5JDNA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 10 mm na+ and 10mm sr2+
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
301
structure length
297
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
molecule keywords sodium-calcium exchanger NCX_Mj
total genus 130
structure length 297
sequence length 301
ec nomenclature
pdb deposition date 2016-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdnA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdnA02
5HXCA 5HXHA 5HXEA 5HXSA 5HWYA 5JDNA 5JDFA 5JDLA 5HYAA 5JDHA 5HWXA 5HXRA 5JDGA 3V5SA 3V5UA 5JDMA 5JDQA
chains in the Genus database with same CATH superfamily
1KNRA 3AVRA 3RX6A 1H7CA 1HF8A 5CB4E 3MACA 2ZM6T 2LKGA 3K8PC 4A98A 3KBUA 3NRYA 2JQ9A 4NUUA 4YFSA 4ILAA 3I0OA 1ZOYA 5LB7B 3IHRA 3LFMA 5LP6E 1V9DA 2BBHA 4GKJT 4HTEA 4XBFB 4MLKA 2R6GF 2X9XA 4DO0A 2KINB 3RYHE 1MIYA 2ES0A 2M6BA 5FZTA 3KDSE 1XWMA 2A72A 1G73A 4DIDB 3AE4A 1ZKEA 2YU2A 3E0ZA 4V1Av 4ZS3A 3KINB 4EYYR 2C0SA 2UUCT 3F31A 5DQWA 4IDZA 3MJXA 2XQ3A 2YEVC 1JNZA 3E08A 4I0UA 4TNVA 2IMLA 4JUYA 1UX4A 1HR0T 3PF0A 3IA3A 1E7PA 4UV8B 5AQHB 5ABFA 5KDMC 1KFYA 3ETUA 3VJZA 3O1JA 2V6XA 2LLYA 4IL4A 5LBMA 3AE2A 3FHNA 3V5SA 2LHNA 4EB6E 5L3GB 2UXDT 2ACZA 3JCFA 4HWHA 4DBRA 5KMGP 5AQSB 4LFCT 4ZHQE 4Z91A 2D5UA 4EEBA 3RC8A 4P1NA 5HWYA 3L3PA 2WDQA 1VCTA 3AEDA 4F8HA 3PUVF 4U7IA 3C4ZA 1BR4A 1XDPA 4OFZA 2V7KA 5L47A 3O4XE 4U3CA 4CQIA 3G06A 1VCSA 2PG8A 3M65A 1T7SA 3N2KE 2CLYC 3N2OA 4H63H 4H9PC 3KV6A 4JEUB 4OYKA 1UK5A 4UF0A 4YHJA 5FMNA 3ZJ1A 2IUBA 4CXWA 4YJ2E 1J5ET 4YLHA 2C5JA 1FMWA 3ABVA 2V6YB 4H9OC 4DR6T 1QSDA 5J2TE 5AQJB 5ETWA 3EDVA 2YN6A 3FZLB 2L3LA 2VK9A 2YKSA 3AA6B 3UTKA 3ZYMA 1WYBA 2WZIA 2XAQB 4DUZT 1GQEA 1LVFA 5JR9A 4EGWA 5L3FB 4DV5T 1D1BA 4B3RT 1YD8G 5GONE 5FKYA 2FBWA 2I59A 2QRXA 2XM2A 3NKZA 5BR8T 4GKKT 2JIWA 3X1DA 3HKBE 4YY3T 3AA7B 4L9IA 3TLUA 4GOUA 2XTLA 4QXHB 2Q9QD 5AQTB 5LA6E 3FBLA 5L3BB 3WSCA 4H9QC 3AB3B 1YKHB 3MA9A 1W09A 3AXJB 2IAKA 2WM9A 3N2GE 4TV8E 1D0ZA 2D0TA 4QWNB 5DJQC 4EV6A 4CXYA 2L7NA 1HG5A 3AEEA 5LGTB 3WURA 4G2AA 2E9XA 4B3MT 1SUMB 2CPTA 3PJAA 3UFEA 3ZT7A 5HEGA 4AIUA 2X68A 2KSRA 2LE8A 3N9NA 3RF1A 4DR7T 4EYUA 1HS7A 2UU9T 4X64T 4MFRA 2V7LA 5ABEA 4I43B 5JQGE 1BR0A 4HGAA 3AEFA 3ZSSA 3LK42 2V8SV 2PBIA 2NP9A 4YTNA 3Q2MA 3PUSA 4PJMA 4X5TA 4ECGA 2WQYA 3ZCIA 4DR4T 2VKOA 4AI6A 3QK6A 4F6RC 3PUXF 5LJMA 3UU3A 2V7JA 3BK9A 3FZFB 3VR8A 4A5XA 5AQNB 2V7IA 5AQMB 3CQXC 1YQ4A 3AECA 5FY1A 4PK6A 2LM2A 1SE7A 2YDRA 5JDGA 1JNRA 2VKHA 2WS3A 1BR2A 2K24A 2H89A 4TX5A 1ZV4X 4QX8B 1NAFA 4TWDA 3TLVA 3U78A 3UU6A 3A5XA 1UURA 2XQ8A 4I50E 2IHR1 3ZKRA 2BKPA 3C50A 4BJNA 4NXMT 2JQHA 2VVNA 4DR5T 3MXZA 4H63V 2PJQA 2CXFA 4X66T 2XAGB 4GYRA 4HWCA 5HXHA 5AQPB 4LFAT 2VQET 2NWBA 4ISSA 4EAHA 4JI7T 5T1DA 3OPCA 4YJ3E 1YQ3A 3K3OA 2W66A 3ESLA 4CZZB 5HWXA 2WSSV 2VKDA 3HL6A 4U74A 2KLQA 2D2SA 4Q25A 2ZMAA 4JI1T 3ZC0A 3P7IA 1VOMA 4UV9B 3PTRB 2Y48B 1FJGT 5IYZE 4AXPA 1LVKA 2CXDA 2N1GA 1VRBA 4WBNE 5HXEA 5JTGA 1UCUA 5HEUA 2E5VA 5AFUL 5L3CB 4UIGA 4I55E 3UQ7A 2XQ7A 1WYCA 4KHPT 1MMNA 1FMVA 2NW7A 2BG9C 2FJEA 1MMAA 2L9QA 2XQ6A 2W62A 2LSGA 2CE7A 4DVDA 4AKHA 3P50A 4UELA 2X9YA 3KV5A 2QGSA 2UXBT 2IC6A 3TLSA 1IAPA 5AQVB 4IDPA 5LHGB 2YK0A 5FVLA 1FEWA 4LMLA 2ACXA 3CWZB 3C4XA 1KNPA 4K0UA 4JLEA 4LMJA 5AQFB 3U3IA 3SRZA 3GMIA 4MBQA 5H6RB 4ZZCA 5J2UE 5JR9B 4DV7T 3AT7A 4YSYA 2WBLA 2FJAA 2VVSA 5HCJA 4HFIA 2RP4A 4IHJE 5JDMA 4DV6T 2B1EA 4DR3T 1N33T 1Y01A 2CMRA 4EXTA 3AE5A 4JBWF 2BS3A 4QH1A 4LF7T 3EDUA 2V5DA 3CIRA 1OEDB 1MMDA 1UX5A 3AE1A 2ZM0A 3JC6C 2D9DA 3PU3A 4L5GA 2XQ4A 3L8RA 1MIVA 2NTXA 1HX1B 3EAMA 3QB5K 4COFA 2DNXA 2LSJA 3ANWB 4DV3T 3RLFF 1CHUA 2W0GA 2WDRA 2JJ9A 2G0UA 3L39A 4LF5T 3AA0B 3A8YC 2NW9A 2KZ7B 1S94A 2HN2A 1IBLT 2BG9E 3EHZA 4QXCB 3OTOT 3H3AA 2WDVA 3RRWA 5IUXA 3FBZA 2Y8DA 4AKRB 2V7MA 4BA9A 3ZT6A 2XQ9A 3OKQA 4H9SE 3VHLA 4YSZA 2VKJA 3OBVE 3C98B 4W8PA 1M62A 2XQAA 4GK5E 3HR0A 3DJBA 2I0MA 3L09A 1WFDA 5LCYA 1W9RA 3OJAA 5DQVA 3RKGA 3RYCE 4M1PA 3IEEA 5F8PA 3ZYLA 2IIUA 1NENA 4KP3C 4TN7B 4U2YA 3PUYF 3TKLB 2LT3A 3ZMVB 3HI2A 3EI0A 3T1HT 3CVRA 1KEYA 3JAEA 4LMKA 4P0BA 2YU1A 3CPZA 4ILBA 4DV2T 4HKAA 3K3QC 4X1IE 5AQUB 3RIUA 5L3EB 4Z90A 2LSYA 4DMWA 4YXDA 2LRLA 5HXRA 5LNKA 2FUPA 2HH7A 4HFBA 1QLBA 4PFPA 2VL8A 3PE0A 4UF0B 3H37A 3M3ZB 1LKXA 5L3DB 3ONLC 3VKGA 2NTYA 4KBMB 3LBXB 2BVMA 4IIJE 4PNIA 4IGUA 3C64A 3EUHA 2CWYA 4HWDA 4O2BE 5JVDE 3ZMZB 