5HXEA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 100 mm na+ and zero ca2+
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
304
structure length
297
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRMGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
molecule keywords sodium,calcium exchanger
total genus 126
structure length 297
sequence length 304
ec nomenclature
pdb deposition date 2016-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hxeA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hxeA02
5JDLA 5JDGA 3V5UA 5JDFA 5HXEA 5JDHA 5JDMA 5HXHA 5HXSA 5JDQA 5HWYA 3V5SA 5HXRA 5HWXA 5HYAA 5JDNA 5HXCA
chains in the Genus database with same CATH superfamily
3P7IA 3FZFB 3T8OA 3PUZF 4IT4A 3I9WA 4COFA 4HWCA 2CHOA 2WZIA 1XWMA 4UIGA 1XDOA 2MTQA 2X67A 1OEDE 2IIUA 2QYWA 2H89A 2W62A 4HFBA 4MFRA 5HXRA 5A1LA 2N2NA 5GONE 2AE9A 2MYSA 5KDMC 2XPKA 1X79A 4PW8A 2E9XB 4PJMA 2KINB 2J4GA 2M6BA 4H9QC 5L47A 3CX8B 4EGWA 3LBXB 1UK5A 5LHIB 3PU3A 2V7KA 1QUUA 3EVYA 3PUGA 4J2CA 3CQXC 4P0BA 3UT5E 1KNZA 2J62A 2KNDA 3O1IA 3FXDB 3LK2B 4Q25A 4KHPT 1W9RA 2UXXB 4JI2T 5EK4A 1XMOT 5AQKB 3PE0A 3P4QA 2C5KT 2CPTA 5FXXA 1N34T 2IC6A 3L3PA 2XAQB 3N9NA 1LVKA 1IJ6A 3RQUA 3UU5A 4EYUA 1E7PA 4HKAA 4X1KE 3ZSSA 2HHHT 4NXNT 2W2UA 5IWAT 3B13A 3QK6A 5CB4E 2JPFA 3AE5A 4QXCB 1YQ4A 2BKOA 2Z6EA 1HG5A 3M65A 4UVCB 4YTPA 2WZHA 3ONJA 4CQIA 2XAJB 4DV4T 5DQWA 4HFCA 1J5WA 3A8YC 4TNWA 5HCMA 3I1AA 2E8IA 4YXDA 3R84B 1HX1B 2J1DG 2YDRA 4JI7T 4X5TA 1DU2A 1WR0A 2W4XA 4LMJA 4PFPA 4XZCA 5FYMA 5JH7E 3IF8B 2GK9A 3Q2MA 3SFEA 2I6HA 5FY7A 1T7SA 3K8PC 4A97A 5L3EB 4AI6A 2YK0A 4CI1B 3O4XE 1R8IA 3B57A 2CMRA 2V1DB 3ONXA 3QC9A 4FI5A 4ZI2C 5LGNB 4P09A 5HCJA 1IZNB 2ODUA 1X9BA 5FMNA 3Q9DA 4QWNB 4H9PC 2Q9QA 4LF8T 1JNRA 2PJQA 4IDNA 4OFZA 3KV4A 5FZTA 4DNDA 3AAAB 2X9YA 2C5JA 3ZMZB 3WAJA 2VL0A 3F2EA 2H3RA 4I55E 4YJ2E 1BR1A 4AQFA 2DLRA 2PTFA 2K9AA 4ZOLE 4JI5T 4EB6E 1BR4A 1FIOA 3RYIE 4JBWF 4X62T 2H88A 3KV9A 3UUMA 3N9LA 4MALA 3RYHE 1OEDB 3AE9A 3QNUA 2ZM2A 3C4ZA 3VRBA 3AEGA 3Q5WA 2WBLA 3AVSA 3W15B 4CXWA 5F3JA 2SPCA 2WDVA 2ZM8A 3FZMB 5LNKA 2L10A 4IDPA 2XQ4A 5HXSA 4A98A 1D0YA 4GKJT 2W0GA 3VJZA 2D5UA 5LGTB 2UXDT 4YFSA 3AE7A 1Z0PA 3ABVA 2VASA 2FUPA 5LB7B 4YSZA 1MMDA 2V6YB 2X0YA 4ILAA 3J9X1 5HXHA 4EZHA 3UU3A 4E7SA 4O2AE 4LF9T 3CQCB 1OWAA 5L3CB 1CHUA 4O8SA 2IUBA 3QUJA 2VVNA 3H3AA 4HGAA 4NIQA 3G06A 4WYVA 4Z8XA 1MNEA 3OBVE 4BJNA 4MHCA 4DR7T 2X0HA 4WNKA 5FL0A 3SWHA 4QH1A 2MBGA 2L7NA 5LBQB 4ECGA 5LYJE 2BDEA 2N1GA 1NAFA 2IC9A 2FBWA 2LHRA 3JC6D 4O4JE 4ZS3A 2NP9A 1SE7A 1VCSA 4YHJA 5EK3A 3UFEA 3CX6B 1MMAA 4UV9B 1HNZT 2WWVA 1NENA 5AQMB 4EEBA 3AE3A 2D2SA 4XAXB 2DWKA 3ZKRA 4GYRA 4IGUA 3ZJ2A 4LFCT 3KINB 1U4QA 3CIRA 3A5XA 3NVOA 2XSBA 4OX9T 1MMGA 3HKCE 5JR9A 4GIWA 2ACZA 3P4RA 3T1HT 3ZC0A 2ODVA 2V5CA 5LGUB 5HXCA 2LT3A 3EUHA 4QX8B 5FXWA 3DTOA 3O1HA 3HKEE 3C4XA 4YSYA 5LJMA 2HPJA 3AXJA 3MJXA 2VQET 2LHNA 2PBIA 5HYAA 2LOSA 3S4UA 5AQJB 3NZPA 5AQTB 3PJAA 3IBPA 2XTLA 2VKJA 3TLWA 3WAKA 1FMWA 2NOXA 4IL4A 5IHYA 2E2AA 2YEVC 3EHZA 2YN6A 3QB5K 3ZT5A 2NW7A 3Q5DA 4LF6T 4AIUA 4Z90A 3RH3A 2WMNA 3JCFA 5AQLB 4DUYT 2Y8DA 2MOZA 3CQGB 2NTXA 3ZCJA 4UVAB 2XAHB 3MA9A 4HFVA 4U2YA 5CA0E 2C5IT 3LSVA 3RRWA 2I0MA 3SRZA 3C51A 3TLSA 3R6NA 2CA5A 3GN5B 4KX6A 3SOLA 1XZYA 2WY2A 3PU8A 4MBQA 4CN1A 1S94A 2W00A 3QOFA 5LA6E 3PUXF 2CCQA 2W61A 4DMVA 5J0ZA 2XASB 5IYZE 3UUXB 3NZQA 4HTEA 5LBMA 5KMGP 2CRBA 4AXPA 1BR0A 5FNVE 2FJDA 2X9WA 5LCYA 4LMKA 1D1BA 4KHZF 2UUBT 2CBJA 5AQNB 3ZN1B 2DCFA 2ES0A 2EHOC 2JJ9A 4K0KT 3AAIA 1JNZA 2R6GF 2A72A 2D0TA 4OHFA 5ABEA 3EDVA 4H9RC 2BG9E 5DJQC 4AKRB 4CI3B 1NEKA 3IA3A 4HEAA 3D0TA 5HXEA 2X0CA 2W67A 2VKOA 1YKEB 2I59A 4NUUA 2UUAT 4DR4T 3MXZA 2JQKA 5FXVA 5IUXA 2EHOA 3T1YT 1XNQT 3KFWX 2F4VT 4TZ4C 5JR9B 2XQ8A 3Q5EA 2M6IA 2P9BA 2VKDA 1ZOYA 5HAXA 2UXCT 4LFBT 5DABA 4JI6T 2JQQA 4KUMB 4IDQA 4EZ4A 5LG3A 3N9QA 3AY5A 3AE8A 1FMVA 4GKKT 4TNVA 2UXBT 2JRKA 2WWUA 4YTNA 4I50E 1GQEA 1B7TA 1BR2A 3AXJB 1QSDA 2XM2A 2CBIA 4JEUB 3UFGA 4BJMA 2WP9A 4UF0A 4CXXA 3PUAA 5FVKA 3P8CD 3N2OA 1WRDA 1WYBA 4LF5T 2VL8A 1T8BA 2PG8A 3BQLA 3HA4A 4PJLA 1VCTA 1AJ3A 1HG2A 5HWYA 2KZ7B 2IDOB 5H6QB 3AE1A 1J1JA 2DWGA 4UELA 4IIJE 4DV0T 3JC6C 4PNIA 3UULA 2IMLA 3I9YA 4EEDA 1WR6A 3CVRA 5CFBA 5JR9C 3M3ZB 4PK5A 3PTRB 1XDPA 3RQWA 2BS4A 1MNDA 2L9QA 2CE7A 3NWIA 3UU8A 3PDYA 3OTOT 5J2TE 1HS7A 3X1DA 1ZKEA 3LK3B 2W66A 4NUVA 4IE5A 4ZEYA 3FHNA 