5JDNA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 10 mm na+ and 10mm sr2+
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
301
structure length
297
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
molecule keywords sodium-calcium exchanger NCX_Mj
total genus 130
structure length 297
sequence length 301
ec nomenclature
pdb deposition date 2016-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdnA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdnA02
5HXHA 3V5UA 5JDHA 5JDFA 5HXRA 5HXSA 5HXCA 5HYAA 5HWXA 5HXEA 5JDLA 5JDQA 5JDNA 5JDMA 5JDGA 3V5SA 5HWYA
chains in the Genus database with same CATH superfamily
1UGOA 2WCAA 4LF7T 3ZMTB 1IJ6A 3K3QC 4JBWF 4K0UA 2BDEA 4KP3C 3RYIE 4IE7A 4DUZT 4CN6A 3Q5EA 2UUCT 1WCRA 2E9XC 2FUPA 3JC6D 4ASKA 5ADXL 2WMOA 3ZMVB 1W0BA 5HXHA 4FJOA 4X1IE 4H9OC 3LDQB 1J5WA 3PUYF 2QA7A 4ERRA 5LA6E 3DYJA 4Z91A 1SUMB 2XZEA 4OYJA 5AQQB 2UU9T 1IBMT 4AKHA 1WYCA 2VQET 1IZNB 2KNDA 2N1GA 2M67A 2WY2A 3AECA 2HPJA 3MA9A 2I59A 4PJJA 4QX8B 2K5BB 4YHJA 5DQVA 3VU7H 2H3RA 2LSYA 2SPCA 2XQ3A 3OBVE 5CA1E 3ANWB 4ZHQE 3I9WA 3RIUA 3CX7B 2WBLA 3UU5A 3KV6A 2LT3A 1E1HB 3RLFF 4BAYB 4WBNE 4WZXA 4IHJE 3D0TA 3PV0F 5HXEA 4HEAA 4MFRA 2XQ8A 3VRBA 4IDOA 1B7TA 3OVUA 3ZLIA 3ZYMA 5JDGA 5LGTB 2V7LA 3P8CD 4AKIA 4QXBB 3MKDA 2X9XA 3PU3A 2V6YA 3BK9A 3BQKA 1FEWA 3O1IA 3ZN0B 3ZMZB 3ZCJA 5JVDE 2WU2A 2GK9A 2YOEA 4EYYR 4DV1T 4IL9A 5JDQA 2CHNA 2WWUA 4ANJA 5KXJA 3ANWA 1H7CA 1UX5A 5H6RB 1N32T 3A7MA 4L9IA 3IBPA 2HH7A 4DUYT 1N33T 3OYZA 4LMLA 2XQ4A 1XZYA 3ZYLA 5ABFA 1XNRT 4ZOLE 2DWGA 1YQ4A 2BG9B 4IE5A 4KHPT 4TX5A 5LOVE 5L3CB 4DR1T 2CWYA 4IDPA 2CWOA 3CPZA 5FY0A 2Y6XA 3HKDE 3V5UA 3P4PA 1WLXA 4CXXA 3UUBA 3QOFA 4JI7T 1O3XA 3RI5A 5FY1A 2LSGA 5CA0E 5LNKA 2XQ9A 4O2BE 3J9X1 3CQCB 2BKNA 2LHNA 2NR4A 3AA7B 3UU8A 4AXPA 2ZM2A 3ZYKA 4TV9E 4CN4A 3B5MA 4H9SE 4KHZF 4EIWA 4JI8T 3AVSA 4ISSA 4GKJT 1MMGA 2X0YA 3T8OA 3ZMUB 1Z0PA 2CRBA 2MTQA 2KLQA 3C50A 4PAGA 5FZTA 1XDPA 2WDQA 2M6BA 5ABFB 3I0QA 2UXBT 1VRBA 2BG9A 5LG4A 2CCQA 4JI5T 1XDOA 4OYKA 5A1LA 1LVKA 3AEFA 4B3RT 3GMIA 2CXLA 3PURA 1D0XA 2Q9QD 3DJBA 3DTOA 1YW0A 1OEDE 3EABA 4YXDA 5JREA 2LSIA 1VCSA 2DCFA 5IYZE 5J1GA 3AVRA 3PUAA 2NOXA 5LG3A 2EHOB 4YLHA 5FL1A 2KSRA 3FHNA 3QUJA 3JCFA 4TV8E 1HTJF 3LSVA 5FVLA 4A98A 4JI2T 2LE8A 2K3WA 4IE4A 3QK6A 2MYSA 3SWHA 5FMNA 3K3OA 2ES0A 3FXDB 5LXTE 5CGMA 3NVOA 3RKGA 3FZHB 2V8SV 3O4XE 2V26A 3PTRB 3HL6A 4NPPA 4ILCA 2X9HA 1ZP0A 5F8PA 4YSZA 5HEUA 4PK4A 2QYWA 2YDQA 3UFGA 4H9NC 2WSSV 3ZCIA 4H63H 3N5LA 1FJGT 2H7OA 1MIVA 2QRXA 3RPUA 5L3DB 1MMNA 2QGSA 2ACXA 4X65T 2LSKA 1NEKA 4DV4T 3N9LA 2WS3A 5HWXA 2V1DB 1UX4A 5LMUT 4NIQA 4AQFC 5LBMA 3H3MA 4QXCB 5IWAT 5AQVB 1M7KA 1ZOYA 4HWCA 4UELA 1Y64B 4P1NA 4P09A 3RQWA 3MZKB 2X0CA 3LG7A 1CUNA 5HYAA 4NXNT 2IW5B 1OXZA 4KMCA 5L3BB 2BVLA 1E2AA 2LEHA 3KVAA 3NWIA 3ONLC 4HFCA 4NUVA 1OEDB 2CBJA 2VURA 3K8PC 1NWMX 5AQPB 2VB6A 3NZQA 4EAHA 4I50E 4PFOA 2KGXA 5T1DA 2ODVA 3Q9DA 4YSYA 3BQIA 2J1DG 5LJMA 2I6HA 1QLBA 5JH7E 4U2YA 2EHOC 3CVRA 2OA5A 3PJAJ 4TUYE 2XM1A 4P0BA 5AQKB 4ZS3A 3TLWA 3QC9A 4HN9A 2W00A 2BVMA 2L9QA 3PUQA 5HXCA 3PU8A 3ZN1B 5ABHA 2YKSA 2X67A 1X9BA 4O4HE 2V5CA 4IE0A 4ZI3C 2UXXB 1FMVA 2VQFT 2FJAA 3ZC0A 3AAAB 3B13A 4OFZA 4HFBA 3ZSTA 1GQEA 1SA0E 2RPAA 1HNZT 3R84B 1BR4A 3TLTA 3EAMA 2AE9A 3CWZB 3HKCE 5HCMA 4EGWA 5L2LA 4DV3T 4DBQA 4XBFB 3EDVA 4DMWA 1D0YA 1QSDA 3ZMSB 4E7SA 1KNPA 3C64A 3CMLA 2J62A 4JI1T 3FBLA 3ZPOA 2XQ7A 2V7JA 3ESLA 4ILUA 4EOZB 4IIJE 5JRCB 3ONJA 3KV4A 2KMFA 3N9OA 4O4LE 3E22E 3H3AA 3KBUA 3P4RA 4EZ4A 3F31A 2MTCA 1IBKT 3AE7A 3A8YC 3RIUC 5L4EA 4ECGA 4COFA 3U3IA 2YDSA 1SE7A 2JMHA 4J2CA 3RKOA 1KFYA 4A56A 5E0OA 4HWFA 3L09A 4ZI2D 2XTLA 2VL0A 1OEDC 1T72A 5AQMB 2MOZA 2PG8A 2HHHT 2OV9A 3IA3A 1XNQT 1U5PA 5FNVE 3I0OA 3V5SA 1MNEA 4I43B 4X64T 5DJQC 4U33A 4GOUA 2BBHA 2MPKA 2CA5A 3F57A 4TN7B 5AQFB 5AQJB 