5HXEA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 100 mm na+ and zero ca2+
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
304
structure length
297
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRMGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 126
structure length 297
sequence length 304
ec nomenclature
pdb deposition date 2016-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hxeA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hxeA02
5JDFA 5JDNA 3V5SA 5HYAA 5HXCA 3V5UA 5JDMA 5HXHA 5JDGA 5JDHA 5HXSA 5JDLA 5JDQA 5HXRA 5HWXA 5HWYA 5HXEA
chains in the Genus database with same CATH superfamily
4HFDA 2J47A 4YSXA 5EK2A 5FKYA 3RRWA 4EIWA 4ZXLA 2XHEB 3ZMTB 3HR0A 4K0KT 2DHRA 3CMLA 2F4VT 3AAAB 5L3GB 4ZI2D 4DO0A 3LG7A 3OKQA 3MJXA 2E9XD 2ACXA 3UQ7A 3E22E 4L5GA 1IBMT 4U2ZA 5FNVE 3K3OA 1FIOA 1KNPA 5AQMB 1HG5A 2KSRA 3UULA 5ABFA 1HF8A 3B5MA 3MXZA 2XAJB 1H7CA 5LNKA 3AA6B 2YU2A 3BQLA 4H63H 4NPPA 3BK9A 5HYAA 4PK5A 4DR6T 2LKHA 4TNWA 2VB6A 3NKZA 1V9DA 2H89A 4X1KE 2EHOD 2K3WA 5JTGA 3RKGA 3D0TA 2Y8DA 3ZN1B 2VKJA 4DNDA 3DP7A 1BR1A 5KXJA 4PK6A 3ZT5A 2NW8A 3R84B 1CUNA 1KNZA 4MALA 3ZYLA 5FY0A 3RIAA 3MK7C 3VRBA 4U7IA 1YKHB 1HG2A 1XNQT 3PUGA 3PUAA 2IMLA 2VL8A 5LBMA 5HCJA 5E0OA 1N36T 4ADZA 2CXFA 2ODUA 3FBLA 2XQ9A 4I4TE 3T1YT 2JJ9A 4IDOA 5DQVA 4YHJA 1SA0E 3MACA 2BVLA 3VRAA 3KVBA 3KV5A 2JQQA 1NAFA 2W66A 3UTKA 3P50A 2M6BA 4NUUA 2D9DA 4DBRA 2CWYA 1ZOYA 2MTQA 4O4JE 1IBLT 4HN9A 2HN1A 3CK6A 3K3QC 4LFBT 3ZYMA 3FZLB 2QRXA 2HPLA 2XQ8A 5JDNA 5FYMA 4LF6T 2IW5B 4DIDB 1OEDE 4QKNA 2A9UA 3L39A 2XASB 4H9SE 2V1DB 3H37A 3AEBA 2CRBA 3UUXB 2CA5A 1FEWA 4ZZCA 3CIRA 5ABGA 2VWAA 3AA0B 4WBNE 5ABEA 2QA7A 2VQET 4HWCA 3KVAA 4ERRA 2CBJA 5LHHB 2W0GA 3AAEB 3RYCE 1SE7A 3N9PA 1T8BA 1UGOA 1XNRT 5LGUB 1HNXT 2E9XB 5AQHB 5ADXL 2MOZA 5HXRA 2D5UA 5J2TE 3ANWA 5LXTE 4C90A 4A98A 4HFHA 3RX6A 2XQAA 4JEHB 3CVRA 4KBMB 2OA5A 2J4GA 2NR4A 4HFVA 3N9MA 5HXHA 1MIYA 4PK4A 2WB5A 4ILUA 3FYQA 3ZC0A 1T72A 3RH3A 5CA1E 2W63A 2KINB 3NWIA 4CXWA 3RF1A 2XM1A 1JNRA 4AQGA 2UXCT 3OPCA 2V7KA 2SPCA 4YTNA 1SJ8A 2CWOA 2V7LA 4I50E 1MIVA 2FJAA 1NEKA 1OEDB 5AQTB 1Y64B 4IDPA 3O1HA 2EHOB 5JRCA 3LSVA 3F31A 1KEYA 3NRXA 3L09A 5JDHA 4YJ3E 2YEVC 1XMOT 3RKOA 4V1Av 2L3LA 5LCYA 3AEEA 4ISSA 5ETWA 3UUMA 1Z8UA 5TAOA 1XWMA 4J2CA 4P09A 2XAGB 4EOZB 5L3CB 3AEAA 2WMNA 3HL6A 3RC3A 1J1JA 2E5VA 3PUXF 3L3PA 5JDFA 3OYXA 4QH1A 4E7ZA 4HWHA 2KMFA 2MPKA 3OTOT 4M1PA 4JI6T 4LF5T 2DL1A 1J5ET 4IDQA 4U31A 3WSCA 1N34T 4EAHA 2NW9A 2W00A 2VKOA 4L9IA 3HKEE 3MA9A 3CQGB 5BMVE 1MNEA 2V6YA 3N2OA 5DQWA 2A72A 4YSZA 3C4XA 4OYKA 2FJDA 3N2KE 4UXNB 3PUSA 3EAMA 3IEEA 4DR5T 4AIUA 4JI7T 4AQYT 1JNZA 3Q9DA 1W0AA 4EZ4A 4AXPA 4PJJA 3ZSSA 3SS1A 5FXXA 4JI1T 2XPKA 2ZLYA 4ZI3C 3N9OA 5LA6E 3UFGA 3ZMSB 2W4XA 4H9OC 4OFZA 4KMCA 4JBWF 4LF7T 4O8SA 2D0TA 3NZPA 5JR9A 4ZEYA 3ZEFB 3P4SA 2XZEA 2HHHT 2MAWA 2LEHA 3J7Yq 1IJ5A 3EVYA 4NIQA 3V5SA 4EEDA 5HEJA 4ASKA 3C4WA 4MHCA 1VRBA 2N2NA 2J1DG 1SJ7A 3A8YC 2DLRA 3DTOA 4UF0B 2UUCT 3LFMA 4L0RA 3RC8A 4JI0T 2Q9QC 3VJZA 2BS3A 4TN7B 4EZHA 3O9XA 3ABVA 2WDVA 4XAXB 4DV4T 2FUPA 1G8XA 2YDSA 2CCQA 2YDQA 4ANJA 3IBPA 3AE1A 4CI3B 4B3TT 3LDQB 2CXLA 5FXZA 2WCAA 2KBBA 3RYIE 4ZOLE 3ZSTA 4DV6T 3RYFE 4FI5A 5M4YA 4AKRB 4UEMA 4TNVA 4F7GB 2QYWA 3TKLB 3MZKB 1HNWT 2D0UA 4TWFA 4GIWA 2HN2A 2H7OA 2ZM8A 3GN5B 5JQGE 2VVSA 2UUAT 5FP3A 3ZCJA 4X64T 2CMRA 2WBLA 4X65T 2B76A 4A5XA 2CHNA 2X67A 3NBXX 3N5LA 4QXBB 2X68A 4AKIA 1O3XA 5FXVA 4ZZBA 3UQ4A 5H6QB 2CPTA 2CXDA 5JVDE 4CXYA 2V6XA 2ZMAA 5AQVB 3AE2A 2KNDA 2NOXA 1FMVA 3SOLA 3CWZB 4ZI7E 5FL0A 5IUXA 3KDSE 4ISTA 3ZLIA 4NUVA 3X1DA 4GYSA 4O2BE 2YKSA 4PJMA 4EGWA 2CBIA 5JDQA 2JPFA 4BAYB 1KFYA 3RLFF 2GK9A 3IHRA 4BA9A 3BQKA 5FZTA 3C50A 2M67A 1YQ4A 3RIUA 4JI3T 4YY3T 1LRZA 3Q5WA 1UUSA 4OX9T 4U3CA 3O1JA 2J62A 3A5XA 5HEGA 4LMJA 3KV9A 5AQJB 3ESLA 3AXJB 2NP9A 3UFEA 3VKGA 2OV9A 1D1BA 2VURA 3E0ZA 3HKBE 4ECGA 4U33A 3JADA 3UT5E 4UIGA 2LHNA 1NENA 3I0OA 2FJBA 2Q9QB 3ZT7A 3K1SA 2RP4A 4P0AA 5L3FB 3U3IA 4IE4A 4H9RC 2X9HA 2G0UA 1IZNB 2JQ9A 3FZMB 5L3EB 2P9BA 3PV0F 4BJMA 3Q2MA 5LGNB 2VQFT 3I0QA 2LJLA 4YXDA 2ACZA 2LT3A 3M1CA 3I1AA 2IHR1 4H9NC 3CQCB 3E08A 2XQ7A 4OK0A 3L8RA 4O4HE 3ZMVB 4WNKA 4C91A 3S4UA 1HR0T 4ZHQE 2PJQA 2B1EA 2IUBA 3FB2A 4EB6E 2IDOB 2IAKA 5KDMC 4AI6A 2LHRA 3I9YA 3PU8A 3N9QA 4DBQA 3KFWX 3GMIA 3RHWA 3LBXA 3CX8B 4LFCT 3CQXC 4TV8E 2UXNB 4U72A 5AQPB 2IC9A 2I0MA 