3N9OA 5JDGA 5LMUT 1XMQT 3U78A 1SJ7A 5F8PA 3MKDA 4X1YE 3LJCA 4O4LE 2G0UA 3AE4A 3I0QA 5L3DB 3AEBA 4HWHA 5JDHA 4A5XA 3VR8A 5CGMA 4DV7T 4WZXA 4JI3T 4F7GB 2A3DA 3Q5XA 4C91A 3EAMA 1EZ3A 2HN1A 4PK4A 4BGOA 2QA7A 3MZKB 4ZXLA 3RC3A 2MAWA 2KWIB 2WSSV 5FXZA 5ABGA 3UQ4A 1FJGT 1KNPA 4EOZB 5ADXL 2LM9A 2Y48B 1W0BA 3ZYMA 3AECA 4UEMA 4OK0A 3LBXA 5BR8T 3F31A 4IDOA 2JQ9A 4WBOA 3C50A 5TAOA 5JDMA 2CHNA 2V8SV 5AQIB 5C3JA 2KT9A 1UURA 3ANWB 1KFYA 3FB2A 5LHGB 5CJ5A 3DYJA 2DNXA 3AEFA 2V5DA 3ZJ1A 1G8XA 3K3QC 2X9HA 5HEUA 4DV6T 3RIFA 4B3TT 4GOUA 3MACA 3FZHB 1OEDC 4DVDA 4B3ST 4UF0B 3UU6A 2KVPA 3RKOA 3PV0F 1IAPA 2WCAA 3RRCA 4CN4A 1J5ET 4A56A 5JDNA 3CWZB 1ZEEA 3LDQB 2ZMAA 3CKDA 3PHF1 2WQYA 1D1CA 2YU1A 2EHOD 2VQFT 4EV6A 3ANWA 3B5MA 3CX7B 2YKSA 3QB5A 1YKHB 5L3BB 3AE2A 4OYJA 1ZHCA 1HNXT 4ZI3C 4EAHA 1M7KA 3EDUA 2WU5A 2B76A 3L09A 4H63V 2LSJA 2E9XA 5E0OA 4WW0A 1MIWA 4DMWA 4AKHA 4O2BE 2V7LA 4JUYA 1IBMT 3PUSA 4IL9A 2LKHA 2BBHA 2BBJA 4DV3T 2XUEA 4DR2T 1SJ8A 3N5LA 2XQAA 3AA7B 4K0UA 5HEOA 2KXPB 4V1Av 3P4WA 1SHZC 1Y64B 4JI4T 3C98B 3PUWF 5JRCB 2BZBA 3H3MA 5AQVB 4ZZBA 5ABHA 4TN7B 3KV5A 3PJAJ 5JDFA 2JIWA 1D1AA 4AKIA 2E5LT 4DV1T 1WCRA 1UX5A 3BQKA 4TV8E 4U7YA 5JTGA 5C2TA 2JMHA 4HN9A 2A2FX 4TX5A 4TWFA 3A7MA 4ILBA 2E5VA 2WB5A 3ESLA 3RX6A 3WI3A 4DR3T 4YT0A 1VRBA 2BG9B 3LK42 4HFDA 1I6ZA 1SA0E 4IE6A 1WYCA 3AEEA 2LOPA 3I0OA 4YY3T 4DV5T 3BK9A 3TLVA 1W0AA 4NXMT 3UQ7A 4HWIB 2CEAA 2X66A 4KMCA 3HKDE 1UGOA 4H63H 2NR4A 4B3RT 3F57A 4LF4T 3KV6A 2H7OA 5C8YE 4UXNB 1W09A 1UX4A 3AVRA 4IE4A 3PUYF 2LSIA 4H9OC 4IHJE 4IDZA 2Q9QC 2XQ7A 4NPPA 4U72A 4ASKA 4E7ZA 4JV5T 5FY0A 2ZM0A 1OXZA 3C64A 5AQUB 3PUQA 2L3LA 1E1HB 4G63A 3ZPOA 1IBKT 3TLUA 4YJ3E 3ZYKA 3GN5A 4YSXA 1M62A 4BAYB 5JDQA 5L3GB 5JVDE 3OJAA 3P4SA 4B3MT 5AQRB 4HFHA 2UU9T 2LJLA 4TWDA 5L4HA 5LOVE 4LMLA 1O3XA 4DIDB 2YDQA 4JI8T 3RYCE 2KLQA 4U7IA 5FVLA 4U3CA 2V7MA 2B1EA 1E2AA 5F5WA 4DUZT 3PURA 3IHRA 1H7CA 4HFEA 4Z91A 3RYFE 1KK7A 2CLYC 3HR0A 3L8RA 4O4IE 3UU4A 1S35A 2V6YA 3VHLA 1IBLT 1ZP0A 1T98A 1YD8G 2D9DA 4OYKA 5ABFA 5LXTE 4JI1T 5L3FB 3RPUA 3E08A 1HFAA 2ZLYA 4ERRA 2QGSA 4IREA 2CXLA 4TUYE 5KX5E 4GYSA 4PJNA 3KVBA 4AQGA 4WBNE 3AA6B 2WU2A 3AEAA 1N36T 2XHEB 2PFVA 1D0XA 3P50A 2E9XC 3AAEB 1MMNA 1UUSA 4HWDA 1SUMB 2OV9A 4QXBB 2NTYA 2XZEA 2WDQA 4QH5A 3RI5A 4DBQA 3HL6A 2K24A 2X0LB 1YQ3A 2BG9A 2FJEA 1FEWA 2HH7A 3IEEA 3MK7C 3RIUC 4ZI3D 2LRLA 5H6RB 2LLYA 2CLYB 4U31A 3JADA 4DO0A 5ABFB 4LFAT 3P4PA 2XAFB 4DBRA 4X64T 3ZEFB 1ZV4X 4JI0T 1MIVA 5CA1E 4IE7A 3ONLC 2CXDA 2NWBA 2BKPA 1Y01A 2JMKA 2M67A 2YINA 3DP7A 3OPCA 1N33T 1YXRA 2NW9A 2CWYA 1HCIA 4UVBB 4CZZB 2ACXA 5JQGE 2LSYA 2WM9A 3TLTA 4QH4A 3WSCA 2BS2A 2WAUA 3OKQA 3RLFF 2CWOA 1HF8A 2LEHA 5AQPB 4IE0A 4AKGA 3DJBA 2LQUA 2VURA 2Q9QB 2CXFA 5HEJA 5LG4A 3OYXA 5L2LA 3RHWA 1Z8UA 5HWXA 5T1DA 4G2AA 1WLXA 3OYZA 3RKGA 2XY8B 2BG9C 3RIUA 4F6RC 4ONRA 3H37A 4H9NC 3K3NA 3ZMTB 2L8KA 4ANJA 2N9DA 3J7Yq 2UXNB 3U3IA 3FXEB 3N9PA 4P1NA 3C4WA 3O1JA 4ZZCA 4W8PA 2Y6XA 4UR9A 3WURA 4AKLA 2IAKA 5LP6E 2MTCA 3AA1B 4QXHB 4ILUA 3HKBE 1NWMX 4M1PA 5AFUL 2K48A 2MPKA 2VVSA 4AQFC 3M1CA 4YTMA 3UTKA 1MIYA 1KNRA 3RF1A 2X51A 3ZC1A 2YOEA 2HPLA 2W63A 3FZKB 3PUVF 5KXJA 2KGXA 3ZN0B 2KSRA 2Q9QD 5LMNT 4U2ZA 4AISA 2BS3A 2LRKA 2J47A 3AEDA 4EIWA 3NRYA 3LG7A 1L0VA 1G73A 3UUBA 1HTJF 4EYYR 3ETVA 1T72A 3FBLA 3E22E 3FBZA 2XQ3A 2DHRA 2OLTA 5AQOB 5J1GA 3NRXA 2RP4A 4CN6A 4X1IE 3V5UA 2FJAA 3CK6A 3N9MA 4U74A 5JREA 4PAGA 3UUNA 3VR9A 4ADZA 4H9SE 3TKLB 4X66T 2BKNA 2RA1A 4ISTA 5FP3A 5AQGB 2QVAA 4L9IA 2IHR1 3ZCIA 3RGLA 3ZMVB 1WFDA 2D0UA 3JAFA 5AQHB 3VKHA 3GMIA 3K3OA 1V9DA 2LSKA 2FJBA 2X68A 2XM1A 3ZYLA 5DQVA 2BVMA 4DV2T 3ZSTA 4L0RA 1LKXA 3N2GE 2DI4A 2H7VC 1YW0A 1UCUA 4KBMB 4AQYT 3FYQA 2KMFA 1IJ5A 3OVUA 4DR1T 4ILCA 4I0UA 2UUCT 3NBXX 4GK0E 3KDSE 2V6XA 2XJ7A 3ZLIA 5EK2A 2E9XD 1KEYA 1HR0T 4JEHB 3V5SA 2A9UA 3N2KE 4BA9A 2K3WA 2K5BB 3JAEA 3AE6A 1LRZA 2C0SA 2XQ6A 4FJOA 2V7IA 4PFOA 4X20E 4KP3C 3EABA 2IW5B 4L5GA 3CMLA 3GWHA 3E0ZA 4QKNA 3AB3B 3AA0B 3KBTA 3RIAA 3GA8A 4EXTA 4CXYA 4XBFB 3VKGA 2ZM6T 3ZT6A 1LVFA 2NW8A 2XAGB 4HE8A 4ZI2D 5EZYE 1U5PA 5AQFB 3HI2A 3LFMA 4X65T 2LSGA 2VB6A 2LM2A 2WS3A 4CI2B 4I4TE 4QHOA 3K1SA 2EHOB 1I94T 5J2UE 4UV8B 1HNWT 2V26A 1QLBA 3KVAA 2VKHA 3L39A 4PJJA 2V7JA 5AQQB 3VU7H 5BMVE 2XQ5A 5HEGA 3RC8A 3AT7A 2XSAA 3CPZA 4N78D 4I43B 5FL1A 3PF0A 4ZHQE 2X9XA 1D0ZA 1OEDA 5LJNA 1US7B 2QRXA 4TV9E 2CM0A 5M4YA 4P0AA 5ETWA 4LF7T 5L4EA 4ZS2A 4ISSA 1VOMA 2RPAA 2XQYA 2YU2A 3ETUA 3FZLB 2WMOA 3NKZA 4GK5E 5HEHA 2YDSA 2HN2A 2LKGA 5AQSB 2BVLA 4C90A 3ZMSB 4ZI7E 2KBBA 3BQIA 2KWHA 2AXDS 4DR5T 4QX7B 2JQHA 3SFDA 3ZMUB 4YLHA 4F8HA 4KI0F 3EI0A 2LE8A 5JDLA 2WDRA 4HFIA 1N32T 4TWHA 4U33A 4B6XA 3KBUA 4DR6T 1HX8A 2DL1A 5LHHB 1CUNA 2VK9A 4HWFA 2OA5A 4MLKA 3O9XA 1XNRT 4JYAT 4O4HE 3VRAA 5JRCA 5FKYA 4PK6A 3SS1A 2XQ9A 1KF6A 2VWAA 4JLEA 5FY1A 4YHHT 3ZT7A