2NTXA 4ILAA 4KUMB 5AQUB 2EHOA 2VL8A 4JI0T 4JLEA 4O2AE 1L0VA 2H88A 2G0UA 5HXRA 3W15B 2FBWA 1JNRA 4LMJA 4U7IA 3ZKRA 3ZT5A 2XQYA 4B6XA 2UXCT 4LFBT 3AXJB 3RX6A 2PFVA 2XJ7A 5IUXA 4UVCB 2WZIA 3R6NA 2LKHA 4YTPA 5M4YA 2A9UA 4H9RC 5EK3A 2W61A 3LBXA 4HFEA 2BKPA 4JYAT 4PW8A 2XUEA 3KINB 5HWYA 4DV5T 3FZFB 3ZC1A 4O4IE 4B3MT 4MHCA 2E2AA 2W66A 2WMNA 3RIFA 4CI2B 5JDMA 1HNWT 4JV5T 4PJNA 4I4TE 1LVFA 3UQ7A 4I0UA 2BKOA 2D0TA 2HPLA 4WBOA 2CXFA 3ABVA 4PJMA 4YTMA 4OHFA 4ZZBA 5HEHA 2F4VT 4YY3T 3AE9A 4DR4T 1UCUA 2ZM8A 5ABEA 5J2TE 2CMRA 5LHHB 3N2OA 2Q9QB 2NW8A 3IF8B 5DABA 3UU6A 2X9YA 1G8XA 2XASB 3AE4A 4F8HA 3CKDA 2FJDA 1D1AA 4A5XA 2X51A 3AE1A 3AE3A 1OEDA 2IC9A 3KV9A 4BJNA 2K9AA 4CN1A 3UTKA 4IDZA 2IC6A 1WR0A 2VVNA 2BS2A 4H63V 4O8SA 5AQRB 1VOMA 2WWVA 5KMGP 2IUBA 1W09A 2V5DA 4QX7B 4W8PA 3H37A 4Z8XA 1IBLT 2NW9A 2KXPB 4X1KE 2CLYB 3WSCA 3TLUA 2JQKA 4HWDA 3NBXX 3OYXA 4XAXB 3P4QA 4ZS2A 2BG9C 5DQWA 2HN1A 3VKGA 2DL1A 1US7B 3NZPA 5C2TA 2A72A 3AB3B 4U31A 2A2FX 1UURA 3PJAA 4UEMA 4OX9T 1R8IA 3N2KE 2JQ9A 2V7KA 3FBZA 4KI0F 2X9WA 2NWBA 3HR0A 5EK4A 2C0SA 2W2UA 2XAJB 3KV5A 4L0RA 2N2NA 4QKNA 4AISA 2ZLYA 3CQGB 4GK5E 2DLRA 1MNDA 1YKEB 3MJXA 4DV7T 1HS7A 4BGOA 4UVBB 1HX8A 2VKDA 2L3LA 4U2ZA 3GWHA 2VKHA 2Z6EA 4FI5A 5LBQB 3VR9A 5CJ5A 1N34T 4KX6A 2NW7A 4HKAA 2LLYA 5AQSB 4PNIA 3VJZA 4G2AA 5LCYA 1J1JA 2MAWA 2VKOA 3RHWA 5KX5E 3WAKA 5FP3A 2KZ7B 1BR1A 3O1JA 3MK7C 2E9XA 4LF5T 4K0KT 4DBRA 1ZV4X 3ZJ1A 4F6RC 1DU2A 4AQGA 1KNZA 4AI6A 2IAKA 2W62A 4PK5A 1SHZC 2XQ6A 2FJBA 1M62A 3AAEB 3AE2A 3CK6A 3P4WA 3PUXF 4HWIB 5IHYA 3AE6A 5JDFA 5LYJE 2WDVA 3C4WA 3HKEE 4DV2T 2ZM0A 2PBIA 4GYSA 4A97A 2UXDT 4C91A 3EI0A 4EXTA 5FXWA 3AE8A 4DV0T 4O4JE 2XQAA 2BG9E 1KNRA 1N36T 5AQHB 4DR6T 1HF8A 3LFMA 4GYRA 4WYVA 1FIOA 2CLYC 4ZI7E 3NKZA 5TAOA 5AQTB 2L10A 3UUXB 3WURA 5H6QB 2KWHA 3Q2MA 3AEEA 5BR8T 4PFPA 2W0GA 3F2EA 3AEDA 1VCTA 1HG5A 4IT4A 5LP6E 3Q5WA 2W4XA 2E9XD 3JC6C 3UUNA 2KT9A 4HFHA 2D0UA 4NXMT 3FXEB 4AIUA 1I6ZA 3FZLB 5HEOA 4JI3T 4ISTA 2WP9A 4ILBA 3RIAA 5L3GB 5JR9B 3TLVA 1UK5A 4HGAA 3WAJA 3FZMB 4ONRA 2BZBA 4GKKT 3RYCE 3SS1A 3AT7A 3HA4A 3CQXC 5AQLB 2WU5A 1CHUA 4UV9B 4DR7T 4U3CA 5JRCA 2ZMAA 3RRWA 2LM9A 3AEGA 3MACA 3KBTA 4JI6T 2JMKA 2LM2A 3OTOT 3LK2B 5FY7A 4X62T 2LSJA 3GN5A 4HE8A 4TNVA 2KINB 2NP9A 3P7IA 4UXNB 2LQUA 2J47A 5FXVA 4GK0E 3JADA 4GIWA 4UVAB 3IEEA 3QB5A 3RH3A 1BR2A 4EYUA 2VASA 2HN2A 4TWHA 2C5IT 2DNXA 2Y8DA 5GONE 3OKQA 1AJ3A 1KEYA 2YU2A 3JAEA 1W9RA 5JR9A 3ONXA 2FJEA 1LKXA 2W63A 2W67A 2E5VA 3AA6B 3PUVF 3UT5E 2WAUA 3RRCA 4EEDA 1D1BA 5L47A 4IE6A 3FB2A 1X79A 4JUYA 4LF9T 2XY8B 5F5WA 4ZEYA 3FYQA 1SJ8A 1XMOT 3SFDA 2CE7A 2NTYA 2V6XA 2A3DA 3PUZF 1OWAA 3EVYA 5LB7B 4AKLA 3M1CA 3LJCA 2WDRA 2VK9A 3UU3A 4E7ZA 4JEUB 4UR9A 3N9NA 2IIUA 3C51A 1V9DA 3KFWX 5AQOB 4EB6E 4ZI2C 4UV8B 4ZI3D 2LOSA 4AKGA 1BR0A 3RYHE 3TLSA 4WW0A 4DR2T 4ZXLA 3VRAA 4AQYT 4QXHB 2LRLA 3AA1B 3PUSA 4TWFA 3SRZA 3I1AA 3UUMA 5JQGE 2LKGA 2QVAA 4IREA 4C90A 4ZZCA 4B3ST 4AQFA 2KVPA 4U72A 2EHOD 3S4UA 4BJMA 4EV6A 3OJAA 2X66A 1T98A 4ADZA 1EZ3A 5EZYE 4CXYA 1MMAA 3DP7A 4MLKA 2LHRA 5FL0A 5L4HA 1W0AA 5C8YE 1E7PA 2Q9QA 3T1YT 3LBXB 3G06A 4CQIA 4Q25A 1NENA 5JDHA 2AXDS 2XM2A 4P0AA 2X68A 2R6GF 1UUSA 2IDOB 3ZSSA 3IHRA 4DMVA 3A5XA 5LHIB 4MALA 2KBBA 3JAFA 4N78D 2JJ9A 2CXDA 4NUUA 2D9DA 3M3ZB 3AA0B 4X1YE 3ZJ2A 3C4XA 3LK3B 3K1SA 1YQ3A 1YD8G 3Q5XA 2CBIA 3I9YA 4HTEA 2N9DA 3X1DA 5CFBA 1IJ5A 1SJ7A 4LF6T 3CX8B 3VHLA 2WM9A 1YKHB 4L5GA 5FXXA 3VR8A 4H9QC 4X66T 2LOPA 4V1Av 3UQ4A 2XAQB 3PDYA 2XSBA 4EZHA 1WYBA 5LMNT 4YT0A 2X0HA 2YN6A 2DHRA 2WQYA 2XHEB 3O1HA 2D2SA 3EUHA 2RA1A 3N2GE 2M6IA 4IGUA 3WI3A 3B57A 5HAXA 3J7Yq 4HFDA 1WRDA 2PJQA 4JEHB 4KBMB 5L3EB 3NRYA 4G63A 4B3TT 1HNXT 4EEBA 1QUUA 2E8IA 4DV6T 4TWDA 4M1PA 3OPCA 4LF4T 2KWIB 2JQHA 2Q9QC 2DWKA 3ETUA 2XQ5A 3K3NA 2WZHA 5J0ZA 1G73A 1WFDA 4WNKA 3AE5A 2B1EA 4DIDB 2XAGB 2UXNB 5BMVE 2J4GA 5JTGA 