5HXEA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 100 mm na+ and zero ca2+
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
304
structure length
297
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRMGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 126
structure length 297
sequence length 304
ec nomenclature
pdb deposition date 2016-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hxeA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hxeA02
5HWYA 5HWXA 5JDGA 5JDMA 5HXHA 5HXCA 5HXEA 5JDHA 3V5UA 5JDFA 5HXSA 5JDNA 5HXRA 5HYAA 5JDQA 3V5SA 5JDLA
chains in the Genus database with same CATH superfamily
2LKHA 4ERRA 3EHZA 3SS1A 1GQEA 3A5XA 3DYJA 3AE3A 4ANJA 2LRKA 4JEUB 2JPFA 3ZN1B 1OEDA 5FXVA 3ZC0A 4I0UA 3PUGA 3KV9A 2RP4A 2WCAA 4ZI3D 4PW8A 4U33A 2BVMA 1UURA 2Q9QD 2XM2A 1XMQT 2UUAT 4UIGA 3RIAA 2IIUA 4KBMB 3EI0A 1E7PA 2D5UA 3R84B 3AEBA 5AQSB 3PU8A 5FY0A 1HR0T 1NWMX 3SFDA 4UV8B 2V5CA 3MK7C 2XY8B 1R8IA 3H3MA 2KMFA 3K8PC 3QOFA 5FXWA 3JAFA 4MLKA 3RQWA 1I94T 2LM2A 3BQIA 2UUCT 4IIJE 3FBZA 3KV4A 3D0TA 3I9YA 4GKJT 2V6XA 4TN7B 3SOLA 3I9WA 4CI2B 1KNPA 2X67A 2AE9A 4XAXB 3O1IA 1BR2A 5BR8T 5FMNA 2L8KA 3ZYLA 2XJ7A 4L9IA 4UF0A 2WU2A 2CPTA 1JNRA 4YTMA 5JDFA 2HPLA 4LF7T 2OLTA 2KSRA 3L09A 2L7NA 2H89A 4OHFA 2OA5A 1UGOA 1XWMA 2XQ8A 4U3CA 4EAHA 4ONRA 2EHOB 5HXRA 1ZP0A 1YD8G 1HS7A 2XQ4A 3O1JA 4JI6T 1D1CA 3V5SA 4U7IA 4F7GB 2ODVA 4L5GA 4UF0B 3J7Yq 1N34T 5LHHB 3UU3A 1XZYA 5L47A 2X9WA 4HWIB 3N2GE 4IL9A 3AA1B 2C5KT 3G06A 3R6NA 1IJ6A 3ZJ1A 5FKYA 3ZT7A 2DWGA 4F8HA 2LEHA 5KDMC 2A72A 2L10A 4A56A 2VK9A 3CKDA 3P50A 4Z8XA 4EIWA 4CI1B 3K3OA 3GN5A 4DR2T 3RKGA 2FJAA 2BS3A 1T8BA 2I0MA 2WZHA 2RPAA 4TX5A 1XNRT 3QC9A 5L4HA 4IE4A 4LF4T 2AXDS 1UUSA 2BS4A 3PUZF 3RC3A 4JI0T 5AQJB 3KV6A 5LMUT 3MA9A 4ZI2C 4PFPA 2E5LT 5KX5E 4PK5A 3F2EA 3E22E 5JQGE 4PJMA 4KMCA 1LKXA 5C2TA 5AQHB 2WMOA 2WS3A 4DIDB 3CIRA 4JI8T 2YDSA 2BZBA 2Q9QA 2V7JA 4B3TT 2E2AA 3RPUA 4DV0T 4CZZB 3AA7B 4F6RC 1HF8A 2JQ9A 2X9XA 4AKGA 5DJQC 1UX5A 3EVYA 5JTGA 5KXJA 1J1JA 3C98B 4C90A 3V5UA 1XNQT 2X0HA 2V1DB 3MACA 2V7MA 3P7IA 1KK7A 4MALA 1IBLT 3ZPOA 2K3WA 1MNDA 2CM0A 3OPCA 3T1HT 2CBJA 3OBVE 5J1GA 2KWHA 3OVUA 1SJ7A 5HEOA 4NUVA 2VKOA 2J4GA 3WURA 3LK42 4CN6A 3UTKA 3N9MA 3M1CA 4YFSA 2FUPA 2JQHA 5C3JA 4HE8A 4CXWA 4Z90A 4CXXA 4BAYB 2BG9A 2A2FX 3HL6A 5LMNT 3H3AA 3AB3B 3LDQB 3PF0A 1XDPA 2PFVA 2FJDA 4TZ4C 2X51A 2LE8A 4A98A 2CMRA 1OWAA 1D1AA 2V7LA 4BJNA 4EV6A 4PAGA 2E8IA 3E08A 5AQQB 2NW7A 5JREA 2K48A 5DABA 4DR7T 2CHOA 1SE7A 4O4LE 2UXCT 2HH7A 3C64A 3KINB 4IDNA 4ZZBA 3HA4A 2IUBA 1FMWA 2BG9B 4WZXA 5ADXL 3RC8A 2DL1A 2VASA 4ZEYA 5FYMA 1KEYA 2CXLA 3FZMB 1S94A 2WSSV 3PJAJ 2J47A 3AE6A 4BGOA 2XQ6A 3ZMSB 4IDPA 4HFVA 2XASB 1U4QA 3ETUA 4P0AA 4KX6A 3PDYA 5ABEA 4CN4A 2WBLA 2W4XA 3WAKA 3PUVF 1T98A 2D0UA 4LMKA 2MPKA 5FXXA 5JDGA 2XM1A 1T72A 3AEEA 2KNDA 4HGAA 4UEMA 3K3QC 2YKSA 1XMOT 1WCRA 1UX4A 1J5ET 4HN9A 2YU2A 3ZC1A 5HXCA 4HTEA 3AAIA 2L3LA 3U78A 4M1PA 4QH1A 2MYSA 3ZJ2A 3O4XE 4HKAA 4ZOLE 4ZHQE 4QX7B 2A9UA 2LQUA 3M3ZB 4ILCA 4QH4A 3FZFB 2IMLA 1VCSA 4NUUA 5DQVA 1MIWA 1W0AA 2V7KA 4AQYT 3VKGA 2W2UA 1G8XA 2YN6A 2WDVA 3ZMVB 2DCFA 1FEWA 5HCJA 2RA1A 1DU2A 2VKHA 2WDRA 2Y8DA 3BK9A 4UV9B 5L3CB 3UU5A 4KUMB 3BQLA 3VR8A 4HFIA 1MMNA 2DLRA 4YTNA 5F8PA 1MMAA 4QH5A 4DMVA 4HWHA 4HFHA 4XBFB 2FBWA 3EAMA 4B3RT 2DNXA 4HFDA 2XQ5A 2PBIA 2H88A 4YSXA 2NTXA 2BDEA 4HEAA 2VVNA 5LNKA 2X0LB 5ETWA 4EXTA 4YTPA 3EDUA 3RHWA 5LA6E 5H6RB 4CN1A 2UUBT 4UVBB 1YQ3A 2JMHA 5LP6E 4ZI3C 2X9HA 3WAJA 2X66A 4LF6T 2Q9QC 3ZKRA 2LSYA 2XQAA 2W62A 2YU1A 4AISA 5LBMA 4LFCT 3ZT6A 4KP3C 5FP3A 1CUNA 2XHEB 4O2AE 4O8SA 1E1HB 3ONLC 3UQ7A 4KI0F 5AQKB 2BS2A 4H9PC 4AI6A 2CLYC 5CFBA 4WYVA 4PK6A 3EDVA 2G0UA 4ISTA 3ZYKA 5FVLA 2V7IA 1XDOA 4QKNA 1IZNB 1LVKA 4PJJA 1M62A 1UCUA 2JQQA 1FJGT 5AQOB 4NPPA 4EB6E 5LB7B 2NR4A 2VQFT 3Q2MA 3O1HA 2PG8A 3U3IA 3AECA 1OEDB 5JR9A 4UVAB 3CK6A 2BG9C 2XAGB 4MHCA 1QSDA 4IREA 2IDOB 5HXSA 3FYQA 3UUMA 4HFBA 1VOMA 3N2KE 3T1YT 2BBHA 4N78D 3UT5E 2NP9A 3KDSE 4P0BA 1HTJF 3VR9A 4Q25A 3AAAB 3EABA 5JR9B 5J0ZA 4ECGA 4TNWA 2D2SA 2WP9A 3UQ4A 5FZTA 2H3RA 3KBTA 4B6XA 2BKPA 2YEVC 3JC6D 3ZN0B 3N9PA 4IDOA 1Z8UA 2CWYA 2XPKA 4JI7T 3AE7A 5HXEA 5JRCA 2QYWA 3B5MA 4H9OC 3C51A 1HNZT 4YXDA 2DHRA 1HNWT 5LBQB 4GKKT 3H37A 2JJ9A 1YXRA 3IEEA 4YLHA 2LSIA 2I6HA 3QB5K 2HHHT 2N9DA 3E0ZA 3I0QA 5JDQA 5FVKA 2MOZA 4HFCA 4IE5A 5BMVE 3JCFA 4DV1T 