2IDOB 2N9DA 2KVPA 4KMCA 1LRZA 3ETVA 4AQGA 4DV1T 1WLXA 4E7SA 5EK4A 3B5MA 3SFDA 2WAUA 3PUQA 5LYJE 3AAEB 2WP9A 3LBXA 2M67A 1U4QA 3N9OA 3O1HA 4AISA 3JAFA 4HWFA 1S35A 1U5PA 4JI5T 3AE8A 3N5LA 3P8CD 5HXSA 1OEDC 2LJLA 5AQQB 2VWAA 4DUYT 2I6HA 3NBXX 4NPPA 5FYMA 1HTJF 2DI4A 2NOXA 3Q5WA 2CHNA 4PJJA 2CWOA 4PJNA 5AQRB 1OEDE 2X0CA 3AE9A 4MALA 2XASB 1L0VA 4GK0E 4GYSA 4ISTA 5JREA 2CM0A 4QKNA 5H6QB 3RYIE 4LF9T 3RQWA 2K5BB 2JMHA 2HPJA 3FXEB 5E0OA 4PAGA 1HX8A 4G63A 3J9X1 3SWHA 5J1GA 5JDNA 2H88A 4QH4A 4ZZBA 1W0BA 1ZEEA 2ZLYA 2YDQA 4FJOA 4ILUA 2XAHB 4HFEA 5AQLB 5IHYA 2W63A 2CCQA 1MNDA 5FVKA 3RKOA 5LG4A 5JDQA 2X51A 3SFEA 3CQGB 2IC9A 1XMOT 3QB5A 4QHOA 3PV0F 2V6YA 2J47A 1SA0E 5EK3A 3UQ4A 4MHCA 3ZSTA 4AQFA 5JRCB 1Z8UA 4PK4A 3UFGA 3DTOA 4UVCB 5LHHB 3VU7H 3EVYA 1KNZA 3CX8B 3QNUA 4IE4A 2XAFB 2MPKA 3AEAA 3GWHA 3BQKA 3V5UA 2K48A 2LSIA 2LRKA 4X65T 4LFBT 3R6NA 4O2AE 2JPFA 5AQIB 3RI5A 2QVAA 3I0QA 2W4XA 3AEGA 3FZKB 4ZS2A 4BJMA 3J7Yq 2MBGA 4WW0A 2UXNB 1HNWT 4CI2B 5L2LA 4WBOA 4AQYT 1IJ6A 1B7TA 1YKEB 2QA7A 4ERRA 5FL1A 3IF8B 3PURA 4OK0A 4X62T 2ZM8A 3N9QA 3MKDA 1SHZC 4TZ4C 4CI1B 3Q5EA 1N36T 2KNDA 3K1SA 4DV0T 3BQIA 2MTQA 1OEDA 4L0RA 4JI3T 1BR1A 1J5WA 3FZHB 2BG9B 4ZOLE 5ABGA 4EEDA 2K9AA 4Z8XA 3KV9A 3ZCJA 4OYJA 4DMVA 3Q5DA 4AKLA 2X67A 3VKHA 1XDOA 1EZ3A 2ODVA 1OXZA 2W67A 3KFWX 3RIFA 5A1LA 3DYJA 5C8YE 5HEJA 3P4PA 3WAKA 3ZJ2A 2DCFA 3ZPOA 2CBJA 5LBQB 5JDHA 2HPLA 2BKOA 2KWIB 4DV4T 2KWHA 4GIWA 4U31A 4DR1T 4KI0F 2X0HA 1UGOA 3S4UA 3ZMUB 1US7B 1KK7A 3GN5A 5HXCA 4IE6A 4ZI2C 3FZMB 5C2TA 4O4JE 5JR9C 2MOZA 3N9LA 3T1YT 5LJNA 2BDEA 2A2FX 1X9BA 5CJ5A 1M7KA 2EHOA 2X0YA 5FNVE 2DL1A 4TUYE 3P4SA 4ANJA 4X1YE 2X9WA 2D0UA 2UXCT 1T8BA 2DWKA 3C4WA 2Q9QA 3HKEE 3JC6D 3KVBA 4H9NC 2XQ5A 3C51A 3SS1A 3LJCA 3NWIA 4AKIA 2FJBA 2W00A 4U33A 2ZM2A 4X1KE 3ZC1A 1MNEA 3KBTA 1MIWA 2BKNA 2E9XD 4HEAA 3RPUA 5JH7E 1HFAA 2AE9A 4I4TE 4TWFA 2BS4A 2Q9QC 2JQKA 2J1DG 1HG2A 4XZCA 4ZI2D 3R84B 2LKHA 1W0AA 3FB2A 4IE0A 3PUGA 3HKCE 4ASKA 3UUNA 3TLWA 2WWUA 3O1IA 1WRDA 1XMQT 5FY0A 3EABA 5AQOB 1WR6A 2WWVA 1OWAA 2CEAA 2H7OA 5LG3A 2XQYA 4K0KT 2AXDS 5L4EA 2CA5A 4P09A 3OVUA 2BS2A 2LOSA 3JADA 4O4HE 4TWHA 3LG7A 4X20E 3KVAA 2QYWA 5AQKB 4KHZF 3RHWA 4XAXB 5HEOA 3P4RA 3ANWA 3D0TA 5FY7A 4EZ4A 2V26A 3CQCB 3GN5B 2Y6XA 4IDQA 2X66A 3P4WA 4CN1A 2MYSA 2V1DB 3F57A 5FXWA 3RQUA 3VR9A 2EHOB 3VRAA 2C5IT 2VASA 3FXDB 3ZN0B 2LHRA 2Z6EA 4UEMA 4C91A 5ABHA 3AY5A 3ZT5A 2H7VC 4TV9E 4UXNB 2WU5A 5FXXA 4DR2T 2NW8A 3N9MA 4ZXLA 3P4QA 5CGMA 1J1JA 2A9UA 1HNXT 1SJ8A 2KBBA 4F7GB 1XNRT 5M4YA 4EOZB 3ONJA 4DNDA 1YW0A 3PJAJ 2HN1A 1XZYA 4EZHA 1N34T 2K3WA 3PUAA 5AQGB 2JRKA 1CUNA 2KXPB 2WB5A 4QH5A 5F5WA 4JI4T 4ONRA 1D0YA 2M6IA 5TAOA 2CLYB 3RRCA 1AJ3A 1IBKT 3NRXA 2W61A 3PDYA 5LGUB 5J0ZA 3I9YA 1QUUA 2E9XC 5DABA 4ZEYA 2CBIA 4AQFC 4JV5T 3Q9DA 2XPKA 2OA5A 4UVBB 4ZI3D 1ZP0A 2FJDA 2NR4A 3AA1B 4NUVA 4WNKA 5EZYE 3UULA 5IWAT 3N9PA 1D1AA 1T98A 2PFVA 4IDNA 1E1HB 3PUWF 4YTMA 3RYFE 2CHOA 2L10A 1IZNB 2XM1A 3RGLA 3AVSA 3NZPA 2E5LT 2V5CA 2A3DA 3CX7B 1Y64B 2XSAA 2XUEA 3BQLA 3CKDA 3MZKB 4H9RC 4IREA 4NIQA 4QXBB 4LF8T 4CN6A 5LGNB 2UUBT 4HE8A 2PTFA 3PU8A 4IDOA 3O9XA 2OV9A 3LK2B 3QUJA 1XNQT 5HEHA 2VQFT 4CN4A 3F2EA 3NVOA 4IL9A 1I6ZA 2XAJB 5JRCA 1DU2A 4J2CA 2JMKA 3WAJA 1HCIA 4HN9A 3HKDE 3Q5XA 2LM9A 4ILCA 3ZEFB 3B57A 3RIUC 2X0LB 4LF4T 2EHOC 2YOEA 4C90A 4DBQA 3CK6A 4O4IE 3WI3A 4HWIB 5JDFA 2WCAA 2X9HA 3IBPA 1NWMX 3QC9A 2LSKA 2W2UA 1IJ5A 4WYVA 4JI2T 3K3NA 3ZN1B 5F3JA 2UUAT 3OYXA 4YHHT 4EIWA 5LMUT 4BGOA 2WY2A 3LSVA 4UR9A 4IT4A 2DWGA 5JDLA 4JI6T 1N32T 2MTCA 2J62A 4O4LE 3RIAA 1KF6A 2LOPA 5ABFB 1I94T 3UU8A 5FXVA 2P9BA 5KX5E 1E2AA 1ZHCA 4YT0A 3KV4A 5C3JA 5LMNT 4JI0T 3ZYKA 3E22E 2DLRA 2H3RA 3W15B 3OYZA 3TLTA 3HA4A 4O8SA 4CI3B 1T72A 2XHEB 4AKGA 2E9XB 2XJ7A 4ZI3C 2YDSA 2LQUA 3RH3A 3QOFA 4IE5A 2GK9A 2MAWA 1WR0A 3I9WA 3LK3B 3ZMSB 2VURA 4UVAB 2N2NA 3UU4A 2XY8B 3CMLA 2B76A 1YXRA 2WMOA 3ZMTB 2XSBA 2WZHA 3B13A 3PUZF 4U7YA 3CX6B 4B3TT 3AE3A 1UUSA 1Z0PA 2RPAA 2J4GA 4PW8A 2CRBA 2VL0A 5FL0A 3H3MA 3T8OA 3UUXB 3VRBA 2E8IA 2LEHA 3A7MA 5L4HA 4HFHA 3AAIA 3NZQA 2XZEA 2UXXB 3AE7A 4CXXA 3I1AA 4A56A 1X79A 4PFOA 3AE6A 2KT9A 2Q9QB 2JQQA 5HYAA 2CXLA 3AEBA 4PJLA 2L8KA 4B3ST 4TNWA 4ADZA 4HFDA 3UT5E 1MMGA 2OLTA 5LXTE 5LHIB 1WCRA 1O3XA 5FXZA 4U2ZA 2DHRA 5CA1E 4QX7B 3AAAB 1D0XA 4HFVA 4JEHB 2EHOD 2VB6A 4B6XA 1HNZT 1D1CA 3AXJA 3FYQA 3DP7A 5CA0E 1IBMT 3UU5A 5EK2A 2ODUA 4YSXA 4U72A 3M1CA 2BBJA 2WMNA 3ZLIA 1SJ7A 5ADXL 1FIOA 5HCMA 3LDQB 4P0AA 4WZXA 4JI8T 3UUMA 4FI5A 4KUMB 5BMVE 2KMFA 3RC3A 3UUBA 4E7ZA 2BG9A 2YINA 2BZBA 5KXJA 2F4VT 3GA8A 2BVLA 2E2AA 3MK7C 5CFBA 4BAYB 4JYAT 4KX6A 2C5KT 5HAXA 5FP3A 3SOLA 2HHHT 2IW5B 4N78D 4YTPA 4OX9T 4ZI7E 4NXNT 2KGXA 2RA1A 4HFCA 2SPCA 2WU2A 4IE7A 4PK5A 4LF6T 5LOVE 1G8XA 1R8IA 3ONXA 3PHF1 4A97A 1NEKA 4OHFA