2L7NA 3EDUA 2E5LT 2H89A 4DO0A 5F3JA 4CXWA 4YTNA 2LRKA 4AKRB 3Q5DA 1KF6A 1S35A 4QHOA 5FVKA 4CZZB 2ACZA 4X20E 1Z8UA 1IAPA 3EHZA 3KVBA 5HEGA 2BS3A 2E9XB 3AAIA 4TZ4C 2XSAA 3RQUA 5JDLA 5LHGB 1HX1B 5LGNB 3FZKB 4X5TA 1MIWA 3QB5K 3AEBA 2VVSA 4LF8T 4YHHT 1I94T 1XMQT 3BQLA 4YJ3E 2V6YB 2XAHB 1NAFA 3PUGA 2WB5A 1KK7A 4I55E 5HCJA 3SOLA 2UUAT 4F7GB 5ABGA 3UFEA 2YINA 3AEAA 4HFVA 1D1CA 3L39A 1LRZA 2VKJA 1D0ZA 3P4SA 4XZCA 3TKLB 3MXZA 1T7SA 4PK6A 5AFUL 4JI4T 3N9MA 3HKBE 3L8RA 2MBGA 4DNDA 3RYFE 5LJNA 2YDRA 3KDSE 4LFAT 2IHR1 4DR3T 2VWAA 4UIGA 2C5KT 4BA9A 3CX6B 3U78A 5FKYA 4HWHA 2V7MA 3CIRA 2XPKA 3ETVA 3RF1A 3T1HT 4PJLA 4U74A 5HXSA 2YU1A 5LGUB 2CPTA 4MBQA 2ODUA 5FXZA 2JIWA 4LFCT 4HFIA 3PHF1 2L8KA 3GA8A 4UF0B 4IL4A 4QH4A 2XAFB 3RC8A 2C5JA 1J5ET 3VKHA 2JQQA 2Y48B 5HEJA 4IDQA 2OLTA 5EK2A 3PE0A 3UULA 2D5UA 4QWNB 3ZT6A 4Z90A 4CI1B 2X0LB 1T8BA 1WR6A 1ZEEA 4QH5A 2IMLA 5JDNA 1ZHCA 2JRKA 3LK42 2V7IA 5KDMC 3O9XA 2CM0A 1FMWA 5ETWA 1HR0T 4LMKA 2BBJA 3C98B 1U4QA 3M65A 4TNWA 4CI3B 2CHOA 3ZT7A 2K24A 3C4ZA 4H9PC 1S94A 3E0ZA 4OK0A 5CB4E 3UU4A 2PTFA 1YXRA 2I0MA 2JPFA 3HI2A 3L3PA 1MIYA 2P9BA 3GN5B 3RGLA 3NRXA 2RP4A 4YFSA 4DR5T 2UUBT 1XWMA 2BS4A 3AXJA 3N9QA 4DVDA 5AQGB 1HG2A 2YK0A 1Y01A 1JNZA 1ZKEA 4IDNA 3PUWF 1HFAA 4QH1A 4UF0A 3SFEA 3AY5A 5JR9C 5FYMA 4YSXA 3P50A 1HCIA 2CEAA 5AQNB 3ZEFB 2B76A 2YEVC 3RC3A 5J2UE 2H7VC 1MMDA 5C3JA 3PF0A 3E08A 4U7YA 2LJLA 2DI4A 5AQIB 4YJ2E 2K48A 3QNUA 5L3FB 2ZM6T 3N9PA
chains in the Genus database with same CATH topology
3ZMTB 1IJ6A 3K3QC 4K0UA 2BDEA 4KP3C 3RYIE 4IE7A 2E9XC 3JC6D 4ASKA 5ADXL 2WMOA 3ZMVB 5HXHA 4FJOA 4X1IE 4H9OC 2QA7A 4ERRA 5LA6E 4OYJA 4AKHA 1WYCA 1IZNB 2KNDA 2N1GA 2M67A 4QX8B 5DQVA 2HPJA 3MA9A 2I59A 4PJJA 4YHJA 2K5BB 3VU7H 5CA1E 5LJNA 2H3RA 2LSYA 2SPCA 3OBVE 3ANWB 4ZHQE 3I9WA 3CX7B 2WBLA 3KV6A 2LT3A 1E1HB 4WBNE 4BAYB 4IHJE 3D0TA 5HXEA 4HEAA 4MFRA 5JDGA 1B7TA 3ZLIA 3ZYMA 5LGTB 4AKIA 2V7LA 3P8CD 4QXBB 3MKDA 2X9XA 3PU3A 3BK9A 3BQKA 3O1IA 1FEWA 3ZN0B 3ZMZB 3ZCJA 5JVDE 2GK9A 4EYYR 5JDQA 2WWUA 4ANJA 3ANWA 1H7CA 1UX5A 5H6RB 4L9IA 3IBPA 2HH7A 3OYZA 3ZYLA 4ZOLE 2DWGA 4IE5A 4TX5A 5LOVE 5L3CB 2CWYA 2CWOA 3CPZA 5FY0A 2Y6XA 3HKDE 3V5UA 1WLXA 4CXXA 1O3XA 5FY1A 2LSGA 5CA0E 5LNKA 4O2BE 3J9X1 3CQCB 3AA7B 2LHNA 4AXPA 2ZM2A 3ZYKA 4TV9E 4H9SE 4EIWA 3AVSA 4ISSA 1MMGA 3T8OA 3ZMUB 1Z0PA 2MTQA 4PAGA 2KLQA 3C50A 3I0QA 1VRBA 5LG4A 2CCQA 4OYKA 5A1LA 1LVKA 3GMIA 2CXLA 3PURA 1D0XA 2Q9QD 3DJBA 3DTOA 1YW0A 5JREA 2LSIA 2DCFA 5IYZE 5J1GA 3AVRA 3PUAA 2NOXA 2EHOB 4YLHA 3QUJA 3FHNA 4TV8E 1HTJF 2LE8A 4IE4A 3QK6A 2MYSA 3SWHA 5FMNA 3K3OA 2ES0A 3FXDB 5LXTE 3O4XE 2V26A 3PTRB 3HL6A 2X9HA 5F8PA 4PK4A 4H9NC 2WSSV 3ZCIA 4H63H 3N5LA 2H7OA 1MIVA 3RPUA 5L3DB 1MMNA 2QGSA 2ACXA 2LSKA 3N9LA 5HWXA 2V1DB 1UX4A 4AQFC 5LBMA 4QXCB 4UELA 1Y64B 4P09A 3MZKB 3LG7A 1CUNA 5HYAA 2IW5B 1OXZA 4KMCA 5L3BB 2BVLA 2LEHA 3KVAA 4NUVA 3K8PC 1NWMX 2VB6A 3NZQA 4EAHA 4I50E 4PFOA 5T1DA 2ODVA 3Q9DA 3BQIA 2J1DG 5LJMA 5JH7E 2EHOC 3CVRA 2OA5A 4TUYE 5LGUB 4P0BA 4ZS3A 3QC9A 4HN9A 2W00A 2BVMA 2L9QA 3PUQA 5HXCA 3PU8A 3ZN1B 2X67A 4O4HE 4IE0A 4ZI3C 2UXXB 1FMVA 3ZC0A 3AAAB 3B13A 4OFZA 1SA0E 3R84B 1BR4A 3CWZB 3HKCE 5L2LA 4DBQA 3EDVA 4DMWA 1D0YA 1QSDA 3ZMSB 4E7SA 3C64A 3CMLA 3FBLA 3ZPOA 4ILUA 2V7JA 3ESLA 4EOZB 4IIJE 5JRCB 3KV4A 2KMFA 3N9OA 4O4LE 3E22E 3H3AA 3KBUA 4EZ4A 3F31A 2MTCA 4ECGA 3U3IA 3RKOA 2JMHA 4J2CA 4A56A 5E0OA 3L09A 4ZI2D 2XTLA 2MOZA 2PG8A 1U5PA 5FNVE 3I0OA 3V5SA 1MNEA 4I43B 5DJQC 4GOUA 3F57A 2CA5A 4TN7B 2NTXA 4KUMB 2EHOA 2VL8A 4JLEA 4O2AE 4XBFB 2G0UA 5HXRA 3W15B 4B6XA 2XQYA 3RX6A 2PFVA 4UVCB 3R6NA 5M4YA 4H9RC 5EK3A 2W61A 3LBXA 4PW8A 2XUEA 3KINB 5HWYA 3ZC1A 4O4IE 4MHCA 2WMNA 4CI2B 5JDMA 4PJNA 4I4TE 1LVFA 2D0TA 2HPLA 4WBOA 2CXFA 4PJMA 4OHFA 1UCUA 2ZM8A 5J2TE 2CMRA 5LHHB 3N2OA 2Q9QB 2NW8A 3IF8B 5DABA 2X9YA 1G8XA 2XASB 3CKDA 1D1AA 2X51A 