5JDNA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 10 mm na+ and 10mm sr2+
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
301
structure length
297
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium-calcium exchanger NCX_Mj
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 130
structure length 297
sequence length 301
ec nomenclature
pdb deposition date 2016-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdnA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdnA02
5JDFA 5HYAA 5JDQA 3V5UA 5HWXA 5JDHA 5JDGA 5JDMA 5HXCA 5HXEA 5HXRA 5HXHA 5HWYA 3V5SA 5HXSA 5JDLA 5JDNA
chains in the Genus database with same CATH superfamily
5FZTA 3EDUA 4EIWA 2W67A 5LBQB 4IGUA 2CE7A 2CPTA 2UXBT 1SJ7A 3IF8B 4DNDA 3FZHB 3AE3A 4HFBA 3PUGA 2Z6EA 3AEFA 3E0ZA 3CK6A 2ES0A 2J62A 4YJ3E 3M3ZB 4TV8E 4GK5E 1HS7A 2A9UA 1N36T 4IE0A 2XUEA 3RIUC 2WP9A 4ILUA 2BS3A 2ZM8A 4YHJA 2X9WA 2X68A 4YTPA 1S94A 4TWFA 3A8YC 2ZM0A 4XBFB 5J1GA 5HCJA 4I43B 3O4XE 4UF0A 2DNXA 2XQ6A 1D0ZA 5ABGA 3MZKB 2KT9A 4BGOA 2CRBA 5JDLA 5LMNT 4QX8B 2MYSA 4CI2B 2BKNA 3K1SA 4AKHA 2BG9E 4ANJA 4X64T 4WZXA 5DQVA 4NUUA 5FL1A 2W0GA 4YSXA 4NXMT 5L2LA 2M67A 2NWBA 2V5DA 5JQGE 3UU6A 4CI1B 5LHHB 4H9RC 2CLYB 2V6YA 3N9NA 3QNUA 3FBZA 2RPAA 3MJXA 3N9LA 5JDNA 3LBXA 4LFAT 4P0AA 5T1DA 4WBNE 2XY8B 5C3JA 5M4YA 5ABFB 2LLYA 3KBUA 2XQ7A 4HFIA 4F7GB 4H63V 3RIFA 3NRYA 2B76A 3M1CA 1BR4A 5ETWA 3HKEE 1HNXT 4NXNT 2E9XB 2JJ9A 3U78A 5IUXA 3ZMSB 5JR9C 2PG8A 2VKJA 4H9OC 2SPCA 2WZHA 3TLSA 1G73A 4I50E 5LGTB 3GA8A 2BKPA 5LGNB 1H7CA 2UXDT 4ONRA 4LF4T 3E08A 2VURA 2H7OA 3TLWA 3IEEA 1MIYA 1YQ4A 2XAQB 2JPFA 1ZP0A 4AKGA 2GK9A 2K9AA 2VQFT 3ZEFB 4TV9E 4DR3T 4TN7B 4ADZA 2LEHA 2K5BB 1UUSA 5KX5E 4F6RC 4NUVA 1JNRA 3DTOA 2PBIA 4IDZA 4U72A 2J1DG 4EYUA 2A72A 2VASA 3WURA 2PTFA 2RA1A 2XM2A 5E0OA 4XZCA 3EUHA 1X79A 3LFMA 1IJ5A 3UUMA 2X67A 3EHZA 4ZS2A 3C51A 4UXNB 3AXJA 1VOMA 4DV7T 3RGLA 5AQUB 3E22E 3C4WA 2LM2A 2X9XA 5FY1A 4X20E 4O4IE 4BJMA 3MXZA 3N2GE 5AQPB 5JDQA 4ZI7E 2E9XD 1I6ZA 3OBVE 3ZN1B 4MLKA 5CFBA 4AKLA 2LSYA 2WDQA 4EAHA 1QSDA 4PJJA 1D1AA 4DR2T 3WAJA 4J2CA 3ZLIA 4A56A 2H88A 2X51A 4HFVA 1J5WA 4ISTA 1MIVA 3B5MA 3FYQA 4UELA 5JDGA 4AXPA 3AE8A 5F5WA 3RIUA 3AEEA 4DR5T 5J0ZA 1YKHB 3SRZA 3CX8B 2NW9A 2XAFB 4MBQA 2FJEA 2IHR1 2KINB 2WY2A 2P9BA 3K3NA 2X9YA 1NWMX 4TNWA 5HEJA 4EZHA 3K3OA 2Q9QD 4AQFC 2JQQA 3OYXA 4UEMA 4HWFA 2W62A 3PV0F 3VKGA 3EI0A 2XAGB 2Y8DA 3L09A 3J7Yq 3RQUA 5LG4A 4IL4A 3TKLB 1B7TA 4GYRA 3UU3A 2MTCA 2LOPA 3VRBA 1XMQT 2DI4A 4CN1A 1E2AA 4QKNA 3QB5A 3N2OA 4ISSA 3ZT5A 5JDMA 4X66T 2FJAA 3OVUA 3O1JA 1HTJF 1HCIA 2I59A 2LT3A 5HXHA 1KNPA 5LXTE 2E9XA 3VHLA 4Z91A 5FNVE 2L7NA 5LYJE 4COFA 2WMNA 4DUYT 4L0RA 5GONE 3HL6A 2DWKA 4DR4T 3CX6B 2W2UA 2UUCT 1ZEEA 3AE9A 4O4JE 2D0TA 2CWYA 3WAKA 3S4UA 2UU9T 2RP4A 5AQFB 2VL0A 5LHIB 2IAKA 1WR0A 3N5LA 2UXCT 3SS1A 4HWHA 4IL9A 4DMWA 4LFCT 2V7LA 1W0AA 2VKHA 4DVDA 5AQQB 1OEDC 4U33A 2LHNA 5H6RB 3RX6A 2OA5A 2QGSA 3CQGB 2M6IA 3AA0B 2Y48B 2NW7A 2KWIB 4A97A 4QH4A 2JQHA 4OK0A 2C5IT 1CUNA 1Z8UA 5FVLA 3FBLA 3PF0A 4TZ4C 5CA0E 1O3XA 4QH5A 1HNWT 2BBJA 4EXTA 5JREA 1VCSA 1FMVA 2D0UA 1ZHCA 4EEBA 4YT0A 1MMGA 5LHGB 5LNKA 3ESLA 4IREA 4MALA 2DWGA 1D1BA 2XASB 5DJQC 1I94T 2IUBA 3FZMB 2FBWA 3ZYLA 2OV9A 3FZFB 4Z90A 3GWHA 2WMOA 5FL0A 1IZNB 1WR6A 5LB7B 4LF8T 2MOZA 2K24A 4C90A 3VRAA 4B3RT 2LOSA 4YY3T 2BVLA 4O2BE 2W66A 3HKDE 3ZYKA 2XAJB 2YOEA 2HPJA 3ZPOA 3KV9A 3LJCA 1IBMT 2XAHB 3TLUA 4H9QC 4CXWA 4GIWA 1XMOT 4AQFA 2PFVA 3PU3A 4O2AE 2CBJA 2LQUA 3C64A 4KUMB 4L9IA 4JUYA 1VCTA 2CM0A 4BAYB 1XDOA 3IBPA 4ZZCA 5J2TE 2C5JA 4ZI2D 1MNEA 1NAFA 3R6NA 1WYCA 2WDVA 4ZXLA 5J2UE 2LSGA 2A3DA 5EZYE 2CXFA 5H6QB 4AQGA 4YXDA 5ADXL 3AE6A 2QA7A 2L10A 4X62T 4QWNB 5L47A 1IAPA 1LKXA 1XWMA 2E5VA 4CZZB 4B6XA 2LSIA 4KBMB 3OKQA 2MBGA 4PK5A 2FJBA 4G63A 5DQWA 4X1YE 2UXXB 3RKGA 5JVDE 4JI0T 3GMIA 5F3JA 3ZMUB 1E7PA 4B3MT 5LOVE 4W8PA 3BQKA 4AKIA 2H7VC 1NENA 2VL8A 4PK6A 3UULA 1SE7A 4ZS3A 1YKEB 3PUXF 4CN6A 1W9RA 4DBRA 4LF9T 3RLFF 1J1JA 4U31A 2CLYC 1XZYA 5AQRB 3ZSSA 4EB6E 1UX4A 3RYFE 5EK3A 2L8KA 3KDSE 2J47A 1EZ3A 5HAXA 3PJAJ 2BZBA 4WNKA 1VRBA 2K3WA 3UT5E 4IE5A 1BR0A 3UUXB 5F8PA 2D9DA 2VWAA 1KNZA 1CHUA 2IMLA 3FZKB 4JI6T 3ZC0A 1OEDA 2LHRA 3RRCA 3WI3A 2X0YA 2E9XC 4WW0A 3NZPA 3PU8A 3NZQA 1D0XA 3VKHA 2E5LT 2BVMA 4DV5T 5CB4E 3QC9A 3RHWA 4U7IA 3KBTA 5L4HA 4JI8T 2W61A 1W09A 3SFEA 2VKDA 3UFEA 4TWDA 5AQLB 2WCAA 