chains in the Genus database with same CATH topology
3AVRA 3RX6A 1H7CA 1HF8A 5CB4E 3MACA 3K8PC 3KBUA 3NRYA 4YFSA 4NUUA 3I0OA 3IHRA 3LFMA 5LP6E 1V9DA 4HTEA 4XBFB 4MLKA 2X9XA 4DO0A 2KINB 3RYHE 1MIYA 2ES0A 3KDSE 2A72A 1G73A 1ZKEA 2YU2A 3E0ZA 4V1Av 4ZS3A 3KINB 2C0SA 3F31A 5DQWA 4IDZA 3MJXA 2YEVC 3E08A 4JUYA 1UX4A 3PF0A 3VJZA 4UV8B 5KDMC 3ETUA 3O1JA 5LBMA 4EB6E 3V5SA 3FHNA 5L3GB 2LHNA 4DBRA 5KMGP 4ZHQE 2D5UA 3RC8A 3L3PA 3C4ZA 1BR4A 4OFZA 2V7KA 3O4XE 4CQIA 2PG8A 3M65A 3N2KE 2CLYC 3N2OA 4H63H 4H9PC 3KV6A 4JEUB 4OYKA 4UF0A 4YHJA 3ZJ1A 5FMNA 4CXWA 4YJ2E 4YLHA 2C5JA 1FMWA 4H9OC 1QSDA 5J2TE 5ETWA 3EDVA 3UTKA 2L3LA 2VK9A 3AA6B 3ZYMA 1WYBA 2XAQB 1LVFA 5JR9A 5L3FB 1D1BA 1YD8G 5GONE 2I59A 3HKBE 3AA7B 4L9IA 4GOUA 2XTLA 4QXHB 2Q9QD 5LA6E 5L3BB 3FBLA 3WSCA 4H9QC 3AB3B 1YKHB 3MA9A 3N2GE 4TV8E 2IAKA 2WM9A 5HWYA 4CXYA 1D0ZA 2D0TA 4QWNB 5DJQC 3WURA 1HG5A 5LGTB 4G2AA 2E9XA 3UFEA 2X68A 2LE8A 3N9NA 4EYUA 1HS7A 4MFRA 2V7LA 4I43B 5JQGE 1BR0A 4HGAA 3LK42 2PBIA 2NP9A 3Q2MA 3PUSA 4PJMA 4ECGA 3ZCIA 4AI6A 2VKOA 3QK6A 4F6RC 5LJMA 2V7JA 3BK9A 2V7IA 5FY1A 3CQXC 4PK6A 5JDGA 2VKHA 1BR2A 2K24A 4TX5A 1ZV4X 4QX8B 1NAFA 3U78A 3A5XA 4I50E 4BJNA 3C50A 3MXZA 4H63V 2PJQA 2CXFA 2XAGB 4GYRA 2NWBA 4ISSA 4EAHA 5T1DA 4YJ3E 5HWXA 3K3OA 3ESLA 4CZZB 2WSSV 2VKDA 3HL6A 4U74A 2KLQA 2D2SA 2ZMAA 3ZC0A 3P7IA 1VOMA 4UV9B 3PTRB 2Y48B 5IYZE 4AXPA 1LVKA 2CXDA 2N1GA 1VRBA 4WBNE 5HXEA 1UCUA 5AFUL 5L3CB 4UIGA 4I55E 1WYCA 1MMNA 1FMVA 2NW7A 2L9QA 1MMAA 2W62A 2LSGA 2CE7A 4DVDA 4AKHA 4UELA 2X9YA 3KV5A 2QGSA 2IC6A 1IAPA 5LHGB 2YK0A 1FEWA 2ACXA 3CWZB 3C4XA 4K0UA 4JLEA 3U3IA 3SRZA 3GMIA 4MBQA 5H6RB 3AT7A 5J2UE 5JR9B 2WBLA 4IHJE 2RP4A 5JDMA 2B1EA 2CMRA 4EXTA 3EDUA 4EYYR 1UX5A 1MMDA 3PU3A 4L5GA 2ZM0A 3JC6C 1MIVA 2NTXA 2DNXA 2LSJA 3ANWB 2W0GA 2JJ9A 2G0UA 3AA0B 2NW9A 2KZ7B 1S94A 4QXCB 3H3AA 3RRWA 3FBZA 2Y8DA 4AKRB 2V7MA 4BA9A 3VHLA 3OKQA 4H9SE 2VKJA 3OBVE 3C98B 4GK5E 3HR0A 3DJBA 3L09A 5LCYA 3RYCE 3OJAA 5DQVA 4M1PA 3IEEA 5F8PA 3ZYLA 4KP3C 4TN7B 3TKLB 3ZMVB 2LT3A 3HI2A 3CVRA 4P0BA 2YU1A 3CPZA 4HKAA 3K3QC 4X1IE 5L3EB 5LNKA 2LSYA 4DMWA 5HXRA 2HH7A 4PFPA 2VL8A 3PE0A 4UF0B 3H37A 1LKXA 5L3DB 3VKGA 2NTYA 4KBMB 3LBXB 2BVMA 4IIJE 4PNIA 4IGUA 3C64A 3EUHA 2CWYA 4O2BE 5JVDE 3ZMZB 2N9DA 4KMCA 1LRZA 3ETVA 4AQGA 1WLXA 4E7SA 5EK4A 5LYJE 2WAUA 3PUQA 3AAEB 3LBXA 3N9OA 2M67A 1U4QA 3O1HA 1S35A 1U5PA 3N5LA 3P8CD 5HXSA 2LJLA 2VWAA 3NBXX 5FYMA 1HTJF 2DI4A 2NOXA 3Q5WA 4PJNA 4PJJA 2CWOA 4MALA 2XASB 5JREA 4GK0E 4GYSA 4ISTA 2CM0A 4QKNA 5H6QB 3RYIE 2K5BB 2JMHA 2HPJA 3FXEB 5E0OA 4PAGA 1HX8A 4G63A 3J9X1 3SWHA 5J1GA 5JDNA 1ZEEA 2ZLYA 4ILUA 4FJOA 5IHYA 2XAHB 5LG4A 3RKOA 2W63A 2CCQA 1MNDA 5JDQA 2X51A 3CQGB 2IC9A 4QHOA 5EK3A 4AQFA 1SA0E 4MHCA 5JRCB 4PK4A 3DTOA 4UVCB 5LHHB 3VU7H 3EVYA 3CX8B 4IE4A 2XAFB 3GWHA 3BQKA 3V5UA 2K48A 2LSIA 3R6NA 4O2AE 2JPFA 3I0QA 4ZS2A 4BJMA 2MBGA 4WW0A 2UXNB 4CI2B 5L2LA 4WBOA 1IJ6A 1B7TA 1YKEB 2QA7A 4ERRA 3IF8B 3PURA 4OK0A 2ZM8A 3N9QA 3MKDA 1SHZC 4TZ4C 4CI1B 2KNDA 3BQIA 2MTQA 4L0RA 1BR1A 4ZOLE 2K9AA 4Z8XA 3KV9A 3ZCJA 4OYJA 4DMVA 4AKLA 2X67A 3VKHA 2ODVA 1EZ3A 3KFWX 1OXZA 5A1LA 5C8YE 3WAKA 3ZJ2A 2DCFA 3ZPOA 5LBQB 5JDHA 2HPLA 2KWIB 2KWHA 4GIWA 3S4UA 3ZMUB 1US7B 1KK7A 3GN5A 5HXCA 4IE6A 4ZI2C 4O4JE 5JR9C 2MOZA 3N9LA 5LJNA 2BDEA 2A2FX 2EHOA 5FNVE 4ANJA 4TUYE 4X1YE 2X9WA 2D0UA 2DWKA 3C4WA 2Q9QA 3HKEE 3JC6D 3KVBA 4H9NC 3C51A 3SS1A 3J7Yq 3LJCA 4AKIA 2W00A 3ZC1A 2ZM2A 4X1KE 1MNEA 3KBTA 1MIWA 2E9XD 4HEAA 3RPUA 5JH7E 1HFAA 4I4TE 2Q9QC 2J1DG 1HG2A 4XZCA 4ZI2D 3R84B 3FB2A 3PUGA 3HKCE 4ASKA 3UUNA 2WWUA 3O1IA 1WRDA 5FY0A 1WR6A 1OWAA 2CEAA 2H7OA 2XQYA 2CA5A 4P09A 4O4HE 2LOSA 4ZI7E 4X20E 3LG7A 3KVAA 4XAXB 3ANWA 3D0TA 5FY7A 4EZ4A 2V26A 3CQCB 3GN5B 2Y6XA 2X66A 2MYSA 2V1DB 3F57A 5FXWA 2EHOB 2C5IT 2VASA 3FXDB 3ZN0B 2LHRA 2Z6EA 4UEMA 4C91A 2H7VC 4TV9E 4UXNB 5FXXA 2NW8A 3N9MA 5M4YA 4EOZB 4DNDA 1YW0A 4EZHA 3PUAA 2JRKA 1CUNA 2KXPB 4ONRA 1D0YA 5TAOA 2CLYB 3RRCA 1AJ3A 3NRXA 2W61A 3PDYA 5LGUB 3I9YA 1QUUA 2E9XC 5DABA 4AQFC 