3KV9A 2IC9A 4BJNA 2K9AA 3UTKA 4IDZA 2IC6A 4H63V 4O8SA 1VOMA 5KMGP 4QX7B 3H37A 4Z8XA 2NW9A 2KXPB 4X1KE 2CLYB 3WSCA 3NBXX 3OYXA 4XAXB 4ZS2A 5DQWA 1US7B 3NZPA 2A72A 3AB3B 2A2FX 4UEMA 3N2KE 2V7KA 3FBZA 2X9WA 2NWBA 3HR0A 5EK4A 2C0SA 2XAJB 3KV5A 4L0RA 2N2NA 4QKNA 2ZLYA 3CQGB 4GK5E 2DLRA 1MNDA 1YKEB 3MJXA 1HS7A 4BGOA 4UVBB 1HX8A 2VKDA 2L3LA 3GWHA 2VKHA 2Z6EA 4FI5A 5LBQB 2NW7A 4HKAA 4PNIA 3VJZA 4G2AA 5LCYA 2VKOA 5KX5E 3WAKA 5FP3A 2KZ7B 1BR1A 3O1JA 3MK7C 2E9XA 3WURA 4DBRA 1ZV4X 3ZJ1A 4AI6A 4AQGA 1KNZA 2IAKA 2W62A 4PK5A 1SHZC 3AAEB 5IHYA 5LYJE 5JDFA 3C4WA 3HKEE 2ZM0A 2PBIA 4GYSA 4C91A 4EXTA 5FXWA 4O4JE 4AKGA 1HF8A 3LFMA 4GYRA 1FIOA 2CLYC 4ZI7E 5TAOA 3UUXB 5H6QB 2KWHA 3Q2MA 4PFPA 2W0GA 3F2EA 5LP6E 1HG5A 3Q5WA 2E9XD 3JC6C 3UUNA 2KT9A 2D0UA 3FXEB 4ISTA 3WAJA 5L3GB 5JR9B 4HGAA 4ONRA 2BZBA 3RYCE 3SS1A 3HA4A 3CQXC 4UV9B 5JRCA 2ZMAA 3RRWA 2LM9A 3MACA 3KBTA 2JMKA 3LK2B 5FY7A 2LSJA 3GN5A 4HE8A 2KINB 2NP9A 3P7IA 4UXNB 2LQUA 5FXVA 4GK0E 4GIWA 4UVAB 3IEEA 3RH3A 1BR2A 4EYUA 2VASA 2C5IT 2DNXA 2Y8DA 5GONE 3OKQA 1AJ3A 2YU2A 5JR9A 3ONXA 2W63A 1LKXA 3AA6B 3UT5E 2WAUA 3RRCA 1D1BA 4IE6A 3FB2A 1X79A 4JUYA 2CE7A 2NTYA 2A3DA 1OWAA 3EVYA 4AKLA 3M1CA 3LJCA 2VK9A 4E7ZA 4JEUB 3N9NA 3C51A 1V9DA 3KFWX 4EB6E 4ZI3D 4ZI2C 4UV8B 2LOSA 1BR0A 3RYHE 4WW0A 4QXHB 3PUSA 3AA1B 3SRZA 3UUMA 3I1AA 5JQGE 4C90A 4AQFA 4U72A 2EHOD 3S4UA 4BJMA 3OJAA 2X66A 1T98A 4ADZA 1EZ3A 5EZYE 4CXYA 1MMAA 3DP7A 4MLKA 2LHRA 5C8YE 2Q9QA 3LBXB 4CQIA 5JDHA 4P0AA 2X68A 3IHRA 4DMVA 3A5XA 5LHIB 4MALA 4NUUA 4N78D 2JJ9A 2CXDA 3AA0B 4X1YE 3ZJ2A 3C4XA 3LK3B 1YD8G 3Q5XA 3I9YA 4HTEA 2N9DA 1IJ5A 3CX8B 3VHLA 2WM9A 1YKHB 4L5GA 5FXXA 4H9QC 2LOPA 4V1Av 2XAQB 3PDYA 4EZHA 1WYBA 2DHRA 2XHEB 3O1HA 2D2SA 3EUHA 2RA1A 3N2GE 4IGUA 3WI3A 3B57A 5HAXA 3J7Yq 1WRDA 2PJQA 4JEHB 4KBMB 5L3EB 3NRYA 4G63A 1QUUA 2E8IA 4M1PA 2KWIB 2Q9QC 2DWKA 3ETUA 3K3NA 1G73A 5BMVE 4WNKA 2B1EA 2XAGB 2UXNB 3EDUA 4DO0A 5F3JA 4CXWA 4AKRB 1S35A 4QHOA 4CZZB 4X20E 1IAPA 3KVBA 2E9XB 3AAIA 4TZ4C 5JDLA 5LHGB 5LGNB 1MIWA 3BQLA 4YJ3E 2XAHB 1NAFA 3PUGA 4I55E 1KK7A 3SOLA 3UFEA 2YINA 4HFVA 3TKLB 1D1CA 1LRZA 2VKJA 1D0ZA 4XZCA 3MXZA 4PK6A 5AFUL 3N9MA 3HKBE 2MBGA 4DNDA 3RYFE 3KDSE 2VWAA 4UIGA 2C5KT 4BA9A 3CX6B 3U78A 2V7MA 3ETVA 4PJLA 4U74A 5HXSA 2YU1A 4MBQA 2ODUA 5FXZA 3PHF1 2L8KA 3GA8A 4UF0B 2XAFB 3RC8A 2C5JA 2JQQA 2Y48B 5EK2A 3PE0A 3UULA 2D5UA 4QWNB 4CI1B 3VKHA 2X0LB 1ZEEA 1WR6A 5JDNA 5KDMC 1ZHCA 2JRKA 3LK42 2V7IA 3O9XA 2CM0A 1FMWA 5ETWA 3C98B 1U4QA 3M65A 4CI3B 2K24A 3C4ZA 4H9PC 1S94A 3E0ZA 4OK0A 5CB4E 3VKGA 3AT7A 2JPFA 3HI2A 3L3PA 1MIYA 2P9BA 3GN5B 3NRXA 2RP4A 4YFSA 3N9QA 4DVDA 4F6RC 1HG2A 2YK0A 4UF0A 1ZKEA 1HFAA 5JR9C 5FYMA 1HCIA 2CEAA 3ZEFB 3RC3A 2YEVC 5J2UE 2H7VC 1MMDA 3PF0A 3E08A 2LJLA 2DI4A 4YJ2E 2K48A 5L3FB 3N9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXH A;  3V5U A;  5JDH A;  5JDF A;  5HXR A;  5HXS A;  5HXC A;  5HYA A;  5HWX A;  5HXE A;  5JDL A;  5JDQ A;  5JDN A;  5JDM A;  5JDG A;  3V5S A;  5HWY A; 
#chains in the Genus database with same CATH topology
 1UGO A;  2WCA A;  4LF7 T;  3ZMT B;  1IJ6 A;  3K3Q C;  4JBW F;  4K0U A;  2BDE A;  4KP3 C;  3RYI E;  4IE7 A;  4DUZ T;  4CN6 A;  3Q5E A;  2UUC T;  1WCR A;  2E9X C;  2FUP A;  3JC6 D;  4ASK A;  5ADX L;  2WMO A;  3ZMV B;  1W0B A;  5HXH A;  4FJO A;  4X1I E;  4H9O C;  3LDQ B;  1J5W A;  3PUY F;  2QA7 A;  4ERR A;  5LA6 E;  3DYJ A;  4Z91 A;  1SUM B;  2XZE A;  4OYJ A;  5AQQ B;  2UU9 T;  1IBM T;  4AKH A;  1WYC A;  2VQE T;  1IZN B;  2KND A;  2N1G A;  2M67 A;  2WY2 A;  3AEC A;  2HPJ A;  3MA9 A;  2I59 A;  4PJJ A;  4QX8 B;  2K5B B;  4YHJ A;  5DQV A;  3VU7 H;  2H3R A;  2LSY A;  2SPC A;  2XQ3 A;  3OBV E;  5CA1 E;  3ANW B;  4ZHQ E;  3I9W A;  3RIU A;  3CX7 B;  2WBL A;  3UU5 A;  3KV6 A;  2LT3 A;  1E1H B;  3RLF F;  4BAY B;  4WBN E;  4WZX A;  4IHJ E;  3D0T A;  3PV0 