chains in the Genus database with same CATH topology
3P7IA 3T8OA 3I9WA 4UIGA 2MTQA 3M1CA 2X67A 4MFRA 2W62A 5HXRA 5A1LA 2N2NA 5GONE 2MYSA 5KDMC 1X79A 4PW8A 2E9XB 4PJMA 2KINB 4H9QC 3CX8B 3LBXB 5LHIB 3PU3A 2V7KA 1QUUA 3EVYA 3PUGA 4J2CA 3CQXC 4P0BA 3UT5E 1KNZA 3O1IA 2KNDA 3FXDB 3LK2B 2UXXB 5EK4A 3PE0A 2C5KT 5FXXA 2IC6A 3L3PA 2XAQB 3N9NA 1LVKA 1IJ6A 4EYUA 4HKAA 4X1KE 3B13A 3QK6A 5CB4E 2JPFA 4QXCB 2Z6EA 1HG5A 3M65A 4UVCB 4CQIA 2XAJB 5DQWA 3I1AA 2E8IA 3R84B 2J1DG 4PFPA 5JH7E 4XZCA 5FYMA 3IF8B 2GK9A 3Q2MA 5L3EB 5FY7A 3K8PC 4AI6A 2YK0A 4CI1B 3O4XE 3B57A 2CMRA 2V1DB 3ONXA 3QC9A 4FI5A 4ZI2C 5LGNB 4P09A 1IZNB 2ODUA 5FMNA 3Q9DA 4QWNB 4H9PC 2Q9QA 2PJQA 4OFZA 3KV4A 4DNDA 3AAAB 2X9YA 2C5JA 3ZMZB 3WAJA 3F2EA 2H3RA 4I55E 4YJ2E 1BR1A 4AQFA 2DLRA 2K9AA 4ZOLE 4EB6E 1BR4A 1FIOA 3RYIE 3KV9A 3UUMA 3N9LA 4MALA 3RYHE 2ZM2A 3C4ZA 3W15B 3Q5WA 5F3JA 2WBLA 3AVSA 4CXWA 5LNKA 2SPCA 2ZM8A 5HXSA 3VJZA 1D0YA 2W0GA 2D5UA 5LGTB 4YFSA 1Z0PA 2VASA 1MMDA 3J9X1 5HXHA 4EZHA 4E7SA 4O2AE 3CQCB 1OWAA 5L3CB 4O8SA 3QUJA 4HGAA 3H3AA 4Z8XA 1MNEA 3OBVE 4BJNA 4MHCA 4WNKA 3SWHA 2MBGA 5LBQB 4ECGA 5LYJE 2BDEA 2IC9A 1NAFA 2LHRA 2N1GA 3JC6D 4O4JE 5EK3A 4ZS3A 2NP9A 4YHJA 3RX6A 3UFEA 3CX6B 1MMAA 4UV9B 2D2SA 4XAXB 2DWKA 4GYRA 4IGUA 3ZJ2A 3KINB 1U4QA 3A5XA 1MMGA 3HKCE 5JR9A 4GIWA 3ZC0A 2ODVA 5LGUB 5HXCA 2LT3A 3EUHA 4QX8B 5FXWA 3DTOA 3O1HA 3HKEE 3C4XA 5LJMA 2HPJA 3MJXA 2LHNA 2PBIA 5HYAA 2LOSA 3S4UA 3NZPA 3IBPA 2XTLA 2VKJA 3WAKA 1FMWA 2NOXA 5IHYA 2YEVC 2NW7A 3RH3A 2WMNA 2Y8DA 2MOZA 3CQGB 2NTXA 3ZCJA 4UVAB 2XAHB 3MA9A 4HFVA 5CA0E 2C5IT 3RRWA 3SRZA 3C51A 3R6NA 2CA5A 3GN5B 3SOLA 3PU8A 4MBQA 1S94A 2W00A 5LA6E 2CCQA 2W61A 4DMVA 2XASB 5IYZE 3UUXB 3NZQA 4HTEA 5LBMA 5KMGP 4AXPA 1BR0A 5FNVE 2X9WA 5LCYA 1D1BA 3ZN1B 2DCFA 2ES0A 2EHOC 2JJ9A 3AAIA 4OHFA 2A72A 2D0TA 3EDVA 4H9RC 5DJQC 4AKRB 4CI3B 4HEAA 3D0TA 5HXEA 2VKOA 1YKEB 2I59A 4NUUA 3MXZA 5FXVA 2EHOA 3KFWX 4TZ4C 5JR9B 2P9BA 2VKDA 5HAXA 5DABA 2JQQA 4KUMB 4EZ4A 3N9QA 1FMVA 2JRKA 2WWUA 4I50E 1B7TA 1BR2A 4JEUB 1QSDA 4BJMA 4UF0A 4CXXA 3PUAA 3P8CD 3N2OA 1WRDA 1WYBA 2VL8A 2PG8A 4PJLA 3BQLA 3HA4A 1AJ3A 1HG2A 5HWYA 2KZ7B 5H6QB 2DWGA 4UELA 4IIJE 3JC6C 4PNIA 3UULA 3I9YA 5JR9C 1WR6A 3CVRA 4PK5A 3PTRB 1MNDA 2L9QA 2CE7A 3PDYA 5J2TE 1HS7A 1ZKEA 3LK3B 5JDGA 4NUVA 4IE5A 3FHNA 3N9OA 3U78A 5F8PA 3MKDA 4X1YE 3LJCA 4O4LE 2G0UA 3I0QA 5L3DB 5JDHA 2A3DA 3Q5XA 4C91A 1EZ3A 4PK4A 4BGOA 2QA7A 3MZKB 3RC3A 2KWIB 2WSSV 5FXZA 4EOZB 5ADXL 2LM9A 2Y48B 3ZYMA 4UEMA 4OK0A 3LBXA 3F31A 4WBOA 3C50A 5TAOA 5JDMA 2KT9A 3ANWB 5LHGB 3FB2A 2DNXA 3ZJ1A 1G8XA 3K3QC 2X9HA 4GOUA 3MACA 4DVDA 4UF0B 3RKOA 1IAPA 3RRCA 4A56A 5JDNA 3CWZB 1ZEEA 2ZMAA 3CKDA 3PHF1 1D1CA 2YU1A 2EHOD 3ANWA 3CX7B 1YKHB 5L3BB 4OYJA 1ZHCA 4ZI3C 4EAHA 3EDUA 3L09A 4H63V 2LSJA 2E9XA 5E0OA 4WW0A 1MIWA 4DMWA 4AKHA 4O2BE 2V7LA 4JUYA 3PUSA 2XUEA 3N5LA 3AA7B 4K0UA 2KXPB 4V1Av 1SHZC 1Y64B 3C98B 5JRCB 2BZBA 4TN7B 3KV5A 5JDFA 1D1AA 4AKIA 1UX5A 3BQKA 4TV8E 2JMHA 4HN9A 2A2FX 4TX5A 3WI3A 3ESLA 1VRBA 3LK42 1SA0E 4IE6A 1WYCA 3I0OA 2LOPA 3BK9A 2CEAA 2X66A 4KMCA 3HKDE 4H63H 3F57A 3KV6A 2H7OA 5C8YE 4UXNB 1UX4A 3AVRA 4IE4A 4H9OC 2LSIA 4IHJE 4IDZA 4U72A 2Q9QC 4ASKA 4E7ZA 5FY0A 2ZM0A 1OXZA 3C64A 3PUQA 2L3LA 1E1HB 4G63A 3ZPOA 4YJ3E 3ZYKA 3GN5A 5JDQA 5L3GB 4BAYB 5JVDE 3OJAA 2LJLA 5LOVE 1O3XA 3RYCE 2KLQA 2V7MA 2B1EA 3PURA 3IHRA 1H7CA 3RYFE 1KK7A 2CLYC 3HR0A 4O4IE 3VHLA 1S35A 1T98A 1YD8G 4OYKA 5LXTE 5L3FB 3RPUA 3E08A 1HFAA 2ZLYA 4ERRA 2QGSA 2CXLA 4TUYE 5KX5E 4GYSA 4PJNA 3KVBA 4AQGA 4WBNE 3AA6B 2XHEB 2PFVA 1D0XA 2E9XC 3AAEB 1MMNA 4QXBB 2NTYA 4DBQA 3HL6A 2K24A 2X0LB 3IEEA 2HH7A 4ZI3D 1FEWA 3MK7C 5J2UE 5H6RB 2CLYB 4DO0A 2XAFB 4DBRA 3ZEFB 1ZV4X 1MIVA 5CA1E 4IE7A 2CXDA 2YINA 2JMKA 2NWBA 2M67A 3DP7A 2NW9A 2CWYA 1HCIA 4UVBB 4CZZB 2ACXA 5JQGE 2LSYA 2WM9A 3WSCA 2WAUA 3OKQA 2CWOA 1HF8A 2LEHA 4AKGA 4IE0A 2LQUA 3DJBA 2Q9QB 2CXFA 5LG4A 3OYXA 5L2LA 5HWXA 5T1DA 4G2AA 1WLXA 3OYZA 4ONRA 4F6RC 3H37A 4H9NC 3K3NA 3ZMTB 2L8KA 