3Q9DA 4ZI3D 2OA5A 4UVBB 3UULA 4WNKA 3AA1B 4NUVA 5EZYE 3N9PA 1D1AA 1T98A 2PFVA 1E1HB 3RYFE 1IZNB 3AVSA 3NZPA 4IE0A 2A3DA 3CX7B 1Y64B 3CKDA 2XUEA 3BQLA 4H9RC 3MZKB 4QXBB 5HXHA 1KNZA 5LGNB 4HE8A 3PU8A 3O9XA 3LK2B 3QUJA 3F2EA 2XAJB 5JRCA 4J2CA 2JMKA 3WAJA 1HCIA 4HN9A 3HKDE 3Q5XA 2LM9A 3ZEFB 3B57A 2X0LB 2EHOC 4C90A 4DBQA 3WI3A 4O4IE 5JDFA 2X9HA 3IBPA 3QC9A 1NWMX 2LSKA 1IJ5A 3ZN1B 3K3NA 5F3JA 3OYXA 4EIWA 4BGOA 5JDLA 2DWGA 2MTCA 4O4LE 2LOPA 5FXVA 2P9BA 5KX5E 1ZHCA 3KV4A 3ZYKA 3E22E 2DLRA 2H3RA 3W15B 3OYZA 4CI3B 3HA4A 4O8SA 4AKGA 2XHEB 2E9XB 4ZI3C 2LQUA 3RH3A 4IE5A 3ZMSB 2GK9A 3LK3B 3I9WA 4UVAB 2N2NA 3CMLA 3ZMTB 2WMOA 3B13A 3CX6B 1Z0PA 4PW8A 3T8OA 3UUXB 2E8IA 2LEHA 3AAIA 3NZQA 2UXXB 4CXXA 3I1AA 4A56A 1X79A 4PFOA 2KT9A 2Q9QB 2JQQA 5HYAA 2CXLA 4PJLA 2L8KA 4ADZA 3UT5E 1MMGA 5LXTE 5LHIB 1O3XA 5FXZA 2DHRA 5CA1E 4QX7B 3AAAB 1D0XA 4HFVA 4JEHB 2EHOD 2VB6A 4B6XA 1D1CA 3DP7A 5CA0E 5EK2A 2ODUA 3M1CA 4U72A 2WMNA 3ZLIA 5ADXL 1FIOA 4P0AA 3UUMA 4FI5A 4KUMB 5BMVE 2KMFA 3RC3A 4E7ZA 2YINA 2BZBA 3GA8A 2BVLA 3MK7C 4BAYB 2C5KT 5HAXA 5FP3A 3SOLA 2IW5B 4N78D 2RA1A 2SPCA 4IE7A 4PK5A 5LOVE 1G8XA 3ONXA 3PHF1 4OHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXC A;  5HXH A;  5HXE A;  5HXS A;  5HWY A;  5JDN A;  5JDF A;  5JDL A;  5HYA A;  5JDH A;  5HWX A;  5HXR A;  5JDG A;  3V5S A;  3V5U A;  5JDM A;  5JDQ A; 
#chains in the Genus database with same CATH topology
 1KNR A;  3AVR A;  3RX6 A;  1H7C A;  1HF8 A;  5CB4 E;  3MAC A;  2ZM6 T;  2LKG A;  3K8P C;  4A98 A;  3KBU A;  3NRY A;  2JQ9 A;  4NUU A;  4YFS A;  4ILA A;  3I0O A;  1ZOY A;  5LB7 B;  3IHR A;  3LFM A;  5LP6 E;  1V9D A;  2BBH A;  4GKJ T;  4HTE A;  4XBF B;  4MLK A;  2R6G F;  2X9X A;  4DO0 A;  2KIN B;  3RYH E;  1MIY A;  2ES0 A;  2M6B A;  5FZT A;  3KDS E;  1XWM A;  2A72 A;  1G73 A;  4DID B;  3AE4 A;  1ZKE A;  2YU2 A;  3E0Z A;  4V1A v;  4ZS3 A;  3KIN B;  4EYY R;  2C0S A;  2UUC T;  3F31 A;  5DQW A;  4IDZ A;  3MJX A;  2XQ3 A;  2YEV C;  1JNZ A;  3E08 A;  4I0U A;  4TNV A;  2IML A;  4JUY A;  1UX4 A;  1HR0 T;  3PF0 A;  3IA3 A;  1E7P A;  4UV8 B;  5AQH B;  5ABF A;  5KDM C;  1KFY A;  3ETU A;  3VJZ A;  3O1J A;  2V6X A;  2LLY A;  4IL4 A;  5LBM A;  3AE2 A;  3FHN A;  3V5S A;  2LHN A;  4EB6 E;  5L3G B;  2UXD T;  2ACZ A;  3JCF A;  4HWH A;  4DBR A;  5KMG P;  5AQS B;  4LFC T;  4ZHQ E;  4Z91 A;  2D5U A;  4EEB A;  3RC8 A;  4P1N A;  5HWY A;  3L3P A;  2WDQ A;  1VCT A;  3AED A;  4F8H A;  3PUV F;  4U7I A;  3C4Z A;  1BR4 A;  1XDP A;  4OFZ A;  2V7K A;  5L47 A;  3O4X E;  4U3C A;  4CQI A;  3G06 A;  1VCS A;  2PG8 A;  3M65 A;  1T7S A;  3N2K E;  2CLY C;  3N2O A;  4H63 H;  4H9P C;  3KV6 A;  4JEU B;  4OYK A;  1UK5 A;  4UF0 A;  4YHJ A;  5FMN A;  3ZJ1 A;  2IUB A;  4CXW A;  4YJ2 E;  1J5E T;  4YLH A;  2C5J A;  1FMW A;  3ABV A;  2V6Y B;  4H9O C;  4DR6 T;  1QSD A;  5J2T E;  5AQJ B;  5ETW A;  3EDV A;  2YN6 A;  3FZL B;  2L3L A;  2VK9 A;  2YKS A;  3AA6 B;  3UTK A;  3ZYM A;  1WYB A;  2WZI A;  2XAQ B;  4DUZ T;  1GQE A;  1LVF A;  5JR9 A;  4EGW A;  5L3F B;  4DV5 T;  1D1B A;  4B3R T;  1YD8 G;  5GON E;  5FKY A;  2FBW A;  2I59 A;  2QRX A;  2XM2 A;  3NKZ A;  5BR8 T;  4GKK T;  2JIW A;  3X1D A;  3HKB E;  4YY3 T;  3AA7 B;  4L9I A;  3TLU A;  4GOU A;  2XTL A;  4QXH B;  2Q9Q D;  5AQT B;  5LA6 E;  3FBL A;  5L3B B;  3WSC A;  4H9Q C;  3AB3 B;  1YKH B;  3MA9 A;  1W09 A;  3AXJ B;  2IAK A;  2WM9 A;  3N2G E;  4TV8 E;  1D0Z A;  2D0T A;  4QWN B;  5DJQ C;  4EV6 A;  4CXY A;  2L7N A;  1HG5 A;  3AEE A;  5LGT B;  3WUR A;  4G2A A;  2E9X A;  4B3M T;  1SUM B;  2CPT A;  3PJA A;  3UFE A;  3ZT7 A;  5HEG A;  4AIU A;  2X68 A;  2KSR A;  2LE8 A;  3N9N A;  3RF1 A;  4DR7 T;  4EYU A;  1HS7 A;  2UU9 T;  4X64 T;  4MFR A;  2V7L A;  5ABE A;  4I43 B;  5JQG E;  1BR0 A;  4HGA A;  3AEF A;  3ZSS A;  3LK4 2;  2V8S V;  2PBI A;  2NP9 A;  4YTN A;  3Q2M A;  3PUS A;  4PJM A;  4X5T A;  4ECG A;  2WQY A;  3ZCI A;  4DR4 T;  2VKO A;  4AI6 A;  3QK6 A;  4F6R C;  3PUX F;  5LJM A;  3UU3 A;  2V7J A;  3BK9 A;  3FZF B;  3VR8 A;  4A5X A;  5AQN B;  2V7I A;  5AQM B;  3CQX C;  1YQ4 A;  3AEC A;  5FY1 A;  4PK6 A;  2LM2 A;  1SE7 A;  2YDR A;  5JDG A;  1JNR A;  2VKH A;  2WS3 A;  1BR2 A;  2K24 A;  2H89 A;  4TX5 A;  1ZV4 X;  4QX8 B;  1NAF A;  4TWD A;  3TLV A;  3U78 A;  3UU6 A;  3A5X A;  1UUR A;  2XQ8 A;  4I50 E;  2IHR 1;  3ZKR A;  2BKP A;  3C50 A;  4BJN A;  4NXM