A;  4H9O C;  1U5P A;  3RC8 A;  3CVR A;  3CX7 B;  2DLR A;  2VKO A;  3AA6 B;  3N5L A;  2ZM8 A;  5H6R B;  3PF0 A;  3QC9 A;  3PDY A;  3EDU A;  5CB4 E;  5DQV A;  4L0R A;  3R84 B;  5J2T E;  5JRC A;  3FXD B;  3J7Y q;  1OWA A;  4CI2 B;  2XAQ B;  2XUE A;  4GIW A;  3P8C D;  2L8K A;  1VRB A;  4P0A A;  5EZY E;  3ZN0 B;  4AKH A;  5KDM C;  1X79 A;  3F31 A;  2DWG A;  2WMO A;  3UUM A;  4U74 A;  4ISS A;  2MTC A;  3TKL B;  3NZP A;  3ZMU B;  4IHJ E;  4AQF C;  4IE6 A;  5FXX A;  5CA0 E;  3CX6 B;  4MLK A;  4PFP A;  5AFU L;  3WAJ A;  4EYU A;  2C5I T;  2JMK A;  1V9D A;  2QA7 A;  4AKR B;  3RPU A;  2KMF A;  5LP6 E;  5HXE A;  4OHF A;  5ETW A;  5F3J A;  2N2N A;  3IF8 B;  5FXV A;  4E7S A;  2W62 A;  4GK5 E;  2Q9Q D;  3ONX A;  2MBG A;  4YHJ A;  2LM9 A;  4WBO A;  3O9X A;  2LOS A;  2BVM A;  3UUN A;  2XAF B;  5LGU B;  3BQL A;  2Q9Q B;  5HXC A;  1G73 A;  4ZI2 D;  4EXT A;  3CKD A;  4IIJ E;  3ZMV B;  3FBL A;  4X1Y E;  4ZHQ E;  5BMV E;  2EHO A;  2YEV C;  3E22 E;  4H9N C;  3BK9 A;  3H37 A;  2V7I A;  3ZLI A;  3JC6 C;  4UVA B;  3CML A;  2A3D A;  2K5B B;  5HWY A;  3ZEF B;  5LOV E;  5LGN B;  2XAJ B;  4UF0 A;  4H63 H;  1US7 B;  4MHC A;  4JEU B;  3RYC E;  3I1A A;  1HS7 A;  2YU1 A;  1WRD A;  1S94 A;  1HTJ F;  1HG5 A;  2ZM0 A;  3LK4 2;  4MAL A;  1BR2 A;  4ONR A;  2HH7 A;  4TUY E;  3HL6 A;  3V5S A;  4BJM A;  3DJB A;  4NUU A;  3PUQ A;  2LHN A;  3JC6 D;  4IE7 A;  3UFE A;  4QX8 B;  1LRZ A;  3O1H A;  4H63 V;  3EUH A;  4BAY B;  3U3I A;  2C5K T;  3ESL A;  3R6N A;  4IGU A;  1HFA A;  3RYH E;  4ASK A;  1IZN B;  4EZ4 A;  3AA7 B;  3C64 A;  3BQK A;  2VAS A;  4N78 D;  4G63 A;  4PJL A;  5KX5 E;  3LBX A;  3E0Z A;  3RH3 A;  5JDQ A;  4O4J E;  2M67 A;  2BVL A;  3L09 A;  5FY7 A;  3FXE B;  2LSG A;  3MKD A;  3MK7 C;  4QKN A;  4YFS A;  4PAG A;  2N9D A;  3AAA B;  4B6X A;  5JR9 C;  3CQC B;  1HG2 A;  3AAI A;  5TAO A;  4YJ2 E;  4NUV A;  1CUN A;  4WW0 A;  3FHN A;  4BGO A;  4JEH B;  2X67 A;  2DI4 A;  2CE7 A;  2XAH B;  2LSY A;  2KT9 A;  3HKD E;  2Y48 B;  2MTQ A;  2E9X C;  4ADZ A;  3LK3 B;  3C4W A;  4OK0 A;  2Y6X A;  2VL8 A;  5JRE A;  1B7T A;  4AQF A;  4I4T E;  3UTK A;  2A2F X;  5EK3 A;  4IE5 A;  5LBQ B;  3J9X 1;  5FY1 A;  1MMA A;  3C51 A;  2LJL A;  2V7L A;  3PUA A;  3WI3 A;  2XAS B;  1HCI A;  2IAK A;  4O4I E;  1KK7 A;  4WNK A;  3T8O A;  3ZYL A;  3RC3 A;  1VOM A;  3VHL A;  5JR9 B;  2D0T A;  1SA0 E;  2WM9 A;  2P9B A;  2HPL A;  3HI2 A;  3K3Q C;  3V5U A;  3OYX A;  1YD8 G;  2E9X D;  5ADX L;  