F;  5HXE A;  4HEA A;  4MFR A;  2XQ8 A;  3VRB A;  4IDO A;  1B7T A;  3OVU A;  3ZLI A;  3ZYM A;  5JDG A;  5LGT B;  2V7L A;  3P8C D;  4AKI A;  4QXB B;  3MKD A;  2X9X A;  3PU3 A;  2V6Y A;  3BK9 A;  3BQK A;  1FEW A;  3O1I A;  3ZN0 B;  3ZMZ B;  3ZCJ A;  5JVD E;  2WU2 A;  2GK9 A;  2YOE A;  4EYY R;  4DV1 T;  4IL9 A;  5JDQ A;  2CHN A;  2WWU A;  4ANJ A;  5KXJ A;  3ANW A;  1H7C A;  1UX5 A;  5H6R B;  1N32 T;  3A7M A;  4L9I A;  3IBP A;  2HH7 A;  4DUY T;  1N33 T;  3OYZ A;  4LML A;  2XQ4 A;  1XZY A;  3ZYL A;  5ABF A;  1XNR T;  4ZOL E;  2DWG A;  1YQ4 A;  2BG9 B;  4IE5 A;  4KHP T;  4TX5 A;  5LOV E;  5L3C B;  4DR1 T;  2CWY A;  4IDP A;  2CWO A;  3CPZ A;  5FY0 A;  2Y6X A;  3HKD E;  3V5U A;  3P4P A;  1WLX A;  4CXX A;  3UUB A;  3QOF A;  4JI7 T;  1O3X A;  3RI5 A;  5FY1 A;  2LSG A;  5CA0 E;  5LNK A;  2XQ9 A;  4O2B E;  3J9X 1;  3CQC B;  2BKN A;  2LHN A;  2NR4 A;  3AA7 B;  3UU8 A;  4AXP A;  2ZM2 A;  3ZYK A;  4TV9 E;  4CN4 A;  3B5M A;  4H9S E;  4KHZ F;  4EIW A;  4JI8 T;  3AVS A;  4ISS A;  4GKJ T;  1MMG A;  2X0Y A;  3T8O A;  3ZMU B;  1Z0P A;  2CRB A;  2MTQ A;  2KLQ A;  3C50 A;  4PAG A;  5FZT A;  1XDP A;  2WDQ A;  2M6B A;  5ABF B;  3I0Q A;  2UXB T;  1VRB A;  2BG9 A;  5LG4 A;  2CCQ A;  4JI5 T;  1XDO A;  4OYK A;  5A1L A;  1LVK A;  3AEF A;  4B3R T;  3GMI A;  2CXL A;  3PUR A;  1D0X A;  2Q9Q D;  3DJB A;  3DTO A;  1YW0 A;  1OED E;  3EAB A;  4YXD A;  5JRE A;  2LSI A;  1VCS A;  2DCF A;  5IYZ E;  5J1G A;  3AVR A;  3PUA A;  2NOX A;  5LG3 A;  2EHO B;  4YLH A;  5FL1 A;  2KSR A;  3FHN A;  3QUJ A;  3JCF A;  4TV8 E;  1HTJ F;  3LSV A;  5FVL A;  4A98 A;  4JI2 T;  2LE8 A;  2K3W A;  4IE4 A;  3QK6 A;  2MYS A;  3SWH A;  5FMN A;  3K3O A;  2ES0 A;  3FXD B;  5LXT E;  5CGM A;  3NVO A;  3RKG A;  3FZH B;  2V8S V;  3O4X E;  2V26 A;  3PTR B;  3HL6 A;  4NPP A;  4ILC A;  2X9H A;  1ZP0 A;  5F8P A;  4YSZ A;  5HEU A;  4PK4 A;  2QYW A;  2YDQ A;  3UFG A;  4H9N C;  2WSS V;  3ZCI A;  4H63 H;  3N5L A;  1FJG T;  2H7O A;  1MIV A;  2QRX A;  3RPU A;  5L3D B;  1MMN A;  2QGS A;  2ACX A;  4X65 T;  2LSK A;  1NEK A;  4DV4 T;  3N9L A;  2WS3 A;  5HWX A;  2V1D B;  1UX4 A;  5LMU T;  4NIQ A;  4AQF C;  5LBM A;  3H3M A;  4QXC B;  5IWA T;  5AQV B;  1M7K A;  1ZOY A;  4HWC A;  4UEL A;  1Y64 B;  4P1N A;  4P09 A;  3RQW A;  3MZK B;  2X0C A;  3LG7 A;  1CUN A;  5HYA A;  4NXN T;  2IW5 B;  1OXZ A;  4KMC A;  5L3B B;  2BVL A;  1E2A A;  2LEH A;  3KVA A;  3NWI A;  3ONL C;  4HFC A;  4NUV A;  1OED B;  2CBJ A;  2VUR A;  3K8P C;  1NWM X;  5AQP B;  2VB6 A;  3NZQ A;  4EAH A;  4I50 E;  4PFO A;  2KGX A;  5T1D A;  2ODV A;  3Q9D A;  4YSY A;  3BQI A;  2J1D G;  5LJM A;  2I6H A;  1QLB A;  5JH7 E;  4U2Y A;  2EHO C;  3CVR A;  2OA5 A;  3PJA J;  4TUY E;  2XM1 A;  4P0B A;  5AQK B;  4ZS3 A;  3TLW A;  3QC9 A;  4HN9 A;  2W00 A;  2BVM A;  2L9Q A;  3PUQ A;  5HXC A;  3PU8 A;  3ZN1 B;  5ABH A;  2YKS A;  2X67 A;  1X9B A;  4O4H E;  2V5C A;  4IE0 A;  4ZI3 C;  2UXX B;  1FMV A;  2VQF T;  2FJA A;  3ZC0 A;  3AAA B;  3B13 A;  4OFZ A;  4HFB A;  3ZST A;  1GQE A;  1SA0 E;  2RPA A;  1HNZ T;  3R84 B;  1BR4 A;  3TLT A;  3EAM A;  2AE9 A;  3CWZ B;  3HKC E;  5HCM A;  4EGW A;  5L2L A;  4DV3 T;  4DBQ A;  4XBF B;  3EDV A;  4DMW A;  1D0Y A;  1QSD A;  3ZMS B;  4E7S A;  1KNP A;  3C64 A;  3CML A;  2J62 A;  4JI1 T;  3FBL A;  3ZPO A;  2XQ7 A;  2V7J A;  3ESL A;  4ILU A;  4EOZ B;  4IIJ E;  5JRC B;  3ONJ A;  3KV4 A;  2KMF A;  3N9O A;  4O4L E;  3E22 E;  3H3A A;  3KBU A;  3P4R A;  4EZ4 A;  3F31 A;  2MTC A;  1IBK T;  3AE7 A;  3A8Y C;  3RIU C;  5L4E A;  4ECG A;  4COF A;  3U3I A;  2YDS A;  1SE7 A;  2JMH A;  4J2C A;  3RKO A;  1KFY A;  4A56 A;  5E0O A;  4HWF A;  3L09 A;  4ZI2 D;  2XTL A;  2VL0 A;  1OED C;  1T72 A;  5AQM B;  2MOZ A;  2PG8 A;  2HHH T;  2OV9 A;  3IA3 A;  1XNQ T;  1U5P A;  5FNV E;  3I0O A;  3V5S A;  1MNE A;  