4A97A 4IL4A 3OVUA 4CXXA 3WAKA 3AAIA 1XMQT 2WSSV 3GA8A 1KNRA 2H3RA 4HWFA 1XDOA 2LSGA 1ZV4X 1IAPA 2V7JA 3ETUA 2YDRA 3B57A 1MMNA 5H6RB 3SRZA 5LYJE 2QGSA 2WWVA 1HNZT 2IIUA 4BGOA 2RPAA 3UU4A 4TZ4C 3V5UA 4AISA 2WDQA 4LMKA 2AE9A 1M62A 4UR9A 2ZM0A 3QNUA 4HWDA 4IE5A 4DV5T 2CLYC 2WZIA 3KBUA 3CKDA 2L10A 5F8PA 4TWHA 4HWIB 3ZJ1A 2BG9A 4IIJE 2ZM2A 2BVMA 3EI0A 4YLHA 3DYJA 3EUHA 5ABFB 5DABA 1VCSA 1HCIA 1WR6A 4Z90A 3TLVA 1KF6A 5L47A 5JDLA 1VOMA 4PAGA 4HKAA 2YK0A 3FZKB 3C98B 4NXNT 3PU3A 5F5WA 2WS3A 1OXZA 4LF4T 4AQFA 3C4ZA 3RQUA 4PNIA 4JLEA 5KX5E 2R6GF 2LSKA 2X9YA 3HKCE 1UX4A 1UX5A 4MBQA 5J1GA 4X1IE 4ZS2A 3F57A 1I94T 3RYHE 2XQ3A 2W61A 4CN6A 3WURA 1MMGA 3HI2A 2C5JA 2LOSA 3SWHA 2DI4A 3ZKRA 4X20E 3OBVE 4HFEA 3KINB 3PE0A 2VKDA 2UXXB 3VHLA 4GKKT 2XTLA 1SHZC 3P4PA 2I59A 3ONJA 5HEUA 4MLKA 2V7MA 2V8SV 1ZEEA 4OYJA 5FY1A 3ZMUB 1HTJF 3T8OA 5LMNT 1YQ3A 4F6RC 4IREA 3VKHA 4B3ST 3NZQA 3C51A 3ONXA 2WMOA 2YU1A 4QWNB 4H63V 1D1AA 2BS2A 3K3NA 3ZJ2A 5J0ZA 4ZI3D 3N2GE 2JQKA 5L3DB 4I0UA 2X0YA 2RA1A 3WI3A 2BZBA 4WYVA 2XQYA 4EYUA 2NTYA 4JYAT 4GK0E 2VVNA 3JAFA 2BKPA 4PJLA 4MFRA 2X0CA 4YJ2E 4CI1B 4DR7T 3KV4A 3PUWF 4QX7B 3H3MA 3G06A 3ETVA 3JC6C 3AE3A 3Q5EA 5HWXA 3RGLA 5JR9C 1MNDA 2MBGA 4O2AE 5FVLA 3DJBA 4F8HA 2Q9QD 1KK7A 5AFUL 2WWUA 2KLQA 5AQNB 2X9XA 5FMNA 3PHF1 4UV9B 2IC6A 2CLYB 2L7NA 4XBFB 5IWAT 3Q5XA 5LBQB 5CFBA 3LK2B 4X66T 2WY2A 1SUMB 4U74A 4QH4A 4QHOA 4LMLA 3ANWB 2X0LB 2KZ7B 2WU2A 4LF9T 4NXMT 2DNXA 4ILBA 2CE7A 4P0BA 3QOFA 4IDZA 1N32T 3ZCIA 1ZP0A 2LSYA 3H3AA 2XY8B 5AQLB 4EEBA 3VU7H 3TLSA 1HFAA 3OJAA 4COFA 2H7VC 3GWHA 4GYRA 2UU9T 3ZN0B 2C5IT 4TX5A 4WW0A 5JRCB 2LOPA 2BBHA 3N9NA 1I6ZA 2DWKA 4KUMB 2V7IA 3FZFB 3F2EA 3P4WA 1IJ6A 4JI2T 3IF8B 4HEAA 3FXEB 2N1GA 3FBZA 4ZS3A 3PUYF 2M6IA 4DUYT 4PW8A 4JV5T 3FXDB 1WYBA 4DR1T 1E2AA 1E7PA 2D2SA 2X51A 3CX7B 3P7IA 2Y48B 5FVKA 2E9XA 2L8KA 2L9QA 4W8PA 1LVKA 2XUEA 4YT0A 3AE9A 2V6YB 2PG8A 4DR3T 1HS7A 4CN1A 4ZI2C 2BDEA 1WR0A 4A56A 4B3RT 2ES0A 3PUZF 5AQQB 5LHGB 3N9LA 2E5LT 4EXTA 2E9XC 3UUBA 3IA3A 4IT4A 3AECA 1FMWA 4U7YA 4QH5A 2CHOA 5J2UE 5AQKB 3K8PC 3PURA 3JCFA 3TLTA 4DV1T 5EK3A 4KI0F 1R8IA 5DJQC 5JR9B 2LKGA 4CN4A 5JH7E 3P4QA 3RIUC 1UURA 2BBJA 2VASA 3C64A 1OEDA 3FZHB 1UCUA 2AXDS 2EHOA 2FBWA 3KV6A 4ILAA 2QVAA 5CA0E 5KMGP 1IBKT 5A1LA 4B3MT 3OYZA 4PFPA 2X0HA 3ZT6A 2W62A 3QC9A 4IDNA 1U5PA 3EDUA 4I43B 2WP9A 1W0BA 2LE8A 5C2TA 2MTCA 1HX1B 3QB5K 1OEDC 3W15B 2KGXA 2K24A 4I55E 4HGAA 2EHOC 1L0VA 2HH7A 4DV0T 2X9WA 3UU3A 3AE7A 2JRKA 5HWYA 1X9BA 2XAHB 3PF0A 4X62T 5HXCA 1YKEB 5FY7A 3EHZA 5EK4A 4HFCA 3PUQA 1Y01A 5CGMA 4O4IE 2A2FX 1EZ3A 4G2AA 1T7SA 2K48A 3SFDA 5JDMA 5HAXA 3QB5A 4P1NA 2XAFB 5IHYA 3ZMZB 1M7KA 2LRLA 5CB4E 2H88A 4JI5T 2XM2A 4YSYA 5AQGB 3VR9A 3CX6B 3LJCA 3AB3B 2BKNA 3RI5A 3LK3B 4DMVA 1T98A 1BR0A 2MYSA 3AEDA 2Z6EA 1D1CA 2WAUA 2XSBA 4K0UA 2NTXA 4YHHT 2VKHA 3PTRB 4HE8A 2NW7A 2YOEA 3UU6A 4DV2T 1YD8G 5HCMA 1US7B 5AQIB 3ZPOA 5EZYE 3HKDE 4N78D 4X1YE 2ZM6T 4AKLA 3WAJA 3NRYA 4CI2B 2JMHA 2X66A 3J9X1 4DMWA 3FHNA 5AQOB 3AVSA 4U2YA 3RRCA 1ZKEA 1S35A 2WQYA 4IHJE 4UF0A 5LOVE 4JI4T 2LLYA 1QLBA 5LG3A 2E2AA 5JDGA 4G63A 3O4XE 2UUBT 3AE6A 3AEFA 3I9WA 4GOUA 3HA4A 4TWDA 2BS4A 3T1HT 5T1DA 4GKJT 3Q5DA 1D0ZA 2LRKA 3U78A 2W2UA 4IGUA 2XQ6A 2UXDT 1MMAA 4YFSA 2BG9C 4BJNA 2JMKA 4HTEA 3LK42 1WRDA 3CPZA 5F3JA 2JIWA 5FXWA 3UUNA 4UVBB 1WCRA 1MMDA 1CHUA 5LMUT 3MKDA 4PJNA 2VK9A 4PFOA 2V26A 3M3ZB 4IE6A 4ILCA 3AE5A 3M65A 1BR2A 3GN5A 5AQUB 2LSIA 4AQFC 3R6NA 3P4RA 4Z91A 5HEHA 2NWBA 5LGTB 2HPJA 2XJ7A 4UVAB 3ZYKA 4Q25A 3TLUA 2K5BB 5AQSB 5BR8T 2OLTA 4JUYA 2V5DA 4CZZB 4DV3T 1VCTA 1QUUA 4O4LE 4UVCB 3AT7A 3O1IA 1XZYA 4DR2T 3EABA 2DWGA 2LM9A 2LQUA 4YTPA 4ONRA 4UV8B 3BQIA 4JI8T 2XQ5A 3TLWA 4QXHB 5IYZE 4IE7A 4HFBA 4WZXA 4YTMA 2ODVA 1S94A 4H9QC 1DU2A 5LB7B 3P8CD 5JREA 5L4HA 4CQIA 2BG9E 3VR8A 4DV7T 1BR4A 2LM2A 2C5KT 1B7TA 4KHPT 1MIWA 1YW0A 2YINA 2XSAA 1Z0PA 1ZHCA 2N9DA 4XZCA 4Z8XA 3JAEA 5L2LA 3ZC1A 2JQHA 4EV6A 3QK6A 3QUJA 3AA7B 3UU8A 3KBTA 1UK5A 3ONLC 2E8IA 1J5WA 4H9PC 3JC6D 3A7MA 5AQFB 2KVPA 3LBXB 3PJAJ 3PJAA 3AY5A 2CM0A 2CEAA 4LF8T 2WU5A 4X5TA 5LJMA 1WYCA 2W67A 3AXJA 4AKGA 3RPUA 3B13A 5AQRB 5LG4A 2UXBT 2KT9A 5LHIB 2Y6XA 1OWAA 4JEUB 3RQWA 4KHZF 3PUVF 2BKOA 2PBIA 5HXSA 2Q9QA 1LKXA 2A3DA 4UELA 2YN6A 5LJNA 5L3BB 2KXPB 2DCFA 5C8YE 3AEGA 5ABHA 1NWMX 1D0YA 1U4QA 1G73A 1E1HB 3RIFA 4TUYE 4DUZT 4LFAT 1FJGT 4TV9E 1GQEA 4KX6A 1W09A 3AVRA 3UU5A 1D0XA 2K9AA 5HEOA 2BG9B 4HFIA 4QXCB 2WZHA 2WDRA 4GK5E 1QSDA 2XAQB 2I6HA 3AE4A 4B6XA 2C0SA 3AE8A 3PDYA 5GONE 3EDVA 4IE0A 1AJ3A 2LSJA 2FJEA 5HXEA 2XQ4A 4AKHA 5C3JA 4DVDA 1LVFA 4OHFA 4DR4T 1XDPA 4EYYR 2V5CA 1HX8A 2PFVA 1X79A 2KWIB 3AA1B 1WLXA 2VL0A 1WFDA 5CJ5A 3NVOA 3SFEA 4WBOA 5LP6E 4FJOA 1W9RA 1N33T 4E7SA 2KWHA 2PTFA 4KP3C 5FL1A 4IL9A 4QX8B 5L4EA 1YXRA 2WM9A