2LRLA 1E2AA 2KWIB 1S35A 5JRCB 3DP7A 4X1IE 2HN2A 4B3MT 3AA0B 1KNRA 5LHGB 3AT7A 5HYAA 3RIUA 4E7SA 5GONE 2JMKA 4PJNA 3QK6A 2ES0A 1SJ8A 3HKDE 3GA8A 4EYUA 3AE8A 2A3DA 4IL4A 4JUYA 5IYZE 3MZKB 2UXXB 4BA9A 3NKZA 4AQFA 1V9DA 3GN5B 2J62A 2XSBA 2CRBA 4LF9T 5JDLA 4ZZCA 5HWYA 1D1BA 5AFUL 2CA5A 5F5WA 2QRXA 2CXDA 4QX8B 1WYBA 1J5WA 5IWAT 2VVSA 4AIUA 2IHR1 5JVDE 2KBBA 2IW5B 3JADA 4COFA 2LOSA 3UULA 4DBQA 5LHIB 4PJLA 3IHRA 2QVAA 3NZQA 4GIWA 4JBWF 3RYFE 4DR4T 2VWAA 3FXDB 4ISSA 2NW9A 4IE7A 3AE9A 5A1LA 4B3ST 3AEFA 1MNEA 5LXTE 3PUQA 3FXEB 4G2AA 2Q9QB 2Z6EA 3P4WA 3ESLA 5HEGA 1OEDC 4H9QC 3FZKB 3FZLB 3ANWA 3VJZA 1L0VA 1N32T 1W0BA 3QB5A 3C50A 3SWHA 2B1EA 1YKHB 3A7MA 2CLYB 3AVRA 1U5PA 2BBJA 2WMNA 2MTCA 5L2LA 4FJOA 3Q5EA 2WU5A 4DR5T 4WNKA 1NENA 5JR9C 2CE7A 3ZMUB 4OYJA 3PV0F 2W00A 1CHUA 1OXZA 3OYXA 1HG2A 5LGNB 2Y6XA 2DWKA 4DV2T 4DV3T 4IHJE 3LJCA 3VRBA 3AE4A 4L0RA 4AQGA 4E7ZA 5C8YE 2K24A 2W63A 3IBPA 4UELA 2UXDT 1D0XA 2WZIA 3HKEE 2CBIA 2VB6A 3FB2A 3ZMTB 4BJMA 2WQYA 4OK0A 2IC6A 3PURA 3L8RA 3AVSA 5TAOA 1IBKT 4YSYA 2JQKA 3LFMA 2LKGA 2WY2A 1WFDA 3CQXC 1JNZA 2EHOD 4TWDA 4X62T 3OTOT 3HR0A 2CWOA 3AEAA 3N9LA 3KVAA 2LJLA 3AEGA 1KFYA 4QXCB 4TV9E 5HEHA 4TV8E 2LOPA 4AKRB 1KNZA 1BR4A 3NRXA 4TWFA 2V5DA 2E9XD 3RLFF 1G73A 3BQKA 4WBNE 5CGMA 4CI3B 3CX7B 4TNVA 5HEUA 3OYZA 5LG4A 3AEDA 3QUJA 4WW0A 5AQLB 3PHF1 3ZT5A 3AAEB 4NIQA 3JAEA 3ZCIA 1KF6A 5CB4E 3KV5A 2QGSA 3X1DA 5AQTB 2ZM2A 3LG7A 3L39A 2C0SA 3RIUC 5LG3A 4QHOA 4U31A 4YJ3E 3ZMZB 4YSZA 1MIYA 5LJNA 5HWXA 5AQNB 3MKDA 3KFWX 5ABFA 4TUYE 2M6IA 2HPJA 4DNDA 2DI4A 2LHNA 4CXYA 2WB5A 4AQFC 4QWNB 1O3XA 5AQUB 1ZEEA 3ETVA 2VKJA 4OFZA 4AKHA 5T1DA 3TLVA 4MFRA 1ZOYA 3LK2B 3K3NA 2XAQB 4ZXLA 2HN1A 4O2BE 5LGUB 2JRKA 3DTOA 3VHLA 2FJEA 5AQFB 5EK2A 3CWZB 1VRBA 4ZS2A 3F57A 4PK4A 4YY3T 2YDRA 4Z91A 2VL8A 2Y48B 1WR0A 4LFAT 4U2ZA 4CQIA 4K0KT 4UXNB 2W61A 2J1DG 1W09A 1X79A 2BKOA 2ZM0A 4X20E 2XSAA 1US7B 4H9NC 2LM9A 2BG9E 2XAFB 3P8CD 4PNIA 4ADZA 5CJ5A 3RI5A 4IE0A 4U72A 5LJMA 2FJBA 3WI3A 3AE2A 1QUUA 5LGTB 1N33T 3DJBA 3UFEA 5FY7A 3NZPA 5HCMA 1YQ4A 1MMGA 2UXBT 4ASKA 3AXJA 4DV5T 2E5VA 2BVLA 4P09A 2WAUA 4OYKA 2KT9A 5FL1A 2GK9A 3B13A 5HEJA 2OV9A 3KVBA 4IDZA 2L9QA 4LMJA 2ZMAA 4ILUA 3P4PA 2SPCA 5J2TE 2P9BA 3UU4A 3JC6C 4HFEA 3RGLA 1Y01A 5L3GB 4FI5A 4IGUA 2EHOA 3C4WA 3AXJB 5JDMA 2QA7A 1HCIA 1HNXT 2W67A 5ABGA 5H6QB 3CQCB 3CMLA 2XZEA 4NXMT 1W9RA 4JV5T 1NEKA 3EUHA 5HAXA 4JI4T 2E9XA 2UXNB 1QLBA 4EYYR 3I0OA 2V26A 1D0ZA 3KBUA 2ZLYA 3Q9DA 5L3BB 1LVFA 4U2YA 3UU8A 2XQYA 2X0YA 4V1Av 2WM9A 5HXHA 5IUXA 3LK3B 1MIVA 3IF8B 2V6YA 3AE1A 5LOVE 3RH3A 2CHNA 4OX9T 2KINB 4I43B 2K9AA 5DQWA 4EZHA 3LBXA 3UU6A 5EK3A 5LCYA 3S4UA 4C91A 1ZHCA 2E9XB 4DV7T 3B57A 3ONXA 2XTLA 2VL0A 4H9SE 4I55E 5FY1A 3ZLIA 4DUZT 4LMLA 4YHHT 4DBRA 1ZV4X 3AE5A 4AKIA 3RYIE 4EZ4A 4K0UA 2V6YB 3PUAA 2X9YA 3WSCA 4EGWA 2CEAA 4DR1T 1IJ5A 1WR6A 3RRWA 5M4YA 3TLSA 4I4TE 4EEBA 4U7YA 1BR0A 2K5BB 3F31A 1EZ3A 3LBXB 1MMDA 5J2UE 2BKNA 1UK5A 3ZEFB 3RYCE 2ACZA 4XZCA 4A5XA 2YOEA 3K1SA 4YHJA 1IAPA 2MAWA 1H7CA 3OJAA 1SUMB 3PUXF 4LFBT 4UVCB 4I50E 3AA6B 3CX8B 5EK4A 3QNUA 3SFEA 2UU9T 4YT0A 4LF8T 1HG5A 3P4RA 5AQIB 3CVRA 3Q5XA 4JYAT 3NWIA 4X1YE 1IBMT 2R6GF 3MJXA 3SRZA 5FXZA 4PFOA 4HWCA 4DV6T 3Q5WA 5AQRB 3VRAA 2JIWA 3UUXB 3LSVA 4O4HE 1OEDE 1YKEB 4X64T 2H7OA 1YW0A 4HWDA 1LRZA 2WWUA 3RIFA 4QXHB 2MBGA 4ZI2D 2PJQA 2YK0A 3T8OA 4AKLA 1AJ3A 4J2CA 1T7SA 5IHYA 2LSGA 4AXPA 4KHZF 3UFGA 1WYCA 4YJ2E 4GYRA 4NXNT 2KVPA 3PU3A 3RYHE 3HI2A 3TLWA 4ZS3A 5AQGB 2PTFA 2CXFA 4DMWA 3GWHA 4EEDA 2C5IT 2X0CA 4H9RC 4X66T 2IC9A 5CA0E 3VKHA 4DR6T 1ZKEA 5L3DB 2KLQA 4GK5E 4TWHA 2V8SV 2C5JA 2MTQA 4O4IE 4LF5T 5F3JA 5FNVE 5AQPB 4DVDA 3TLUA 4JEHB 2M67A 3ONJA 3RF1A 3ZCJA 5JDNA 2LLYA 4IDQA 2LHRA 3Q5DA 3C4XA 3HKBE 2CCQA 4EOZB 3ANWB 3O9XA 3N2OA 4ILAA 4GYSA 3PUSA 1WLXA 3ZSTA 5JH7E 1X9BA 2YINA 3FBLA 5AQVB 4KHPT 3UUBA 2NOXA 4DV4T 2EHOC 2VKDA 4A97A 4ZI7E 3A8YC 3P4QA 2N1GA 2B76A 4X1KE 4H63V 2ACXA 3N9NA 4P1NA 1NAFA 1SA0E 3ABVA 4HWFA 2LT3A 4MBQA 3FHNA 3PUWF 2D9DA 3AY5A 3CPZA 2E9XC 2YDQA 1FMVA 2VQET 4DR3T 4ILBA 2NWBA 1Y64B 3M65A 2XQ7A 3CX6B 2LSJA 3IA3A 2X68A 5L4EA 4GK0E 4JI3T 2ODUA 5CA1E 4H63H 4JLEA 3J9X1 5ABHA 2XQ3A 2ZM8A 1BR1A 3NBXX 3OKQA 2N2NA 2IAKA 1VCTA 5AQMB 2KXPB 3UUNA 4DUYT 5LYJE 3P4SA 3RQUA 3RX6A 4X65T 2W0GA 2XAJB 3C4ZA 1M7KA 2H7VC 1N36T 3HKCE 3PJAA 4WBOA 3CQGB 3NVOA 5JDHA 1FIOA 2F4VT 4QXBB 3TKLB 4IE6A 4JI5T 3I1AA 1B7TA 3N9QA 5L3FB 3RKOA 4G63A 5FL0A 3NRYA 3GMIA 1WRDA 4W8PA 3ZSSA 2LSKA 3VU7H 3ZYMA 4IT4A 1HFAA 3PTRB 2XUEA 2KZ7B 5E0OA 4GOUA 5L3EB 4JI2T 5EZYE 1HX8A 1SHZC 3PE0A 2XAHB 3RRCA 3FZHB 3PUYF 2NW8A 4UR9A 3L3PA 3W15B 1Z0PA 5KMGP 4X5TA 1D0YA 2W66A 2WWVA 3N5LA 2D0TA 3TLTA 4DO0A 4JI1T 2WDQA 1I6ZA 2KGXA 4U74A 5ABFB 2XQ9A 3MXZA 4O4JE 2ZM6T 2VURA 3N9OA 2NTYA 1HX1B 2I59A 2M6BA