4I43 B;  4X64 T;  5DJQ C;  4U33 A;  4GOU A;  2BBH A;  2MPK A;  2CA5 A;  3F57 A;  4TN7 B;  5AQF B;  5AQJ B;  2NTX A;  4ILA A;  4KUM B;  5AQU B;  2EHO A;  2VL8 A;  4JI0 T;  4JLE A;  4O2A E;  1L0V A;  2H88 A;  2G0U A;  5HXR A;  3W15 B;  2FBW A;  1JNR A;  4LMJ A;  4U7I A;  3ZKR A;  3ZT5 A;  2XQY A;  4B6X A;  2UXC T;  4LFB T;  3AXJ B;  3RX6 A;  2PFV A;  2XJ7 A;  5IUX A;  4UVC B;  2WZI A;  3R6N A;  2LKH A;  4YTP A;  5M4Y A;  2A9U A;  4H9R C;  5EK3 A;  2W61 A;  3LBX A;  4HFE A;  2BKP A;  4JYA T;  4PW8 A;  2XUE A;  3KIN B;  5HWY A;  4DV5 T;  3FZF B;  3ZC1 A;  4O4I E;  4B3M T;  4MHC A;  2E2A A;  2W66 A;  2WMN A;  3RIF A;  4CI2 B;  5JDM A;  1HNW T;  4JV5 T;  4PJN A;  4I4T E;  1LVF A;  3UQ7 A;  4I0U A;  2BKO A;  2D0T A;  2HPL A;  4WBO A;  2CXF A;  3ABV A;  4PJM A;  4YTM A;  4OHF A;  4ZZB A;  5HEH A;  2F4V T;  4YY3 T;  3AE9 A;  4DR4 T;  1UCU A;  2ZM8 A;  5ABE A;  5J2T E;  2CMR A;  5LHH B;  3N2O A;  2Q9Q B;  2NW8 A;  3IF8 B;  5DAB A;  3UU6 A;  2X9Y A;  1G8X A;  2XAS B;  3AE4 A;  4F8H A;  3CKD A;  2FJD A;  1D1A A;  4A5X A;  2X51 A;  3AE1 A;  3AE3 A;  1OED A;  2IC9 A;  3KV9 A;  4BJN A;  2K9A A;  4CN1 A;  3UTK A;  4IDZ A;  2IC6 A;  1WR0 A;  2VVN A;  2BS2 A;  4H63 V;  4O8S A;  5AQR B;  1VOM A;  2WWV A;  5KMG P;  2IUB A;  1W09 A;  2V5D A;  4QX7 B;  4W8P A;  3H37 A;  4Z8X A;  1IBL T;  2NW9 A;  2KXP B;  4X1K E;  2CLY B;  3WSC A;  3TLU A;  2JQK A;  4HWD A;  3NBX X;  3OYX A;  4XAX B;  3P4Q A;  4ZS2 A;  2BG9 C;  5DQW A;  2HN1 A;  3VKG A;  2DL1 A;  1US7 B;  3NZP A;  5C2T A;  2A72 A;  3AB3 B;  4U31 A;  2A2F X;  1UUR A;  3PJA A;  4UEM A;  4OX9 T;  1R8I A;  3N2K E;  2JQ9 A;  2V7K A;  3FBZ A;  4KI0 F;  2X9W A;  2NWB A;  3HR0 A;  5EK4 A;  2C0S A;  2W2U A;  2XAJ B;  3KV5 A;  4L0R A;  2N2N A;  4QKN A;  4AIS A;  2ZLY A;  3CQG B;  4GK5 E;  2DLR A;  1MND A;  1YKE B;  3MJX A;  4DV7 T;  1HS7 A;  4BGO A;  4UVB B;  1HX8 A;  2VKD A;  2L3L A;  4U2Z A;  3GWH A;  2VKH A;  2Z6E A;  4FI5 A;  5LBQ B;  3VR9 A;  5CJ5 A;  1N34 T;  4KX6 A;  2NW7 A;  4HKA A;  2LLY A;  5AQS B;  4PNI A;  3VJZ A;  4G2A A;  5LCY A;  1J1J A;  2MAW A;  2VKO A;  3RHW A;  5KX5 E;  3WAK A;  5FP3 A;  2KZ7 B;  1BR1 A;  3O1J A;  3MK7 C;  2E9X A;  4LF5 T;  4K0K T;  4DBR A;  1ZV4 X;  3ZJ1 A;  4F6R C;  1DU2 A;  4AQG A;  1KNZ A;  4AI6 A;  2IAK A;  2W62 A;  4PK5 A;  1SHZ C;  2XQ6 A;  2FJB A;  1M62 A;  3AAE B;  3AE2 A;  3CK6 A;  3P4W A;  3PUX F;  4HWI B;  5IHY A;  3AE6 A;  5JDF A;  5LYJ E;  2WDV A;  3C4W A;  3HKE E;  4DV2 T;  2ZM0 A;  2PBI A;  4GYS A;  4A97 A;  2UXD T;  4C91 A;  3EI0 A;  4EXT A;  5FXW A;  3AE8 A;  4DV0 T;  4O4J E;  2XQA A;  2BG9 E;  1KNR A;  1N36 T;  5AQH B;  4DR6 T;  1HF8 A;  3LFM A;  4GYR A;  4WYV A;  1FIO A;  2CLY C;  4ZI7 E;  3NKZ A;  5TAO A;  5AQT B;  2L10 A;  3UUX B;  3WUR A;  5H6Q B;  2KWH A;  3Q2M A;  3AEE A;  5BR8 T;  4PFP A;  2W0G A;  3F2E A;  3AED A;  1VCT A;  1HG5 A;  4IT4 A;  5LP6 E;  3Q5W A;  2W4X A;  2E9X D;  3JC6 C;  3UUN A;  2KT9 A;  4HFH A;  2D0U A;  4NXM T;  3FXE B;  4AIU A;  1I6Z A;  3FZL B;  5HEO A;  4JI3 T;  4IST A;  2WP9 A;  4ILB A;  3RIA A;  5L3G B;  5JR9 B;  3TLV A;  1UK5 A;  4HGA A;  3WAJ A;  3FZM B;  4ONR A;  2BZB A;  4GKK T;  3RYC E;  3SS1 A;  3AT7 A;  3HA4 A;  3CQX C;  5AQL B;  2WU5 A;  1CHU A;  4UV9 B;  4DR7 T;  4U3C A;  5JRC A;  2ZMA A;  3RRW A;  2LM9 A;  3AEG A;  3MAC A;  3KBT A;  4JI6 T;  2JMK A;  2LM2 A;  3OTO T;  3LK2 B;  5FY7 A;  4X62 T;  2LSJ A;  3GN5 A;  4HE8 A;  4TNV A;  2KIN B;  2NP9 A;  3P7I A;  4UXN B;  2LQU A;  2J47 A;  5FXV A;  4GK0 E;  3JAD A;  4GIW A;  4UVA B;  3IEE A;  3QB5 A;  3RH3 A;  1BR2 A;  4EYU A;  2VAS A;  2HN2 A;  4TWH A;  2C5I T;  2DNX A;  2Y8D A;  5GON E;  3OKQ A;  1AJ3 A;  1KEY A;  2YU2 A;  3JAE A;  1W9R A;  5JR9 A;  3ONX A;  2FJE A;  1LKX A;  2W63 A;  2W67 A;  2E5V A;  3AA6 B;  