chains in the Genus database with same CATH topology
3PF0A 1WR6A 4O8SA 5HXCA 2D0TA 1YKEB 3NZPA 5FY7A 5EK2A 5EK4A 5JR9A 3RRWA 4EIWA 3PUQA 5JDLA 2XHEB 3ZEFB 3ZMTB 3HR0A 1VOMA 2DHRA 3CMLA 4PAGA 3AAAB 2LEHA 2A2FX 4O4IE 4HKAA 4ZI2D 1EZ3A 2YK0A 5L3GB 4DO0A 4G2AA 3J7Yq 2K48A 1IJ5A 3EVYA 3LG7A 3C98B 3PU3A 5JDMA 5HAXA 1OXZA 3OKQA 3V5SA 4AQFA 3C4ZA 3MJXA 2E9XD 2ACXA 2XAFB 5IHYA 3ZMZB 5CB4E 4PNIA 3E22E 4L5GA 4JLEA 5FNVE 4ASKA 3C4WA 5KX5E 4MHCA 3K3OA 1VRBA 2N2NA 1FIOA 2J1DG 2LSKA 3DTOA 2DLRA 4UF0B 3CX6B 2X9YA 3LFMA 3LJCA 4L0RA 3AB3B 3RC8A 3HKCE 1UX5A 1UX4A 4MBQA 1HG5A 2Q9QC 4X1IE 5J1GA 4ZS2A 3LK3B 3UULA 4DMVA 3VJZA 1T98A 3F57A 4TN7B 1HF8A 1BR0A 4EZHA 3O9XA 3MXZA 2MYSA 1H7CA 2XAJB 5LNKA 3AA6B 4XAXB 3RYHE 2Z6EA 1G8XA 2W61A 2YU2A 2CCQA 1MMGA 3BQLA 3HI2A 4H63H 3WURA 1D1CA 2WAUA 2C5JA 2LOSA 4ANJA 3SWHA 4K0UA 2DI4A 3IBPA 2NTXA 3BK9A 4X20E 3OBVE 2VKHA 3PTRB 3KINB 4HE8A 2NW7A 3PE0A 4CI3B 5HYAA 4PK5A 2CXLA 2VKDA 2UXXB 3VHLA 5FXZA 2VB6A 1YD8G 2XTLA 1SHZC 1US7B 2I59A 3ZPOA 5EZYE 3RYIE 4ZOLE 3HKDE 4N78D 4X1YE 4MLKA 2V7MA 4OYJA 1ZEEA 4AKLA 3WAJA 3RYFE 4FI5A 1V9DA 5FY1A 3ZMUB 3NRYA 5M4YA 4AKRB 4X1KE 1HTJF 3T8OA 4CI2B 2JMHA 2X66A 3J9X1 4F6RC 4DMWA 4UEMA 3FHNA 3VKHA 3NZQA 3AVSA 3C51A 3ONXA 2EHOD 3RRCA 2WMOA 1ZKEA 2YU1A 1S35A 3D0TA 4IHJE 4QWNB 4UF0A 4H63V 5LOVE 1D1AA 3K3NA 2Y8DA 3ZJ2A 5JDGA 3ZN1B 4G63A 3TKLB 4ZI3D 3MZKB 3O4XE 2D0UA 2VKJA 4DNDA 3DP7A 3N2GE 1BR1A 4GIWA 4PK6A 5L3DB 3I9WA 4GOUA 2H7OA 3HA4A 2ZM8A 2RA1A 2NW8A 3R84B 3GN5B 5JQGE 1CUNA 1KNZA 3WI3A 5FP3A 4MALA 3ZYLA 3ZCJA 5FY0A 5T1DA 2CMRA 2BZBA 3MK7C 2XQYA 4EYUA 2WBLA 1YKHB 1D0ZA 1HG2A 2X67A 3NBXX 3U78A 2NTYA 3N5LA 3PUGA 4IGUA 4GK0E 4QXBB 3PUAA 1MMAA 4YFSA 4BJNA 2JMKA 2X68A 4PJLA 4MFRA 4AKIA 4HTEA 1O3XA 3LK42 5FXVA 4YJ2E 4CI1B 2VL8A 1WRDA 3KV4A 5LBMA 4QX7B 5E0OA 3CPZA 5H6QB 5F3JA 2CXDA 3ETVA 3JC6C 2CXFA 4ADZA 5FXWA 2ODUA 3FBLA 4I4TE 4UVBB 3UUNA 2JJ9A 5JVDE 5DQVA 5HWXA 4CXYA 4YHJA 1SA0E 5JR9C 1MMDA 2BVLA 2ZMAA 1MNDA 3MACA 4O2AE 2MBGA 3KVBA 3DJBA 3KV5A 2JQQA 2Q9QD 1KK7A 1NAFA 2KNDA 3MKDA 2NOXA 4PJNA 5AFUL 1FMVA 2VK9A 2WWUA 4PFOA 3UTKA 2KLQA 3SOLA 2V26A 4IE6A 3CWZB 4NUUA 3M65A 4ZI7E 2X9XA 5FMNA 1BR2A 3PHF1 4UV9B 3GN5A 4DBRA 2IC6A 2CWYA 2LSIA 3KDSE 4ISTA 4AQFC 2MTQA 3R6NA 3ZLIA 2CLYB 4O4JE 4HN9A 4XBFB 2NWBA 5LGTB 2HPJA 4NUVA 3K3QC 4UVAB 3ZYMA 3ZYKA 4GYSA 3Q5XA 2K5BB 4O2BE 5LBQB 4JUYA 3LK2B 4CZZB 2HPLA 4PJMA 5JDNA 1QUUA 4U74A 5JDQA 2JPFA 5FYMA 4QHOA 4O4LE 4BAYB 2IW5B 3ANWB 2X0LB 4QKNA 4UVCB 2GK9A 2KZ7B 3IHRA 3AT7A 3O1IA 4BA9A 3BQKA 2XASB 2DWGA 3C50A 2DNXA 2LM9A 2M67A 4H9SE 2V1DB 3H37A 2CE7A 4P0BA 2LQUA 4IDZA 4ONRA 4UV8B 3UUXB 3BQIA 2CA5A 1FEWA 4QXHB 5IYZE 4IE7A 1LRZA 3ZCIA 3Q5WA 2VWAA 3AA0B 3O1JA 4WBNE 3A5XA 2LSYA 3H3AA 2ODVA 1S94A 4H9QC 3KV9A 3VU7H 2QA7A 1HFAA 3P8CD 3ESLA 5JREA 3KVAA 3UFEA 2NP9A 3VKGA 4CQIA 4ERRA 3OJAA 5LHHB 1D1BA 2H7VC 2W0GA 1BR4A 3AAEB 3GWHA 3RYCE 3E0ZA 3HKBE 3N9PA 4ECGA 4GYRA 3UT5E 4UIGA 5LGUB 2C5KT 1B7TA 3ZN0B 2E9XB 2LHNA 3I0OA 5ADXL 2C5IT 2MOZA 5HXRA 1MIWA 1YW0A 2Q9QB 2YINA 4TX5A 4WW0A 1Z0PA 1ZHCA 2N9DA 2D5UA 4XZCA 4Z8XA 5J2TE 5L2LA 2RP4A 3ZC1A 4P0AA 5JRCB 2LOPA 3ANWA 3QK6A 3QUJA 5L3FB 3AA7B 3U3IA 4IE4A 3N9NA 3KBTA 4H9RC 2DWKA 2X9HA 5LXTE 2G0UA 4C90A 2E8IA 4KUMB 1IZNB 4H9PC 3JC6D 3RX6A 2V7IA 4JEHB 3F2EA 3CVRA 4KBMB 1IJ6A 3LBXB 2OA5A 3IF8B 4HEAA 4HFVA 3N9MA 5HXHA 1MIYA 3FXEB 5L3EB 2N1GA 2P9BA 3FBZA 4ZS3A 4PK4A 4BJMA 3Q2MA 4ILUA 3ZC0A 5CA1E 3RH3A 2CM0A 2CEAA 5LGNB 3I0QA 2W63A 2LJLA 2LT3A 2KINB 4PW8A 3M1CA 3I1AA 3FXDB 4H9NC 5LJMA 1WYCA 1WYBA 4CXWA 3CQCB 3RPUA 4AKGA 3E08A 3B13A 4OK0A 5LG4A 4AQGA 4O4HE 2KT9A 3ZMVB 4WNKA 4C91A 2V7KA 2SPCA 2D2SA 5LHIB 2Y6XA 1OWAA 4JEUB 2CWOA 2V7LA 4I50E 3S4UA 2X51A 4ZHQE 3CX7B 3P7IA 2Y48B 2PJQA 2B1EA 2E9XA 2L8KA 2L9QA 3FB2A 2PBIA 5HXSA 1LVKA 1MIVA 2XUEA 2Q9QA 1LKXA 2A3DA 1Y64B 4EB6E 4UELA 2IAKA 3O1HA 2EHOB 2PG8A 5KDMC 5JRCA 5LJNA 1HS7A 4ZI2C 2BDEA 2KXPB 5L3BB 2DCFA 4AI6A 2LHRA 5C8YE 3I9YA 4A56A 3PU8A 3N9QA 4DBQA 2ES0A 1NWMX 3KFWX 1D0YA 