chains in the Genus database with same CATH topology
5A1LA 2K9AA 5DQWA 2KNDA 4HGAA 4ERRA 4UEMA 3K3QC 3SS1A 4EZHA 1MNEA 1UX4A 5LXTE 3LBXA 4HN9A 5EK3A 2YU2A 3PUQA 5LCYA 3S4UA 3ZC1A 3A5XA 4C91A 1ZHCA 2E9XB 3FXEB 4HTEA 5HXCA 4ANJA 3AAIA 3B57A 2L3LA 3U78A 4M1PA 4G2AA 2Q9QB 2Z6EA 2MYSA 4JEUB 3ZJ2A 3O4XE 2JPFA 3ZN1B 3ONXA 2XTLA 4HKAA 3ESLA 4ZOLE 4ZHQE 4H9SE 5FXVA 3ZC0A 4I55E 4QX7B 5FY1A 4H9QC 3ZLIA 2LQUA 4DBRA 1ZV4X 4AKIA 3PUGA 3KV9A 2RP4A 3RYIE 4EZ4A 3ANWA 3VJZA 4K0UA 3PUAA 4ZI3D 2X9YA 4PW8A 3WSCA 4NUUA 5DQVA 2BVMA 2Q9QD 1MIWA 2CEAA 4UIGA 4KBMB 1IJ5A 1WR6A 3C50A 3RRWA 2V7KA 2D5UA 3R84B 5M4YA 3VKGA 4I4TE 3PU8A 5FY0A 3SWHA 2B1EA 1YKHB 1G8XA 1BR0A 2K5BB 1NWMX 3F31A 2CLYB 3AVRA 1EZ3A 3LBXB 1U5PA 1MMDA 4UV8B 5J2UE 3MK7C 2WMNA 3ZEFB 3ZMVB 3RYCE 2DCFA 4XZCA 1FEWA 2MTCA 4YHJA 2KMFA 1IAPA 3K8PC 5L2LA 4FJOA 5FXWA 4WNKA 2RA1A 1H7CA 3OJAA 4MLKA 5JR9C 2CE7A 4UVCB 4I50E 3ZMUB 2VKHA 3AA6B 3CX8B 5EK4A 4OYJA 2Y8DA 3BK9A 2W00A 4UV9B 5L3CB 1HG5A 4KUMB 3BQIA 1OXZA 3BQLA 3OYXA 1HG2A 3CVRA 2Y6XA 5LGNB 1MMNA 4IIJE 3FBZA 3KV4A 3Q5XA 2DWKA 2DLRA 3D0TA 3I9YA 5F8PA 4TN7B 3SOLA 1MMAA 3I9WA 4X1YE 4IHJE 4DMVA 4CI2B 3LJCA 4XBFB 2X67A 4XAXB 3O1IA 1BR2A 2DNXA 3MJXA 3SRZA 4L0RA 5FMNA 2L8KA 3ZYLA 4UF0A 4L9IA 2PBIA 2NTXA 4AQGA 4E7ZA 2BDEA 5FXZA 5C8YE 2K24A 4HEAA 2W63A 3IBPA 4PFOA 4UELA 5JDFA 2HPLA 5LNKA 2X0LB 5ETWA 3L09A 1D0XA 3HKEE 4EXTA 3Q5WA 2VB6A 3FB2A 2OA5A 4OHFA 3ZMTB 4BJMA 3EDUA 3UUXB 4OK0A 2IC6A 4O4HE 3PURA 4EAHA 5LA6E 4ONRA 1YKEB 5H6RB 2H7OA 1YW0A 2EHOB 4UVBB 5HXRA 2JMHA 3AVSA 5TAOA 1LRZA 1YD8G 5LP6E 1HS7A 4ZI3C 2WWUA 3O1JA 2X9HA 3WAJA 2X66A 3LFMA 4QXHB 2Q9QC 2LSYA 2W62A 1D1CA 2MBGA 4ZI2D 2PJQA 3V5SA 2YU1A 3CQXC 2YK0A 5LBMA 2ODVA 4L5GA 3T8OA 4AKLA 1AJ3A 4J2CA 4KP3C 2EHOD 5FP3A 5IHYA 3HR0A 4UF0B 3J7Yq 2LSGA 2CWOA 5LHHB 4AXPA 1CUNA 3N9LA 2XHEB 3KVAA 2LJLA 4O2AE 4O8SA 1E1HB 4QXCB 4TV9E 4TV8E 1WYCA 2X9WA 4YJ2E 2LOPA 4AKRB 1KNZA 3N2GE 4GYRA 3AA1B 1BR4A 2C5KT 3NRXA 4H9PC 3R6NA 1IJ6A 4AI6A 3ZJ1A 3PU3A 3RYHE 3HI2A 4ZS3A 2CLYC 2DWGA 2LEHA 2E9XD 2CXFA 4DMWA 4PK6A 1G73A 3EDVA 3BQKA 3GWHA 4WBNE 2G0UA 4ISTA 3ZYKA 2C5IT 5KDMC 2A72A 4CI3B 2V7IA 2VK9A 4A56A 3CKDA 4H9RC 3CX7B 4QKNA 2IC9A 1IZNB 5CA0E 3VKHA 3OYZA 1LVKA 5LG4A 4PJJA 3QUJA 1ZKEA 4WW0A 1UCUA 2JQQA 2KLQA 4GK5E 4Z8XA 4EIWA 5L3DB 4CI1B 3K3OA 3GN5A 2C5JA 2MTQA 4O4IE 4EB6E 3PHF1 5F3JA 5FNVE 3AAEB 4DVDA 4JEHB 2M67A 3ZCIA 3Q2MA 5CB4E 3KV5A 2QGSA 3ZCJA 3O1HA 2PG8A 3U3IA 5JR9A 4UVAB 2ZM2A 5JDNA 2XAGB 3LG7A 4MHCA 2C0SA 2LHRA 1QSDA 4TX5A 3C4XA 4QHOA 5HXSA 3HKBE 3QC9A 2CCQA 3UUMA 4EOZB 4IE4A 3ANWB 1VOMA 3N2KE 4YJ3E 3ZMZB 3O9XA 1MIYA 5LJNA 3N2OA 5HWXA 4GYSA 4N78D 3MKDA 3KFWX 3PUSA 1WLXA 4TUYE 3RC3A 2HPJA 3UT5E 4DNDA 5JH7E 3KV6A 2YINA 2NP9A 2DI4A 2LHNA 3FBLA 3MA9A 4CXYA 4ZI2C 4PFPA 3KDSE 4P0BA 4AQFC 2NOXA 1HTJF 4QWNB 2EHOC 2VKDA 1O3XA 3AAAB 5KX5E 4ZI7E 4PK5A 3F2EA 2N1GA 3E22E 1ZEEA 5JQGE 3ETVA 4X1KE 4H63V 2VKJA 4PJMA 4OFZA 4KMCA 5JR9B 4AKHA 2ACXA 3N9NA 4ECGA 2D2SA 1NAFA 5T1DA 1LKXA 1SA0E 4MFRA 3LK2B 3K3NA 2H3RA 2WMOA 3KBTA 4B6XA 2XAQB 2LT3A 4MBQA 3FHNA 2YEVC 3JC6D 4O2BE 5LGUB 2JRKA 3DTOA 3VHLA 2BZBA 2Q9QA 3ZN0B 3CPZA 2E9XC 2V7JA 3N9PA 5EK2A 1FMVA 3CWZB 1VRBA 4ZS2A 3RPUA 3F57A 4PK4A 2NWBA 1Y64B 2CWYA 3M65A 4CZZB 3AA7B 4F6RC 1HF8A 2VL8A 2X9XA 4AKGA 5HXEA 5DJQC 1UX5A 5JRCA 3EVYA 2Y48B 3CX6B 3C98B 4H9OC 4CQIA 4C90A 2LSJA 3C51A 2X68A 3V5UA 4UXNB 2DHRA 2W61A 2V1DB 4GK0E 5LBQB 3MACA 2ODUA 2J1DG 2V7MA 5CA1E 3H37A 3P7IA 2JJ9A 4H63H 4JLEA 3J9X1 1KK7A 1X79A 3IEEA 4YLHA 4MALA 2ZM0A 4X20E 3ZPOA 1US7B 4H9NC 2LSIA 2ZM8A 2LM9A 1BR1A 1MNDA 2CM0A 2XAFB 3P8CD 4PNIA 4ADZA 3OBVE 5J1GA 2N9DA 2KWHA 3E0ZA 3I0QA 3NBXX 5JDQA 3OKQA 4NUVA 2MOZA 4IE5A 2VKOA 3WURA 4IE0A 3LK42 4U72A 2N2NA 5LJMA 5BMVE 3WI3A 2IAKA 1QUUA 5LGTB 2KXPB 3UTKA 3UUNA 3N9MA 3M1CA 3DJBA 3UFEA 5LYJE 2KWIB 4YFSA 5FY7A 1S35A 3NZPA 5JRCB 3RX6A 2W0GA 4HE8A 3DP7A 2XAJB 3C4ZA 1MMGA 2H7VC 4ASKA 4X1IE 3HKCE 4WBOA 3CQGB 5JDHA 3AA0B 4CXWA 1FIOA 2BVLA 4P09A 4QXBB 3TKLB 4CXXA 4IE6A 3I1AA 