3PUS A;  3KV9 A;  3HKC E;  3H3A A;  4OFZ A;  3KIN B;  4ZOL E;  2E9X B;  2CXF A;  2DWK A;  5LG4 A;  3AA1 B;  4ANJ A;  5EK2 A;  3F57 A;  4AQG A;  2JMH A;  2Q9Q C;  5L3C B;  1IJ5 A;  2RA1 A;  2V7K A;  2CWO A;  4QXC B;  3B57 A;  2H3R A;  2B1E A;  2LHR A;  5LHI B;  3I9Y A;  4DO0 A;  4K0U A;  3W15 B;  4ZI2 C;  1D0Z A;  4DBQ A;  3OKQ A;  3PHF 1;  4UV9 B;  3N2O A;  2ZLY A;  4C91 A;  1FMV A;  3AA0 B;  2PG8 A;  2KWI B;  5FYM A;  3ZMZ B;  2X68 A;  2BDE A;  2Y8D A;  3ANW B;  4H9R C;  2ZMA A;  2V7M A;  3ZMS B;  4EZH A;  4YLH A;  1EZ3 A;  1AJ3 A;  2DHR A;  1BR4 A;  3AVS A;  4H9P C;  2X51 A;  4CXW A;  5J1G A;  2JPF A;  3KFW X;  2J1D G;  3PU3 A;  5JDH A;  5LNK A;  4JLE A;  1D1B A;  4GK0 E;  3BQI A;  3MA9 A;  4QWN B;  2L3L A;  4AKI A;  1SHZ C;  5LBM A;  4PK4 A;  3SOL A;  1D0Y A;  4O8S A;  2ACX A;  4A56 A;  3K3N A;  4PNI A;  3CPZ A;  3IBP A;  4TN7 B;  4TX5 A;  1WYB A;  1MND A;  5L3B B;  3GN5 B;  5FY0 A;  2NTY A;  5JDG A;  1KNZ A;  3EDV A;  5JVD E;  1OXZ A;  4OYJ A;  2Z6E A;  2K24 A;  3O1J A;  5HWX A;  3C4X A;  1QUU A;  4J2C A;  3C4Z A;  3ZC1 A;  1D1A A;  2CLY B;  2CWY A;  2I59 A;  4TZ4 C;  2VKJ A;  4OYK A;  2NP9 A;  2RP4 A;  3A5X A;  4X1K E;  4GYR A;  2LSK A;  1G8X A;  3Q2M A;  4O2A E;  5JDM A;  3OYZ A;  5LCY A;  4TV9 E;  2BZB A;  4CZZ B;  4UXN B;  2UXX B;  3HR0 A;  4I50 E;  4DBR A;  3LG7 A;  4GOU A;  2CEA A;  3HA4 A;  4TV8 E;  4L9I A;  2XQY A;  4KMC A;  4UEM A;  5DJQ C;  4KP3 C;  4ZS2 A;  3MZK B;  1ZHC A;  2DCF A;  4ZI7 E;  1D0X A;  2CXL A;  3N9M A;  2JQQ A;  4ZI3 C;  4HKA A;  4ECG A;  5LA6 E;  2DNX A;  5L2L A;  1HF8 A;  1QSD A;  3LJC A;  4HE8 A;  2IC6 A;  5JRC B;  3AB3 B;  5IHY A;  1ZEE A;  2KLQ A;  5CA1 E;  2ZM2 A;  5HAX A;  4PK6 A;  1S35 A;  4AI6 A;  4HEA A;  2PBI A;  4CXX A;  1MIV A;  4HGA A;  3CQG B;  3Q5W A;  5LYJ E;  3KV4 A;  2EHO C;  2PJQ A;  2K48 A;  4DMV A;  4MBQ A;  2X9X A;  3AT7 A;  1E1H B;  4ZI3 D;  2LOP A;  3IHR A;  4X1I E;  2MOZ A;  2Q9Q A;  4O2B E;  2YIN A;  2CM0 A;  1BR0 A;  1BR1 A;  1YKE B;  4HTE A;  2LSJ A;  2MYS A;  3OJA A;  3PUR A;  1FMW A;  4BJN A;  3MJX A;  4AKL A;  4DND A;  4DVD A;  5L3G B;  4IDZ A;  5J2U E;  1H7C A;  3GA8 A;  2NW7 A;  3KBU A;  2CA5 A;  2EHO D;  3U78 A;  3ETV A;  2KIN B;  3KDS E;  3QUJ A;  2CXD A;  3D0T A;  4EYY R;  4HFV A;  2EHO B;  4PJJ A;  2W00 A;  5HYA A;  3AAE B;  4CI1 B;  4PFO A;  2X0L B;  5EK4 A;  2KZ7 B;  3N9L A;  4XBF B;  3L3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...