3ZN0B 5HYAA 2BS2A 1SA0E 3RYCE 3P8CD 4IE4A 2BG9B 3KVAA 4AISA 3H3MA 4HN9A 4GKJT 1DU2A 3NBXX 3Q9DA 1M62A 4PJNA 3UU4A 2Q9QB 2Q9QC 3ZMVB 4H9SE 2LRLA 3Q5EA 3PUWF 4DR1T 1LVFA 1FEWA 4DR7T 3G06A 3RIAA 2G0UA 4U7YA 3X1DA 3RYIE 4PNIA 3JAFA 2R6GF 3UFGA 5AQIB 5AQOB 3P7IA 3RH3A 2LSJA 3D0TA 3RC3A 2WAUA 4U2YA 2NP9A 4IT4A 3SOLA 3N9OA 1WCRA 3V5SA 5TAOA 4TUYE 2W00A 5L4EA 1U5PA 2IW5B 4MFRA 5AQGB 3RKOA 3A5XA 4E7SA 2XQ5A 2E8IA 2ZMAA 2NW8A 4OHFA 4XAXB 2FJDA 2M6BA 4P1NA 2YDRA 1SUMB 2K48A 4DV2T 2VK9A 2XQ4A 3ZKRA 4LMLA 3PTRB 2X0CA 4EV6A 1KF6A 5ABEA 3F31A 3ANWB 2DCFA 3R84B 4HGAA 5IHYA 5BR8T 5L3EB 2JQKA 3PE0A 2MAWA 2XQ3A 4YFSA 3OPCA 3AEDA 3ONXA 1SJ8A 3CQCB 4QXHB 1X9BA 3I0OA 4HFEA 1M7KA 2B1EA 4LFBT 1FIOA 4X1KE 1HNZT 5EK2A 3T8OA 5L3GB 2N2NA 5C2TA 4ZZBA 3DJBA 3MACA 3HR0A 2D5UA 1MNDA 3EVYA 3PDYA 4QHOA 4F8HA 1FJGT 1OEDE 2L9QA 2VQET 3LG7A 4ZHQE 2DL1A 2V5CA 3QB5K 1G8XA 3AEBA 2YN6A 2YU1A 4DV0T 1ZV4X 3Q2MA 4HFDA 1QLBA 4IE6A 2ZM2A 2DLRA 1XNRT 5ABFA 5IWAT 3MA9A 4V1Av 4LF5T 4IDPA 2WU5A 1HG5A 2I0MA 1UURA 1HX1B 3P4QA 3ZJ2A 3AA1B 4EGWA 3FB2A 3WSCA 1Y01A 3JCFA 4QX7B 4DMVA 4ERRA 2IC6A 3ZCJA 5L3BB 4IHJE 5FXXA 1KEYA 5HWYA 3CKDA 4DV1T 2C5KT 3P4RA 4NPPA 2MTQA 2N9DA 4FJOA 3H3AA 5AFUL 5DABA 5JDHA 3AAAB 2ODVA 3AE5A 1MMAA 3LBXB 3P50A 2KGXA 4OYKA 4HWDA 2NOXA 2BG9A 5BMVE 4GYSA 4NIQA 1IBKT 2XPKA 1OXZA 4HWIB 4ZI3D 3VJZA 1OWAA 5FMNA 5L3CB 2DHRA 2E2AA 2Q9QA 3BQIA 3AVSA 2LKHA 4I55E 2MPKA 5LJNA 3ABVA 2W4XA 4B3ST 3GN5B 2AXDS 2WQYA 2VB6A 3C98B 4HE8A 3O9XA 2CCQA 3CWZB 3OJAA 4ZI2C 3RYHE 3AAIA 1HG2A 2HN2A 2XQ8A 3IA3A 5AQTB 5FY0A 5LA6E 3SFDA 4KX6A 4EYYR 3P4SA 4UV8B 3PUZF 4A5XA 1J5ET 5FVKA 4O4LE 4OFZA 4UR9A 3LK3B 3N9PA 2YEVC 5ABHA 4HFCA 4M1PA 5CGMA 2LM9A 3HKBE 3ZMTB 1UCUA 3FZLB 1U4QA 4X1IE 1WRDA 4GK0E 3F57A 4B3TT 4JI1T 2ODUA 3AE2A 5HXEA 2XSAA 3OTOT 4PAGA 3ANWA 1T7SA 4AIUA 4K0UA 3I0QA 4JBWF 5AQMB 4GKKT 3DYJA 3UQ4A 1UGOA 3Q5WA 1UX5A 5LCYA 3RPUA 4UV9B 4KP3C 4PFOA 4BJNA 1WYBA 1T98A 2PJQA 2JIWA 1XDPA 4DV3T 3I1AA 3PHF1 3KVBA 3K8PC 2FUPA 4IDNA 1Z0PA 2OLTA 4JEUB 4YTMA 4IDQA 4PFPA 4HEAA 3RI5A 3LK42 2LRKA 4YJ2E 2UUAT 1UK5A 2CBIA 2XSBA 3ETVA 3AEAA 2CEAA 3O1IA 4U3CA 2Y6XA 3T1YT 2V26A 4LF6T 5LJMA 1YXRA 3HKCE 4EZ4A 4ILAA 4AI6A 1N33T 2KBBA 2NTYA 4OX9T 2I6HA 4YHHT 5KXJA 3VR8A 4LMJA 1IJ6A 4JI3T 4HWCA 2LKGA 5FXVA 4DO0A 4AQYT 5LP6E 3AE4A 3UUNA 4Z8XA 3NRXA 3RC8A 3F2EA 4X5TA 2WS3A 3ZCIA 3CVRA 2KNDA 2W63A 3CPZA 3BQLA 4JLEA 2LSKA 2NR4A 3K3QC 3LDQB 4GOUA 4QXCB 4DV6T 2N1GA 3LSVA 1D1CA 4JI2T 4DUZT 3KINB 3OYZA 4DR6T 2XQAA 3PUVF 5FXZA 4L5GA 2KWHA 4OYJA 2HH7A 5FKYA 2YKSA 2BDEA 3ONLC 4KHPT 2WB5A 2CHOA 5LG3A 2EHOB 3JC6C 2EHOC 3NVOA 1Y64B 3PUAA 4TWHA 4A98A 3AY5A 3NWIA 3QUJA 3Q5XA 4JYAT 1D0YA 3CX7B 3TLTA 3ZT7A 2YU2A 3L3PA 3AB3B 3Q5DA 2V7JA 3C4XA 4WYVA 2KSRA 3GN5A 3MK7C 4LF7T 3J9X1 4JI7T 3ONJA 4H9NC 4ILBA 4YLHA 5JR9B 4KHZF 2D2SA 3ZYMA 1WLXA 2CWOA 3ZC1A 4ZEYA 5FXWA 1AJ3A 1BR1A 2BG9C 5KDMC 3AE1A 1N32T 2CXLA 2ACZA 5HEUA 4YSYA 2ZLYA 4DBQA 3B57A 4CI3B 3ZMZB 3MKDA 3NKZA 5CJ5A 4YSZA 4PJLA 5HXRA 4C91A 2A2FX 4I0UA 2WU2A 1MIWA 2ZM6T 3EABA 3N9MA 3AT7A 3P4PA 2AE9A 2V7MA 1YW0A 5L3DB 3JC6D 4K0KT 2EHOD 4P09A 1V9DA 3QK6A 5EK4A 4ASKA 2BS4A 4CN4A 2XHEB 5AQKB 2HN1A 4H9PC 4FI5A 5AQJB 3A7MA 1T72A 4YTNA 3PURA 3ETUA 5HEOA 3HI2A 4PJMA 1FMWA 3I9YA 2HPLA 5LMUT 4HKAA 5HWXA 1XNQT 4ILCA 1KNRA 4JEHB 2V1DB 5C8YE 5FP3A 1JNZA 3B13A 5AQSB 5HXCA 2JMKA 4JI5T 2X0HA 4P0BA 1LRZA 3IHRA 2NTXA 3RF1A 5HXSA 1S35A 3RQWA 4U74A 2V7IA 4CXYA 3HA4A 2CXDA 4QXBB 2YDQA 5CA1E 1N34T 5AQHB 2VVNA 3ZJ1A 4KMCA 1ZKEA 3AAEB 1YQ3A 1MMNA 4CXXA 5JRCB 2X0LB 3ZSTA 4KI0F 2WWVA 2BBHA 5LGUB 4HFHA 3SWHA 2WBLA 4I4TE 2XQYA 2YK0A 2H3RA 3AECA 3I9WA 5KMGP 1HF8A 1LVKA 1NEKA 3AEGA 3W15B 4CQIA 3UQ7A 3EDVA 2XJ7A 2V6XA 2QYWA 3CQXC 4UVCB 2LJLA 1R8IA 3FHNA 4UVBB 3AVRA 4MHCA 4ZI3C 2XM1A 5LBMA 2XQ9A 5HEHA 2KXPB 2VKOA 2QVAA 4JI4T 4PK4A 3FXDB 4LMKA 3ZT6A 3N9QA 2XZEA 3CMLA 2CHNA 3AE7A 4BA9A 3P4WA 3N2KE 2IIUA 3AA7B 2L3LA 3CIRA 2EHOA 3L39A 1L0VA 1MMDA 5FY7A 2WDRA 4UF0B 2KMFA 2V7KA 3JAEA 2IDOB 1T8BA 1W0BA 3C50A 1ZOYA 5IYZE 2JQ9A 2JMHA 5JH7E 2HHHT 4O8SA 3QOFA 4TNVA 2H89A 5HCMA 2J4GA 3VR9A 4E7ZA 2IC9A 4UIGA 4PW8A 5AQNB 1WFDA 1KFYA 2LE8A 2V6YB 3U3IA 4X65T 4JV5T 5JR9A 3T1HT 3AA6B 5L3FB 5JDFA 3RRWA 2C0SA 3PUYF 3BK9A 5A1LA 3H37A 3KV5A 4TX5A 4U2ZA 4DIDB 2WZIA 3KFWX 3JADA 2KVPA 4EEDA 4ZOLE 1GQEA 4WBOA 2UXNB 3UTKA 1OEDB 4H63H 4G2AA 2BKOA 5HEGA 2WSSV 5AQVB 4AKRB 3C4ZA 2VVSA 4HTEA 2CMRA 2KZ7B 4O4HE 1YD8G 1HFAA 3UUBA 3KV4A 4IDOA 2UUBT 1QUUA 2X66A 1US7B 2WM9A 4QH1A 2X9HA 3M65A 4UVAB 3L8RA 3FXEB 1HR0T 2YDSA 4IIJE 1KK7A 1SHZC 1HX8A 3PUQA 3O1HA 5JTGA 1IBLT 2YINA 2KLQA 2ACXA 2V8SV 4ECGA 1E1HB 3PJAA 4DV4T 2JRKA 3EAMA 2XTLA 5FYMA 3TLVA 2WWUA 1BR2A 3VU7H 3V5UA 3UU8A 4EOZB 3LK2B 3PUSA 3UU5A 4IE7A 3KV6A 4Q25A 2QRXA 3DP7A 3AXJB 5JRCA 2CA5A 2F4VT 4N78D