4BAYB 5LHGB 2A2FX 2WAUA 4OYKA 3AT7A 2KT9A 1B7TA 3N9QA 3HL6A 5L3FB 3RKOA 2GK9A 5HYAA 3B13A 3H3AA 4G63A 3AB3B 4E7SA 3KVBA 4IDZA 5GONE 2JMKA 4PJNA 3NRYA 3GMIA 3QK6A 2ES0A 1WRDA 3PF0A 2L9QA 2PFVA 3HKDE 3GA8A 4EYUA 4TZ4C 2A3DA 2ZMAA 4JUYA 2LSKA 2X51A 4ILUA 2SPCA 2LE8A 5IYZE 3VU7H 3ZYMA 5J2TE 2P9BA 2CMRA 1OWAA 3JC6C 1HFAA 3MZKB 3PTRB 2XUEA 1D1AA 2V7LA 2UXXB 2KZ7B 4BJNA 5E0OA 4GOUA 4PAGA 2E8IA 3E08A 4BA9A 2NW7A 5L3EB 5JREA 2K48A 5DABA 5EZYE 1HX8A 1SHZC 3PE0A 4O4LE 5L3GB 4FI5A 2XAHB 4AQFA 2HH7A 3C64A 4IGUA 3KINB 1V9DA 3GN5B 3HA4A 2EHOA 3C4WA 3RRCA 5JDLA 2NW8A 5HWYA 3L3PA 5JDMA 3W15B 1Z0PA 5KMGP 1D1BA 5AFUL 2CA5A 2QA7A 1FMWA 1D0YA 2CXDA 4QX8B 5ADXL 3RC8A 1WYBA 1HCIA 2VASA 5FYMA 2CXLA 1S94A 2WSSV 3N5LA 2D0TA 5JVDE 5H6QB 3CQCB 4BGOA 3CMLA 4DO0A 3ZMSB 4HFVA 3EUHA 2XASB 5HAXA 2IW5B 1U4QA 2E9XA 2UXNB 3ETUA 2LOSA 3I0OA 4U74A 3UULA 4DBQA 4EYYR 4P0AA 2V26A 5LHIB 4PJLA 1D0ZA 3PDYA 3KBUA 2ZLYA 3MXZA 4O4JE 3IHRA 3Q9DA 5L3BB 1LVFA 3NZQA 2XQYA 2WBLA 4V1Av 2WM9A 4GIWA 3WAKA 5HXHA 3N9OA 3LK3B 1MIVA 3IF8B 5LOVE 3RYFE 1T98A 2D0UA 5FXXA 2VWAA 5JDGA 3RH3A 2NTYA 3FXDB 4ISSA 2I59A 2NW9A 2KINB 4IE7A 4I43B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWY A;  5HWX A;  5JDG A;  5JDM A;  5HXH A;  5HXC A;  5HXE A;  5JDH A;  3V5U A;  5JDF A;  5HXS A;  5JDN A;  5HXR A;  5HYA A;  5JDQ A;  3V5S A;  5JDL A; 
#chains in the Genus database with same CATH topology
 2LKH A;  4ERR A;  3EHZ A;  3SS1 A;  1GQE A;  3A5X A;  3DYJ A;  3AE3 A;  4ANJ A;  2LRK A;  4JEU B;  2JPF A;  3ZN1 B;  1OED A;  5FXV A;  3ZC0 A;  4I0U A;  3PUG A;  3KV9 A;  2RP4 A;  2WCA A;  4ZI3 D;  4PW8 A;  4U33 A;  2BVM A;  1UUR A;  2Q9Q D;  2XM2 A;  1XMQ T;  2UUA T;  4UIG A;  3RIA A;  2IIU A;  4KBM B;  3EI0 A;  1E7P A;  2D5U A;  3R84 B;  3AEB A;  5AQS B;  3PU8 A;  5FY0 A;  1HR0 T;  1NWM X;  3SFD A;  4UV8 B;  2V5C A;  3MK7 C;  2XY8 B;  1R8I A;  3H3M A;  2KMF A;  3K8P C;  3QOF A;  5FXW A;  3JAF A;  4MLK A;  3RQW A;  1I94 T;  2LM2 A;  3BQI A;  2UUC T;  4IIJ E;  3FBZ A;  3KV4 A;  3D0T A;  3I9Y A;  4GKJ T;  2V6X A;  4TN7 B;  3SOL A;  3I9W A;  4CI2 B;  1KNP A;  2X67 A;  2AE9 A;  4XAX B;  3O1I A;  1BR2 A;  5BR8 T;  5FMN A;  2L8K A;  3ZYL A;  2XJ7 A;  4L9I A;  4UF0 A;  2WU2 A;  2CPT A;  1JNR A;  4YTM A;  5JDF A;  2HPL A;  4LF7 T;  2OLT A;  2KSR A;  3L09 A;  2L7N A;  2H89 A;  4OHF A;  2OA5 A;  1UGO A;  1XWM A;  2XQ8 A;  4U3C A;  4EAH A;  4ONR A;  2EHO B;  5HXR A;  1ZP0 A;  1YD8 G;  1HS7 A;  2XQ4 A;  3O1J A;  4JI6 T;  1D1C A;  3V5S A;  4U7I A;  4F7G B;  2ODV A;  4L5G A;  4UF0 B;  3J7Y q;  1N34 T;  5LHH B;  3UU3 A;  1XZY A;  5L47 A;  2X9W A;  4HWI B;  3N2G E;  4IL9 A;  3AA1 B;  2C5K T;  3G06 A;  3R6N A;  1IJ6 A;  3ZJ1 A;  5FKY A;  3ZT7 A;  2DWG A;  4F8H A;  2LEH A;  5KDM C;  2A72 A;  2L10 A;  4A56 A;  2VK9 A;  3CKD A;  3P50 A;  4Z8X A;  4EIW A;  4CI1 B;  3K3O A;  3GN5 A;  4DR2 T;  3RKG A;  2FJA A;  2BS3 A;  1T8B A;  2I0M A;  2WZH A;  2RPA A;  4TX5 A;  1XNR T;  3QC9 A;  5L4H A;  4IE4 A;  4LF4 T;  2AXD S;  1UUS A;  2BS4 A;  3PUZ F;  3RC3 A;  4JI0 T;  5AQJ B;  3KV6 A;  5LMU T;  3MA9 A;  4ZI2 C;  4PFP A;  2E5L T;  5KX5 E;  4PK5 A;  3F2E A;  3E22 E;  5JQG E;  4PJM A;  4KMC A;  1LKX A;  5C2T A;  5AQH B;  2WMO A;  2WS3 A;  4DID B;  3CIR A;  4JI8 T;  2YDS A;  2BZB A;  2Q9Q A;  2V7J A;  4B3T T;  2E2A A;  3RPU A;  4DV0 T;  4CZZ B;  3AA7 B;  4F6R C;  1HF8 A;  2JQ9 A;  2X9X A;  4AKG A;  5DJQ C;  1UX5 A;  3EVY A;  5JTG A;  5KXJ A;  1J1J A;  3C98 B;  4C90 A;  3V5U A;  1XNQ T;  2X0H A;  2V1D B;  3MAC A;  2V7M A;  3P7I A;  1KK7 A;  4MAL A;  1IBL T;  3ZPO A;  2K3W A;  1MND A;  2CM0 A;  3OPC A;  3T1H T;  2CBJ A;  3OBV E;  5J1G A;  2KWH A;  3OVU A;  1SJ7 A;  5HEO A;  4NUV A;  2VKO A;  2J4G A;  3WUR A;  3LK4 2;  4CN6 A;  3UTK A;  3N9M A;  3M1C A;  4YFS A;  2FUP A;  2JQH A;  5C3J A;  4HE8 A;  4CXW A;  4Z90 A;  4CXX A;  4BAY B;  2BG9 A;  2A2F X;  3HL6 A;  5LMN T;  3H3A A;  3AB3 B;  3LDQ B;  3PF0 A;  1XDP A;  2PFV A;  2FJD A;  4TZ4 C;  2X51 A;  2LE8 A;  4A98 A;  2CMR A;  1OWA A;  1D1A A;  2V7L A;  4BJN A;  4EV6 A;  4PAG A;  2E8I A;  3E08 A;  5AQQ B;  2NW7 A;  5JRE A;  2K48 A;  5DAB A;  4DR7 T;  2CHO A;  1SE7 A;  4O4L E;  2UXC T;  2HH7 A;  3C64 A;  3KIN B;  4IDN A;  4ZZB A;  3HA4 A;  2IUB A;  1FMW A;  2BG9 B;  4WZX A;  5ADX L;  3RC8 A;  2DL1 A;  2VAS A;  4ZEY A;  5FYM A;  