T;  2JQH A;  2VVN A;  4DR5 T;  3MXZ A;  4H63 V;  2PJQ A;  2CXF A;  4X66 T;  2XAG B;  4GYR A;  4HWC A;  5HXH A;  5AQP B;  4LFA T;  2VQE T;  2NWB A;  4ISS A;  4EAH A;  4JI7 T;  5T1D A;  3OPC A;  4YJ3 E;  1YQ3 A;  3K3O A;  2W66 A;  3ESL A;  4CZZ B;  5HWX A;  2WSS V;  2VKD A;  3HL6 A;  4U74 A;  2KLQ A;  2D2S A;  4Q25 A;  2ZMA A;  4JI1 T;  3ZC0 A;  3P7I A;  1VOM A;  4UV9 B;  3PTR B;  2Y48 B;  1FJG T;  5IYZ E;  4AXP A;  1LVK A;  2CXD A;  2N1G A;  1VRB A;  4WBN E;  5HXE A;  5JTG A;  1UCU A;  5HEU A;  2E5V A;  5AFU L;  5L3C B;  4UIG A;  4I55 E;  3UQ7 A;  2XQ7 A;  1WYC A;  4KHP T;  1MMN A;  1FMV A;  2NW7 A;  2BG9 C;  2FJE A;  1MMA A;  2L9Q A;  2XQ6 A;  2W62 A;  2LSG A;  2CE7 A;  4DVD A;  4AKH A;  3P50 A;  4UEL A;  2X9Y A;  3KV5 A;  2QGS A;  2UXB T;  2IC6 A;  3TLS A;  1IAP A;  5AQV B;  4IDP A;  5LHG B;  2YK0 A;  5FVL A;  1FEW A;  4LML A;  2ACX A;  3CWZ B;  3C4X A;  1KNP A;  4K0U A;  4JLE A;  4LMJ A;  5AQF B;  3U3I A;  3SRZ A;  3GMI A;  4MBQ A;  5H6R B;  4ZZC A;  5J2U E;  5JR9 B;  4DV7 T;  3AT7 A;  4YSY A;  2WBL A;  2FJA A;  2VVS A;  5HCJ A;  4HFI A;  2RP4 A;  4IHJ E;  5JDM A;  4DV6 T;  2B1E A;  4DR3 T;  1N33 T;  1Y01 A;  2CMR A;  4EXT A;  3AE5 A;  4JBW F;  2BS3 A;  4QH1 A;  4LF7 T;  3EDU A;  2V5D A;  3CIR A;  1OED B;  1MMD A;  1UX5 A;  3AE1 A;  2ZM0 A;  3JC6 C;  2D9D A;  3PU3 A;  4L5G A;  2XQ4 A;  3L8R A;  1MIV A;  2NTX A;  1HX1 B;  3EAM A;  3QB5 K;  4COF A;  2DNX A;  2LSJ A;  3ANW B;  4DV3 T;  3RLF F;  1CHU A;  2W0G A;  2WDR A;  2JJ9 A;  2G0U A;  3L39 A;  4LF5 T;  3AA0 B;  3A8Y C;  2NW9 A;  2KZ7 B;  1S94 A;  2HN2 A;  1IBL T;  2BG9 E;  3EHZ A;  4QXC B;  3OTO T;  3H3A A;  2WDV A;  3RRW A;  5IUX A;  3FBZ A;  2Y8D A;  4AKR B;  2V7M A;  4BA9 A;  3ZT6 A;  2XQ9 A;  3OKQ A;  4H9S E;  3VHL A;  4YSZ A;  2VKJ A;  3OBV E;  3C98 B;  4W8P A;  1M62 A;  2XQA A;  4GK5 E;  3HR0 A;  3DJB A;  2I0M A;  3L09 A;  1WFD A;  5LCY A;  1W9R A;  3OJA A;  5DQV A;  3RKG A;  3RYC E;  4M1P A;  3IEE A;  5F8P A;  3ZYL A;  2IIU A;  1NEN A;  4KP3 C;  4TN7 B;  4U2Y A;  3PUY F;  3TKL B;  2LT3 A;  3ZMV B;  3HI2 A;  3EI0 A;  3T1H T;  3CVR A;  1KEY A;  3JAE A;  4LMK A;  4P0B A;  2YU1 A;  3CPZ A;  4ILB A;  4DV2 T;  4HKA A;  3K3Q C;  4X1I E;  5AQU B;  3RIU A;  5L3E B;  4Z90 A;  2LSY A;  4DMW A;  4YXD A;  2LRL A;  5HXR A;  5LNK A;  2FUP A;  2HH7 A;  4HFB A;  1QLB A;  4PFP A;  2VL8 A;  3PE0 A;  4UF0 B;  3H37 A;  3M3Z B;  1LKX A;  5L3D B;  3ONL C;  3VKG A;  2NTY A;  4KBM B;  3LBX B;  2BVM A;  4IIJ E;  4PNI A;  4IGU A;  3C64 A;  3EUH A;  2CWY A;  4HWD A;  4O2B E;  5JVD E;  3ZMZ B;  2IDO B;  2N9D A;  2KVP A;  4KMC A;  1LRZ A;  3ETV A;  4AQG A;  4DV1 T;  1WLX A;  4E7S A;  5EK4 A;  3B5M A;  3SFD A;  2WAU A;  3PUQ A;  5LYJ E;  3AAE B;  2WP9 A;  3LBX A;  2M67 A;  1U4Q A;  3N9O A;  3O1H A;  4AIS A;  3JAF A;  4HWF A;  1S35 A;  1U5P A;  4JI5 T;  3AE8 A;  3N5L A;  3P8C D;  5HXS A;  1OED C;  2LJL A;  5AQQ B;  2VWA A;  4DUY T;  2I6H A;  3NBX X;  4NPP A;  5FYM A;  1HTJ F;  2DI4 A;  2NOX A;  3Q5W A;  2CHN A;  4PJJ A;  2CWO A;  4PJN A;  5AQR B;  1OED E;  2X0C A;  3AE9 A;  4MAL A;  2XAS B;  1L0V A;  4GK0 E;  4GYS A;  4IST A;  5JRE A;  2CM0 A;  4QKN A;  5H6Q B;  3RYI E;  4LF9 T;  3RQW A;  2K5B B;  2JMH A;  2HPJ A;  3FXE B;  5E0O A;  4PAG A;  1HX8 A;  4G63 A;  3J9X 1;  3SWH A;  5J1G A;  5JDN A;  2H88 A;  4QH4 A;  4ZZB A;  1W0B A;  1ZEE A;  2ZLY A;  2YDQ A;  4FJO A;  4ILU A;  2XAH B;  4HFE A;  5AQL B;  5IHY A;  2W63 A;  2CCQ A;  1MND A;  5FVK A;  3RKO A;  5LG4 A;  5JDQ A;  2X51 A;  3SFE A;  3CQG B;  2IC9 A;  1XMO T;  3QB5 A;  4QHO A;  3PV0 F;  2V6Y A;  2J47 A;  1SA0 E;  5EK3 A;  3UQ4 A;  4MHC A;  3ZST A;  4AQF A;  5JRC B;  1Z8U A;  4PK4 A;  3UFG A;  3DTO A;  4UVC B;  5LHH B;  3VU7 H;  3EVY A;  1KNZ A;  3CX8 B;  3QNU A;  4IE4 A;  2XAF B;  2MPK A;  3AEA A;  3GWH A;  3BQK A;  3V5U A;  2K48 A;  2LSI A;  2LRK A;  4X65 T;  4LFB T;  3R6N A;  4O2A E;  2JPF A;  5AQI B;  3RI5 A;  2QVA A;  3I0Q A;  2W4X A;  3AEG A;  3FZK B;  4ZS2 A;  4BJM A;  3J7Y q;  2MBG A;  4WW0 A;  2UXN B;  1HNW T;  4CI2 B;  5L2L A;  4WBO A;  4AQY T;  1IJ6 A;  1B7T A;  1YKE B;  2QA7 A;  4ERR A;  5FL1 A;  3IF8 B;  3PUR A;  4OK0 A;  4X62 T;  2ZM8 A;  3N9Q A;  3MKD A;  1SHZ C;  4TZ4 C;  4CI1 B;  3Q5E A;  1N36 T;  2KND A;  3K1S A;  4DV0 T;  3BQI A;  2MTQ A;  1OED A;  4L0R A;  4JI3 T;  