chains in the Genus database with same CATH topology
3Q5XA 3S4UA 2K48A 2RP4A 1D0YA 2VK9A 5LHIB 3CX7B 3EDUA 4EIWA 5LBQB 2YU2A 3L3PA 2IAKA 3PTRB 4IGUA 3N5LA 3AB3B 3SS1A 3F31A 3ANWB 2CE7A 2DCFA 3R84B 2V7JA 3C4XA 4HGAA 4DMWA 5IHYA 3GN5A 3MK7C 5L3EB 2V7LA 3IF8B 3PE0A 3J9X1 4DNDA 2VKHA 4YFSA 4DVDA 3ONXA 3PUGA 3CQCB 2LHNA 4QXHB 2Z6EA 4H9NC 4YLHA 3I0OA 5H6RB 3E0ZA 5JR9B 2ES0A 4YJ3E 3RX6A 2B1EA 2OA5A 2QGSA 2D2SA 3CQGB 4TV8E 1FIOA 3AA0B 4GK5E 2Y48B 3ZYMA 1WLXA 2KWIB 2NW7A 1HS7A 2CWOA 3ZC1A 4X1KE 5FXWA 4IE0A 2XUEA 5EK2A 3T8OA 5L3GB 1AJ3A 1BR1A 4OK0A 2C5IT 2N2NA 1CUNA 4ILUA 5KDMC 3FBLA 3DJBA 3PF0A 2CXLA 2ZM8A 4YHJA 2X9WA 2X68A 4TZ4C 1S94A 3HR0A 2D5UA 1MNDA 3EVYA 3MACA 2ZLYA 3PDYA 4QHOA 5CA0E 1O3XA 4DBQA 3B57A 4CI3B 2ZM0A 4XBFB 5J1GA 3ZMZB 3MKDA 4EXTA 4I43B 3O4XE 2L9QA 4UF0A 2DNXA 3LG7A 5JREA 1D0ZA 4PJLA 5HXRA 4ZHQE 3MZKB 4C91A 2KT9A 2A2FX 1FMVA 4BGOA 2D0UA 1ZHCA 5JDLA 1MMGA 1MIWA 5LHGB 4QX8B 1G8XA 5LNKA 3ESLA 3N9MA 2YU1A 2MYSA 4CI2B 4MALA 3AT7A 4AKHA 2V7MA 2DWGA 4ANJA 1YW0A 1D1BA 1ZV4X 2XASB 3Q2MA 5DJQC 5L3DB 3JC6D 2EHOD 5DQVA 4IE6A 2ZM2A 2DLRA 4P09A 4NUUA 1V9DA 2W0GA 3QK6A 5EK4A 3ZYLA 4ASKA 5L2LA 2M67A 2XHEB 2NWBA 4H9PC 3MA9A 4FI5A 4V1Av 4CI1B 5JQGE 3GWHA 5LHHB 2WMOA 4H9RC 1HG5A 2CLYB 3N9NA 1IZNB 1WR6A 3PURA 3ZJ2A 3ETUA 3FBZA 3AA1B 3MJXA 3HI2A 4PJMA 1FMWA 3FB2A 3I9YA 3WSCA 2HPLA 2MOZA 3N9LA 5JDNA 2K24A 4QX7B 4HKAA 4C90A 4DMVA 4ERRA 5HWXA 2IC6A 3ZCJA 3LBXA 2LOSA 4JEHB 2BVLA 4P0AA 4O2BE 5L3BB 5T1DA 2V1DB 3HKDE 3ZYKA 5FP3A 2XAJB 4WBNE 4IHJE 5FXXA 5C8YE 3B13A 5HWYA 5M4YA 5HXCA 2JMKA 2HPJA 3KBUA 4P0BA 3CKDA 1LRZA 3ZPOA 4H63V 3NRYA 3IHRA 3KV9A 2NTXA 3LJCA 2C5KT 5HXSA 1BR4A 3M1CA 2XAHB 5ETWA 2MTQA 3HKEE 2N9DA 4H9QC 4FJOA 4CXWA 4GIWA 1S35A 3H3AA 2E9XB 4U74A 5AFUL 5DABA 2V7IA 2JJ9A 5JDHA 4CXYA 3AAAB 2ODVA 3U78A 3HA4A 4AQFA 2CXDA 4QXBB 1MMAA 2PFVA 3PU3A 5CA1E 4O2AE 3ZJ1A 4KMCA 2LQUA 3C64A 4KUMB 4L9IA 4JUYA 1ZKEA 3LBXB 3AAEB 1MMNA 4OYKA 2CM0A 4CXXA 4BAYB 2NOXA 5JRCB 2X0LB 5BMVE 3ZMSB 4GYSA 5LGUB 5JR9C 3SWHA 2WBLA 2PG8A 4I4TE 1OXZA 2VKJA 3IBPA 2XQYA 4ZI3D 5J2TE 2YK0A 4H9OC 2H3RA 2SPCA 3VJZA 2C5JA 1OWAA 4ZI2D 5FMNA 5L3CB 1G73A 1MNEA 1NAFA 2DHRA 3I9WA 5KMGP 2Q9QA 1HF8A 4I50E 1LVKA 3BQIA 3AVSA 5LGTB 3R6NA 3GA8A 1WYCA 5LGNB 4I55E 5LJNA 1H7CA 3W15B 4CQIA 5J2UE 4ONRA 3EDVA 2LSGA 3GN5B 2A3DA 3E08A 5EZYE 3CQXC 2CXFA 4UVCB 5H6QB 2LJLA 2H7OA 4AQGA 2VB6A 3C98B 3FHNA 4HE8A 4UVBB 5ADXL 3AVRA 4MHCA 3O9XA 2QA7A 2CCQA 3CWZB 3OJAA 4ZI3C 3IEEA 4QWNB 1MIYA 5LBMA 4ZI2C 1IAPA 3RYHE 2XAQB 3AAIA 1LKXA 1HG2A 2JPFA 4AKGA 2GK9A 2KXPB 2K9AA 2VKOA 4CZZB 3ZEFB 4B6XA 2LSIA 4TV9E 4TN7B 4KBMB 4ADZA 2LEHA 3OKQA 4PK4A 2K5BB 2MBGA 4PK5A 3FXDB 4G63A 5DQWA 4X1YE 4F6RC 4NUVA 5KX5E 3N9QA 3DTOA 5FY0A 2UXXB 5LA6E 5JVDE 2PBIA 4EYYR 4IDZA 3GMIA 4U72A 3CMLA 5F3JA 3ZMUB 2J1DG 4UV8B 2A72A 5LOVE 3BQKA 4EYUA 2VASA 4AKIA 3WURA 4BA9A 2RA1A 2H7VC 3N2KE 3AA7B 2L3LA 2VL8A 4O4LE 4XZCA 2EHOA 4PK6A 5E0OA 3EUHA 3UULA 4OFZA 1MMDA 1X79A 3LK3B 5FY7A 3N9PA 3LFMA 4ZS3A 2YEVC 1YKEB 4UF0B 2KMFA 1IJ5A 2V7KA 4M1PA 3UUMA 4DBRA 2X67A 4ZS2A 3C51A 3C50A 2LM9A 4UXNB 2CLYC 5IYZE 3HKBE 3QUJA 1VOMA 3ZMTB 1UCUA 2JMHA 5JH7E 1U4QA 3C4WA 3E22E 4EB6E 1UX4A 3RYFE 2X9XA 5FY1A 4X1IE 4X20E 4O8SA 4O4IE 1WRDA 4GK0E 4BJMA 3F57A 3MXZA 3N2GE 5EK3A 2L8KA 5JDQA 3KDSE 2ODUA 4ZI7E 5HXEA 1EZ3A 2E9XD 5HAXA 4PAGA 2BZBA 3OBVE 3ANWA 4WNKA 3ZN1B 4MLKA 1VRBA 3UT5E 4E7ZA 4IE5A 2LSYA 4AKLA 3UUXB 4K0UA 5F8PA 4EAHA 1BR0A 3I0QA 2VWAA 1QSDA 4PJJA 1KNZA 1D1AA 2IC9A 4UIGA 3WAJA 4J2CA 3ZLIA 4A56A 4PW8A 3ZC0A 3Q5WA 2LHRA 1UX5A 2LE8A 2X51A 4HFVA 5LCYA 3RPUA 4ISTA 4UV9B 3RRCA 4KP3C 4PFOA 1MIVA 3WI3A 3U3IA 4BJNA 1WYBA 1T98A 5JR9A 2E9XC 2PJQA 3AA6B 4WW0A 4UELA 5JDGA 5L3FB 5JDFA 4AXPA 3RRWA 2C0SA 3I1AA 3NZPA 3PHF1 3BK9A 5A1LA 3H37A 3KVBA 3KV5A 4TX5A 3K8PC 1Z0PA 3NZQA 3PU8A 1D0XA 4JEUB 3VKHA 1YKHB 2BVMA 3SRZA 3KFWX 4PFPA 4HEAA 3LK42 3CX8B 4ZOLE 2NW9A 5CB4E 2XAFB 4MBQA 3QC9A 3KBTA 4WBOA 4YJ2E 2KINB 2W61A 2UXNB 2P9BA 3UTKA 3K3NA 2X9YA 