1KEY A;  2CXL A;  3FZM B;  1S94 A;  2WSS V;  3PJA J;  2J47 A;  3AE6 A;  4BGO A;  2XQ6 A;  3ZMS B;  4IDP A;  4HFV A;  2XAS B;  1U4Q A;  3ETU A;  4P0A A;  4KX6 A;  3PDY A;  5ABE A;  4CN4 A;  2WBL A;  2W4X A;  3WAK A;  3PUV F;  1T98 A;  2D0U A;  4LMK A;  2MPK A;  5FXX A;  5JDG A;  2XM1 A;  1T72 A;  3AEE A;  2KND A;  4HGA A;  4UEM A;  3K3Q C;  2YKS A;  1XMO T;  1WCR A;  1UX4 A;  1J5E T;  4HN9 A;  2YU2 A;  3ZC1 A;  5HXC A;  4HTE A;  3AAI A;  2L3L A;  3U78 A;  4M1P A;  4QH1 A;  2MYS A;  3ZJ2 A;  3O4X E;  4HKA A;  4ZOL E;  4ZHQ E;  4QX7 B;  2A9U A;  2LQU A;  3M3Z B;  4ILC A;  4QH4 A;  3FZF B;  2IML A;  1VCS A;  4NUU A;  5DQV A;  1MIW A;  1W0A A;  2V7K A;  4AQY T;  3VKG A;  2W2U A;  1G8X A;  2YN6 A;  2WDV A;  3ZMV B;  2DCF A;  1FEW A;  5HCJ A;  2RA1 A;  1DU2 A;  2VKH A;  2WDR A;  2Y8D A;  3BK9 A;  4UV9 B;  5L3C B;  3UU5 A;  4KUM B;  3BQL A;  3VR8 A;  4HFI A;  1MMN A;  2DLR A;  4YTN A;  5F8P A;  1MMA A;  4QH5 A;  4DMV A;  4HWH A;  4HFH A;  4XBF B;  2FBW A;  3EAM A;  4B3R T;  2DNX A;  4HFD A;  2XQ5 A;  2PBI A;  2H88 A;  4YSX A;  2NTX A;  2BDE A;  4HEA A;  2VVN A;  5LNK A;  2X0L B;  5ETW A;  4EXT A;  4YTP A;  3EDU A;  3RHW A;  5LA6 E;  5H6R B;  4CN1 A;  2UUB T;  4UVB B;  1YQ3 A;  2JMH A;  5LP6 E;  4ZI3 C;  2X9H A;  3WAJ A;  2X66 A;  4LF6 T;  2Q9Q C;  3ZKR A;  2LSY A;  2XQA A;  2W62 A;  2YU1 A;  4AIS A;  5LBM A;  4LFC T;  3ZT6 A;  4KP3 C;  5FP3 A;  1CUN A;  2XHE B;  4O2A E;  4O8S A;  1E1H B;  3ONL C;  3UQ7 A;  4KI0 F;  5AQK B;  2BS2 A;  4H9P C;  4AI6 A;  2CLY C;  5CFB A;  4WYV A;  4PK6 A;  3EDV A;  2G0U A;  4IST A;  3ZYK A;  5FVL A;  2V7I A;  1XDO A;  4QKN A;  1IZN B;  1LVK A;  4PJJ A;  1M62 A;  1UCU A;  2JQQ A;  1FJG T;  5AQO B;  4NPP A;  4EB6 E;  5LB7 B;  2NR4 A;  2VQF T;  3Q2M A;  3O1H A;  2PG8 A;  3U3I A;  3AEC A;  1OED B;  5JR9 A;  4UVA B;  3CK6 A;  2BG9 C;  2XAG B;  4MHC A;  1QSD A;  4IRE A;  2IDO B;  5HXS A;  3FYQ A;  3UUM A;  4HFB A;  1VOM A;  3N2K E;  3T1Y T;  2BBH A;  4N78 D;  3UT5 E;  2NP9 A;  3KDS E;  4P0B A;  1HTJ F;  3VR9 A;  4Q25 A;  3AAA B;  3EAB A;  5JR9 B;  5J0Z A;  4ECG A;  4TNW A;  2D2S A;  2WP9 A;  3UQ4 A;  5FZT A;  2H3R A;  3KBT A;  4B6X A;  2BKP A;  2YEV C;  3JC6 D;  3ZN0 B;  3N9P A;  4IDO A;  1Z8U A;  2CWY A;  2XPK A;  4JI7 T;  3AE7 A;  5HXE A;  5JRC A;  2QYW A;  3B5M A;  4H9O C;  3C51 A;  1HNZ T;  4YXD A;  2DHR A;  1HNW T;  5LBQ B;  4GKK T;  3H37 A;  2JJ9 A;  1YXR A;  3IEE A;  4YLH A;  2LSI A;  2I6H A;  3QB5 K;  2HHH T;  2N9D A;  3E0Z A;  3I0Q A;  5JDQ A;  5FVK A;  2MOZ A;  4HFC A;  4IE5 A;  5BMV E;  3JCF A;  4DV1 T;  2LRL A;  1E2A A;  2KWI B;  1S35 A;  5JRC B;  3DP7 A;  4X1I E;  2HN2 A;  4B3M T;  3AA0 B;  1KNR A;  5LHG B;  3AT7 A;  5HYA A;  3RIU A;  4E7S A;  5GON E;  2JMK A;  4PJN A;  3QK6 A;  2ES0 A;  1SJ8 A;  3HKD E;  3GA8 A;  4EYU A;  3AE8 A;  2A3D A;  4IL4 A;  4JUY A;  5IYZ E;  3MZK B;  2UXX B;  4BA9 A;  3NKZ A;  4AQF A;  1V9D A;  3GN5 B;  2J62 A;  2XSB A;  2CRB A;  4LF9 T;  5JDL A;  4ZZC A;  5HWY A;  1D1B A;  5AFU L;  2CA5 A;  5F5W A;  2QRX A;  2CXD A;  4QX8 B;  1WYB A;  1J5W A;  5IWA T;  2VVS A;  4AIU A;  2IHR 1;  5JVD E;  2KBB A;  2IW5 B;  3JAD A;  4COF A;  2LOS A;  3UUL A;  4DBQ A;  5LHI B;  4PJL A;  3IHR A;  2QVA A;  3NZQ A;  4GIW A;  4JBW F;  3RYF E;  4DR4 T;  2VWA A;  3FXD B;  4ISS A;  2NW9 A;  4IE7 A;  3AE9 A;  5A1L A;  4B3S T;  3AEF A;  1MNE A;  5LXT E;  3PUQ A;  3FXE B;  4G2A A;  2Q9Q B;  2Z6E A;  3P4W A;  3ESL A;  5HEG A;  1OED C;  4H9Q C;  3FZK B;  3FZL B;  3ANW A;  3VJZ A;  1L0V A;  1N32 T;  1W0B A;  3QB5 A;  3C50 A;  3SWH A;  2B1E A;  1YKH B;  3A7M A;  2CLY B;  3AVR A;  1U5P A;  2BBJ A;  2WMN A;  2MTC A;  5L2L A;  4FJO A;  3Q5E A;  2WU5 A;  4DR5 T;  4WNK A;  1NEN A;  5JR9 C;  2CE7 A;  3ZMU B;  4OYJ A;  3PV0 F;  2W00 A;  1CHU A;  1OXZ A;  3OYX A;  1HG2 A;  5LGN B;  2Y6X A;  2DWK A;  4DV2 T;  4DV3 T;  4IHJ E;  3LJC A;  3VRB A;  3AE4 A;  4L0R A;  4AQG A;  4E7Z A;  5C8Y E;  2K24 A;  2W63 A;  3IBP A;  4UEL A;  2UXD T;  1D0X A;  2WZI A;  3HKE E;  2CBI A;  2VB6 A;  3FB2 A;  3ZMT B;  4BJM A;  2WQY A;  4OK0 A;  2IC6 A;  3PUR A;  3L8R A;  3AVS A;  5TAO A;  1IBK T;  4YSY A;  2JQK A;  3LFM A;  2LKG A;  2WY2 A;  1WFD A;  3CQX C;  1JNZ A;  2EHO D;  4TWD A;  4X62 T;  3OTO T;  3HR0 A;  2CWO A;  3AEA A;  3N9L A;  3KVA A;  2LJL A;  3AEG A;  1KFY A;  