3F31A 3GMIA 1U4QA 5LHGB 1G73A 3N9LA 3LBXA 1E1HB 2E9XC 3CX8B 4TUYE 4EXTA 3NRXA 4TV9E 3CQXC 4TV8E 2UXNB 4U72A 3L09A 5JDHA 4YJ3E 2IC9A 2YEVC 3RKOA 4V1Av 2L3LA 4CXXA 5LCYA 3WAKA 4ISSA 1FMWA 3AAIA 3AVRA 5ETWA 3UUMA 2WSSV 3GA8A 5TAOA 1D0XA 2K9AA 2H3RA 4J2CA 4P09A 2XAGB 5J2UE 4EOZB 5L3CB 2LSGA 4QXCB 1ZV4X 4GK5E 1IAPA 1QSDA 2WMNA 2XAQB 3HL6A 3RC3A 2V7JA 3ETUA 3K8PC 3B57A 1MMNA 3PURA 4B6XA 3L3PA 5H6RB 2C0SA 3SRZA 5EK3A 5JDFA 3OYXA 4E7ZA 2KMFA 5LYJE 3PDYA 4M1PA 2QGSA 5GONE 5DJQC 3EDVA 4IE0A 3WSCA 4EAHA 5JR9B 2NW9A 5JH7E 4BGOA 2W00A 1AJ3A 2LSJA 2VKOA 2VASA 3C64A 5HXEA 4L9IA 4TZ4C 3HKEE 3MA9A 3CQGB 1MNEA 1UCUA 3N2OA 5DQWA 3V5UA 2A72A 4DVDA 5BMVE 4AKHA 2EHOA 3KV6A 1LVFA 5CA0E 5KMGP 5A1LA 4OHFA 3OYZA 4PFPA 3C4XA 4EYYR 1HX8A 2PFVA 1X79A 2KWIB 2ZM0A 4OYKA 3N2KE 2W62A 3AA1B 3QC9A 4UXNB 1U5PA 3PUSA 1WLXA 3EDUA 3IEEA 4I43B 2LE8A 4IE5A 3Q9DA 2MTCA 4WBOA 5LP6E 4EZ4A 3W15B 4FJOA 4AXPA 2CLYC 2K24A 4I55E 4HGAA 3KBUA 2EHOC 3CKDA 2HH7A 4PJJA 5F8PA 3SS1A 3ZJ1A 4E7SA 2X9WA 5FXXA 4IIJE 2KWHA 2ZM2A 2BVMA 2JRKA 4KP3C 4YLHA 2ZLYA 4ZI3C 5HWYA 3N9OA 3EUHA 4QX8B 5LA6E 3ZMSB 4H9OC 5DABA 2WM9A 1HCIA 4OFZA 2XAHB 4KMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDF A;  5JDN A;  3V5S A;  5HYA A;  5HXC A;  3V5U A;  5JDM A;  5HXH A;  5JDG A;  5JDH A;  5HXS A;  5JDL A;  5JDQ A;  5HXR A;  5HWX A;  5HWY A;  5HXE A; 
#chains in the Genus database with same CATH topology
 4HFD A;  2J47 A;  4YSX A;  5EK2 A;  5FKY A;  3RRW A;  4EIW A;  4ZXL A;  2XHE B;  3ZMT B;  3HR0 A;  4K0K T;  2DHR A;  3CML A;  2F4V T;  3AAA B;  5L3G B;  4ZI2 D;  4DO0 A;  3LG7 A;  3OKQ A;  3MJX A;  2E9X D;  2ACX A;  3UQ7 A;  3E22 E;  4L5G A;  1IBM T;  4U2Z A;  5FNV E;  3K3O A;  1FIO A;  1KNP A;  5AQM B;  1HG5 A;  2KSR A;  3UUL A;  5ABF A;  1HF8 A;  3B5M A;  3MXZ A;  2XAJ B;  1H7C A;  5LNK A;  3AA6 B;  2YU2 A;  3BQL A;  4H63 H;  4NPP A;  3BK9 A;  5HYA A;  4PK5 A;  4DR6 T;  2LKH A;  4TNW A;  2VB6 A;  3NKZ A;  1V9D A;  2H89 A;  4X1K E;  2EHO D;  2K3W A;  5JTG A;  3RKG A;  3D0T A;  2Y8D A;  3ZN1 B;  2VKJ A;  4DND A;  3DP7 A;  1BR1 A;  5KXJ A;  4PK6 A;  3ZT5 A;  2NW8 A;  3R84 B;  1CUN A;  1KNZ A;  4MAL A;  3ZYL A;  5FY0 A;  3RIA A;  3MK7 C;  3VRB A;  4U7I A;  1YKH B;  1HG2 A;  1XNQ T;  3PUG A;  3PUA A;  2IML A;  2VL8 A;  5LBM A;  5HCJ A;  5E0O A;  1N36 T;  4ADZ A;  2CXF A;  2ODU A;  3FBL A;  2XQ9 A;  4I4T E;  3T1Y T;  2JJ9 A;  4IDO A;  5DQV A;  4YHJ A;  1SA0 E;  3MAC A;  2BVL A;  3VRA A;  3KVB A;  3KV5 A;  2JQQ A;  1NAF A;  2W66 A;  3UTK A;  3P50 A;  2M6B A;  4NUU A;  2D9D A;  4DBR A;  2CWY A;  1ZOY A;  2MTQ A;  4O4J E;  1IBL T;  4HN9 A;  2HN1 A;  3CK6 A;  3K3Q C;  4LFB T;  3ZYM A;  3FZL B;  2QRX A;  2HPL A;  2XQ8 A;  5JDN A;  5FYM A;  4LF6 T;  2IW5 B;  4DID B;  1OED E;  4QKN A;  2A9U A;  3L39 A;  2XAS B;  4H9S E;  2V1D B;  3H37 A;  3AEB A;  2CRB A;  3UUX B;  2CA5 A;  1FEW A;  4ZZC A;  3CIR A;  5ABG A;  2VWA A;  3AA0 B;  4WBN E;  5ABE A;  2QA7 A;  2VQE T;  4HWC A;  3KVA A;  4ERR A;  2CBJ A;  5LHH B;  2W0G A;  3AAE B;  3RYC E;  1SE7 A;  3N9P A;  1T8B A;  1UGO A;  1XNR T;  5LGU B;  1HNX T;  2E9X B;  5AQH B;  5ADX L;  2MOZ A;  5HXR A;  2D5U A;  5J2T E;  3ANW A;  5LXT E;  4C90 A;  4A98 A;  4HFH A;  3RX6 A;  2XQA A;  4JEH B;  3CVR A;  4KBM B;  2OA5 A;  2J4G A;  2NR4 A;  4HFV A;  3N9M A;  5HXH A;  1MIY A;  4PK4 A;  2WB5 A;  4ILU A;  3FYQ A;  3ZC0 A;  1T72 A;  3RH3 A;  5CA1 E;  2W63 A;  2KIN B;  3NWI A;  4CXW A;  3RF1 A;  2XM1 A;  1JNR A;  4AQG A;  2UXC T;  3OPC A;  2V7K A;  2SPC A;  4YTN A;  1SJ8 A;  2CWO A;  2V7L A;  4I50 E;  1MIV A;  2FJA A;  1NEK A;  1OED B;  5AQT B;  1Y64 B;  4IDP A;  3O1H A;  2EHO B;  5JRC A;  3LSV A;  3F31 A;  1KEY A;  3NRX A;  3L09 A;  5JDH A;  4YJ3 E;  2YEV C;  1XMO T;  3RKO A;  4V1A v;  2L3L A;  5LCY A;  3AEE A;  4ISS A;  5ETW A;  3UUM A;  1Z8U A;  5TAO A;  1XWM A;  4J2C A;  4P09 A;  2XAG B;  4EOZ B;  5L3C B;  3AEA A;  2WMN A;  3HL6 A;  3RC3 A;  1J1J A;  2E5V A;  3PUX F;  3L3P A;  5JDF A;  3OYX A;  4QH1 A;  4E7Z A;  4HWH A;  2KMF A;  2MPK A;  3OTO T;  4M1P A;  4JI6 T;  4LF5 T;  2DL1 A;  1J5E T;  4IDQ A;  4U31 A;  3WSC A;  1N34 T;  4EAH A;  2NW9 A;  2W00 A;  2VKO A;  4L9I A;  3HKE E;  3MA9 A;  3CQG B;  5BMV E;  1MNE A;  2V6Y A;  3N2O A;  5DQW A;  2A72 A;  4YSZ A;  3C4X A;  4OYK A;  2FJD A;  3N2K E;  4UXN B;  3PUS A;  3EAM A;  