1NWMX 2VKDA 4H63H 4G2AA 3UFEA 3ETVA 2CEAA 4EZHA 3O1IA 2WSSV 2Y6XA 4AKRB 3K3OA 2V26A 2Q9QD 5LJMA 3C4ZA 3HKCE 4AQFC 3ZN0B 4EZ4A 5HYAA 2JQQA 4AI6A 1SA0E 3OYXA 2NTYA 4HTEA 2CMRA 3RYCE 2KZ7B 3P8CD 4IE4A 4O4HE 4UEMA 1YD8G 1HFAA 3KVAA 1IJ6A 2W62A 5FXVA 3VKGA 4HN9A 4DO0A 3KV4A 5LP6E 2XAGB 2Y8DA 1QUUA 2X66A 3NBXX 3L09A 4Z8XA 3UUNA 3J7Yq 3NRXA 3Q9DA 5LG4A 1US7B 4PJNA 3TKLB 3RC8A 2Q9QB 3F2EA 1B7TA 2WM9A 4GYRA 2X9HA 2Q9QC 3ZCIA 3ZMVB 3CVRA 4H9SE 2KNDA 2W63A 3M65A 4UVAB 2MTCA 2LOPA 3CPZA 3FXEB 3BQLA 4JLEA 1LVFA 1FEWA 2LSKA 2G0UA 2DI4A 3K3QC 4IIJE 1KK7A 4GOUA 3RYIE 4QXCB 2N1GA 1SHZC 4PNIA 1HX8A 3PUQA 4QKNA 1D1CA 3P7IA 3O1HA 3RH3A 3KINB 3OYZA 3N2OA 2YINA 2LSJA 4ISSA 2KLQA 2ACXA 3D0TA 5JDMA 4ECGA 3RC3A 1E1HB 2WAUA 4L5GA 5FXZA 2NP9A 2KWHA 2JRKA 3O1JA 3SOLA 2XTLA 3N9OA 4OYJA 2HH7A 5FYMA 1HTJF 1HCIA 2WWUA 1BR2A 3V5SA 3VU7H 5TAOA 3V5UA 2BDEA 2I59A 2LT3A 4TUYE 5HXHA 2W00A 5LXTE 2E9XA 3VHLA 1U5PA 2EHOB 3JC6C 5FNVE 2IW5B 5LYJE 2EHOC 4EOZB 2WMNA 3LK2B 4MFRA 3PUSA 3RKOA 3A5XA 4E7SA 4IE7A 4L0RA 1Y64B 5GONE 3KV6A 3HL6A 2DWKA 2E8IA 3PUAA 2ZMAA 3CX6B 2NW8A 4OHFA 3DP7A 4XAXB 5JRCA 1ZEEA 2CA5A 4O4JE 2D0TA 4N78D 2CWYA 3WAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDF A;  5HYA A;  5JDQ A;  3V5U A;  5HWX A;  5JDH A;  5JDG A;  5JDM A;  5HXC A;  5HXE A;  5HXR A;  5HXH A;  5HWY A;  3V5S A;  5HXS A;  5JDL A;  5JDN A; 
#chains in the Genus database with same CATH topology
 5FZT A;  3EDU A;  4EIW A;  2W67 A;  5LBQ B;  4IGU A;  2CE7 A;  2CPT A;  2UXB T;  1SJ7 A;  3IF8 B;  4DND A;  3FZH B;  3AE3 A;  4HFB A;  3PUG A;  2Z6E A;  3AEF A;  3E0Z A;  3CK6 A;  2ES0 A;  2J62 A;  4YJ3 E;  3M3Z B;  4TV8 E;  4GK5 E;  1HS7 A;  2A9U A;  1N36 T;  4IE0 A;  2XUE A;  3RIU C;  2WP9 A;  4ILU A;  2BS3 A;  2ZM8 A;  4YHJ A;  2X9W A;  2X68 A;  4YTP A;  1S94 A;  4TWF A;  3A8Y C;  2ZM0 A;  4XBF B;  5J1G A;  5HCJ A;  4I43 B;  3O4X E;  4UF0 A;  2DNX A;  2XQ6 A;  1D0Z A;  5ABG A;  3MZK B;  2KT9 A;  4BGO A;  2CRB A;  5JDL A;  5LMN T;  4QX8 B;  2MYS A;  4CI2 B;  2BKN A;  3K1S A;  4AKH A;  2BG9 E;  4ANJ A;  4X64 T;  4WZX A;  5DQV A;  4NUU A;  5FL1 A;  2W0G A;  4YSX A;  4NXM T;  5L2L A;  2M67 A;  2NWB A;  2V5D A;  5JQG E;  3UU6 A;  4CI1 B;  5LHH B;  4H9R C;  2CLY B;  2V6Y A;  3N9N A;  3QNU A;  3FBZ A;  2RPA A;  3MJX A;  3N9L A;  5JDN A;  3LBX A;  4LFA T;  4P0A A;  5T1D A;  4WBN E;  2XY8 B;  5C3J A;  5M4Y A;  5ABF B;  2LLY A;  3KBU A;  2XQ7 A;  4HFI A;  4F7G B;  4H63 V;  3RIF A;  3NRY A;  2B76 A;  3M1C A;  1BR4 A;  5ETW A;  3HKE E;  1HNX T;  4NXN T;  2E9X B;  2JJ9 A;  3U78 A;  5IUX A;  3ZMS B;  5JR9 C;  2PG8 A;  2VKJ A;  4H9O C;  2SPC A;  2WZH A;  3TLS A;  1G73 A;  4I50 E;  5LGT B;  3GA8 A;  2BKP A;  5LGN B;  1H7C A;  2UXD T;  4ONR A;  4LF4 T;  3E08 A;  2VUR A;  2H7O A;  3TLW A;  3IEE A;  1MIY A;  1YQ4 A;  2XAQ B;  2JPF A;  1ZP0 A;  4AKG A;  2GK9 A;  2K9A A;  2VQF T;  3ZEF B;  4TV9 E;  4DR3 T;  4TN7 B;  4ADZ A;  2LEH A;  2K5B B;  1UUS A;  5KX5 E;  4F6R C;  4NUV A;  1JNR A;  3DTO A;  2PBI A;  4IDZ A;  4U72 A;  2J1D G;  4EYU A;  2A72 A;  2VAS A;  3WUR A;  2PTF A;  2RA1 A;  2XM2 A;  5E0O A;  4XZC A;  3EUH A;  1X79 A;  3LFM A;  1IJ5 A;  3UUM A;  2X67 A;  3EHZ A;  4ZS2 A;  3C51 A;  4UXN B;  3AXJ A;  1VOM A;  4DV7 T;  3RGL A;  5AQU B;  3E22 E;  3C4W A;  2LM2 A;  2X9X A;  5FY1 A;  4X20 E;  4O4I E;  4BJM A;  3MXZ A;  3N2G E;  5AQP B;  5JDQ A;  4ZI7 E;  2E9X D;  1I6Z A;  3OBV E;  3ZN1 B;  4MLK A;  5CFB A;  4AKL A;  2LSY A;  2WDQ A;  4EAH A;  1QSD A;  4PJJ A;  1D1A A;  4DR2 T;  3WAJ A;  4J2C A;  3ZLI A;  4A56 A;  2H88 A;  2X51 A;  4HFV A;  1J5W A;  4IST A;  1MIV A;  3B5M A;  3FYQ A;  4UEL A;  5JDG A;  4AXP A;  3AE8 A;  5F5W A;  3RIU A;  3AEE A;  4DR5 T;  5J0Z A;  1YKH B;  3SRZ A;  3CX8 B;  2NW9 A;  2XAF B;  4MBQ A;  2FJE A;  2IHR 1;  2KIN B;  2WY2 A;  2P9B A;  3K3N A;  2X9Y A;  1NWM X;  4TNW A;  5HEJ A;  4EZH A;  3K3O A;  2Q9Q D;  4AQF C;  2JQQ A;  3OYX A;  4UEM A;  4HWF A;  2W62 A;  3PV0 F;  3VKG A;  3EI0 A;  2XAG B;  2Y8D A;  3L09 A;  3J7Y q;  3RQU A;  5LG4 A;  4IL4 A;  3TKL B;  1B7T A;  4GYR A;  3UU3 A;  2MTC A;  2LOP A;  3VRB A;  1XMQ T;  2DI4 A;  4CN1 A;  1E2A A;  4QKN A;  3QB5 A;  3N2O A;  4ISS A;  3ZT5 A;  5JDM A;  4X66 T;  2FJA A;  3OVU A;  3O1J A;  1HTJ F;  1HCI A;  2I59 A;  2LT3 A;  5HXH A;  1KNP A;  5LXT E;  2E9X A;  3VHL A;  4Z91 A;  5FNV E;  2L7N A;  5LYJ E;  4COF A;  2WMN A;  4DUY T;  4L0R A;  5GON E;  3HL6 A;  2DWK A;  4DR4 T;  3CX6 B;  2W2U A;  2UUC T;  1ZEE A;  3AE9 A;  4O4J E;  2D0T A;  2CWY A;  3WAK A;  3S4U A;  2UU9 T;  2RP4 A;  5AQF B;  2VL0 A;  5LHI B;  2IAK A;  1WR0 A;  3N5L A;  2UXC T;  3SS1 A;  4HWH A;  4IL9 A;  4DMW A;  4LFC T;  2V7L A;  1W0A A;  2VKH A;  4DVD A;  5AQQ B;  1OED C;  4U33 A;  2LHN A;  5H6R B;  3RX6 A;  2OA5 A;  2QGS A;  3CQG B;  2M6I A;  3AA0 B;  2Y48 B;  2NW7 A;  2KWI B;  4A97 A;  4QH4 A;  2JQH A;  4OK0 A;  2C5I T;  1CUN A;  1Z8U A;  5FVL A;  3FBL A;  3PF0 A;  4TZ4 C;  5CA0 E;  1O3X A;  4QH5 A;  1HNW T;  2BBJ A;  4EXT A;  5JRE A;  1VCS A;  1FMV A;  2D0U A;  1ZHC A;  4EEB A;  4YT0 A;  1MMG A;  5LHG B;  5LNK A;  3ESL A;  4IRE A;  4MAL A;  2DWG A;  1D1B A;  2XAS B;  5DJQ C;  1I94 T;  2IUB A;  3FZM B;  2FBW A;  3ZYL A;  2OV9 A;  3FZF B;  4Z90 A;  3GWH A;  2WMO A;  5FL0 A;  1IZN B;  1WR6 A;  5LB7 B;  4LF8 T;  2MOZ A;  2K24 A;  4C90 A;  3VRA A;  4B3R T;  2LOS A;  4YY3 T;  2BVL A;  4O2B E;  2W66 A;  3HKD E;  3ZYK A;  2XAJ B;  2YOE A;  2HPJ A;  3ZPO A;  3KV9 A;  3LJC A;  1IBM T;  2XAH B;  3TLU A;  4H9Q C;  4CXW A;  4GIW A;  1XMO T;  4AQF A;  2PFV A;  3PU3 A;  4O2A E;  2CBJ A;  2LQU A;  3C64 A;  4KUM B;  4L9I A;  4JUY A;  1VCT A;  2CM0 A;  4BAY B;  1XDO A;  3IBP A;  4ZZC A;  5J2T E;  2C5J A;  4ZI2 D;  1MNE A;  1NAF A;  3R6N A;  1WYC A;  2WDV A;  4ZXL A;  5J2U E;  2LSG A;  2A3D A;  5EZY E;  2CXF A;  5H6Q B;  4AQG A;  4YXD A;  5ADX L;  3AE6 A;  2QA7 A;  2L10 A;  4X62 T;  4QWN B;  5L47 A;  1IAP A;  1LKX A;  1XWM A;  2E5V A;  4CZZ B;  4B6X A;  2LSI A;  4KBM B;  3OKQ A;  2MBG A;  4PK5 A;  2FJB A;  4G63 A;  5DQW A;  4X1Y E;  2UXX B;  3RKG A;  5JVD E;  4JI0 T;  3GMI A;  5F3J A;  3ZMU B;  1E7P A;  4B3M T;  5LOV E;  4W8P A;  3BQK A;  4AKI A;  2H7V C;  1NEN A;  2VL8 A;  4PK6 A;  3UUL A;  1SE7 A;  4ZS3 A;  1YKE B;  3PUX F;  4CN6 A;  1W9R A;  4DBR A;  4LF9 T;  3RLF F;  1J1J A;  4U31 A;  2CLY C;  1XZY A;  5AQR B;  3ZSS A;  4EB6 E;  1UX4 A;  3RYF E;  5EK3 A;  2L8K A;  3KDS E;  2J47 A;  1EZ3 A;  5HAX A;  3PJA J;  2BZB A;  4WNK A;  1VRB A;  2K3W A;  3UT5 E;  4IE5 A;  1BR0 A;  3UUX B;  5F8P A;  2D9D A;  2VWA A;  1KNZ A;  1CHU A;  2IML A;  3FZK B;  4JI6 T;  3ZC0 A;  1OED A;  2LHR A;  3RRC A;  3WI3 A;  2X0Y A;  2E9X C;  4WW0 A;  3NZP A;  3PU8 A;  3NZQ A;  1D0X A;  3VKH A;  2E5L T;  2BVM A;  4DV5 T;  5CB4 E;  3QC9 A;  3RHW A;  4U7I A;  3KBT A;  5L4H A;  4JI8 T;  2W61 A;  1W09 A;  3SFE A;  2VKD A;  3UFE A;  4TWD A;  5AQL B;  2WCA A;  3ZN0 B;  5HYA A;  2BS2 A;  1SA0 E;  3RYC E;  3P8C D;  4IE4 A;  2BG9 B;  3KVA A;  4AIS A;  3H3M A;  4HN9 A;  4GKJ T;  1DU2 A;  3NBX X;  3Q9D A;  1M62 A;  4PJN A;  3UU4 A;  2Q9Q B;  2Q9Q C;  3ZMV B;  4H9S E;  2LRL A;  3Q5E A;  3PUW F;  4DR1 T;  1LVF A;  1FEW A;  4DR7 T;  3G06 A;  3RIA A;  2G0U A;  4U7Y A;  3X1D A;  3RYI E;  4PNI A;  3JAF A;  2R6G F;  3UFG A;  5AQI B;  5AQO B;  3P7I A;  3RH3 A;  2LSJ A;  3D0T A;  3RC3 A;  2WAU A;  4U2Y A;  2NP9 A;  4IT4 A;  3SOL A;  3N9O A;  1WCR A;  3V5S A;  5TAO A;  4TUY E;  2W00 A;  5L4E A;  1U5P A;  2IW5 B;  4MFR A;  5AQG B;  3RKO A;  3A5X A;  4E7S A;  2XQ5 A;  2E8I A;  2ZMA A;  2NW8 A;  4OHF A;  4XAX B;  2FJD A;  2M6B A;  4P1N A;  2YDR A;  1SUM B;  2K48 A;  4DV2 T;  2VK9 A;  2XQ4 A;  3ZKR A;  4LML A;  3PTR B;  2X0C A;  4EV6 A;  1KF6 A;  5ABE A;  3F31 A;  3ANW B;  2DCF A;  3R84 B;  4HGA A;  5IHY A;  5BR8 T;  5L3E B;  2JQK A;  3PE0 A;  2MAW A;  2XQ3 A;  4YFS A;  3OPC A;  3AED A;  3ONX A;  1SJ8 A;  3CQC B;  4QXH B;  1X9B A;  3I0O A;  4HFE A;  1M7K A;  2B1E A;  4LFB T;  1FIO A;  4X1K E;  1HNZ T;  5EK2 A;  3T8O A;  5L3G B;  2N2N A;  5C2T A;  4ZZB A;  3DJB A;  3MAC A;  3HR0 A;  2D5U A;  1MND A;  3EVY A;  3PDY A;  4QHO A;  4F8H A;  1FJG T;  1OED E;  2L9Q A;  2VQE T;  3LG7 A;  4ZHQ E;  2DL1 A;  2V5C A;  3QB5 K;  1G8X A;  3AEB A;  2YN6 A;  2YU1 A;  4DV0 T;  1ZV4 X;  3Q2M A;  4HFD A;  1QLB A;  4IE6 A;  2ZM2 A;  2DLR A;  1XNR T;  5ABF A;  5IWA T;  3MA9 A;  4V1A v;  4LF5 T;  4IDP A;  2WU5 A;  1HG5 A;  2I0M A;  1UUR A;  1HX1 B;  3P4Q A;  3ZJ2 A;  3AA1 B;  4EGW A;  3FB2 A;  3WSC A;  1Y01 A;  3JCF A;  4QX7 B;  4DMV A;  4ERR A;  2IC6 A;  3ZCJ A;  5L3B B;  4IHJ E;  5FXX A;  1KEY A;  5HWY A;  3CKD A;  4DV1 T;  2C5K T;  3P4R A;  4NPP A;  2MTQ A;  