4QXC B;  4TV9 E;  5HEH A;  4TV8 E;  2LOP A;  4AKR B;  1KNZ A;  1BR4 A;  3NRX A;  4TWF A;  2V5D A;  2E9X D;  3RLF F;  1G73 A;  3BQK A;  4WBN E;  5CGM A;  4CI3 B;  3CX7 B;  4TNV A;  5HEU A;  3OYZ A;  5LG4 A;  3AED A;  3QUJ A;  4WW0 A;  5AQL B;  3PHF 1;  3ZT5 A;  3AAE B;  4NIQ A;  3JAE A;  3ZCI A;  1KF6 A;  5CB4 E;  3KV5 A;  2QGS A;  3X1D A;  5AQT B;  2ZM2 A;  3LG7 A;  3L39 A;  2C0S A;  3RIU C;  5LG3 A;  4QHO A;  4U31 A;  4YJ3 E;  3ZMZ B;  4YSZ A;  1MIY A;  5LJN A;  5HWX A;  5AQN B;  3MKD A;  3KFW X;  5ABF A;  4TUY E;  2M6I A;  2HPJ A;  4DND A;  2DI4 A;  2LHN A;  4CXY A;  2WB5 A;  4AQF C;  4QWN B;  1O3X A;  5AQU B;  1ZEE A;  3ETV A;  2VKJ A;  4OFZ A;  4AKH A;  5T1D A;  3TLV A;  4MFR A;  1ZOY A;  3LK2 B;  3K3N A;  2XAQ B;  4ZXL A;  2HN1 A;  4O2B E;  5LGU B;  2JRK A;  3DTO A;  3VHL A;  2FJE A;  5AQF B;  5EK2 A;  3CWZ B;  1VRB A;  4ZS2 A;  3F57 A;  4PK4 A;  4YY3 T;  2YDR A;  4Z91 A;  2VL8 A;  2Y48 B;  1WR0 A;  4LFA T;  4U2Z A;  4CQI A;  4K0K T;  4UXN B;  2W61 A;  2J1D G;  1W09 A;  1X79 A;  2BKO A;  2ZM0 A;  4X20 E;  2XSA A;  1US7 B;  4H9N C;  2LM9 A;  2BG9 E;  2XAF B;  3P8C D;  4PNI A;  4ADZ A;  5CJ5 A;  3RI5 A;  4IE0 A;  4U72 A;  5LJM A;  2FJB A;  3WI3 A;  3AE2 A;  1QUU A;  5LGT B;  1N33 T;  3DJB A;  3UFE A;  5FY7 A;  3NZP A;  5HCM A;  1YQ4 A;  1MMG A;  2UXB T;  4ASK A;  3AXJ A;  4DV5 T;  2E5V A;  2BVL A;  4P09 A;  2WAU A;  4OYK A;  2KT9 A;  5FL1 A;  2GK9 A;  3B13 A;  5HEJ A;  2OV9 A;  3KVB A;  4IDZ A;  2L9Q A;  4LMJ A;  2ZMA A;  4ILU A;  3P4P A;  2SPC A;  5J2T E;  2P9B A;  3UU4 A;  3JC6 C;  4HFE A;  3RGL A;  1Y01 A;  5L3G B;  4FI5 A;  4IGU A;  2EHO A;  3C4W A;  3AXJ B;  5JDM A;  2QA7 A;  1HCI A;  1HNX T;  2W67 A;  5ABG A;  5H6Q B;  3CQC B;  3CML A;  2XZE A;  4NXM T;  1W9R A;  4JV5 T;  1NEK A;  3EUH A;  5HAX A;  4JI4 T;  2E9X A;  2UXN B;  1QLB A;  4EYY R;  3I0O A;  2V26 A;  1D0Z A;  3KBU A;  2ZLY A;  3Q9D A;  5L3B B;  1LVF A;  4U2Y A;  3UU8 A;  2XQY A;  2X0Y A;  4V1A v;  2WM9 A;  5HXH A;  5IUX A;  3LK3 B;  1MIV A;  3IF8 B;  2V6Y A;  3AE1 A;  5LOV E;  3RH3 A;  2CHN A;  4OX9 T;  2KIN B;  4I43 B;  2K9A A;  5DQW A;  4EZH A;  3LBX A;  3UU6 A;  5EK3 A;  5LCY A;  3S4U A;  4C91 A;  1ZHC A;  2E9X B;  4DV7 T;  3B57 A;  3ONX A;  2XTL A;  2VL0 A;  4H9S E;  4I55 E;  5FY1 A;  3ZLI A;  4DUZ T;  4LML A;  4YHH T;  4DBR A;  1ZV4 X;  3AE5 A;  4AKI A;  3RYI E;  4EZ4 A;  4K0U A;  2V6Y B;  3PUA A;  2X9Y A;  3WSC A;  4EGW A;  2CEA A;  4DR1 T;  1IJ5 A;  1WR6 A;  3RRW A;  5M4Y A;  3TLS A;  4I4T E;  4EEB A;  4U7Y A;  1BR0 A;  2K5B B;  3F31 A;  1EZ3 A;  3LBX B;  1MMD A;  5J2U E;  2BKN A;  1UK5 A;  3ZEF B;  3RYC E;  2ACZ A;  4XZC A;  4A5X A;  2YOE A;  3K1S A;  4YHJ A;  1IAP A;  2MAW A;  1H7C A;  3OJA A;  1SUM B;  3PUX F;  4LFB T;  4UVC B;  4I50 E;  3AA6 B;  3CX8 B;  5EK4 A;  3QNU A;  3SFE A;  2UU9 T;  4YT0 A;  4LF8 T;  1HG5 A;  3P4R A;  5AQI B;  3CVR A;  3Q5X A;  4JYA T;  3NWI A;  4X1Y E;  1IBM T;  2R6G F;  3MJX A;  3SRZ A;  5FXZ A;  4PFO A;  4HWC A;  4DV6 T;  3Q5W A;  5AQR B;  3VRA A;  2JIW A;  3UUX B;  3LSV A;  4O4H E;  1OED E;  1YKE B;  4X64 T;  2H7O A;  1YW0 A;  4HWD A;  1LRZ A;  2WWU A;  3RIF A;  4QXH B;  2MBG A;  4ZI2 D;  2PJQ A;  2YK0 A;  3T8O A;  4AKL A;  1AJ3 A;  4J2C A;  1T7S A;  5IHY A;  2LSG A;  4AXP A;  4KHZ F;  3UFG A;  1WYC A;  4YJ2 E;  4GYR A;  4NXN T;  2KVP A;  3PU3 A;  3RYH E;  3HI2 A;  3TLW A;  4ZS3 A;  5AQG B;  2PTF A;  2CXF A;  4DMW A;  3GWH A;  4EED A;  2C5I T;  2X0C A;  4H9R C;  4X66 T;  2IC9 A;  5CA0 E;  3VKH A;  4DR6 T;  1ZKE A;  5L3D B;  2KLQ A;  4GK5 E;  4TWH A;  2V8S V;  2C5J A;  2MTQ A;  4O4I E;  4LF5 T;  5F3J A;  5FNV E;  5AQP B;  4DVD A;  3TLU A;  4JEH B;  2M67 A;  3ONJ A;  3RF1 A;  3ZCJ A;  5JDN A;  2LLY A;  4IDQ A;  2LHR A;  3Q5D A;  3C4X A;  3HKB E;  2CCQ A;  4EOZ B;  3ANW B;  3O9X A;  3N2O A;  4ILA A;  4GYS A;  3PUS A;  1WLX A;  3ZST A;  5JH7 E;  1X9B A;  2YIN A;  3FBL A;  5AQV B;  4KHP T;  3UUB A;  2NOX A;  4DV4 T;  2EHO C;  2VKD A;  4A97 A;  4ZI7 E;  3A8Y C;  3P4Q A;  2N1G A;  2B76 A;  4X1K E;  4H63 V;  2ACX A;  3N9N A;  4P1N A;  1NAF A;  1SA0 E;  3ABV A;  4HWF A;  2LT3 A;  4MBQ A;  3FHN A;  3PUW F;  2D9D A;  3AY5 A;  3CPZ A;  2E9X C;  2YDQ A;  1FMV A;  2VQE T;  4DR3 T;  4ILB A;  2NWB A;  1Y64 B;  3M65 A;  2XQ7 A;  3CX6 B;  2LSJ A;  3IA3 A;  2X68 A;  5L4E A;  4GK0 