4ANJA 2N9DA 3J7Yq 2UXNB 3U3IA 3FXEB 3N9PA 3C4WA 3O1JA 2Y6XA 3WURA 4AKLA 2IAKA 5LP6E 2MTCA 3AA1B 4QXHB 4ILUA 3HKBE 1NWMX 4M1PA 5AFUL 2K48A 4AQFC 3UTKA 1MIYA 2X51A 3ZC1A 2HPLA 2W63A 3ZN0B 2Q9QD 4EIWA 3NRYA 3LG7A 1G73A 1HTJF 4EYYR 3ETVA 3FBLA 3E22E 3FBZA 2DHRA 5J1GA 3NRXA 2RP4A 4X1IE 3V5UA 3N9MA 4U74A 5JREA 4PAGA 3UUNA 4ADZA 4H9SE 3TKLB 2RA1A 4ISTA 5FP3A 4L9IA 3ZCIA 3ZMVB 2D0UA 3VKHA 3GMIA 3K3OA 1V9DA 2LSKA 2X68A 3ZYLA 5DQVA 2BVMA 4L0RA 1LKXA 3N2GE 2DI4A 2H7VC 1YW0A 1UCUA 4KBMB 2KMFA 1IJ5A 3NBXX 4GK0E 3KDSE 3ZLIA 5EK2A 2E9XD 4JEHB 3V5SA 3N2KE 4BA9A 2K5BB 1LRZA 2C0SA 4FJOA 4PFOA 2V7IA 4X20E 4KP3C 2IW5B 4L5GA 3CMLA 3GWHA 3E0ZA 4QKNA 3AB3B 3AA0B 3KBTA 4EXTA 3GA8A 4CXYA 3VKGA 4XBFB 1LVFA 2NW8A 2XAGB 4HE8A 4ZI2D 5EZYE 1U5PA 3HI2A 3LFMA 2LSGA 2VB6A 4CI2B 4I4TE 4QHOA 2EHOB 4UV8B 2V26A 3KVAA 5BMVE 2VKHA 4PJJA 3VU7H 2V7JA 3RC8A 3AT7A 3CPZA 4N78D 4I43B 3PF0A 4ZHQE 2X9XA 1D0ZA 5LJNA 1US7B 5M4YA 4TV9E 2CM0A 4P0AA 5ETWA 4ZS2A 4ISSA 1VOMA 2XQYA 2YU2A 4GK5E 3ETUA 2WMOA 4C90A 4ZI7E 2BVLA 3ZMSB 3BQIA 2KWHA 4QX7B 3ZMUB 4YLHA 2LE8A 5JDLA 4B6XA 3KBUA 1HX8A 5LHHB 1CUNA 2VK9A 2OA5A 4MLKA 3O9XA 4O4HE 5JRCA 4PK6A 3SS1A 2VWAA 4JLEA 5FY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDL A;  5JDG A;  3V5U A;  5JDF A;  5HXE A;  5JDH A;  5JDM A;  5HXH A;  5HXS A;  5JDQ A;  5HWY A;  3V5S A;  5HXR A;  5HWX A;  5HYA A;  5JDN A;  5HXC A; 
#chains in the Genus database with same CATH topology
 3P7I A;  3FZF B;  3T8O A;  3PUZ F;  4IT4 A;  3I9W A;  4COF A;  4HWC A;  2CHO A;  2WZI A;  1XWM A;  4UIG A;  1XDO A;  2MTQ A;  2X67 A;  1OED E;  2IIU A;  2QYW A;  2H89 A;  2W62 A;  4HFB A;  4MFR A;  5HXR A;  5A1L A;  2N2N A;  5GON E;  2AE9 A;  2MYS A;  5KDM C;  2XPK A;  1X79 A;  4PW8 A;  2E9X B;  4PJM A;  2KIN B;  2J4G A;  2M6B A;  4H9Q C;  5L47 A;  3CX8 B;  4EGW A;  3LBX B;  1UK5 A;  5LHI B;  3PU3 A;  2V7K A;  1QUU A;  3EVY A;  3PUG A;  4J2C A;  3CQX C;  4P0B A;  3UT5 E;  1KNZ A;  2J62 A;  2KND A;  3O1I A;  3FXD B;  3LK2 B;  4Q25 A;  4KHP T;  1W9R A;  2UXX B;  4JI2 T;  5EK4 A;  1XMO T;  5AQK B;  3PE0 A;  3P4Q A;  2C5K T;  2CPT A;  5FXX A;  1N34 T;  2IC6 A;  3L3P A;  2XAQ B;  3N9N A;  1LVK A;  1IJ6 A;  3RQU A;  3UU5 A;  4EYU A;  1E7P A;  4HKA A;  4X1K E;  3ZSS A;  2HHH T;  4NXN T;  2W2U A;  5IWA T;  3B13 A;  3QK6 A;  5CB4 E;  2JPF A;  3AE5 A;  4QXC B;  1YQ4 A;  2BKO A;  2Z6E A;  1HG5 A;  3M65 A;  4UVC B;  4YTP A;  2WZH A;  3ONJ A;  4CQI A;  2XAJ B;  4DV4 T;  5DQW A;  4HFC A;  1J5W A;  3A8Y C;  4TNW A;  5HCM A;  3I1A A;  2E8I A;  4YXD A;  3R84 B;  1HX1 B;  2J1D G;  2YDR A;  4JI7 T;  4X5T A;  1DU2 A;  1WR0 A;  2W4X A;  4LMJ A;  4PFP A;  4XZC A;  5FYM A;  5JH7 E;  3IF8 B;  2GK9 A;  3Q2M A;  3SFE A;  2I6H A;  5FY7 A;  1T7S A;  3K8P C;  4A97 A;  5L3E B;  4AI6 A;  2YK0 A;  4CI1 B;  3O4X E;  1R8I A;  3B57 A;  2CMR A;  2V1D B;  3ONX A;  3QC9 A;  4FI5 A;  4ZI2 C;  5LGN B;  4P09 A;  5HCJ A;  1IZN B;  2ODU A;  1X9B A;  5FMN A;  3Q9D A;  4QWN B;  4H9P C;  2Q9Q A;  4LF8 T;  1JNR A;  2PJQ A;  4IDN A;  4OFZ A;  3KV4 A;  5FZT A;  4DND A;  3AAA B;  2X9Y A;  2C5J A;  3ZMZ B;  3WAJ A;  2VL0 A;  3F2E A;  2H3R A;  4I55 E;  4YJ2 E;  1BR1 A;  4AQF A;  2DLR A;  2PTF A;  2K9A A;  4ZOL E;  4JI5 T;  4EB6 E;  1BR4 A;  1FIO A;  3RYI E;  4JBW F;  4X62 T;  2H88 A;  3KV9 A;  3UUM A;  3N9L A;  4MAL A;  3RYH E;  1OED B;  3AE9 A;  3QNU A;  2ZM2 A;  3C4Z A;  3VRB A;  3AEG A;  3Q5W A;  2WBL A;  3AVS A;  3W15 B;  4CXW A;  5F3J A;  2SPC A;  2WDV A;  2ZM8 A;  3FZM B;  5LNK A;  2L10 A;  4IDP A;  2XQ4 A;  5HXS A;  4A98 A;  1D0Y A;  4GKJ T;  2W0G A;  3VJZ A;  2D5U A;  5LGT B;  2UXD T;  4YFS A;  3AE7 A;  1Z0P A;  3ABV A;  2VAS A;  2FUP A;  5LB7 B;  4YSZ A;  1MMD A;  2V6Y B;  2X0Y A;  4ILA A;  3J9X 1;  5HXH A;  4EZH A;  3UU3 A;  4E7S A;  4O2A E;  4LF9 T;  3CQC B;  1OWA A;  5L3C B;  1CHU A;  4O8S A;  2IUB A;  3QUJ A;  2VVN A;  3H3A A;  4HGA A;  4NIQ A;  3G06 A;  4WYV A;  4Z8X A;  1MNE A;  3OBV E;  4BJN A;  4MHC A;  4DR7 T;  2X0H A;  4WNK A;  5FL0 A;  3SWH A;  4QH1 A;  2MBG A;  2L7N A;  5LBQ B;  4ECG A;  5LYJ E;  2BDE A;  2N1G A;  1NAF A;  2IC9 A;  2FBW A;  2LHR A;  3JC6 D;  4O4J E;  4ZS3 A;  2NP9 A;  1SE7 A;  1VCS A;  4YHJ A;  5EK3 A;  3UFE A;  3CX6 B;  1MMA A;  4UV9 B;  1HNZ T;  2WWV A;  1NEN A;  5AQM B;  4EEB A;  3AE3 A;  2D2S A;  4XAX B;  2DWK A;  3ZKR A;  