1BR1 A;  1J5W A;  3FZH B;  2BG9 B;  4ZOL E;  5ABG A;  4EED A;  2K9A A;  4Z8X A;  3KV9 A;  3ZCJ A;  4OYJ A;  4DMV A;  3Q5D A;  4AKL A;  2X67 A;  3VKH A;  1XDO A;  1EZ3 A;  2ODV A;  1OXZ A;  2W67 A;  3KFW X;  3RIF A;  5A1L A;  3DYJ A;  5C8Y E;  5HEJ A;  3P4P A;  3WAK A;  3ZJ2 A;  2DCF A;  3ZPO A;  2CBJ A;  5LBQ B;  5JDH A;  2HPL A;  2BKO A;  2KWI B;  4DV4 T;  2KWH A;  4GIW A;  4U31 A;  4DR1 T;  4KI0 F;  2X0H A;  1UGO A;  3S4U A;  3ZMU B;  1US7 B;  1KK7 A;  3GN5 A;  5HXC A;  4IE6 A;  4ZI2 C;  3FZM B;  5C2T A;  4O4J E;  5JR9 C;  2MOZ A;  3N9L A;  3T1Y T;  5LJN A;  2BDE A;  2A2F X;  1X9B A;  5CJ5 A;  1M7K A;  2EHO A;  2X0Y A;  5FNV E;  2DL1 A;  4TUY E;  3P4S A;  4ANJ A;  4X1Y E;  2X9W A;  2D0U A;  2UXC T;  1T8B A;  2DWK A;  3C4W A;  2Q9Q A;  3HKE E;  3JC6 D;  3KVB A;  4H9N C;  2XQ5 A;  3C51 A;  3SS1 A;  3LJC A;  3NWI A;  4AKI A;  2FJB A;  2W00 A;  4U33 A;  2ZM2 A;  4X1K E;  3ZC1 A;  1MNE A;  3KBT A;  1MIW A;  2BKN A;  2E9X D;  4HEA A;  3RPU A;  5JH7 E;  1HFA A;  2AE9 A;  4I4T E;  4TWF A;  2BS4 A;  2Q9Q C;  2JQK A;  2J1D G;  1HG2 A;  4XZC A;  4ZI2 D;  3R84 B;  2LKH A;  1W0A A;  3FB2 A;  4IE0 A;  3PUG A;  3HKC E;  4ASK A;  3UUN A;  3TLW A;  2WWU A;  3O1I A;  1WRD A;  1XMQ T;  5FY0 A;  3EAB A;  5AQO B;  1WR6 A;  2WWV A;  1OWA A;  2CEA A;  2H7O A;  5LG3 A;  2XQY A;  4K0K T;  2AXD S;  5L4E A;  2CA5 A;  4P09 A;  3OVU A;  2BS2 A;  2LOS A;  3JAD A;  4O4H E;  4TWH A;  3LG7 A;  4X20 E;  3KVA A;  2QYW A;  5AQK B;  4KHZ F;  3RHW A;  4XAX B;  5HEO A;  3P4R A;  3ANW A;  3D0T A;  5FY7 A;  4EZ4 A;  2V26 A;  3CQC B;  3GN5 B;  2Y6X A;  4IDQ A;  2X66 A;  3P4W A;  4CN1 A;  2MYS A;  2V1D B;  3F57 A;  5FXW A;  3RQU A;  3VR9 A;  2EHO B;  3VRA A;  2C5I T;  2VAS A;  3FXD B;  3ZN0 B;  2LHR A;  2Z6E A;  4UEM A;  4C91 A;  5ABH A;  3AY5 A;  3ZT5 A;  2H7V C;  4TV9 E;  4UXN B;  2WU5 A;  5FXX A;  4DR2 T;  2NW8 A;  3N9M A;  4ZXL A;  3P4Q A;  5CGM A;  1J1J A;  2A9U A;  1HNX T;  1SJ8 A;  2KBB A;  4F7G B;  1XNR T;  5M4Y A;  4EOZ B;  3ONJ A;  4DND A;  1YW0 A;  3PJA J;  2HN1 A;  1XZY A;  4EZH A;  1N34 T;  2K3W A;  3PUA A;  5AQG B;  2JRK A;  1CUN A;  2KXP B;  2WB5 A;  4QH5 A;  5F5W A;  4JI4 T;  4ONR A;  1D0Y A;  2M6I A;  5TAO A;  2CLY B;  3RRC A;  1AJ3 A;  1IBK T;  3NRX A;  2W61 A;  3PDY A;  5LGU B;  5J0Z A;  3I9Y A;  1QUU A;  2E9X C;  5DAB A;  4ZEY A;  2CBI A;  4AQF C;  4JV5 T;  3Q9D A;  2XPK A;  2OA5 A;  4UVB B;  4ZI3 D;  1ZP0 A;  2FJD A;  2NR4 A;  3AA1 B;  4NUV A;  4WNK A;  5EZY E;  3UUL A;  5IWA T;  3N9P A;  1D1A A;  1T98 A;  2PFV A;  4IDN A;  1E1H B;  3PUW F;  4YTM A;  3RYF E;  2CHO A;  2L10 A;  1IZN B;  2XM1 A;  3RGL A;  3AVS A;  3NZP A;  2E5L T;  2V5C A;  2A3D A;  3CX7 B;  1Y64 B;  2XSA A;  2XUE A;  3BQL A;  3CKD A;  3MZK B;  4H9R C;  4IRE A;  4NIQ A;  4QXB B;  4LF8 T;  4CN6 A;  5LGN B;  2UUB T;  4HE8 A;  2PTF A;  3PU8 A;  4IDO A;  3O9X A;  2OV9 A;  3LK2 B;  3QUJ A;  1XNQ T;  5HEH A;  2VQF T;  4CN4 A;  3F2E A;  3NVO A;  4IL9 A;  1I6Z A;  2XAJ B;  5JRC A;  1DU2 A;  4J2C A;  2JMK A;  3WAJ A;  1HCI A;  4HN9 A;  3HKD E;  3Q5X A;  2LM9 A;  4ILC A;  3ZEF B;  3B57 A;  3RIU C;  2X0L B;  4LF4 T;  2EHO C;  2YOE A;  4C90 A;  4DBQ A;  3CK6 A;  4O4I E;  3WI3 A;  4HWI B;  5JDF A;  2WCA A;  2X9H A;  3IBP A;  1NWM X;  3QC9 A;  2LSK A;  2W2U A;  1IJ5 A;  4WYV A;  4JI2 T;  3K3N A;  3ZN1 B;  5F3J A;  2UUA T;  3OYX A;  4YHH T;  4EIW A;  5LMU T;  4BGO A;  2WY2 A;  3LSV A;  4UR9 A;  4IT4 A;  2DWG A;  5JDL A;  4JI6 T;  1N32 T;  2MTC A;  2J62 A;  4O4L E;  3RIA A;  1KF6 A;  2LOP A;  5ABF B;  1I94 T;  3UU8 A;  5FXV A;  2P9B A;  5KX5 E;  1E2A A;  1ZHC A;  4YT0 A;  3KV4 A;  5C3J A;  5LMN T;  4JI0 T;  3ZYK A;  3E22 E;  2DLR A;  2H3R A;  3W15 B;  3OYZ A;  3TLT A;  3HA4 A;  4O8S A;  4CI3 B;  1T72 A;  2XHE B;  4AKG A;  2E9X B;  2XJ7 A;  4ZI3 C;  2YDS A;  2LQU A;  3RH3 A;  3QOF A;  4IE5 A;  2GK9 A;  2MAW A;  1WR0 A;  3I9W A;  3LK3 B;  3ZMS B;  2VUR A;  4UVA B;  2N2N A;  3UU4 A;  2XY8 B;  3CML A;  2B76 A;  1YXR A;  2WMO A;  3ZMT B;  2XSB A;  2WZH A;  3B13 A;  3PUZ F;  4U7Y A;  3CX6 B;  4B3T T;  3AE3 A;  1UUS A;  1Z0P A;  2RPA A;  2J4G A;  4PW8 A;  2CRB A;  2VL0 A;  5FL0 A;  3H3M A;  3T8O A;  3UUX B;  3VRB A;  2E8I A;  2LEH A;  3A7M A;  5L4H A;  4HFH A;  3AAI A;  3NZQ A;  2XZE A;  2UXX B;  3AE7 A;  4CXX A;  3I1A A;  4A56 A;  1X79 A;  