2N9D A;  4FJO A;  3H3A A;  5AFU L;  5DAB A;  5JDH A;  3AAA B;  2ODV A;  3AE5 A;  1MMA A;  3LBX B;  3P50 A;  2KGX A;  4OYK A;  4HWD A;  2NOX A;  2BG9 A;  5BMV E;  4GYS A;  4NIQ A;  1IBK T;  2XPK A;  1OXZ A;  4HWI B;  4ZI3 D;  3VJZ A;  1OWA A;  5FMN A;  5L3C B;  2DHR A;  2E2A A;  2Q9Q A;  3BQI A;  3AVS A;  2LKH A;  4I55 E;  2MPK A;  5LJN A;  3ABV A;  2W4X A;  4B3S T;  3GN5 B;  2AXD S;  2WQY A;  2VB6 A;  3C98 B;  4HE8 A;  3O9X A;  2CCQ A;  3CWZ B;  3OJA A;  4ZI2 C;  3RYH E;  3AAI A;  1HG2 A;  2HN2 A;  2XQ8 A;  3IA3 A;  5AQT B;  5FY0 A;  5LA6 E;  3SFD A;  4KX6 A;  4EYY R;  3P4S A;  4UV8 B;  3PUZ F;  4A5X A;  1J5E T;  5FVK A;  4O4L E;  4OFZ A;  4UR9 A;  3LK3 B;  3N9P A;  2YEV C;  5ABH A;  4HFC A;  4M1P A;  5CGM A;  2LM9 A;  3HKB E;  3ZMT B;  1UCU A;  3FZL B;  1U4Q A;  4X1I E;  1WRD A;  4GK0 E;  3F57 A;  4B3T T;  4JI1 T;  2ODU A;  3AE2 A;  5HXE A;  2XSA A;  3OTO T;  4PAG A;  3ANW A;  1T7S A;  4AIU A;  4K0U A;  3I0Q A;  4JBW F;  5AQM B;  4GKK T;  3DYJ A;  3UQ4 A;  1UGO A;  3Q5W A;  1UX5 A;  5LCY A;  3RPU A;  4UV9 B;  4KP3 C;  4PFO A;  4BJN A;  1WYB A;  1T98 A;  2PJQ A;  2JIW A;  1XDP A;  4DV3 T;  3I1A A;  3PHF 1;  3KVB A;  3K8P C;  2FUP A;  4IDN A;  1Z0P A;  2OLT A;  4JEU B;  4YTM A;  4IDQ A;  4PFP A;  4HEA A;  3RI5 A;  3LK4 2;  2LRK A;  4YJ2 E;  2UUA T;  1UK5 A;  2CBI A;  2XSB A;  3ETV A;  3AEA A;  2CEA A;  3O1I A;  4U3C A;  2Y6X A;  3T1Y T;  2V26 A;  4LF6 T;  5LJM A;  1YXR A;  3HKC E;  4EZ4 A;  4ILA A;  4AI6 A;  1N33 T;  2KBB A;  2NTY A;  4OX9 T;  2I6H A;  4YHH T;  5KXJ A;  3VR8 A;  4LMJ A;  1IJ6 A;  4JI3 T;  4HWC A;  2LKG A;  5FXV A;  4DO0 A;  4AQY T;  5LP6 E;  3AE4 A;  3UUN A;  4Z8X A;  3NRX A;  3RC8 A;  3F2E A;  4X5T A;  2WS3 A;  3ZCI A;  3CVR A;  2KND A;  2W63 A;  3CPZ A;  3BQL A;  4JLE A;  2LSK A;  2NR4 A;  3K3Q C;  3LDQ B;  4GOU A;  4QXC B;  4DV6 T;  2N1G A;  3LSV A;  1D1C A;  4JI2 T;  4DUZ T;  3KIN B;  3OYZ A;  4DR6 T;  2XQA A;  3PUV F;  5FXZ A;  4L5G A;  2KWH A;  4OYJ A;  2HH7 A;  5FKY A;  2YKS A;  2BDE A;  3ONL C;  4KHP T;  2WB5 A;  2CHO A;  5LG3 A;  2EHO B;  3JC6 C;  2EHO C;  3NVO A;  1Y64 B;  3PUA A;  4TWH A;  4A98 A;  3AY5 A;  3NWI A;  3QUJ A;  3Q5X A;  4JYA T;  1D0Y A;  3CX7 B;  3TLT A;  3ZT7 A;  2YU2 A;  3L3P A;  3AB3 B;  3Q5D A;  2V7J A;  3C4X A;  4WYV A;  2KSR A;  3GN5 A;  3MK7 C;  4LF7 T;  3J9X 1;  4JI7 T;  3ONJ A;  4H9N C;  4ILB A;  4YLH A;  5JR9 B;  4KHZ F;  2D2S A;  3ZYM A;  1WLX A;  2CWO A;  3ZC1 A;  4ZEY A;  5FXW A;  1AJ3 A;  1BR1 A;  2BG9 C;  5KDM C;  3AE1 A;  1N32 T;  2CXL A;  2ACZ A;  5HEU A;  4YSY A;  2ZLY A;  4DBQ A;  3B57 A;  4CI3 B;  3ZMZ B;  3MKD A;  3NKZ A;  5CJ5 A;  4YSZ A;  4PJL A;  5HXR A;  4C91 A;  2A2F X;  4I0U A;  2WU2 A;  1MIW A;  2ZM6 T;  3EAB A;  3N9M A;  3AT7 A;  3P4P A;  2AE9 A;  2V7M A;  1YW0 A;  5L3D B;  3JC6 D;  4K0K T;  2EHO D;  4P09 A;  1V9D A;  3QK6 A;  5EK4 A;  4ASK A;  2BS4 A;  4CN4 A;  2XHE B;  5AQK B;  2HN1 A;  4H9P C;  4FI5 A;  5AQJ B;  3A7M A;  1T72 A;  4YTN A;  3PUR A;  3ETU A;  5HEO A;  3HI2 A;  4PJM A;  1FMW A;  3I9Y A;  2HPL A;  5LMU T;  4HKA A;  5HWX A;  1XNQ T;  4ILC A;  1KNR A;  4JEH B;  2V1D B;  5C8Y E;  5FP3 A;  1JNZ A;  3B13 A;  5AQS B;  5HXC A;  2JMK A;  4JI5 T;  2X0H A;  4P0B A;  1LRZ A;  3IHR A;  2NTX A;  3RF1 A;  5HXS A;  1S35 A;  3RQW A;  4U74 A;  2V7I A;  4CXY A;  3HA4 A;  2CXD A;  4QXB B;  2YDQ A;  5CA1 E;  1N34 T;  5AQH B;  2VVN A;  3ZJ1 A;  4KMC A;  1ZKE A;  3AAE B;  1YQ3 A;  1MMN A;  4CXX A;  5JRC B;  2X0L B;  3ZST A;  4KI0 F;  2WWV A;  2BBH A;  5LGU B;  4HFH A;  3SWH A;  2WBL A;  4I4T E;  2XQY A;  2YK0 A;  2H3R A;  3AEC A;  3I9W A;  5KMG P;  1HF8 A;  1LVK A;  1NEK A;  3AEG A;  3W15 B;  4CQI A;  3UQ7 A;  3EDV A;  2XJ7 A;  2V6X A;  2QYW A;  3CQX C;  4UVC B;  2LJL A;  1R8I A;  3FHN A;  4UVB B;  3AVR A;  4MHC A;  4ZI3 C;  2XM1 A;  5LBM A;  2XQ9 A;  5HEH A;  2KXP B;  2VKO A;  2QVA A;  4JI4 T;  4PK4 A;  3FXD B;  4LMK A;  3ZT6 A;  3N9Q A;  2XZE A;  3CML A;  2CHN A;  3AE7 A;  4BA9 A;  3P4W A;  3N2K E;  2IIU A;  3AA7 B;  2L3L A;  3CIR A;  2EHO A;  3L39 A;  1L0V A;  1MMD A;  5FY7 A;  2WDR A;  4UF0 B;  2KMF A;  2V7K A;  3JAE A;  2IDO B;  1T8B A;  1W0B A;  3C50 A;  1ZOY A;  5IYZ E;  2JQ9 A;  2JMH A;  5JH7 E;  2HHH T;  4O8S A;  3QOF A;  4TNV A;  2H89 A;  5HCM A;  2J4G A;  3VR9 A;  4E7Z A;  2IC9 A;  4UIG A;  4PW8 