3IEE A;  4DR5 T;  4AIU A;  4JI7 T;  4AQY T;  1JNZ A;  3Q9D A;  1W0A A;  4EZ4 A;  4AXP A;  4PJJ A;  3ZSS A;  3SS1 A;  5FXX A;  4JI1 T;  2XPK A;  2ZLY A;  4ZI3 C;  3N9O A;  5LA6 E;  3UFG A;  3ZMS B;  2W4X A;  4H9O C;  4OFZ A;  4KMC A;  4JBW F;  4LF7 T;  4O8S A;  2D0T A;  3NZP A;  5JR9 A;  4ZEY A;  3ZEF B;  3P4S A;  2XZE A;  2HHH T;  2MAW A;  2LEH A;  3J7Y q;  1IJ5 A;  3EVY A;  4NIQ A;  3V5S A;  4EED A;  5HEJ A;  4ASK A;  3C4W A;  4MHC A;  1VRB A;  2N2N A;  2J1D G;  1SJ7 A;  3A8Y C;  2DLR A;  3DTO A;  4UF0 B;  2UUC T;  3LFM A;  4L0R A;  3RC8 A;  4JI0 T;  2Q9Q C;  3VJZ A;  2BS3 A;  4TN7 B;  4EZH A;  3O9X A;  3ABV A;  2WDV A;  4XAX B;  4DV4 T;  2FUP A;  1G8X A;  2YDS A;  2CCQ A;  2YDQ A;  4ANJ A;  3IBP A;  3AE1 A;  4CI3 B;  4B3T T;  3LDQ B;  2CXL A;  5FXZ A;  2WCA A;  2KBB A;  3RYI E;  4ZOL E;  3ZST A;  4DV6 T;  3RYF E;  4FI5 A;  5M4Y A;  4AKR B;  4UEM A;  4TNV A;  4F7G B;  2QYW A;  3TKL B;  3MZK B;  1HNW T;  2D0U A;  4TWF A;  4GIW A;  2HN2 A;  2H7O A;  2ZM8 A;  3GN5 B;  5JQG E;  2VVS A;  2UUA T;  5FP3 A;  3ZCJ A;  4X64 T;  2CMR A;  2WBL A;  4X65 T;  2B76 A;  4A5X A;  2CHN A;  2X67 A;  3NBX X;  3N5L A;  4QXB B;  2X68 A;  4AKI A;  1O3X A;  5FXV A;  4ZZB A;  3UQ4 A;  5H6Q B;  2CPT A;  2CXD A;  5JVD E;  4CXY A;  2V6X A;  2ZMA A;  5AQV B;  3AE2 A;  2KND A;  2NOX A;  1FMV A;  3SOL A;  3CWZ B;  4ZI7 E;  5FL0 A;  5IUX A;  3KDS E;  4IST A;  3ZLI A;  4NUV A;  3X1D A;  4GYS A;  4O2B E;  2YKS A;  4PJM A;  4EGW A;  2CBI A;  5JDQ A;  2JPF A;  4BAY B;  1KFY A;  3RLF F;  2GK9 A;  3IHR A;  4BA9 A;  3BQK A;  5FZT A;  3C50 A;  2M67 A;  1YQ4 A;  3RIU A;  4JI3 T;  4YY3 T;  1LRZ A;  3Q5W A;  1UUS A;  4OX9 T;  4U3C A;  3O1J A;  2J62 A;  3A5X A;  5HEG A;  4LMJ A;  3KV9 A;  5AQJ B;  3ESL A;  3AXJ B;  2NP9 A;  3UFE A;  3VKG A;  2OV9 A;  1D1B A;  2VUR A;  3E0Z A;  3HKB E;  4ECG A;  4U33 A;  3JAD A;  3UT5 E;  4UIG A;  2LHN A;  1NEN A;  3I0O A;  2FJB A;  2Q9Q B;  3ZT7 A;  3K1S A;  2RP4 A;  4P0A A;  5L3F B;  3U3I A;  4IE4 A;  4H9R C;  2X9H A;  2G0U A;  1IZN B;  2JQ9 A;  3FZM B;  5L3E B;  2P9B A;  3PV0 F;  4BJM A;  3Q2M A;  5LGN B;  2VQF T;  3I0Q A;  2LJL A;  4YXD A;  2ACZ A;  2LT3 A;  3M1C A;  3I1A A;  2IHR 1;  4H9N C;  3CQC B;  3E08 A;  2XQ7 A;  4OK0 A;  3L8R A;  4O4H E;  3ZMV B;  4WNK A;  4C91 A;  3S4U A;  1HR0 T;  4ZHQ E;  2PJQ A;  2B1E A;  2IUB A;  3FB2 A;  4EB6 E;  2IDO B;  2IAK A;  5KDM C;  4AI6 A;  2LHR A;  3I9Y A;  3PU8 A;  3N9Q A;  4DBQ A;  3KFW X;  3GMI A;  3RHW A;  3LBX A;  3CX8 B;  4LFC T;  3CQX C;  4TV8 E;  2UXN B;  4U72 A;  5AQP B;  2IC9 A;  2I0M A;  4A97 A;  4IL4 A;  3OVU A;  4CXX A;  3WAK A;  3AAI A;  1XMQ T;  2WSS V;  3GA8 A;  1KNR A;  2H3R A;  4HWF A;  1XDO A;  2LSG A;  1ZV4 X;  1IAP A;  2V7J A;  3ETU A;  2YDR A;  3B57 A;  1MMN A;  5H6R B;  3SRZ A;  5LYJ E;  2QGS A;  2WWV A;  1HNZ T;  2IIU A;  4BGO A;  2RPA A;  3UU4 A;  4TZ4 C;  3V5U A;  4AIS A;  2WDQ A;  4LMK A;  2AE9 A;  1M62 A;  4UR9 A;  2ZM0 A;  3QNU A;  4HWD A;  4IE5 A;  4DV5 T;  2CLY C;  2WZI A;  3KBU A;  3CKD A;  2L10 A;  5F8P A;  4TWH A;  4HWI B;  3ZJ1 A;  2BG9 A;  4IIJ E;  2ZM2 A;  2BVM A;  3EI0 A;  4YLH A;  3DYJ A;  3EUH A;  5ABF B;  5DAB A;  1VCS A;  1HCI A;  1WR6 A;  4Z90 A;  3TLV A;  1KF6 A;  5L47 A;  5JDL A;  1VOM A;  4PAG A;  4HKA A;  2YK0 A;  3FZK B;  3C98 B;  4NXN T;  3PU3 A;  5F5W A;  2WS3 A;  1OXZ A;  4LF4 T;  4AQF A;  3C4Z A;  3RQU A;  4PNI A;  4JLE A;  5KX5 E;  2R6G F;  2LSK A;  2X9Y A;  3HKC E;  1UX4 A;  1UX5 A;  4MBQ A;  5J1G A;  4X1I E;  4ZS2 A;  3F57 A;  1I94 T;  3RYH E;  2XQ3 A;  2W61 A;  4CN6 A;  3WUR A;  1MMG A;  3HI2 A;  2C5J A;  2LOS A;  3SWH A;  2DI4 A;  3ZKR A;  4X20 E;  3OBV E;  4HFE A;  3KIN B;  3PE0 A;  2VKD A;  2UXX B;  3VHL A;  4GKK T;  2XTL A;  1SHZ C;  3P4P A;  2I59 A;  3ONJ A;  5HEU A;  4MLK A;  2V7M A;  2V8S V;  1ZEE A;  4OYJ A;  5FY1 A;  3ZMU B;  1HTJ F;  3T8O A;  5LMN T;  1YQ3 A;  4F6R C;  4IRE A;  3VKH A;  4B3S T;  3NZQ A;  3C51 A;  3ONX A;  2WMO A;  2YU1 A;  4QWN B;  4H63 V;  1D1A A;  2BS2 A;  3K3N A;  3ZJ2 A;  5J0Z A;  4ZI3 D;  3N2G E;  2JQK A;  5L3D B;  4I0U A;  2X0Y A;  2RA1 A;  3WI3 A;  2BZB A;  4WYV A;  2XQY A;  4EYU A;  2NTY A;  4JYA T;  4GK0 E;  2VVN A;  3JAF A;  2BKP A;  4PJL A;  4MFR A;  2X0C A;  4YJ2 E;  4CI1 B;  4DR7 T;  3KV4 A;  3PUW F;  4QX7 B;  3H3M A;  3G06 A;  3ETV A;  