4PFO A;  3AE6 A;  2KT9 A;  2Q9Q B;  2JQQ A;  5HYA A;  2CXL A;  3AEB A;  4PJL A;  2L8K A;  4B3S T;  4TNW A;  4ADZ A;  4HFD A;  3UT5 E;  1MMG A;  2OLT A;  5LXT E;  5LHI B;  1WCR A;  1O3X A;  5FXZ A;  4U2Z A;  2DHR A;  5CA1 E;  4QX7 B;  3AAA B;  1D0X A;  4HFV A;  4JEH B;  2EHO D;  2VB6 A;  4B6X A;  1HNZ T;  1D1C A;  3AXJ A;  3FYQ A;  3DP7 A;  5CA0 E;  1IBM T;  3UU5 A;  5EK2 A;  2ODU A;  4YSX A;  4U72 A;  3M1C A;  2BBJ A;  2WMN A;  3ZLI A;  1SJ7 A;  5ADX L;  1FIO A;  5HCM A;  3LDQ B;  4P0A A;  4WZX A;  4JI8 T;  3UUM A;  4FI5 A;  4KUM B;  5BMV E;  2KMF A;  3RC3 A;  3UUB A;  4E7Z A;  2BG9 A;  2YIN A;  2BZB A;  5KXJ A;  2F4V T;  3GA8 A;  2BVL A;  2E2A A;  3MK7 C;  5CFB A;  4BAY B;  4JYA T;  4KX6 A;  2C5K T;  5HAX A;  5FP3 A;  3SOL A;  2HHH T;  2IW5 B;  4N78 D;  4YTP A;  4OX9 T;  4ZI7 E;  4NXN T;  2KGX A;  2RA1 A;  4HFC A;  2SPC A;  2WU2 A;  4IE7 A;  4PK5 A;  4LF6 T;  5LOV E;  1G8X A;  1R8I A;  3ONX A;  3PHF 1;  4A97 A;  1NEK A;  4OHF A; 
#chains in the Genus database with same CATH homology
 3AVR A;  3RX6 A;  1H7C A;  1HF8 A;  5CB4 E;  3MAC A;  3K8P C;  3KBU A;  3NRY A;  4YFS A;  4NUU A;  3I0O A;  3IHR A;  3LFM A;  5LP6 E;  1V9D A;  4HTE A;  4XBF B;  4MLK A;  2X9X A;  4DO0 A;  2KIN B;  3RYH E;  1MIY A;  2ES0 A;  3KDS E;  2A72 A;  1G73 A;  1ZKE A;  2YU2 A;  3E0Z A;  4V1A v;  4ZS3 A;  3KIN B;  2C0S A;  3F31 A;  5DQW A;  4IDZ A;  3MJX A;  2YEV C;  3E08 A;  4JUY A;  1UX4 A;  3PF0 A;  3VJZ A;  4UV8 B;  5KDM C;  3ETU A;  3O1J A;  5LBM A;  4EB6 E;  3V5S A;  3FHN A;  5L3G B;  2LHN A;  4DBR A;  5KMG P;  4ZHQ E;  2D5U A;  3RC8 A;  3L3P A;  3C4Z A;  1BR4 A;  4OFZ A;  2V7K A;  3O4X E;  4CQI A;  2PG8 A;  3M65 A;  3N2K E;  2CLY C;  3N2O A;  4H63 H;  4H9P C;  3KV6 A;  4JEU B;  4OYK A;  4UF0 A;  4YHJ A;  3ZJ1 A;  5FMN A;  4CXW A;  4YJ2 E;  4YLH A;  2C5J A;  1FMW A;  4H9O C;  1QSD A;  5J2T E;  5ETW A;  3EDV A;  3UTK A;  2L3L A;  2VK9 A;  3AA6 B;  3ZYM A;  1WYB A;  2XAQ B;  1LVF A;  5JR9 A;  5L3F B;  1D1B A;  1YD8 G;  5GON E;  2I59 A;  3HKB E;  3AA7 B;  4L9I A;  4GOU A;  2XTL A;  4QXH B;  2Q9Q D;  5LA6 E;  5L3B B;  3FBL A;  3WSC A;  4H9Q C;  3AB3 B;  1YKH B;  3MA9 A;  3N2G E;  4TV8 E;  2IAK A;  2WM9 A;  5HWY A;  4CXY A;  1D0Z A;  2D0T A;  4QWN B;  5DJQ C;  3WUR A;  1HG5 A;  5LGT B;  4G2A A;  2E9X A;  3UFE A;  2X68 A;  2LE8 A;  3N9N A;  4EYU A;  1HS7 A;  4MFR A;  2V7L A;  4I43 B;  5JQG E;  1BR0 A;  4HGA A;  3LK4 2;  2PBI A;  2NP9 A;  3Q2M A;  3PUS A;  4PJM A;  4ECG A;  3ZCI A;  4AI6 A;  2VKO A;  3QK6 A;  4F6R C;  5LJM A;  2V7J A;  3BK9 A;  2V7I A;  5FY1 A;  3CQX C;  4PK6 A;  5JDG A;  2VKH A;  1BR2 A;  2K24 A;  4TX5 A;  1ZV4 X;  4QX8 B;  1NAF A;  3U78 A;  3A5X A;  4I50 E;  4BJN A;  3C50 A;  3MXZ A;  4H63 V;  2PJQ A;  2CXF A;  2XAG B;  4GYR A;  2NWB A;  4ISS A;  4EAH A;  5T1D A;  4YJ3 E;  5HWX A;  3K3O A;  3ESL A;  4CZZ B;  2WSS V;  2VKD A;  3HL6 A;  4U74 A;  2KLQ A;  2D2S A;  2ZMA A;  3ZC0 A;  3P7I A;  1VOM A;  4UV9 B;  3PTR B;  2Y48 B;  5IYZ E;  4AXP A;  1LVK A;  2CXD A;  2N1G A;  1VRB A;  4WBN E;  5HXE A;  1UCU A;  5AFU L;  5L3C B;  4UIG A;  4I55 E;  1WYC A;  1MMN A;  1FMV A;  2NW7 A;  2L9Q A;  1MMA A;  2W62 A;  2LSG A;  2CE7 A;  4DVD A;  4AKH A;  4UEL A;  2X9Y A;  3KV5 A;  2QGS A;  2IC6 A;  1IAP A;  5LHG B;  2YK0 A;  1FEW A;  2ACX A;  3CWZ B;  3C4X A;  4K0U A;  4JLE A;  3U3I A;  3SRZ A;  3GMI A;  4MBQ A;  5H6R B;  3AT7 A;  5J2U E;  5JR9 B;  2WBL A;  4IHJ E;  2RP4 A;  5JDM A;  2B1E A;  2CMR A;  4EXT A;  3EDU A;  4EYY R;  1UX5 A;  1MMD A;  3PU3 A;  4L5G A;  2ZM0 A;  3JC6 C;  1MIV A;  2NTX A;  2DNX A;  2LSJ A;  3ANW B;  2W0G A;  2JJ9 A;  2G0U A;  3AA0 B;  2NW9 A;  2KZ7 B;  1S94 A;  4QXC B;  3H3A A;  3RRW A;  3FBZ A;  2Y8D A;  4AKR B;  2V7M A;  4BA9 A;  3VHL A;  3OKQ A;  4H9S E;  2VKJ A;  3OBV E;  3C98 B;  4GK5 E;  3HR0 A;  3DJB A;  3L09 A;  5LCY A;  3RYC E;  3OJA A;  5DQV A;  4M1P A;  3IEE A;  5F8P A;  3ZYL A;  4KP3 C;  4TN7 B;  3TKL B;  3ZMV B;  2LT3 A;  3HI2 A;  3CVR A;  4P0B A;  2YU1 A;  3CPZ A;  4HKA A;  3K3Q C;  4X1I E;  5L3E B;  5LNK A;  2LSY A;  4DMW A;  5HXR A;  2HH7 A;  4PFP A;  2VL8 A;  3PE0 A;  4UF0 B;  3H37 A;  1LKX A;  5L3D B;  3VKG A;  2NTY A;  4KBM B;  3LBX B;  2BVM A;  4IIJ E;  4PNI A;  4IGU A;  3C64 A;  3EUH A;  2CWY A;  4O2B E;  5JVD E;  3ZMZ B;  2N9D A;  4KMC A;  1LRZ A;  3ETV