4GYR A;  4IGU A;  3ZJ2 A;  4LFC T;  3KIN B;  1U4Q A;  3CIR A;  3A5X A;  3NVO A;  2XSB A;  4OX9 T;  1MMG A;  3HKC E;  5JR9 A;  4GIW A;  2ACZ A;  3P4R A;  3T1H T;  3ZC0 A;  2ODV A;  2V5C A;  5LGU B;  5HXC A;  2LT3 A;  3EUH A;  4QX8 B;  5FXW A;  3DTO A;  3O1H A;  3HKE E;  3C4X A;  4YSY A;  5LJM A;  2HPJ A;  3AXJ A;  3MJX A;  2VQE T;  2LHN A;  2PBI A;  5HYA A;  2LOS A;  3S4U A;  5AQJ B;  3NZP A;  5AQT B;  3PJA A;  3IBP A;  2XTL A;  2VKJ A;  3TLW A;  3WAK A;  1FMW A;  2NOX A;  4IL4 A;  5IHY A;  2E2A A;  2YEV C;  3EHZ A;  2YN6 A;  3QB5 K;  3ZT5 A;  2NW7 A;  3Q5D A;  4LF6 T;  4AIU A;  4Z90 A;  3RH3 A;  2WMN A;  3JCF A;  5AQL B;  4DUY T;  2Y8D A;  2MOZ A;  3CQG B;  2NTX A;  3ZCJ A;  4UVA B;  2XAH B;  3MA9 A;  4HFV A;  4U2Y A;  5CA0 E;  2C5I T;  3LSV A;  3RRW A;  2I0M A;  3SRZ A;  3C51 A;  3TLS A;  3R6N A;  2CA5 A;  3GN5 B;  4KX6 A;  3SOL A;  1XZY A;  2WY2 A;  3PU8 A;  4MBQ A;  4CN1 A;  1S94 A;  2W00 A;  3QOF A;  5LA6 E;  3PUX F;  2CCQ A;  2W61 A;  4DMV A;  5J0Z A;  2XAS B;  5IYZ E;  3UUX B;  3NZQ A;  4HTE A;  5LBM A;  5KMG P;  2CRB A;  4AXP A;  1BR0 A;  5FNV E;  2FJD A;  2X9W A;  5LCY A;  4LMK A;  1D1B A;  4KHZ F;  2UUB T;  2CBJ A;  5AQN B;  3ZN1 B;  2DCF A;  2ES0 A;  2EHO C;  2JJ9 A;  4K0K T;  3AAI A;  1JNZ A;  2R6G F;  2A72 A;  2D0T A;  4OHF A;  5ABE A;  3EDV A;  4H9R C;  2BG9 E;  5DJQ C;  4AKR B;  4CI3 B;  1NEK A;  3IA3 A;  4HEA A;  3D0T A;  5HXE A;  2X0C A;  2W67 A;  2VKO A;  1YKE B;  2I59 A;  4NUU A;  2UUA T;  4DR4 T;  3MXZ A;  2JQK A;  5FXV A;  5IUX A;  2EHO A;  3T1Y T;  1XNQ T;  3KFW X;  2F4V T;  4TZ4 C;  5JR9 B;  2XQ8 A;  3Q5E A;  2M6I A;  2P9B A;  2VKD A;  1ZOY A;  5HAX A;  2UXC T;  4LFB T;  5DAB A;  4JI6 T;  2JQQ A;  4KUM B;  4IDQ A;  4EZ4 A;  5LG3 A;  3N9Q A;  3AY5 A;  3AE8 A;  1FMV A;  4GKK T;  4TNV A;  2UXB T;  2JRK A;  2WWU A;  4YTN A;  4I50 E;  1GQE A;  1B7T A;  1BR2 A;  3AXJ B;  1QSD A;  2XM2 A;  2CBI A;  4JEU B;  3UFG A;  4BJM A;  2WP9 A;  4UF0 A;  4CXX A;  3PUA A;  5FVK A;  3P8C D;  3N2O A;  1WRD A;  1WYB A;  4LF5 T;  2VL8 A;  1T8B A;  2PG8 A;  3BQL A;  3HA4 A;  4PJL A;  1VCT A;  1AJ3 A;  1HG2 A;  5HWY A;  2KZ7 B;  2IDO B;  5H6Q B;  3AE1 A;  1J1J A;  2DWG A;  4UEL A;  4IIJ E;  4DV0 T;  3JC6 C;  4PNI A;  3UUL A;  2IML A;  3I9Y A;  4EED A;  1WR6 A;  3CVR A;  5CFB A;  5JR9 C;  3M3Z B;  4PK5 A;  3PTR B;  1XDP A;  3RQW A;  2BS4 A;  1MND A;  2L9Q A;  2CE7 A;  3NWI A;  3UU8 A;  3PDY A;  3OTO T;  5J2T E;  1HS7 A;  3X1D A;  1ZKE A;  3LK3 B;  2W66 A;  4NUV A;  4IE5 A;  4ZEY A;  3FHN A;  3N9O A;  5JDG A;  5LMU T;  1XMQ T;  3U78 A;  1SJ7 A;  5F8P A;  3MKD A;  4X1Y E;  3LJC A;  4O4L E;  2G0U A;  3AE4 A;  3I0Q A;  5L3D B;  3AEB A;  4HWH A;  5JDH A;  4A5X A;  3VR8 A;  5CGM A;  4DV7 T;  4WZX A;  4JI3 T;  4F7G B;  2A3D A;  3Q5X A;  4C91 A;  3EAM A;  1EZ3 A;  2HN1 A;  4PK4 A;  4BGO A;  2QA7 A;  3MZK B;  4ZXL A;  3RC3 A;  2MAW A;  2KWI B;  2WSS V;  5FXZ A;  5ABG A;  3UQ4 A;  1FJG T;  1KNP A;  4EOZ B;  5ADX L;  2LM9 A;  2Y48 B;  1W0B A;  3ZYM A;  3AEC A;  4UEM A;  4OK0 A;  3LBX A;  5BR8 T;  3F31 A;  4IDO A;  2JQ9 A;  4WBO A;  3C50 A;  5TAO A;  5JDM A;  2CHN A;  2V8S V;  5AQI B;  5C3J A;  2KT9 A;  1UUR A;  3ANW B;  1KFY A;  3FB2 A;  5LHG B;  5CJ5 A;  3DYJ A;  2DNX A;  3AEF A;  2V5D A;  3ZJ1 A;  1G8X A;  3K3Q C;  2X9H A;  5HEU A;  4DV6 T;  3RIF A;  4B3T T;  4GOU A;  3MAC A;  3FZH B;  1OED C;  4DVD A;  4B3S T;  4UF0 B;  3UU6 A;  2KVP A;  3RKO A;  3PV0 F;  1IAP A;  2WCA A;  3RRC A;  4CN4 A;  1J5E T;  4A56 A;  5JDN A;  3CWZ B;  1ZEE A;  3LDQ B;  2ZMA A;  3CKD A;  3PHF 1;  2WQY A;  1D1C A;  2YU1 A;  2EHO D;  2VQF T;  4EV6 A;  3ANW A;  3B5M A;  3CX7 B;  2YKS A;  3QB5 A;  1YKH B;  5L3B B;  3AE2 A;  4OYJ A;  1ZHC A;  1HNX T;  4ZI3 C;  4EAH A;  1M7K A;  3EDU A;  2WU5 A;  2B76 A;  3L09 A;  4H63 V;  2LSJ A;  2E9X A;  5E0O A;  4WW0 A;  1MIW A;  4DMW A;  4AKH A;  4O2B E;  2V7L A;  4JUY A;  1IBM T;  3PUS A;  4IL9 A;  2LKH A;  2BBH A;  2BBJ A;  4DV3 T;  2XUE A;  4DR2 T;  1SJ8 A;  3N5L A;  2XQA A;  3AA7 B;  4K0U A;  5HEO A;  2KXP B;  4V1A v;  3P4W A;  1SHZ C;  1Y64 B;  4JI4 T;  3C98 B;  3PUW F;  5JRC B;  2BZB A;  3H3M A;  5AQV B;  4ZZB A;  5ABH A;  4TN7 B;  3KV5 A;  3PJA J;  5JDF A;  2JIW A;  1D1A A;  4AKI A;  2E5L T;  4DV1 T;  1WCR A;  1UX5 A;  3BQK A;  4TV8 E;  4U7Y A;  5JTG A;  5C2T A;  2JMH A;  