3JC6 C;  3AE3 A;  3Q5E A;  5HWX A;  3RGL A;  5JR9 C;  1MND A;  2MBG A;  4O2A E;  5FVL A;  3DJB A;  4F8H A;  2Q9Q D;  1KK7 A;  5AFU L;  2WWU A;  2KLQ A;  5AQN B;  2X9X A;  5FMN A;  3PHF 1;  4UV9 B;  2IC6 A;  2CLY B;  2L7N A;  4XBF B;  5IWA T;  3Q5X A;  5LBQ B;  5CFB A;  3LK2 B;  4X66 T;  2WY2 A;  1SUM B;  4U74 A;  4QH4 A;  4QHO A;  4LML A;  3ANW B;  2X0L B;  2KZ7 B;  2WU2 A;  4LF9 T;  4NXM T;  2DNX A;  4ILB A;  2CE7 A;  4P0B A;  3QOF A;  4IDZ A;  1N32 T;  3ZCI A;  1ZP0 A;  2LSY A;  3H3A A;  2XY8 B;  5AQL B;  4EEB A;  3VU7 H;  3TLS A;  1HFA A;  3OJA A;  4COF A;  2H7V C;  3GWH A;  4GYR A;  2UU9 T;  3ZN0 B;  2C5I T;  4TX5 A;  4WW0 A;  5JRC B;  2LOP A;  2BBH A;  3N9N A;  1I6Z A;  2DWK A;  4KUM B;  2V7I A;  3FZF B;  3F2E A;  3P4W A;  1IJ6 A;  4JI2 T;  3IF8 B;  4HEA A;  3FXE B;  2N1G A;  3FBZ A;  4ZS3 A;  3PUY F;  2M6I A;  4DUY T;  4PW8 A;  4JV5 T;  3FXD B;  1WYB A;  4DR1 T;  1E2A A;  1E7P A;  2D2S A;  2X51 A;  3CX7 B;  3P7I A;  2Y48 B;  5FVK A;  2E9X A;  2L8K A;  2L9Q A;  4W8P A;  1LVK A;  2XUE A;  4YT0 A;  3AE9 A;  2V6Y B;  2PG8 A;  4DR3 T;  1HS7 A;  4CN1 A;  4ZI2 C;  2BDE A;  1WR0 A;  4A56 A;  4B3R T;  2ES0 A;  3PUZ F;  5AQQ B;  5LHG B;  3N9L A;  2E5L T;  4EXT A;  2E9X C;  3UUB A;  3IA3 A;  4IT4 A;  3AEC A;  1FMW A;  4U7Y A;  4QH5 A;  2CHO A;  5J2U E;  5AQK B;  3K8P C;  3PUR A;  3JCF A;  3TLT A;  4DV1 T;  5EK3 A;  4KI0 F;  1R8I A;  5DJQ C;  5JR9 B;  2LKG A;  4CN4 A;  5JH7 E;  3P4Q A;  3RIU C;  1UUR A;  2BBJ A;  2VAS A;  3C64 A;  1OED A;  3FZH B;  1UCU A;  2AXD S;  2EHO A;  2FBW A;  3KV6 A;  4ILA A;  2QVA A;  5CA0 E;  5KMG P;  1IBK T;  5A1L A;  4B3M T;  3OYZ A;  4PFP A;  2X0H A;  3ZT6 A;  2W62 A;  3QC9 A;  4IDN A;  1U5P A;  3EDU A;  4I43 B;  2WP9 A;  1W0B A;  2LE8 A;  5C2T A;  2MTC A;  1HX1 B;  3QB5 K;  1OED C;  3W15 B;  2KGX A;  2K24 A;  4I55 E;  4HGA A;  2EHO C;  1L0V A;  2HH7 A;  4DV0 T;  2X9W A;  3UU3 A;  3AE7 A;  2JRK A;  5HWY A;  1X9B A;  2XAH B;  3PF0 A;  4X62 T;  5HXC A;  1YKE B;  5FY7 A;  3EHZ A;  5EK4 A;  4HFC A;  3PUQ A;  1Y01 A;  5CGM A;  4O4I E;  2A2F X;  1EZ3 A;  4G2A A;  1T7S A;  2K48 A;  3SFD A;  5JDM A;  5HAX A;  3QB5 A;  4P1N A;  2XAF B;  5IHY A;  3ZMZ B;  1M7K A;  2LRL A;  5CB4 E;  2H88 A;  4JI5 T;  2XM2 A;  4YSY A;  5AQG B;  3VR9 A;  3CX6 B;  3LJC A;  3AB3 B;  2BKN A;  3RI5 A;  3LK3 B;  4DMV A;  1T98 A;  1BR0 A;  2MYS A;  3AED A;  2Z6E A;  1D1C A;  2WAU A;  2XSB A;  4K0U A;  2NTX A;  4YHH T;  2VKH A;  3PTR B;  4HE8 A;  2NW7 A;  2YOE A;  3UU6 A;  4DV2 T;  1YD8 G;  5HCM A;  1US7 B;  5AQI B;  3ZPO A;  5EZY E;  3HKD E;  4N78 D;  4X1Y E;  2ZM6 T;  4AKL A;  3WAJ A;  3NRY A;  4CI2 B;  2JMH A;  2X66 A;  3J9X 1;  4DMW A;  3FHN A;  5AQO B;  3AVS A;  4U2Y A;  3RRC A;  1ZKE A;  1S35 A;  2WQY A;  4IHJ E;  4UF0 A;  5LOV E;  4JI4 T;  2LLY A;  1QLB A;  5LG3 A;  2E2A A;  5JDG A;  4G63 A;  3O4X E;  2UUB T;  3AE6 A;  3AEF A;  3I9W A;  4GOU A;  3HA4 A;  4TWD A;  2BS4 A;  3T1H T;  5T1D A;  4GKJ T;  3Q5D A;  1D0Z A;  2LRK A;  3U78 A;  2W2U A;  4IGU A;  2XQ6 A;  2UXD T;  1MMA A;  4YFS A;  2BG9 C;  4BJN A;  2JMK A;  4HTE A;  3LK4 2;  1WRD A;  3CPZ A;  5F3J A;  2JIW A;  5FXW A;  3UUN A;  4UVB B;  1WCR A;  1MMD A;  1CHU A;  5LMU T;  3MKD A;  4PJN A;  2VK9 A;  4PFO A;  2V26 A;  3M3Z B;  4IE6 A;  4ILC A;  3AE5 A;  3M65 A;  1BR2 A;  3GN5 A;  5AQU B;  2LSI A;  4AQF C;  3R6N A;  3P4R A;  4Z91 A;  5HEH A;  2NWB A;  5LGT B;  2HPJ A;  2XJ7 A;  4UVA B;  3ZYK A;  4Q25 A;  3TLU A;  2K5B B;  5AQS B;  5BR8 T;  2OLT A;  4JUY A;  2V5D A;  4CZZ B;  4DV3 T;  1VCT A;  1QUU A;  4O4L E;  4UVC B;  3AT7 A;  3O1I A;  1XZY A;  4DR2 T;  3EAB A;  2DWG A;  2LM9 A;  2LQU A;  4YTP A;  4ONR A;  4UV8 B;  3BQI A;  4JI8 T;  2XQ5 A;  3TLW A;  4QXH B;  5IYZ E;  4IE7 A;  4HFB A;  4WZX A;  4YTM A;  2ODV A;  1S94 A;  4H9Q C;  1DU2 A;  5LB7 B;  3P8C D;  5JRE A;  5L4H A;  4CQI A;  2BG9 E;  3VR8 A;  4DV7 T;  1BR4 A;  2LM2 A;  2C5K T;  1B7T A;  4KHP T;  1MIW A;  1YW0 A;  2YIN A;  2XSA A;  1Z0P A;  1ZHC A;  2N9D A;  4XZC A;  4Z8X A;  3JAE A;  5L2L A;  3ZC1 A;  2JQH A;  4EV6 A;  3QK6 A;  3QUJ A;  3AA7 B;  3UU8 A;  3KBT A;  1UK5 A;  3ONL C;  2E8I A;  1J5W A;  4H9P C;  3JC6 D;  3A7M A;  5AQF B;  2KVP A;  3LBX B;  3PJA J;  3PJA A;  3AY5 A;  2CM0 A;  2CEA A;  4LF8 T;  2WU5 A;  4X5T A;  5LJM A;  1WYC A;  2W67 A;  3AXJ A;  4AKG