E;  4JI3 T;  2ODU A;  5CA1 E;  4H63 H;  4JLE A;  3J9X 1;  5ABH A;  2XQ3 A;  2ZM8 A;  1BR1 A;  3NBX X;  3OKQ A;  2N2N A;  2IAK A;  1VCT A;  5AQM B;  2KXP B;  3UUN A;  4DUY T;  5LYJ E;  3P4S A;  3RQU A;  3RX6 A;  4X65 T;  2W0G A;  2XAJ B;  3C4Z A;  1M7K A;  2H7V C;  1N36 T;  3HKC E;  3PJA A;  4WBO A;  3CQG B;  3NVO A;  5JDH A;  1FIO A;  2F4V T;  4QXB B;  3TKL B;  4IE6 A;  4JI5 T;  3I1A A;  1B7T A;  3N9Q A;  5L3F B;  3RKO A;  4G63 A;  5FL0 A;  3NRY A;  3GMI A;  1WRD A;  4W8P A;  3ZSS A;  2LSK A;  3VU7 H;  3ZYM A;  4IT4 A;  1HFA A;  3PTR B;  2XUE A;  2KZ7 B;  5E0O A;  4GOU A;  5L3E B;  4JI2 T;  5EZY E;  1HX8 A;  1SHZ C;  3PE0 A;  2XAH B;  3RRC A;  3FZH B;  3PUY F;  2NW8 A;  4UR9 A;  3L3P A;  3W15 B;  1Z0P A;  5KMG P;  4X5T A;  1D0Y A;  2W66 A;  2WWV A;  3N5L A;  2D0T A;  3TLT A;  4DO0 A;  4JI1 T;  2WDQ A;  1I6Z A;  2KGX A;  4U74 A;  5ABF B;  2XQ9 A;  3MXZ A;  4O4J E;  2ZM6 T;  2VUR A;  3N9O A;  2NTY A;  1HX1 B;  2I59 A;  2M6B A; 
#chains in the Genus database with same CATH homology
 5A1L A;  2K9A A;  5DQW A;  2KND A;  4HGA A;  4ERR A;  4UEM A;  3K3Q C;  3SS1 A;  4EZH A;  1MNE A;  1UX4 A;  5LXT E;  3LBX A;  4HN9 A;  5EK3 A;  2YU2 A;  3PUQ A;  5LCY A;  3S4U A;  3ZC1 A;  3A5X A;  4C91 A;  1ZHC A;  2E9X B;  3FXE B;  4HTE A;  5HXC A;  4ANJ A;  3AAI A;  3B57 A;  2L3L A;  3U78 A;  4M1P A;  4G2A A;  2Q9Q B;  2Z6E A;  2MYS A;  4JEU B;  3ZJ2 A;  3O4X E;  2JPF A;  3ZN1 B;  3ONX A;  2XTL A;  4HKA A;  3ESL A;  4ZOL E;  4ZHQ E;  4H9S E;  5FXV A;  3ZC0 A;  4I55 E;  4QX7 B;  5FY1 A;  4H9Q C;  3ZLI A;  2LQU A;  4DBR A;  1ZV4 X;  4AKI A;  3PUG A;  3KV9 A;  2RP4 A;  3RYI E;  4EZ4 A;  3ANW A;  3VJZ A;  4K0U A;  3PUA A;  4ZI3 D;  2X9Y A;  4PW8 A;  3WSC A;  4NUU A;  5DQV A;  2BVM A;  2Q9Q D;  1MIW A;  2CEA A;  4UIG A;  4KBM B;  1IJ5 A;  1WR6 A;  3C50 A;  3RRW A;  2V7K A;  2D5U A;  3R84 B;  5M4Y A;  3VKG A;  4I4T E;  3PU8 A;  5FY0 A;  3SWH A;  2B1E A;  1YKH B;  1G8X A;  1BR0 A;  2K5B B;  1NWM X;  3F31 A;  2CLY B;  3AVR A;  1EZ3 A;  3LBX B;  1U5P A;  1MMD A;  4UV8 B;  5J2U E;  3MK7 C;  2WMN A;  3ZEF B;  3ZMV B;  3RYC E;  2DCF A;  4XZC A;  1FEW A;  2MTC A;  4YHJ A;  2KMF A;  1IAP A;  3K8P C;  5L2L A;  4FJO A;  5FXW A;  4WNK A;  2RA1 A;  1H7C A;  3OJA A;  4MLK A;  5JR9 C;  2CE7 A;  4UVC B;  4I50 E;  3ZMU B;  2VKH A;  3AA6 B;  3CX8 B;  5EK4 A;  4OYJ A;  2Y8D A;  3BK9 A;  2W00 A;  4UV9 B;  5L3C B;  1HG5 A;  4KUM B;  3BQI A;  1OXZ A;  3BQL A;  3OYX A;  1HG2 A;  3CVR A;  2Y6X A;  5LGN B;  1MMN A;  4IIJ E;  3FBZ A;  3KV4 A;  3Q5X A;  2DWK A;  2DLR A;  3D0T A;  3I9Y A;  5F8P A;  4TN7 B;  3SOL A;  1MMA A;  3I9W A;  4X1Y E;  4IHJ E;  4DMV A;  4CI2 B;  3LJC A;  4XBF B;  2X67 A;  4XAX B;  3O1I A;  1BR2 A;  2DNX A;  3MJX A;  3SRZ A;  4L0R A;  5FMN A;  2L8K A;  3ZYL A;  4UF0 A;  4L9I A;  2PBI A;  2NTX A;  4AQG A;  4E7Z A;  2BDE A;  5FXZ A;  5C8Y E;  2K24 A;  4HEA A;  2W63 A;  3IBP A;  4PFO A;  4UEL A;  5JDF A;  2HPL A;  5LNK A;  2X0L B;  5ETW A;  3L09 A;  1D0X A;  3HKE E;  4EXT A;  3Q5W A;  2VB6 A;  3FB2 A;  2OA5 A;  4OHF A;  3ZMT B;  4BJM A;  3EDU A;  3UUX B;  4OK0 A;  2IC6 A;  4O4H E;  3PUR A;  4EAH A;  5LA6 E;  4ONR A;  1YKE B;  5H6R B;  2H7O A;  1YW0 A;  2EHO B;  4UVB B;  5HXR A;  2JMH A;  3AVS A;  5TAO A;  1LRZ A;  1YD8 G;  5LP6 E;  1HS7 A;  4ZI3 C;  2WWU A;  3O1J A;  2X9H A;  3WAJ A;  2X66 A;  3LFM A;  4QXH B;  2Q9Q C;  2LSY A;  2W62 A;  1D1C A;  2MBG A;  4ZI2 D;  2PJQ A;  3V5S A;  2YU1 A;  3CQX C;  2YK0 A;  5LBM A;  2ODV A;  4L5G A;  3T8O A;  4AKL A;  1AJ3 A;  4J2C A;  4KP3 C;  2EHO D;  5FP3 A;  5IHY A;  3HR0 A;  4UF0 B;  3J7Y q;  2LSG A;  2CWO A;  5LHH B;  4AXP A;  1CUN A;  3N9L A;  2XHE B;  3KVA A;  2LJL A;  4O2A E;  4O8S A;  1E1H B;  4QXC B;  4TV9 E;  4TV8 E;  1WYC A;  2X9W A;  4YJ2 E;  2LOP A;  4AKR B;  1KNZ A;  3N2G E;  4GYR A;  3AA1 B;  1BR4 A;  2C5K T;  3NRX A;  4H9P C;  3R6N A;  1IJ6 A;  4AI6 A;  3ZJ1 A;  3PU3 A;  3RYH E;  3HI2 A;  4ZS3 A;  2CLY C;  2DWG A;  2LEH A;  2E9X D;  2CXF A;  4DMW A;  4PK6 A;  1G73 A;  3EDV A;  3BQK A;  3GWH A;  4WBN E;  2G0U A;  4IST A;  3ZYK A;  2C5I T;  5KDM C;  2A72 A;  4CI3 B;  2V7I A;  2VK9 A;  4A56 A;  3CKD A;  4H9R C;  3CX7 B;  4QKN A;  2IC9 A;  1IZN B;  5CA0 E;  3VKH A;  3OYZ A;  1LVK A;  5LG4 A;  4PJJ A;  3QUJ A;  1ZKE A;  4WW0 A;  1UCU A;  2JQQ A;  2KLQ A;  4GK5 E;  4Z8X A;  4EIW A;  5L3D B;  4CI1 B;  3K3O A;  3GN5 A;  2C5J A;  2MTQ A;  4O4I E;  4EB6 E;  3PHF 1;  5F3J A;  5FNV E;  3AAE B;  4DVD A;  4JEH B;  2M67 A;  3ZCI A;  3Q2M A;  5CB4 E;  3KV5 A;  2QGS A;  3ZCJ A;  3O1H A;  2PG8 A;  3U3I A;  5JR9 A;  4UVA B;  2ZM2 A;  5JDN A;  2XAG B;  3LG7 A;  4MHC A;  2C0S A;  2LHR A;  1QSD A;  4TX5 A;  3C4X A;  4QHO A;  5HXS A;  3HKB E;  3QC9 A;  2CCQ A;  3UUM A;  4EOZ B;  4IE4 A;  3ANW B;  1VOM A;  3N2K E;  4YJ3 E;  3ZMZ B;  3O9X A;  1MIY A;  5LJN A;  3N2O A;  5HWX A;  4GYS A;  4N78 D;  3MKD A;  3KFW X;  3PUS A;  1WLX A;  4TUY E;  3RC3 A;  2HPJ A;  3UT5 E;  4DND A;  5JH7 E;  3KV6 A;  2YIN A;  2NP9 A;  2DI4 A;  2LHN A;  3FBL A;  3MA9 A;  4CXY A;  4ZI2 C;  4PFP A;  3KDS E;  4P0B A;  4AQF C;  2NOX A;  1HTJ F;  4QWN B;  2EHO C;  2VKD A;  1O3X A;  3AAA B;  5KX5 E;  4ZI7 E;  4PK5 A;  3F2E A;  2N1G A;  3E22 E;  1ZEE A;  5JQG E;  3ETV A;  4X1K E;  4H63 V;  2VKJ A;  4PJM A;  4OFZ A;  4KMC A;  5JR9 B;  4AKH A;  2ACX A;  3N9N A;  4ECG A;  2D2S A;  1NAF A;  5T1D A;  1LKX A;  1SA0 E;  4MFR A;  3LK2 B;  3K3N A;  2H3R A;  2WMO A;  3KBT A;  4B6X A;  2XAQ B;  2LT3 A;  4MBQ A;  3FHN A;  2YEV C;  3JC6 D;  4O2B E;  5LGU B;  2JRK A;  3DTO A;  3VHL A;  2BZB A;  2Q9Q A;  3ZN0 B;  3CPZ A;  2E9X C;  2V7J A;  3N9P A;  5EK2 A;  1FMV A;  3CWZ B;  1VRB A;  4ZS2 A;  3RPU A;  3F57 A;  4PK4 A;  2NWB A;  1Y64 B;  2CWY A;  3M65 A;  4CZZ B;  3AA7 B;  4F6R C;  1HF8 A;  2VL8 A;  2X9X A;  4AKG A;  5HXE A;  5DJQ C;  1UX5 A;  5JRC A;  3EVY A;  2Y48 B;  3CX6 B;  3C98 B;  4H9O C;  4CQI A;  4C90 A;  2LSJ A;  3C51 A;  2X68 A;  3V5U A;  4UXN B;  2DHR A;  2W61 A;  2V1D B;  4GK0 E;  5LBQ B;  3MAC A;  2ODU A;  2J1D G;  2V7M A;  5CA1 E;  3H37 A;  3P7I A;  2JJ9 A;  4H63 H;  4JLE A;  3J9X 1;  1KK7 A;  1X79 A;  3IEE A;  4YLH A;  4MAL A;  2ZM0 A;  4X20 E;  3ZPO A;  1US7 B;  4H9N C;  2LSI A;  2ZM8 A;  2LM9 A;  1BR1 A;  1MND A;  2CM0 A;  2XAF B;  3P8C D;  4PNI A;  4ADZ A;  3OBV E;  5J1G A;  2N9D A;  2KWH A;  3E0Z A;  3I0Q A;  3NBX X;  5JDQ A;  3OKQ A;  4NUV A;  2MOZ A;  4IE5 A;  2VKO A;  3WUR A;  4IE0 A;  3LK4 2;  4U72 A;  2N2N A;  5LJM A;  5BMV E;  3WI3 A;  2IAK A;  1QUU A;  5LGT B;  2KXP B;  3UTK A;  3UUN A;  3N9M A;  3M1C A;  3DJB A;  3UFE A;  5LYJ E;  2KWI B;  4YFS A;  5FY7 A;  1S35 A;  3NZP A;  5JRC B;  3RX6 A;  2W0G A;  4HE8 A;  3DP7 A;  2XAJ B;  3C4Z A;  1MMG A;  2H7V C;  4ASK A;  4X1I E;  3HKC E;  4WBO A;  3CQG B;  5JDH A;  3AA0 B;  4CXW A;  1FIO A;  2BVL A;  4P09 A;  4QXB B;  3TKL B;  4CXX A;  4IE6 A;  3I1A A;  4BAY B;  5LHG B;  2A2F X;  2WAU A;  4OYK A;  3AT7 A;  2KT9 A;  1B7T A;  3N9Q A;  3HL6 A;  5L3F B;  3RKO A;  2GK9 A;  5HYA A;  3B13 A;  3H3A A;  4G63 A;  3AB3 B;  4E7S A;  3KVB A;  4IDZ A;  5GON E;  2JMK A;  4PJN A;  3NRY A;  3GMI A;  3QK6 A;  2ES0 A;  1WRD A;  3PF0 A;  2L9Q A;  2PFV A;  3HKD E;  3GA8 A;  4EYU A;  4TZ4 C;  2A3D A;  2ZMA A;  4JUY A;  2LSK A;  2X51 A;  4ILU A;  2SPC A;  2LE8 A;  5IYZ E;  3VU7 H;  3ZYM A;  5J2T E;  2P9B A;  2CMR A;  1OWA A;  3JC6 C;  1HFA A;  3MZK B;  3PTR B;  2XUE A;  1D1A A;  2V7L A;  2UXX B;  2KZ7 B;  4BJN A;  5E0O A;  4GOU A;  4PAG A;  2E8I A;  3E08 A;  4BA9 A;  2NW7 A;  5L3E B;  5JRE A;  2K48 A;  5DAB A;  5EZY E;  1HX8 A;  1SHZ C;  3PE0 A;  4O4L E;  5L3G B;  4FI5 A;  2XAH B;  4AQF A;  2HH7 A;  3C64 A;  4IGU A;  3KIN B;  1V9D A;  3GN5 B;  3HA4 A;  2EHO A;  3C4W A;  3RRC A;  5JDL A;  2NW8 A;  5HWY A;  3L3P A;  5JDM A;  3W15 B;  1Z0P A;  5KMG P;  1D1B A;  5AFU L;  2CA5 A;  2QA7 A;  1FMW A;  1D0Y A;  2CXD A;  4QX8 B;  5ADX L;  3RC8 A;  1WYB A;  1HCI A;  2VAS A;  5FYM A;  2CXL A;  1S94 A;  2WSS V;  3N5L A;  2D0T A;  5JVD E;  5H6Q B;  3CQC B;  4BGO A;  3CML A;  4DO0 A;  3ZMS B;  4HFV A;  3EUH A;  2XAS B;  5HAX A;  2IW5 B;  1U4Q A;  2E9X A;  2UXN B;  3ETU A;  2LOS A;  3I0O A;  4U74 A;  3UUL A;  4DBQ A;  4EYY R;  4P0A A;  2V26 A;  5LHI B;  4PJL A;  1D0Z A;  3PDY A;  3KBU A;  2ZLY A;  3MXZ A;  4O4J E;  3IHR A;  3Q9D A;  5L3B B;  1LVF A;  3NZQ A;  2XQY A;  2WBL A;  4V1A v;  2WM9 A;  4GIW A;  3WAK A;  5HXH A;  3N9O A;  3LK3 B;  1MIV A;  3IF8 B;  5LOV E;  3RYF E;  1T98 A;  2D0U A;  5FXX A;  2VWA A;  5JDG A;  3RH3 A;  2NTY A;  3FXD B;  4ISS A;  2I59 A;  2NW9 A;  2KIN B;  4IE7 A;  4I43 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...