4HN9 A;  2A2F X;  4TX5 A;  4TWF A;  3A7M A;  4ILB A;  2E5V A;  2WB5 A;  3ESL A;  3RX6 A;  3WI3 A;  4DR3 T;  4YT0 A;  1VRB A;  2BG9 B;  3LK4 2;  4HFD A;  1I6Z A;  1SA0 E;  4IE6 A;  1WYC A;  3AEE A;  2LOP A;  3I0O A;  4YY3 T;  4DV5 T;  3BK9 A;  3TLV A;  1W0A A;  4NXM T;  3UQ7 A;  4HWI B;  2CEA A;  2X66 A;  4KMC A;  3HKD E;  1UGO A;  4H63 H;  2NR4 A;  4B3R T;  3F57 A;  4LF4 T;  3KV6 A;  2H7O A;  5C8Y E;  4UXN B;  1W09 A;  1UX4 A;  3AVR A;  4IE4 A;  3PUY F;  2LSI A;  4H9O C;  4IHJ E;  4IDZ A;  2Q9Q C;  2XQ7 A;  4NPP A;  4U72 A;  4ASK A;  4E7Z A;  4JV5 T;  5FY0 A;  2ZM0 A;  1OXZ A;  3C64 A;  5AQU B;  3PUQ A;  2L3L A;  1E1H B;  4G63 A;  3ZPO A;  1IBK T;  3TLU A;  4YJ3 E;  3ZYK A;  3GN5 A;  4YSX A;  1M62 A;  4BAY B;  5JDQ A;  5L3G B;  5JVD E;  3OJA A;  3P4S A;  4B3M T;  5AQR B;  4HFH A;  2UU9 T;  2LJL A;  4TWD A;  5L4H A;  5LOV E;  4LML A;  1O3X A;  4DID B;  2YDQ A;  4JI8 T;  3RYC E;  2KLQ A;  4U7I A;  5FVL A;  4U3C A;  2V7M A;  2B1E A;  1E2A A;  5F5W A;  4DUZ T;  3PUR A;  3IHR A;  1H7C A;  4HFE A;  4Z91 A;  3RYF E;  1KK7 A;  2CLY C;  3HR0 A;  3L8R A;  4O4I E;  3UU4 A;  1S35 A;  2V6Y A;  3VHL A;  1IBL T;  1ZP0 A;  1T98 A;  1YD8 G;  2D9D A;  4OYK A;  5ABF A;  5LXT E;  4JI1 T;  5L3F B;  3RPU A;  3E08 A;  1HFA A;  2ZLY A;  4ERR A;  2QGS A;  4IRE A;  2CXL A;  4TUY E;  5KX5 E;  4GYS A;  4PJN A;  3KVB A;  4AQG A;  4WBN E;  3AA6 B;  2WU2 A;  3AEA A;  1N36 T;  2XHE B;  2PFV A;  1D0X A;  3P50 A;  2E9X C;  3AAE B;  1MMN A;  1UUS A;  4HWD A;  1SUM B;  2OV9 A;  4QXB B;  2NTY A;  2XZE A;  2WDQ A;  4QH5 A;  3RI5 A;  4DBQ A;  3HL6 A;  2K24 A;  2X0L B;  1YQ3 A;  2BG9 A;  2FJE A;  1FEW A;  2HH7 A;  3IEE A;  3MK7 C;  3RIU C;  4ZI3 D;  2LRL A;  5H6R B;  2LLY A;  2CLY B;  4U31 A;  3JAD A;  4DO0 A;  5ABF B;  4LFA T;  3P4P A;  2XAF B;  4DBR A;  4X64 T;  3ZEF B;  1ZV4 X;  4JI0 T;  1MIV A;  5CA1 E;  4IE7 A;  3ONL C;  2CXD A;  2NWB A;  2BKP A;  1Y01 A;  2JMK A;  2M67 A;  2YIN A;  3DP7 A;  3OPC A;  1N33 T;  1YXR A;  2NW9 A;  2CWY A;  1HCI A;  4UVB B;  4CZZ B;  2ACX A;  5JQG E;  2LSY A;  2WM9 A;  3TLT A;  4QH4 A;  3WSC A;  2BS2 A;  2WAU A;  3OKQ A;  3RLF F;  2CWO A;  1HF8 A;  2LEH A;  5AQP B;  4IE0 A;  4AKG A;  3DJB A;  2LQU A;  2VUR A;  2Q9Q B;  2CXF A;  5HEJ A;  5LG4 A;  3OYX A;  5L2L A;  3RHW A;  1Z8U A;  5HWX A;  5T1D A;  4G2A A;  1WLX A;  3OYZ A;  3RKG A;  2XY8 B;  2BG9 C;  3RIU A;  4F6R C;  4ONR A;  3H37 A;  4H9N C;  3K3N A;  3ZMT B;  2L8K A;  4ANJ A;  2N9D A;  3J7Y q;  2UXN B;  3U3I A;  3FXE B;  3N9P A;  4P1N A;  3C4W A;  3O1J A;  4ZZC A;  4W8P A;  2Y6X A;  4UR9 A;  3WUR A;  4AKL A;  2IAK A;  5LP6 E;  2MTC A;  3AA1 B;  4QXH B;  4ILU A;  3HKB E;  1NWM X;  4M1P A;  5AFU L;  2K48 A;  2MPK A;  2VVS A;  4AQF C;  3M1C A;  4YTM A;  3UTK A;  1MIY A;  1KNR A;  3RF1 A;  2X51 A;  3ZC1 A;  2YOE A;  2HPL A;  2W63 A;  3FZK B;  3PUV F;  5KXJ A;  2KGX A;  3ZN0 B;  2KSR A;  2Q9Q D;  5LMN T;  4U2Z A;  4AIS A;  2BS3 A;  2LRK A;  2J47 A;  3AED A;  4EIW A;  3NRY A;  3LG7 A;  1L0V A;  1G73 A;  3UUB A;  1HTJ F;  4EYY R;  3ETV A;  1T72 A;  3FBL A;  3E22 E;  3FBZ A;  2XQ3 A;  2DHR A;  2OLT A;  5AQO B;  5J1G A;  3NRX A;  2RP4 A;  4CN6 A;  4X1I E;  3V5U A;  2FJA A;  3CK6 A;  3N9M A;  4U74 A;  5JRE A;  4PAG A;  3UUN A;  3VR9 A;  4ADZ A;  4H9S E;  3TKL B;  4X66 T;  2BKN A;  2RA1 A;  4IST A;  5FP3 A;  5AQG B;  2QVA A;  4L9I A;  2IHR 1;  3ZCI A;  3RGL A;  3ZMV B;  1WFD A;  2D0U A;  3JAF A;  5AQH B;  3VKH A;  3GMI A;  3K3O A;  1V9D A;  2LSK A;  2FJB A;  2X68 A;  2XM1 A;  3ZYL A;  5DQV A;  2BVM A;  4DV2 T;  3ZST A;  4L0R A;  1LKX A;  3N2G E;  2DI4 A;  2H7V C;  1YW0 A;  1UCU A;  4KBM B;  4AQY T;  3FYQ A;  2KMF A;  1IJ5 A;  3OVU A;  4DR1 T;  4ILC A;  4I0U A;  2UUC T;  3NBX X;  4GK0 E;  3KDS E;  2V6X A;  2XJ7 A;  3ZLI A;  5EK2 A;  2E9X D;  1KEY A;  1HR0 T;  4JEH B;  3V5S A;  2A9U A;  3N2K E;  4BA9 A;  2K3W A;  2K5B B;  3JAE A;  3AE6 A;  1LRZ A;  2C0S A;  2XQ6 A;  4FJO A;  2V7I A;  4PFO A;  4X20 E;  4KP3 C;  3EAB A;  2IW5 B;  4L5G A;  3CML A;  3GWH A;  3E0Z A;  4QKN A;  3AB3 B;  3AA0 B;  3KBT A;  3RIA A;  3GA8 A;  4EXT A;  4CXY A;  4XBF B;  3VKG A;  2ZM6 T;  3ZT6 A;  1LVF A;  2NW8 A;  2XAG B;  4HE8 A;  4ZI2 D;  5EZY E;  1U5P A;  5AQF B;  3HI2 A;  3LFM A;  4X65 T;  2LSG A;  2VB6 A;  2LM2 A;  2WS3 A;  4CI2 B;  4I4T E;  4QHO A;  3K1S