A;  3RPU A;  3B13 A;  5AQR B;  5LG4 A;  2UXB T;  2KT9 A;  5LHI B;  2Y6X A;  1OWA A;  4JEU B;  3RQW A;  4KHZ F;  3PUV F;  2BKO A;  2PBI A;  5HXS A;  2Q9Q A;  1LKX A;  2A3D A;  4UEL A;  2YN6 A;  5LJN A;  5L3B B;  2KXP B;  2DCF A;  5C8Y E;  3AEG A;  5ABH A;  1NWM X;  1D0Y A;  1U4Q A;  1G73 A;  1E1H B;  3RIF A;  4TUY E;  4DUZ T;  4LFA T;  1FJG T;  4TV9 E;  1GQE A;  4KX6 A;  1W09 A;  3AVR A;  3UU5 A;  1D0X A;  2K9A A;  5HEO A;  2BG9 B;  4HFI A;  4QXC B;  2WZH A;  2WDR A;  4GK5 E;  1QSD A;  2XAQ B;  2I6H A;  3AE4 A;  4B6X A;  2C0S A;  3AE8 A;  3PDY A;  5GON E;  3EDV A;  4IE0 A;  1AJ3 A;  2LSJ A;  2FJE A;  5HXE A;  2XQ4 A;  4AKH A;  5C3J A;  4DVD A;  1LVF A;  4OHF A;  4DR4 T;  1XDP A;  4EYY R;  2V5C A;  1HX8 A;  2PFV A;  1X79 A;  2KWI B;  3AA1 B;  1WLX A;  2VL0 A;  1WFD A;  5CJ5 A;  3NVO A;  3SFE A;  4WBO A;  5LP6 E;  4FJO A;  1W9R A;  1N33 T;  4E7S A;  2KWH A;  2PTF A;  4KP3 C;  5FL1 A;  4IL9 A;  4QX8 B;  5L4E A;  1YXR A;  2WM9 A; 
#chains in the Genus database with same CATH homology
 3PF0 A;  1WR6 A;  4O8S A;  5HXC A;  2D0T A;  1YKE B;  3NZP A;  5FY7 A;  5EK2 A;  5EK4 A;  5JR9 A;  3RRW A;  4EIW A;  3PUQ A;  5JDL A;  2XHE B;  3ZEF B;  3ZMT B;  3HR0 A;  1VOM A;  2DHR A;  3CML A;  4PAG A;  3AAA B;  2LEH A;  2A2F X;  4O4I E;  4HKA A;  4ZI2 D;  1EZ3 A;  2YK0 A;  5L3G B;  4DO0 A;  4G2A A;  3J7Y q;  2K48 A;  1IJ5 A;  3EVY A;  3LG7 A;  3C98 B;  3PU3 A;  5JDM A;  5HAX A;  1OXZ A;  3OKQ A;  3V5S A;  4AQF A;  3C4Z A;  3MJX A;  2E9X D;  2ACX A;  2XAF B;  5IHY A;  3ZMZ B;  5CB4 E;  4PNI A;  3E22 E;  4L5G A;  4JLE A;  5FNV E;  4ASK A;  3C4W A;  5KX5 E;  4MHC A;  3K3O A;  1VRB A;  2N2N A;  1FIO A;  2J1D G;  2LSK A;  3DTO A;  2DLR A;  4UF0 B;  3CX6 B;  2X9Y A;  3LFM A;  3LJC A;  4L0R A;  3AB3 B;  3RC8 A;  3HKC E;  1UX5 A;  1UX4 A;  4MBQ A;  1HG5 A;  2Q9Q C;  4X1I E;  5J1G A;  4ZS2 A;  3LK3 B;  3UUL A;  4DMV A;  3VJZ A;  1T98 A;  3F57 A;  4TN7 B;  1HF8 A;  1BR0 A;  4EZH A;  3O9X A;  3MXZ A;  2MYS A;  1H7C A;  2XAJ B;  5LNK A;  3AA6 B;  4XAX B;  3RYH E;  2Z6E A;  1G8X A;  2W61 A;  2YU2 A;  2CCQ A;  1MMG A;  3BQL A;  3HI2 A;  4H63 H;  3WUR A;  1D1C A;  2WAU A;  2C5J A;  2LOS A;  4ANJ A;  3SWH A;  4K0U A;  2DI4 A;  3IBP A;  2NTX A;  3BK9 A;  4X20 E;  3OBV E;  2VKH A;  3PTR B;  3KIN B;  4HE8 A;  2NW7 A;  3PE0 A;  4CI3 B;  5HYA A;  4PK5 A;  2CXL A;  2VKD A;  2UXX B;  3VHL A;  5FXZ A;  2VB6 A;  1YD8 G;  2XTL A;  1SHZ C;  1US7 B;  2I59 A;  3ZPO A;  5EZY E;  3RYI E;  4ZOL E;  3HKD E;  4N78 D;  4X1Y E;  4MLK A;  2V7M A;  4OYJ A;  1ZEE A;  4AKL A;  3WAJ A;  3RYF E;  4FI5 A;  1V9D A;  5FY1 A;  3ZMU B;  3NRY A;  5M4Y A;  4AKR B;  4X1K E;  1HTJ F;  3T8O A;  4CI2 B;  2JMH A;  2X66 A;  3J9X 1;  4F6R C;  4DMW A;  4UEM A;  3FHN A;  3VKH A;  3NZQ A;  3AVS A;  3C51 A;  3ONX A;  2EHO D;  3RRC A;  2WMO A;  1ZKE A;  2YU1 A;  1S35 A;  3D0T A;  4IHJ E;  4QWN B;  4UF0 A;  4H63 V;  5LOV E;  1D1A A;  3K3N A;  2Y8D A;  3ZJ2 A;  5JDG A;  3ZN1 B;  4G63 A;  3TKL B;  4ZI3 D;  3MZK B;  3O4X E;  2D0U A;  2VKJ A;  4DND A;  3DP7 A;  3N2G E;  1BR1 A;  4GIW A;  4PK6 A;  5L3D B;  3I9W A;  4GOU A;  2H7O A;  3HA4 A;  2ZM8 A;  2RA1 A;  2NW8 A;  3R84 B;  3GN5 B;  5JQG E;  1CUN A;  1KNZ A;  3WI3 A;  5FP3 A;  4MAL A;  3ZYL A;  3ZCJ A;  5FY0 A;  5T1D A;  2CMR A;  2BZB A;  3MK7 C;  2XQY A;  4EYU A;  2WBL A;  1YKH B;  1D0Z A;  1HG2 A;  2X67 A;  3NBX X;  3U78 A;  2NTY A;  3N5L A;  3PUG A;  4IGU A;  4GK0 E;  4QXB B;  3PUA A;  1MMA A;  4YFS A;  4BJN A;  2JMK A;  2X68 A;  4PJL A;  4MFR A;  4AKI A;  4HTE A;  1O3X A;  3LK4 2;  5FXV A;  4YJ2 E;  4CI1 B;  2VL8 A;  1WRD A;  3KV4 A;  5LBM A;  4QX7 B;  5E0O A;  3CPZ A;  5H6Q B;  5F3J A;  2CXD A;  3ETV A;  3JC6 C;  2CXF A;  4ADZ A;  5FXW A;  2ODU A;  3FBL A;  4I4T E;  4UVB B;  3UUN A;  2JJ9 A;  5JVD E;  5DQV A;  5HWX A;  4CXY A;  4YHJ A;  1SA0 E;  5JR9 C;  1MMD A;  2BVL A;  2ZMA A;  1MND A;  3MAC A;  4O2A E;  2MBG A;  3KVB A;  3DJB A;  3KV5 A;  2JQQ A;  2Q9Q D;  1KK7 A;  1NAF A;  2KND A;  3MKD A;  2NOX A;  4PJN A;  5AFU L;  1FMV A;  2VK9 A;  2WWU A;  4PFO A;  3UTK A;  2KLQ A;  3SOL A;  2V26 A;  4IE6 A;  3CWZ B;  4NUU A;  3M65 A;  4ZI7 E;  2X9X A;  5FMN A;  1BR2 A;  3PHF 1;  4UV9 B;  3GN5 A;  4DBR A;  2IC6 A;  2CWY A;  2LSI A;  3KDS E;  4IST A;  4AQF C;  2MTQ A;  3R6N A;  3ZLI A;  2CLY B;  4O4J