A;  4AQG A;  1WLX A;  4E7S A;  5EK4 A;  5LYJ E;  2WAU A;  3PUQ A;  3AAE B;  3LBX A;  3N9O A;  2M67 A;  1U4Q A;  3O1H A;  1S35 A;  1U5P A;  3N5L A;  3P8C D;  5HXS A;  2LJL A;  2VWA A;  3NBX X;  5FYM A;  1HTJ F;  2DI4 A;  2NOX A;  3Q5W A;  4PJN A;  4PJJ A;  2CWO A;  4MAL A;  2XAS B;  5JRE A;  4GK0 E;  4GYS A;  4IST A;  2CM0 A;  4QKN A;  5H6Q B;  3RYI E;  2K5B B;  2JMH A;  2HPJ A;  3FXE B;  5E0O A;  4PAG A;  1HX8 A;  4G63 A;  3J9X 1;  3SWH A;  5J1G A;  5JDN A;  1ZEE A;  2ZLY A;  4ILU A;  4FJO A;  5IHY A;  2XAH B;  5LG4 A;  3RKO A;  2W63 A;  2CCQ A;  1MND A;  5JDQ A;  2X51 A;  3CQG B;  2IC9 A;  4QHO A;  5EK3 A;  4AQF A;  1SA0 E;  4MHC A;  5JRC B;  4PK4 A;  3DTO A;  4UVC B;  5LHH B;  3VU7 H;  3EVY A;  3CX8 B;  4IE4 A;  2XAF B;  3GWH A;  3BQK A;  3V5U A;  2K48 A;  2LSI A;  3R6N A;  4O2A E;  2JPF A;  3I0Q A;  4ZS2 A;  4BJM A;  2MBG A;  4WW0 A;  2UXN B;  4CI2 B;  5L2L A;  4WBO A;  1IJ6 A;  1B7T A;  1YKE B;  2QA7 A;  4ERR A;  3IF8 B;  3PUR A;  4OK0 A;  2ZM8 A;  3N9Q A;  3MKD A;  1SHZ C;  4TZ4 C;  4CI1 B;  2KND A;  3BQI A;  2MTQ A;  4L0R A;  1BR1 A;  4ZOL E;  2K9A A;  4Z8X A;  3KV9 A;  3ZCJ A;  4OYJ A;  4DMV A;  4AKL A;  2X67 A;  3VKH A;  2ODV A;  1EZ3 A;  3KFW X;  1OXZ A;  5A1L A;  5C8Y E;  3WAK A;  3ZJ2 A;  2DCF A;  3ZPO A;  5LBQ B;  5JDH A;  2HPL A;  2KWI B;  2KWH A;  4GIW A;  3S4U A;  3ZMU B;  1US7 B;  1KK7 A;  3GN5 A;  5HXC A;  4IE6 A;  4ZI2 C;  4O4J E;  5JR9 C;  2MOZ A;  3N9L A;  5LJN A;  2BDE A;  2A2F X;  2EHO A;  5FNV E;  4ANJ A;  4TUY E;  4X1Y E;  2X9W A;  2D0U A;  2DWK A;  3C4W A;  2Q9Q A;  3HKE E;  3JC6 D;  3KVB A;  4H9N C;  3C51 A;  3SS1 A;  3J7Y q;  3LJC A;  4AKI A;  2W00 A;  3ZC1 A;  2ZM2 A;  4X1K E;  1MNE A;  3KBT A;  1MIW A;  2E9X D;  4HEA A;  3RPU A;  5JH7 E;  1HFA A;  4I4T E;  2Q9Q C;  2J1D G;  1HG2 A;  4XZC A;  4ZI2 D;  3R84 B;  3FB2 A;  3PUG A;  3HKC E;  4ASK A;  3UUN A;  2WWU A;  3O1I A;  1WRD A;  5FY0 A;  1WR6 A;  1OWA A;  2CEA A;  2H7O A;  2XQY A;  2CA5 A;  4P09 A;  4O4H E;  2LOS A;  4ZI7 E;  4X20 E;  3LG7 A;  3KVA A;  4XAX B;  3ANW A;  3D0T A;  5FY7 A;  4EZ4 A;  2V26 A;  3CQC B;  3GN5 B;  2Y6X A;  2X66 A;  2MYS A;  2V1D B;  3F57 A;  5FXW A;  2EHO B;  2C5I T;  2VAS A;  3FXD B;  3ZN0 B;  2LHR A;  2Z6E A;  4UEM A;  4C91 A;  2H7V C;  4TV9 E;  4UXN B;  5FXX A;  2NW8 A;  3N9M A;  5M4Y A;  4EOZ B;  4DND A;  1YW0 A;  4EZH A;  3PUA A;  2JRK A;  1CUN A;  2KXP B;  4ONR A;  1D0Y A;  5TAO A;  2CLY B;  3RRC A;  1AJ3 A;  3NRX A;  2W61 A;  3PDY A;  5LGU B;  3I9Y A;  1QUU A;  2E9X C;  5DAB A;  4AQF C;  3Q9D A;  4ZI3 D;  2OA5 A;  4UVB B;  3UUL A;  4WNK A;  3AA1 B;  4NUV A;  5EZY E;  3N9P A;  1D1A A;  1T98 A;  2PFV A;  1E1H B;  3RYF E;  1IZN B;  3AVS A;  3NZP A;  4IE0 A;  2A3D A;  3CX7 B;  1Y64 B;  3CKD A;  2XUE A;  3BQL A;  4H9R C;  3MZK B;  4QXB B;  5HXH A;  1KNZ A;  5LGN B;  4HE8 A;  3PU8 A;  3O9X A;  3LK2 B;  3QUJ A;  3F2E A;  2XAJ B;  5JRC A;  4J2C A;  2JMK A;  3WAJ A;  1HCI A;  4HN9 A;  3HKD E;  3Q5X A;  2LM9 A;  3ZEF B;  3B57 A;  2X0L B;  2EHO C;  4C90 A;  4DBQ A;  3WI3 A;  4O4I E;  5JDF A;  2X9H A;  3IBP A;  3QC9 A;  1NWM X;  2LSK A;  1IJ5 A;  3ZN1 B;  3K3N A;  5F3J A;  3OYX A;  4EIW A;  4BGO A;  5JDL A;  2DWG A;  2MTC A;  4O4L E;  2LOP A;  5FXV A;  2P9B A;  5KX5 E;  1ZHC A;  3KV4 A;  3ZYK A;  3E22 E;  2DLR A;  2H3R A;  3W15 B;  3OYZ A;  4CI3 B;  3HA4 A;  4O8S A;  4AKG A;  2XHE B;  2E9X B;  4ZI3 C;  2LQU A;  3RH3 A;  4IE5 A;  3ZMS B;  2GK9 A;  3LK3 B;  3I9W A;  4UVA B;  2N2N A;  3CML A;  3ZMT B;  2WMO A;  3B13 A;  3CX6 B;  1Z0P A;  4PW8 A;  3T8O A;  3UUX B;  2E8I A;  2LEH A;  3AAI A;  3NZQ A;  2UXX B;  4CXX A;  3I1A A;  4A56 A;  1X79 A;  4PFO A;  2KT9 A;  2Q9Q B;  2JQQ A;  5HYA A;  2CXL A;  4PJL A;  2L8K A;  4ADZ A;  3UT5 E;  1MMG A;  5LXT E;  5LHI B;  1O3X A;  5FXZ A;  2DHR A;  5CA1 E;  4QX7 B;  3AAA B;  1D0X A;  4HFV A;  4JEH B;  2EHO D;  2VB6 A;  4B6X A;  1D1C A;  3DP7 A;  5CA0 E;  5EK2 A;  2ODU A;  3M1C A;  4U72 A;  2WMN A;  3ZLI A;  5ADX L;  1FIO A;  4P0A A;  3UUM A;  4FI5 A;  4KUM B;  5BMV E;  2KMF A;  3RC3 A;  4E7Z A;  2YIN A;  2BZB A;  3GA8 A;  2BVL A;  3MK7 C;  4BAY B;  2C5K T;  5HAX A;  5FP3 A;  3SOL A;  2IW5 B;  4N78 D;  2RA1 A;  2SPC A;  4IE7 A;  4PK5 A;  5LOV E;  1G8X A;  3ONX A;  3PHF 1;  4OHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...