A;  5AQN B;  1WFD A;  1KFY A;  2LE8 A;  2V6Y B;  3U3I A;  4X65 T;  4JV5 T;  5JR9 A;  3T1H T;  3AA6 B;  5L3F B;  5JDF A;  3RRW A;  2C0S A;  3PUY F;  3BK9 A;  5A1L A;  3H37 A;  3KV5 A;  4TX5 A;  4U2Z A;  4DID B;  2WZI A;  3KFW X;  3JAD A;  2KVP A;  4EED A;  4ZOL E;  1GQE A;  4WBO A;  2UXN B;  3UTK A;  1OED B;  4H63 H;  4G2A A;  2BKO A;  5HEG A;  2WSS V;  5AQV B;  4AKR B;  3C4Z A;  2VVS A;  4HTE A;  2CMR A;  2KZ7 B;  4O4H E;  1YD8 G;  1HFA A;  3UUB A;  3KV4 A;  4IDO A;  2UUB T;  1QUU A;  2X66 A;  1US7 B;  2WM9 A;  4QH1 A;  2X9H A;  3M65 A;  4UVA B;  3L8R A;  3FXE B;  1HR0 T;  2YDS A;  4IIJ E;  1KK7 A;  1SHZ C;  1HX8 A;  3PUQ A;  3O1H A;  5JTG A;  1IBL T;  2YIN A;  2KLQ A;  2ACX A;  2V8S V;  4ECG A;  1E1H B;  3PJA A;  4DV4 T;  2JRK A;  3EAM A;  2XTL A;  5FYM A;  3TLV A;  2WWU A;  1BR2 A;  3VU7 H;  3V5U A;  3UU8 A;  4EOZ B;  3LK2 B;  3PUS A;  3UU5 A;  4IE7 A;  3KV6 A;  4Q25 A;  2QRX A;  3DP7 A;  3AXJ B;  5JRC A;  2CA5 A;  2F4V T;  4N78 D; 
#chains in the Genus database with same CATH homology
 3Q5X A;  3S4U A;  2K48 A;  2RP4 A;  1D0Y A;  2VK9 A;  5LHI B;  3CX7 B;  3EDU A;  4EIW A;  5LBQ B;  2YU2 A;  3L3P A;  2IAK A;  3PTR B;  4IGU A;  3N5L A;  3AB3 B;  3SS1 A;  3F31 A;  3ANW B;  2CE7 A;  2DCF A;  3R84 B;  2V7J A;  3C4X A;  4HGA A;  4DMW A;  5IHY A;  3GN5 A;  3MK7 C;  5L3E B;  2V7L A;  3IF8 B;  3PE0 A;  3J9X 1;  4DND A;  2VKH A;  4YFS A;  4DVD A;  3ONX A;  3PUG A;  3CQC B;  2LHN A;  4QXH B;  2Z6E A;  4H9N C;  4YLH A;  3I0O A;  5H6R B;  3E0Z A;  5JR9 B;  2ES0 A;  4YJ3 E;  3RX6 A;  2B1E A;  2OA5 A;  2QGS A;  2D2S A;  3CQG B;  4TV8 E;  1FIO A;  3AA0 B;  4GK5 E;  2Y48 B;  3ZYM A;  1WLX A;  2KWI B;  2NW7 A;  1HS7 A;  2CWO A;  3ZC1 A;  4X1K E;  5FXW A;  4IE0 A;  2XUE A;  5EK2 A;  3T8O A;  5L3G B;  1AJ3 A;  1BR1 A;  4OK0 A;  2C5I T;  2N2N A;  1CUN A;  4ILU A;  5KDM C;  3FBL A;  3DJB A;  3PF0 A;  2CXL A;  2ZM8 A;  4YHJ A;  2X9W A;  2X68 A;  4TZ4 C;  1S94 A;  3HR0 A;  2D5U A;  1MND A;  3EVY A;  3MAC A;  2ZLY A;  3PDY A;  4QHO A;  5CA0 E;  1O3X A;  4DBQ A;  3B57 A;  4CI3 B;  2ZM0 A;  4XBF B;  5J1G A;  3ZMZ B;  3MKD A;  4EXT A;  4I43 B;  3O4X E;  2L9Q A;  4UF0 A;  2DNX A;  3LG7 A;  5JRE A;  1D0Z A;  4PJL A;  5HXR A;  4ZHQ E;  3MZK B;  4C91 A;  2KT9 A;  2A2F X;  1FMV A;  4BGO A;  2D0U A;  1ZHC A;  5JDL A;  1MMG A;  1MIW A;  5LHG B;  4QX8 B;  1G8X A;  5LNK A;  3ESL A;  3N9M A;  2YU1 A;  2MYS A;  4CI2 B;  4MAL A;  3AT7 A;  4AKH A;  2V7M A;  2DWG A;  4ANJ A;  1YW0 A;  1D1B A;  1ZV4 X;  2XAS B;  3Q2M A;  5DJQ C;  5L3D B;  3JC6 D;  2EHO D;  5DQV A;  4IE6 A;  2ZM2 A;  2DLR A;  4P09 A;  4NUU A;  1V9D A;  2W0G A;  3QK6 A;  5EK4 A;  3ZYL A;  4ASK A;  5L2L A;  2M67 A;  2XHE B;  2NWB A;  4H9P C;  3MA9 A;  4FI5 A;  4V1A v;  4CI1 B;  5JQG E;  3GWH A;  5LHH B;  2WMO A;  4H9R C;  1HG5 A;  2CLY B;  3N9N A;  1IZN B;  1WR6 A;  3PUR A;  3ZJ2 A;  3ETU A;  3FBZ A;  3AA1 B;  3MJX A;  3HI2 A;  4PJM A;  1FMW A;  3FB2 A;  3I9Y A;  3WSC A;  2HPL A;  2MOZ A;  3N9L A;  5JDN A;  2K24 A;  4QX7 B;  4HKA A;  4C90 A;  4DMV A;  4ERR A;  5HWX A;  2IC6 A;  3ZCJ A;  3LBX A;  2LOS A;  4JEH B;  2BVL A;  4P0A A;  4O2B E;  5L3B B;  5T1D A;  2V1D B;  3HKD E;  3ZYK A;  5FP3 A;  2XAJ B;  4WBN E;  4IHJ E;  5FXX A;  5C8Y E;  3B13 A;  5HWY A;  5M4Y A;  5HXC A;  2JMK A;  2HPJ A;  3KBU A;  4P0B A;  3CKD A;  1LRZ A;  3ZPO A;  4H63 V;  3NRY A;  3IHR A;  3KV9 A;  2NTX A;  3LJC A;  2C5K T;  5HXS A;  1BR4 A;  3M1C A;  2XAH B;  5ETW A;  2MTQ A;  3HKE E;  2N9D A;  4H9Q C;  4FJO A;  4CXW A;  4GIW A;  1S35 A;  3H3A A;  2E9X B;  4U74 A;  5AFU L;  5DAB A;  2V7I A;  2JJ9 A;  5JDH A;  4CXY A;  3AAA B;  2ODV A;  3U78 A;  3HA4 A;  4AQF A;  2CXD A;  4QXB B;  1MMA A;  2PFV A;  3PU3 A;  5CA1 E;  4O2A E;  3ZJ1 A;  4KMC A;  2LQU A;  3C64 A;  4KUM B;  4L9I A;  4JUY A;  1ZKE A;  3LBX B;  3AAE B;  1MMN A;  4OYK A;  2CM0 A;  4CXX A;  4BAY B;  2NOX A;  5JRC B;  2X0L B;  5BMV E;  3ZMS B;  4GYS A;  5LGU B;  5JR9 C;  3SWH A;  2WBL A;  2PG8 A;  4I4T E;  1OXZ A;  2VKJ A;  3IBP A;  2XQY A;  4ZI3 D;  5J2T E;  2YK0 A;  4H9O C;  2H3R A;  2SPC A;  3VJZ A;  2C5J A;  1OWA A;  4ZI2 D;  5FMN A;  5L3C B;  1G73 A;  1MNE A;  1NAF A;  2DHR A;  3I9W A;  5KMG P;  2Q9Q A;  1HF8 A;  4I50 E;  1LVK A;  3BQI A;  3AVS A;  5LGT B;  3R6N A;  3GA8 A;  1WYC A;  5LGN B;  4I55 E;  5LJN A;  