A;  2EHO B;  1I94 T;  5J2U E;  4UV8 B;  1HNW T;  2V26 A;  1QLB A;  3KVA A;  2VKH A;  3L39 A;  4PJJ A;  2V7J A;  5AQQ B;  3VU7 H;  5BMV E;  2XQ5 A;  5HEG A;  3RC8 A;  3AT7 A;  2XSA A;  3CPZ A;  4N78 D;  4I43 B;  5FL1 A;  3PF0 A;  4ZHQ E;  2X9X A;  1D0Z A;  1OED A;  5LJN A;  1US7 B;  2QRX A;  4TV9 E;  2CM0 A;  5M4Y A;  4P0A A;  5ETW A;  4LF7 T;  5L4E A;  4ZS2 A;  4ISS A;  1VOM A;  2RPA A;  2XQY A;  2YU2 A;  3ETU A;  3FZL B;  2WMO A;  3NKZ A;  4GK5 E;  5HEH A;  2YDS A;  2HN2 A;  2LKG A;  5AQS B;  2BVL A;  4C90 A;  3ZMS B;  4ZI7 E;  2KBB A;  3BQI A;  2KWH A;  2AXD S;  4DR5 T;  4QX7 B;  2JQH A;  3SFD A;  3ZMU B;  4YLH A;  4F8H A;  4KI0 F;  3EI0 A;  2LE8 A;  5JDL A;  2WDR A;  4HFI A;  1N32 T;  4TWH A;  4U33 A;  4B6X A;  3KBU A;  4DR6 T;  1HX8 A;  2DL1 A;  5LHH B;  1CUN A;  2VK9 A;  4HWF A;  2OA5 A;  4MLK A;  3O9X A;  1XNR T;  4JYA T;  4O4H E;  3VRA A;  5JRC A;  5FKY A;  4PK6 A;  3SS1 A;  2XQ9 A;  1KF6 A;  2VWA A;  4JLE A;  5FY1 A;  4YHH T;  3ZT7 A; 
#chains in the Genus database with same CATH homology
 3P7I A;  3T8O A;  3I9W A;  4UIG A;  2MTQ A;  3M1C A;  2X67 A;  4MFR A;  2W62 A;  5HXR A;  5A1L A;  2N2N A;  5GON E;  2MYS A;  5KDM C;  1X79 A;  4PW8 A;  2E9X B;  4PJM A;  2KIN B;  4H9Q C;  3CX8 B;  3LBX B;  5LHI B;  3PU3 A;  2V7K A;  1QUU A;  3EVY A;  3PUG A;  4J2C A;  3CQX C;  4P0B A;  3UT5 E;  1KNZ A;  3O1I A;  2KND A;  3FXD B;  3LK2 B;  2UXX B;  5EK4 A;  3PE0 A;  2C5K T;  5FXX A;  2IC6 A;  3L3P A;  2XAQ B;  3N9N A;  1LVK A;  1IJ6 A;  4EYU A;  4HKA A;  4X1K E;  3B13 A;  3QK6 A;  5CB4 E;  2JPF A;  4QXC B;  2Z6E A;  1HG5 A;  3M65 A;  4UVC B;  4CQI A;  2XAJ B;  5DQW A;  3I1A A;  2E8I A;  3R84 B;  2J1D G;  4PFP A;  5JH7 E;  4XZC A;  5FYM A;  3IF8 B;  2GK9 A;  3Q2M A;  5L3E B;  5FY7 A;  3K8P C;  4AI6 A;  2YK0 A;  4CI1 B;  3O4X E;  3B57 A;  2CMR A;  2V1D B;  3ONX A;  3QC9 A;  4FI5 A;  4ZI2 C;  5LGN B;  4P09 A;  1IZN B;  2ODU A;  5FMN A;  3Q9D A;  4QWN B;  4H9P C;  2Q9Q A;  2PJQ A;  4OFZ A;  3KV4 A;  4DND A;  3AAA B;  2X9Y A;  2C5J A;  3ZMZ B;  3WAJ A;  3F2E A;  2H3R A;  4I55 E;  4YJ2 E;  1BR1 A;  4AQF A;  2DLR A;  2K9A A;  4ZOL E;  4EB6 E;  1BR4 A;  1FIO A;  3RYI E;  3KV9 A;  3UUM A;  3N9L A;  4MAL A;  3RYH E;  2ZM2 A;  3C4Z A;  3W15 B;  3Q5W A;  5F3J A;  2WBL A;  3AVS A;  4CXW A;  5LNK A;  2SPC A;  2ZM8 A;  5HXS A;  3VJZ A;  1D0Y A;  2W0G A;  2D5U A;  5LGT B;  4YFS A;  1Z0P A;  2VAS A;  1MMD A;  3J9X 1;  5HXH A;  4EZH A;  4E7S A;  4O2A E;  3CQC B;  1OWA A;  5L3C B;  4O8S A;  3QUJ A;  4HGA A;  3H3A A;  4Z8X A;  1MNE A;  3OBV E;  4BJN A;  4MHC A;  4WNK A;  3SWH A;  2MBG A;  5LBQ B;  4ECG A;  5LYJ E;  2BDE A;  2IC9 A;  1NAF A;  2LHR A;  2N1G A;  3JC6 D;  4O4J E;  5EK3 A;  4ZS3 A;  2NP9 A;  4YHJ A;  3RX6 A;  3UFE A;  3CX6 B;  1MMA A;  4UV9 B;  2D2S A;  4XAX B;  2DWK A;  4GYR A;  4IGU A;  3ZJ2 A;  3KIN B;  1U4Q A;  3A5X A;  1MMG A;  3HKC E;  5JR9 A;  4GIW A;  3ZC0 A;  2ODV A;  5LGU B;  5HXC A;  2LT3 A;  3EUH A;  4QX8 B;  5FXW A;  3DTO A;  3O1H A;  3HKE E;  3C4X A;  5LJM A;  2HPJ A;  3MJX A;  2LHN A;  2PBI A;  5HYA A;  2LOS A;  3S4U A;  3NZP A;  3IBP A;  2XTL A;  2VKJ A;  3WAK A;  1FMW A;  2NOX A;  5IHY A;  2YEV C;  2NW7 A;  3RH3 A;  2WMN A;  2Y8D A;  2MOZ A;  3CQG B;  2NTX A;  3ZCJ A;  4UVA B;  2XAH B;  3MA9 A;  4HFV A;  5CA0 E;  2C5I T;  3RRW A;  3SRZ A;  3C51 A;  3R6N A;  2CA5 A;  3GN5 B;  3SOL A;  3PU8 A;  4MBQ A;  1S94 A;  2W00 A;  5LA6 E;  2CCQ A;  2W61 A;  4DMV A;  2XAS B;  5IYZ E;  3UUX B;  3NZQ A;  4HTE A;  5LBM A;  5KMG P;  4AXP A;  1BR0 A;  5FNV E;  2X9W A;  5LCY A;  1D1B A;  3ZN1 B;  2DCF A;  2ES0 A;  2EHO C;  2JJ9 A;  3AAI A;  4OHF A;  2A72 A;  2D0T A;  3EDV A;  4H9R C;  5DJQ C;  4AKR B;  4CI3 B;  4HEA A;  3D0T A;  5HXE A;  2VKO A;  1YKE B;  2I59 A;  4NUU A;  3MXZ A;  5FXV A;  2EHO A;  3KFW X;  4TZ4 C;  5JR9 B;  2P9B A;  2VKD A;  5HAX A;  5DAB A;  2JQQ A;  4KUM B;  4EZ4 A;  3N9Q A;  1FMV A;  2JRK A;  2WWU A;  4I50 E;  1B7T A;  1BR2 A;  4JEU B;  1QSD A;  4BJM A;  4UF0 A;  4CXX A;  3PUA A;  3P8C D;  3N2O A;  1WRD A;  1WYB A;  2VL8 A;  2PG8 A;  4PJL A;  3BQL A;  3HA4 A;  1AJ3 A;  1HG2 A;  5HWY A;  2KZ7 B;  5H6Q B;  2DWG A;  4UEL A;  4IIJ E;  3JC6 C;  4PNI A;  3UUL A;  3I9Y A;  5JR9 C;  1WR6 A;  3CVR A;  4PK5 A;  3PTR B;  1MND A;  2L9Q A;  2CE7 A;  3PDY A;  5J2T E;  1HS7 A;  1ZKE