3PUV F;  3UT5 E;  2WAU A;  3RRC A;  4EED A;  1D1B A;  5L47 A;  4IE6 A;  3FB2 A;  1X79 A;  4JUY A;  4LF9 T;  2XY8 B;  5F5W A;  4ZEY A;  3FYQ A;  1SJ8 A;  1XMO T;  3SFD A;  2CE7 A;  2NTY A;  2V6X A;  2A3D A;  3PUZ F;  1OWA A;  3EVY A;  5LB7 B;  4AKL A;  3M1C A;  3LJC A;  2WDR A;  2VK9 A;  3UU3 A;  4E7Z A;  4JEU B;  4UR9 A;  3N9N A;  2IIU A;  3C51 A;  1V9D A;  3KFW X;  5AQO B;  4EB6 E;  4ZI2 C;  4UV8 B;  4ZI3 D;  2LOS A;  4AKG A;  1BR0 A;  3RYH E;  3TLS A;  4WW0 A;  4DR2 T;  4ZXL A;  3VRA A;  4AQY T;  4QXH B;  2LRL A;  3AA1 B;  3PUS A;  4TWF A;  3SRZ A;  3I1A A;  3UUM A;  5JQG E;  2LKG A;  2QVA A;  4IRE A;  4C90 A;  4ZZC A;  4B3S T;  4AQF A;  2KVP A;  4U72 A;  2EHO D;  3S4U A;  4BJM A;  4EV6 A;  3OJA A;  2X66 A;  1T98 A;  4ADZ A;  1EZ3 A;  5EZY E;  4CXY A;  1MMA A;  3DP7 A;  4MLK A;  2LHR A;  5FL0 A;  5L4H A;  1W0A A;  5C8Y E;  1E7P A;  2Q9Q A;  3T1Y T;  3LBX B;  3G06 A;  4CQI A;  4Q25 A;  1NEN A;  5JDH A;  2AXD S;  2XM2 A;  4P0A A;  2X68 A;  2R6G F;  1UUS A;  2IDO B;  3ZSS A;  3IHR A;  4DMV A;  3A5X A;  5LHI B;  4MAL A;  2KBB A;  3JAF A;  4N78 D;  2JJ9 A;  2CXD A;  4NUU A;  2D9D A;  3M3Z B;  3AA0 B;  4X1Y E;  3ZJ2 A;  3C4X A;  3LK3 B;  3K1S A;  1YQ3 A;  1YD8 G;  3Q5X A;  2CBI A;  3I9Y A;  4HTE A;  2N9D A;  3X1D A;  5CFB A;  1IJ5 A;  1SJ7 A;  4LF6 T;  3CX8 B;  3VHL A;  2WM9 A;  1YKH B;  4L5G A;  5FXX A;  3VR8 A;  4H9Q C;  4X66 T;  2LOP A;  4V1A v;  3UQ4 A;  2XAQ B;  3PDY A;  2XSB A;  4EZH A;  1WYB A;  5LMN T;  4YT0 A;  2X0H A;  2YN6 A;  2DHR A;  2WQY A;  2XHE B;  3O1H A;  2D2S A;  3EUH A;  2RA1 A;  3N2G E;  2M6I A;  4IGU A;  3WI3 A;  3B57 A;  5HAX A;  3J7Y q;  4HFD A;  1WRD A;  2PJQ A;  4JEH B;  4KBM B;  5L3E B;  3NRY A;  4G63 A;  4B3T T;  1HNX T;  4EEB A;  1QUU A;  2E8I A;  4DV6 T;  4TWD A;  4M1P A;  3OPC A;  4LF4 T;  2KWI B;  2JQH A;  2Q9Q C;  2DWK A;  3ETU A;  2XQ5 A;  3K3N A;  2WZH A;  5J0Z A;  1G73 A;  1WFD A;  4WNK A;  3AE5 A;  2B1E A;  4DID B;  2XAG B;  2UXN B;  5BMV E;  2J4G A;  5JTG A;  2L7N A;  3EDU A;  2E5L T;  2H89 A;  4DO0 A;  5F3J A;  4CXW A;  4YTN A;  2LRK A;  4AKR B;  3Q5D A;  1KF6 A;  1S35 A;  4QHO A;  5FVK A;  4CZZ B;  2ACZ A;  4X20 E;  1Z8U A;  1IAP A;  3EHZ A;  3KVB A;  5HEG A;  2BS3 A;  2E9X B;  3AAI A;  4TZ4 C;  2XSA A;  3RQU A;  5JDL A;  5LHG B;  1HX1 B;  5LGN B;  3FZK B;  4X5T A;  1MIW A;  3QB5 K;  3AEB A;  2VVS A;  4LF8 T;  4YHH T;  1I94 T;  1XMQ T;  3BQL A;  4YJ3 E;  2V6Y B;  2XAH B;  1NAF A;  3PUG A;  2WB5 A;  1KK7 A;  4I55 E;  5HCJ A;  3SOL A;  2UUA T;  4F7G B;  5ABG A;  3UFE A;  2YIN A;  3AEA A;  4HFV A;  1D1C A;  3L39 A;  1LRZ A;  2VKJ A;  1D0Z A;  3P4S A;  4XZC A;  3TKL B;  3MXZ A;  1T7S A;  4PK6 A;  5AFU L;  4JI4 T;  3N9M A;  3HKB E;  3L8R A;  2MBG A;  4DND A;  3RYF E;  5LJN A;  2YDR A;  3KDS E;  4LFA T;  2IHR 1;  4DR3 T;  2VWA A;  4UIG A;  2C5K T;  4BA9 A;  3CX6 B;  3U78 A;  5FKY A;  4HWH A;  2V7M A;  3CIR A;  2XPK A;  3ETV A;  3RF1 A;  3T1H T;  4PJL A;  4U74 A;  5HXS A;  2YU1 A;  5LGU B;  2CPT A;  4MBQ A;  2ODU A;  5FXZ A;  2JIW A;  4LFC T;  4HFI A;  3PHF 1;  2L8K A;  3GA8 A;  4UF0 B;  4IL4 A;  4QH4 A;  2XAF B;  3RC8 A;  2C5J A;  1J5E T;  3VKH A;  2JQQ A;  2Y48 B;  5HEJ A;  4IDQ A;  2OLT A;  5EK2 A;  3PE0 A;  3UUL A;  2D5U A;  4QWN B;  3ZT6 A;  4Z90 A;  4CI1 B;  2X0L B;  1T8B A;  1WR6 A;  1ZEE A;  4QH5 A;  2IML A;  5JDN A;  1ZHC A;  2JRK A;  3LK4 2;  2V7I A;  5KDM C;  3O9X A;  2CM0 A;  1FMW A;  5ETW A;  1HR0 T;  4LMK A;  2BBJ A;  3C98 B;  1U4Q A;  3M65 A;  4TNW A;  4CI3 B;  2CHO A;  3ZT7 A;  2K24 A;  3C4Z A;  4H9P C;  1S94 A;  3E0Z A;  4OK0 A;  5CB4 E;  3UU4 A;  2PTF A;  1YXR A;  2I0M A;  2JPF A;  3HI2 A;  3L3P A;  1MIY A;  2P9B A;  3GN5 B;  3RGL A;  3NRX A;  2RP4 A;  4YFS A;  4DR5 T;  2UUB T;  1XWM A;  2BS4 A;  3AXJ A;  3N9Q A;  4DVD A;  5AQG B;  1HG2 A;  2YK0 A;  1Y01 A;  1JNZ A;  1ZKE A;  4IDN A;  3PUW F;  1HFA A;  4QH1 A;  4UF0 A;  3SFE A;  3AY5 A;  5JR9 C;  5FYM A;  4YSX A;  3P50 A;  1HCI A;  2CEA A;  5AQN B;  3ZEF B;  2B76 A;  2YEV C;  3RC3 A;  5J2U E;  2H7V C;  1MMD A;  5C3J A;  3PF0 A;  3E08 A;  4U7Y A;  2LJL A;  2DI4 A;  5AQI B;  4YJ2 E;  2K48 A;  3QNU A;  5L3F B;  2ZM6 T;  3N9P A; 