E;  4HN9 A;  4XBF B;  2NWB A;  5LGT B;  2HPJ A;  4NUV A;  3K3Q C;  4UVA B;  3ZYM A;  3ZYK A;  4GYS A;  3Q5X A;  2K5B B;  4O2B E;  5LBQ B;  4JUY A;  3LK2 B;  4CZZ B;  2HPL A;  4PJM A;  5JDN A;  1QUU A;  4U74 A;  5JDQ A;  2JPF A;  5FYM A;  4QHO A;  4O4L E;  4BAY B;  2IW5 B;  3ANW B;  2X0L B;  4QKN A;  4UVC B;  2GK9 A;  2KZ7 B;  3IHR A;  3AT7 A;  3O1I A;  4BA9 A;  3BQK A;  2XAS B;  2DWG A;  3C50 A;  2DNX A;  2LM9 A;  2M67 A;  4H9S E;  2V1D B;  3H37 A;  2CE7 A;  4P0B A;  2LQU A;  4IDZ A;  4ONR A;  4UV8 B;  3UUX B;  3BQI A;  2CA5 A;  1FEW A;  4QXH B;  5IYZ E;  4IE7 A;  1LRZ A;  3ZCI A;  3Q5W A;  2VWA A;  3AA0 B;  3O1J A;  4WBN E;  3A5X A;  2LSY A;  3H3A A;  2ODV A;  1S94 A;  4H9Q C;  3KV9 A;  3VU7 H;  2QA7 A;  1HFA A;  3P8C D;  3ESL A;  5JRE A;  3KVA A;  3UFE A;  2NP9 A;  3VKG A;  4CQI A;  4ERR A;  3OJA A;  5LHH B;  1D1B A;  2H7V C;  2W0G A;  1BR4 A;  3AAE B;  3GWH A;  3RYC E;  3E0Z A;  3HKB E;  3N9P A;  4ECG A;  4GYR A;  3UT5 E;  4UIG A;  5LGU B;  2C5K T;  1B7T A;  3ZN0 B;  2E9X B;  2LHN A;  3I0O A;  5ADX L;  2C5I T;  2MOZ A;  5HXR A;  1MIW A;  1YW0 A;  2Q9Q B;  2YIN A;  4TX5 A;  4WW0 A;  1Z0P A;  1ZHC A;  2N9D A;  2D5U A;  4XZC A;  4Z8X A;  5J2T E;  5L2L A;  2RP4 A;  3ZC1 A;  4P0A A;  5JRC B;  2LOP A;  3ANW A;  3QK6 A;  3QUJ A;  5L3F B;  3AA7 B;  3U3I A;  4IE4 A;  3N9N A;  3KBT A;  4H9R C;  2DWK A;  2X9H A;  5LXT E;  2G0U A;  4C90 A;  2E8I A;  4KUM B;  1IZN B;  4H9P C;  3JC6 D;  3RX6 A;  2V7I A;  4JEH B;  3F2E A;  3CVR A;  4KBM B;  1IJ6 A;  3LBX B;  2OA5 A;  3IF8 B;  4HEA A;  4HFV A;  3N9M A;  5HXH A;  1MIY A;  3FXE B;  5L3E B;  2N1G A;  2P9B A;  3FBZ A;  4ZS3 A;  4PK4 A;  4BJM A;  3Q2M A;  4ILU A;  3ZC0 A;  5CA1 E;  3RH3 A;  2CM0 A;  2CEA A;  5LGN B;  3I0Q A;  2W63 A;  2LJL A;  2LT3 A;  2KIN B;  4PW8 A;  3M1C A;  3I1A A;  3FXD B;  4H9N C;  5LJM A;  1WYC A;  1WYB A;  4CXW A;  3CQC B;  3RPU A;  4AKG A;  3E08 A;  3B13 A;  4OK0 A;  5LG4 A;  4AQG A;  4O4H E;  2KT9 A;  3ZMV B;  4WNK A;  4C91 A;  2V7K A;  2SPC A;  2D2S A;  5LHI B;  2Y6X A;  1OWA A;  4JEU B;  2CWO A;  2V7L A;  4I50 E;  3S4U A;  2X51 A;  4ZHQ E;  3CX7 B;  3P7I A;  2Y48 B;  2PJQ A;  2B1E A;  2E9X A;  2L8K A;  2L9Q A;  3FB2 A;  2PBI A;  5HXS A;  1LVK A;  1MIV A;  2XUE A;  2Q9Q A;  1LKX A;  2A3D A;  1Y64 B;  4EB6 E;  4UEL A;  2IAK A;  3O1H A;  2EHO B;  2PG8 A;  5KDM C;  5JRC A;  5LJN A;  1HS7 A;  4ZI2 C;  2BDE A;  2KXP B;  5L3B B;  2DCF A;  4AI6 A;  2LHR A;  5C8Y E;  3I9Y A;  4A56 A;  3PU8 A;  3N9Q A;  4DBQ A;  2ES0 A;  1NWM X;  3KFW X;  1D0Y A;  3F31 A;  3GMI A;  1U4Q A;  5LHG B;  1G73 A;  3N9L A;  3LBX A;  1E1H B;  2E9X C;  3CX8 B;  4TUY E;  4EXT A;  3NRX A;  4TV9 E;  3CQX C;  4TV8 E;  2UXN B;  4U72 A;  3L09 A;  5JDH A;  4YJ3 E;  2IC9 A;  2YEV C;  3RKO A;  4V1A v;  2L3L A;  4CXX A;  5LCY A;  3WAK A;  4ISS A;  1FMW A;  3AAI A;  3AVR A;  5ETW A;  3UUM A;  2WSS V;  3GA8 A;  5TAO A;  1D0X A;  2K9A A;  2H3R A;  4J2C A;  4P09 A;  2XAG B;  5J2U E;  4EOZ B;  5L3C B;  2LSG A;  4QXC B;  1ZV4 X;  4GK5 E;  1IAP A;  1QSD A;  2WMN A;  2XAQ B;  3HL6 A;  3RC3 A;  2V7J A;  3ETU A;  3K8P C;  3B57 A;  1MMN A;  3PUR A;  4B6X A;  3L3P A;  5H6R B;  2C0S A;  3SRZ A;  5EK3 A;  5JDF A;  3OYX A;  4E7Z A;  2KMF A;  5LYJ E;  3PDY A;  4M1P A;  2QGS A;  5GON E;  5DJQ C;  3EDV A;  4IE0 A;  3WSC A;  4EAH A;  5JR9 B;  2NW9 A;  5JH7 E;  4BGO A;  2W00 A;  1AJ3 A;  2LSJ A;  2VKO A;  2VAS A;  3C64 A;  5HXE A;  4L9I A;  4TZ4 C;  3HKE E;  3MA9 A;  3CQG B;  1MNE A;  1UCU A;  3N2O A;  5DQW A;  3V5U A;  2A72 A;  4DVD A;  5BMV E;  4AKH A;  2EHO A;  3KV6 A;  1LVF A;  5CA0 E;  5KMG P;  5A1L A;  4OHF A;  3OYZ A;  4PFP A;  3C4X A;  4EYY R;  1HX8 A;  2PFV A;  1X79 A;  2KWI B;  2ZM0 A;  4OYK A;  3N2K E;  2W62 A;  3AA1 B;  3QC9 A;  4UXN B;  1U5P A;  3PUS A;  1WLX A;  3EDU A;  3IEE A;  4I43 B;  2LE8 A;  4IE5 A;  3Q9D A;  2MTC A;  4WBO A;  5LP6 E;  4EZ4 A;  3W15 B;  4FJO A;  4AXP A;  2CLY C;  2K24 A;  4I55 E;  4HGA A;  3KBU A;  2EHO C;  3CKD A;  2HH7 A;  4PJJ A;  5F8P A;  3SS1 A;  3ZJ1 A;  4E7S A;  2X9W A;  5FXX A;  4IIJ E;  2KWH A;  2ZM2 A;  2BVM A;  2JRK A;  4KP3 C;  4YLH A;  2ZLY A;  4ZI3 C;  5HWY A;  3N9O A;  3EUH A;  4QX8 B;  5LA6 E;  3ZMS B;  4H9O C;  5DAB A;  2WM9 A;  1HCI A;  4OFZ A;  2XAH B;  4KMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...