1H7C A;  3W15 B;  4CQI A;  5J2U E;  4ONR A;  3EDV A;  2LSG A;  3GN5 B;  2A3D A;  3E08 A;  5EZY E;  3CQX C;  2CXF A;  4UVC B;  5H6Q B;  2LJL A;  2H7O A;  4AQG A;  2VB6 A;  3C98 B;  3FHN A;  4HE8 A;  4UVB B;  5ADX L;  3AVR A;  4MHC A;  3O9X A;  2QA7 A;  2CCQ A;  3CWZ B;  3OJA A;  4ZI3 C;  3IEE A;  4QWN B;  1MIY A;  5LBM A;  4ZI2 C;  1IAP A;  3RYH E;  2XAQ B;  3AAI A;  1LKX A;  1HG2 A;  2JPF A;  4AKG A;  2GK9 A;  2KXP B;  2K9A A;  2VKO A;  4CZZ B;  3ZEF B;  4B6X A;  2LSI A;  4TV9 E;  4TN7 B;  4KBM B;  4ADZ A;  2LEH A;  3OKQ A;  4PK4 A;  2K5B B;  2MBG A;  4PK5 A;  3FXD B;  4G63 A;  5DQW A;  4X1Y E;  4F6R C;  4NUV A;  5KX5 E;  3N9Q A;  3DTO A;  5FY0 A;  2UXX B;  5LA6 E;  5JVD E;  2PBI A;  4EYY R;  4IDZ A;  3GMI A;  4U72 A;  3CML A;  5F3J A;  3ZMU B;  2J1D G;  4UV8 B;  2A72 A;  5LOV E;  3BQK A;  4EYU A;  2VAS A;  4AKI A;  3WUR A;  4BA9 A;  2RA1 A;  2H7V C;  3N2K E;  3AA7 B;  2L3L A;  2VL8 A;  4O4L E;  4XZC A;  2EHO A;  4PK6 A;  5E0O A;  3EUH A;  3UUL A;  4OFZ A;  1MMD A;  1X79 A;  3LK3 B;  5FY7 A;  3N9P A;  3LFM A;  4ZS3 A;  2YEV C;  1YKE B;  4UF0 B;  2KMF A;  1IJ5 A;  2V7K A;  4M1P A;  3UUM A;  4DBR A;  2X67 A;  4ZS2 A;  3C51 A;  3C50 A;  2LM9 A;  4UXN B;  2CLY C;  5IYZ E;  3HKB E;  3QUJ A;  1VOM A;  3ZMT B;  1UCU A;  2JMH A;  5JH7 E;  1U4Q A;  3C4W A;  3E22 E;  4EB6 E;  1UX4 A;  3RYF E;  2X9X A;  5FY1 A;  4X1I E;  4X20 E;  4O8S A;  4O4I E;  1WRD A;  4GK0 E;  4BJM A;  3F57 A;  3MXZ A;  3N2G E;  5EK3 A;  2L8K A;  5JDQ A;  3KDS E;  2ODU A;  4ZI7 E;  5HXE A;  1EZ3 A;  2E9X D;  5HAX A;  4PAG A;  2BZB A;  3OBV E;  3ANW A;  4WNK A;  3ZN1 B;  4MLK A;  1VRB A;  3UT5 E;  4E7Z A;  4IE5 A;  2LSY A;  4AKL A;  3UUX B;  4K0U A;  5F8P A;  4EAH A;  1BR0 A;  3I0Q A;  2VWA A;  1QSD A;  4PJJ A;  1KNZ A;  1D1A A;  2IC9 A;  4UIG A;  3WAJ A;  4J2C A;  3ZLI A;  4A56 A;  4PW8 A;  3ZC0 A;  3Q5W A;  2LHR A;  1UX5 A;  2LE8 A;  2X51 A;  4HFV A;  5LCY A;  3RPU A;  4IST A;  4UV9 B;  3RRC A;  4KP3 C;  4PFO A;  1MIV A;  3WI3 A;  3U3I A;  4BJN A;  1WYB A;  1T98 A;  5JR9 A;  2E9X C;  2PJQ A;  3AA6 B;  4WW0 A;  4UEL A;  5JDG A;  5L3F B;  5JDF A;  4AXP A;  3RRW A;  2C0S A;  3I1A A;  3NZP A;  3PHF 1;  3BK9 A;  5A1L A;  3H37 A;  3KVB A;  3KV5 A;  4TX5 A;  3K8P C;  1Z0P A;  3NZQ A;  3PU8 A;  1D0X A;  4JEU B;  3VKH A;  1YKH B;  2BVM A;  3SRZ A;  3KFW X;  4PFP A;  4HEA A;  3LK4 2;  3CX8 B;  4ZOL E;  2NW9 A;  5CB4 E;  2XAF B;  4MBQ A;  3QC9 A;  3KBT A;  4WBO A;  4YJ2 E;  2KIN B;  2W61 A;  2UXN B;  2P9B A;  3UTK A;  3K3N A;  2X9Y A;  1NWM X;  2VKD A;  4H63 H;  4G2A A;  3UFE A;  3ETV A;  2CEA A;  4EZH A;  3O1I A;  2WSS V;  2Y6X A;  4AKR B;  3K3O A;  2V26 A;  2Q9Q D;  5LJM A;  3C4Z A;  3HKC E;  4AQF C;  3ZN0 B;  4EZ4 A;  5HYA A;  2JQQ A;  4AI6 A;  1SA0 E;  3OYX A;  2NTY A;  4HTE A;  2CMR A;  3RYC E;  2KZ7 B;  3P8C D;  4IE4 A;  4O4H E;  4UEM A;  1YD8 G;  1HFA A;  3KVA A;  1IJ6 A;  2W62 A;  5FXV A;  3VKG A;  4HN9 A;  4DO0 A;  3KV4 A;  5LP6 E;  2XAG B;  2Y8D A;  1QUU A;  2X66 A;  3NBX X;  3L09 A;  4Z8X A;  3UUN A;  3J7Y q;  3NRX A;  3Q9D A;  5LG4 A;  1US7 B;  4PJN A;  3TKL B;  3RC8 A;  2Q9Q B;  3F2E A;  1B7T A;  2WM9 A;  4GYR A;  2X9H A;  2Q9Q C;  3ZCI A;  3ZMV B;  3CVR A;  4H9S E;  2KND A;  2W63 A;  3M65 A;  4UVA B;  2MTC A;  2LOP A;  3CPZ A;  3FXE B;  3BQL A;  4JLE A;  1LVF A;  1FEW A;  2LSK A;  2G0U A;  2DI4 A;  3K3Q C;  4IIJ E;  1KK7 A;  4GOU A;  3RYI E;  4QXC B;  2N1G A;  1SHZ C;  4PNI A;  1HX8 A;  3PUQ A;  4QKN A;  1D1C A;  3P7I A;  3O1H A;  3RH3 A;  3KIN B;  3OYZ A;  3N2O A;  2YIN A;  2LSJ A;  4ISS A;  2KLQ A;  2ACX A;  3D0T A;  5JDM A;  4ECG A;  3RC3 A;  1E1H B;  2WAU A;  4L5G A;  5FXZ A;  2NP9 A;  2KWH A;  2JRK A;  3O1J A;  3SOL A;  2XTL A;  3N9O A;  4OYJ A;  2HH7 A;  5FYM A;  1HTJ F;  1HCI A;  2WWU A;  1BR2 A;  3V5S A;  3VU7 H;  5TAO A;  3V5U A;  2BDE A;  2I59 A;  2LT3 A;  4TUY E;  5HXH A;  2W00 A;  5LXT E;  2E9X A;  3VHL A;  1U5P A;  2EHO B;  3JC6 C;  5FNV E;  2IW5 B;  5LYJ E;  2EHO C;  4EOZ B;  2WMN A;  3LK2 B;  4MFR A;  3PUS A;  3RKO A;  3A5X A;  4E7S A;  4IE7 A;  4L0R A;  1Y64 B;  5GON E;  3KV6 A;  3HL6 A;  2DWK A;  2E8I A;  3PUA A;  2ZMA A;  3CX6 B;  2NW8 A;  4OHF A;  3DP7 A;  4XAX B;  5JRC A;  1ZEE A;  2CA5 A;  4O4J E;  2D0T A;  4N78 D;  2CWY A;  3WAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...