A;  3LK3 B;  5JDG A;  4NUV A;  4IE5 A;  3FHN A;  3N9O A;  3U78 A;  5F8P A;  3MKD A;  4X1Y E;  3LJC A;  4O4L E;  2G0U A;  3I0Q A;  5L3D B;  5JDH A;  2A3D A;  3Q5X A;  4C91 A;  1EZ3 A;  4PK4 A;  4BGO A;  2QA7 A;  3MZK B;  3RC3 A;  2KWI B;  2WSS V;  5FXZ A;  4EOZ B;  5ADX L;  2LM9 A;  2Y48 B;  3ZYM A;  4UEM A;  4OK0 A;  3LBX A;  3F31 A;  4WBO A;  3C50 A;  5TAO A;  5JDM A;  2KT9 A;  3ANW B;  5LHG B;  3FB2 A;  2DNX A;  3ZJ1 A;  1G8X A;  3K3Q C;  2X9H A;  4GOU A;  3MAC A;  4DVD A;  4UF0 B;  3RKO A;  1IAP A;  3RRC A;  4A56 A;  5JDN A;  3CWZ B;  1ZEE A;  2ZMA A;  3CKD A;  3PHF 1;  1D1C A;  2YU1 A;  2EHO D;  3ANW A;  3CX7 B;  1YKH B;  5L3B B;  4OYJ A;  1ZHC A;  4ZI3 C;  4EAH A;  3EDU A;  3L09 A;  4H63 V;  2LSJ A;  2E9X A;  5E0O A;  4WW0 A;  1MIW A;  4DMW A;  4AKH A;  4O2B E;  2V7L A;  4JUY A;  3PUS A;  2XUE A;  3N5L A;  3AA7 B;  4K0U A;  2KXP B;  4V1A v;  1SHZ C;  1Y64 B;  3C98 B;  5JRC B;  2BZB A;  4TN7 B;  3KV5 A;  5JDF A;  1D1A A;  4AKI A;  1UX5 A;  3BQK A;  4TV8 E;  2JMH A;  4HN9 A;  2A2F X;  4TX5 A;  3WI3 A;  3ESL A;  1VRB A;  3LK4 2;  1SA0 E;  4IE6 A;  1WYC A;  3I0O A;  2LOP A;  3BK9 A;  2CEA A;  2X66 A;  4KMC A;  3HKD E;  4H63 H;  3F57 A;  3KV6 A;  2H7O A;  5C8Y E;  4UXN B;  1UX4 A;  3AVR A;  4IE4 A;  4H9O C;  2LSI A;  4IHJ E;  4IDZ A;  4U72 A;  2Q9Q C;  4ASK A;  4E7Z A;  5FY0 A;  2ZM0 A;  1OXZ A;  3C64 A;  3PUQ A;  2L3L A;  1E1H B;  4G63 A;  3ZPO A;  4YJ3 E;  3ZYK A;  3GN5 A;  5JDQ A;  5L3G B;  4BAY B;  5JVD E;  3OJA A;  2LJL A;  5LOV E;  1O3X A;  3RYC E;  2KLQ A;  2V7M A;  2B1E A;  3PUR A;  3IHR A;  1H7C A;  3RYF E;  1KK7 A;  2CLY C;  3HR0 A;  4O4I E;  3VHL A;  1S35 A;  1T98 A;  1YD8 G;  4OYK A;  5LXT E;  5L3F B;  3RPU A;  3E08 A;  1HFA A;  2ZLY A;  4ERR A;  2QGS A;  2CXL A;  4TUY E;  5KX5 E;  4GYS A;  4PJN A;  3KVB A;  4AQG A;  4WBN E;  3AA6 B;  2XHE B;  2PFV A;  1D0X A;  2E9X C;  3AAE B;  1MMN A;  4QXB B;  2NTY A;  4DBQ A;  3HL6 A;  2K24 A;  2X0L B;  3IEE A;  2HH7 A;  4ZI3 D;  1FEW A;  3MK7 C;  5J2U E;  5H6R B;  2CLY B;  4DO0 A;  2XAF B;  4DBR A;  3ZEF B;  1ZV4 X;  1MIV A;  5CA1 E;  4IE7 A;  2CXD A;  2YIN A;  2JMK A;  2NWB A;  2M67 A;  3DP7 A;  2NW9 A;  2CWY A;  1HCI A;  4UVB B;  4CZZ B;  2ACX A;  5JQG E;  2LSY A;  2WM9 A;  3WSC A;  2WAU A;  3OKQ A;  2CWO A;  1HF8 A;  2LEH A;  4AKG A;  4IE0 A;  2LQU A;  3DJB A;  2Q9Q B;  2CXF A;  5LG4 A;  3OYX A;  5L2L A;  5HWX A;  5T1D A;  4G2A A;  1WLX A;  3OYZ A;  4ONR A;  4F6R C;  3H37 A;  4H9N C;  3K3N A;  3ZMT B;  2L8K A;  4ANJ A;  2N9D A;  3J7Y q;  2UXN B;  3U3I A;  3FXE B;  3N9P A;  3C4W A;  3O1J A;  2Y6X A;  3WUR A;  4AKL A;  2IAK A;  5LP6 E;  2MTC A;  3AA1 B;  4QXH B;  4ILU A;  3HKB E;  1NWM X;  4M1P A;  5AFU L;  2K48 A;  4AQF C;  3UTK A;  1MIY A;  2X51 A;  3ZC1 A;  2HPL A;  2W63 A;  3ZN0 B;  2Q9Q D;  4EIW A;  3NRY A;  3LG7 A;  1G73 A;  1HTJ F;  4EYY R;  3ETV A;  3FBL A;  3E22 E;  3FBZ A;  2DHR A;  5J1G A;  3NRX A;  2RP4 A;  4X1I E;  3V5U A;  3N9M A;  4U74 A;  5JRE A;  4PAG A;  3UUN A;  4ADZ A;  4H9S E;  3TKL B;  2RA1 A;  4IST A;  5FP3 A;  4L9I A;  3ZCI A;  3ZMV B;  2D0U A;  3VKH A;  3GMI A;  3K3O A;  1V9D A;  2LSK A;  2X68 A;  3ZYL A;  5DQV A;  2BVM A;  4L0R A;  1LKX A;  3N2G E;  2DI4 A;  2H7V C;  1YW0 A;  1UCU A;  4KBM B;  2KMF A;  1IJ5 A;  3NBX X;  4GK0 E;  3KDS E;  3ZLI A;  5EK2 A;  2E9X D;  4JEH B;  3V5S A;  3N2K E;  4BA9 A;  2K5B B;  1LRZ A;  2C0S A;  4FJO A;  4PFO A;  2V7I A;  4X20 E;  4KP3 C;  2IW5 B;  4L5G A;  3CML A;  3GWH A;  3E0Z A;  4QKN A;  3AB3 B;  3AA0 B;  3KBT A;  4EXT A;  3GA8 A;  4CXY A;  3VKG A;  4XBF B;  1LVF A;  2NW8 A;  2XAG B;  4HE8 A;  4ZI2 D;  5EZY E;  1U5P A;  3HI2 A;  3LFM A;  2LSG A;  2VB6 A;  4CI2 B;  4I4T E;  4QHO A;  2EHO B;  4UV8 B;  2V26 A;  3KVA A;  5BMV E;  2VKH A;  4PJJ A;  3VU7 H;  2V7J A;  3RC8 A;  3AT7 A;  3CPZ A;  4N78 D;  4I43 B;  3PF0 A;  4ZHQ E;  2X9X A;  1D0Z A;  5LJN A;  1US7 B;  5M4Y A;  4TV9 E;  2CM0 A;  4P0A A;  5ETW A;  4ZS2 A;  4ISS A;  1VOM A;  2XQY A;  2YU2 A;  4GK5 E;  3ETU A;  2WMO A;  4C90 A;  4ZI7 E;  2BVL A;  3ZMS B;  3BQI A;  2KWH A;  4QX7 B;  3ZMU B;  4YLH A;  2LE8 A;  5JDL A;  4B6X A;  3KBU A;  1HX8 A;  5LHH B;  1CUN A;  2VK9 A;  2OA5 A;  4MLK A;  3O9X A;  4O4H E;  5JRC A;  4PK6 A;  3SS1 A;  2VWA A;  4JLE A;  5FY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...