#chains in the Genus database with same CATH homology
 3ZMT B;  1IJ6 A;  3K3Q C;  4K0U A;  2BDE A;  4KP3 C;  3RYI E;  4IE7 A;  2E9X C;  3JC6 D;  4ASK A;  5ADX L;  2WMO A;  3ZMV B;  5HXH A;  4FJO A;  4X1I E;  4H9O C;  2QA7 A;  4ERR A;  5LA6 E;  4OYJ A;  4AKH A;  1WYC A;  1IZN B;  2KND A;  2N1G A;  2M67 A;  4QX8 B;  5DQV A;  2HPJ A;  3MA9 A;  2I59 A;  4PJJ A;  4YHJ A;  2K5B B;  3VU7 H;  5CA1 E;  5LJN A;  2H3R A;  2LSY A;  2SPC A;  3OBV E;  3ANW B;  4ZHQ E;  3I9W A;  3CX7 B;  2WBL A;  3KV6 A;  2LT3 A;  1E1H B;  4WBN E;  4BAY B;  4IHJ E;  3D0T A;  5HXE A;  4HEA A;  4MFR A;  5JDG A;  1B7T A;  3ZLI A;  3ZYM A;  5LGT B;  4AKI A;  2V7L A;  3P8C D;  4QXB B;  3MKD A;  2X9X A;  3PU3 A;  3BK9 A;  3BQK A;  3O1I A;  1FEW A;  3ZN0 B;  3ZMZ B;  3ZCJ A;  5JVD E;  2GK9 A;  4EYY R;  5JDQ A;  2WWU A;  4ANJ A;  3ANW A;  1H7C A;  1UX5 A;  5H6R B;  4L9I A;  3IBP A;  2HH7 A;  3OYZ A;  3ZYL A;  4ZOL E;  2DWG A;  4IE5 A;  4TX5 A;  5LOV E;  5L3C B;  2CWY A;  2CWO A;  3CPZ A;  5FY0 A;  2Y6X A;  3HKD E;  3V5U A;  1WLX A;  4CXX A;  1O3X A;  5FY1 A;  2LSG A;  5CA0 E;  5LNK A;  4O2B E;  3J9X 1;  3CQC B;  3AA7 B;  2LHN A;  4AXP A;  2ZM2 A;  3ZYK A;  4TV9 E;  4H9S E;  4EIW A;  3AVS A;  4ISS A;  1MMG A;  3T8O A;  3ZMU B;  1Z0P A;  2MTQ A;  4PAG A;  2KLQ A;  3C50 A;  3I0Q A;  1VRB A;  5LG4 A;  2CCQ A;  4OYK A;  5A1L A;  1LVK A;  3GMI A;  2CXL A;  3PUR A;  1D0X A;  2Q9Q D;  3DJB A;  3DTO A;  1YW0 A;  5JRE A;  2LSI A;  2DCF A;  5IYZ E;  5J1G A;  3AVR A;  3PUA A;  2NOX A;  2EHO B;  4YLH A;  3QUJ A;  3FHN A;  4TV8 E;  1HTJ F;  2LE8 A;  4IE4 A;  3QK6 A;  2MYS A;  3SWH A;  5FMN A;  3K3O A;  2ES0 A;  3FXD B;  5LXT E;  3O4X E;  2V26 A;  3PTR B;  3HL6 A;  2X9H A;  5F8P A;  4PK4 A;  4H9N C;  2WSS V;  3ZCI A;  4H63 H;  3N5L A;  2H7O A;  1MIV A;  3RPU A;  5L3D B;  1MMN A;  2QGS A;  2ACX A;  2LSK A;  3N9L A;  5HWX A;  2V1D B;  1UX4 A;  4AQF C;  5LBM A;  4QXC B;  4UEL A;  1Y64 B;  4P09 A;  3MZK B;  3LG7 A;  1CUN A;  5HYA A;  2IW5 B;  1OXZ A;  4KMC A;  5L3B B;  2BVL A;  2LEH A;  3KVA A;  4NUV A;  3K8P C;  1NWM X;  2VB6 A;  3NZQ A;  4EAH A;  4I50 E;  4PFO A;  5T1D A;  2ODV A;  3Q9D A;  3BQI A;  2J1D G;  5LJM A;  5JH7 E;  2EHO C;  3CVR A;  2OA5 A;  4TUY E;  5LGU B;  4P0B A;  4ZS3 A;  3QC9 A;  4HN9 A;  2W00 A;  2BVM A;  2L9Q A;  3PUQ A;  5HXC A;  3PU8 A;  3ZN1 B;  2X67 A;  4O4H E;  4IE0 A;  4ZI3 C;  2UXX B;  1FMV A;  3ZC0 A;  3AAA B;  3B13 A;  4OFZ A;  1SA0 E;  3R84 B;  1BR4 A;  3CWZ B;  3HKC E;  5L2L A;  4DBQ A;  3EDV A;  4DMW A;  1D0Y A;  1QSD A;  3ZMS B;  4E7S A;  3C64 A;  3CML A;  3FBL A;  3ZPO A;  4ILU A;  2V7J A;  3ESL A;  4EOZ B;  4IIJ E;  5JRC B;  3KV4 A;  2KMF A;  3N9O A;  4O4L E;  3E22 E;  3H3A A;  3KBU A;  4EZ4 A;  3F31 A;  2MTC A;  4ECG A;  3U3I A;  3RKO A;  2JMH A;  4J2C A;  4A56 A;  5E0O A;  3L09 A;  4ZI2 D;  2XTL A;  2MOZ A;  2PG8 A;  1U5P A;  5FNV E;  3I0O A;  3V5S A;  1MNE A;  4I43 B;  5DJQ C;  4GOU A;  3F57 A;  2CA5 A;  4TN7 B;  2NTX A;  4KUM B;  2EHO A;  2VL8 A;  4JLE A;  4O2A E;  4XBF B;  2G0U A;  5HXR A;  3W15 B;  4B6X A;  2XQY A;  3RX6 A;  2PFV A;  4UVC B;  3R6N A;  5M4Y A;  4H9R C;  5EK3 A;  2W61 A;  3LBX A;  4PW8 A;  2XUE A;  3KIN B;  5HWY A;  3ZC1 A;  4O4I E;  4MHC A;  2WMN A;  4CI2 B;  5JDM A;  4PJN A;  4I4T E;  1LVF A;  2D0T A;  2HPL A;  4WBO A;  2CXF A;  4PJM A;  4OHF A;  1UCU A;  2ZM8 A;  5J2T E;  2CMR A;  5LHH B;  3N2O A;  2Q9Q B;  2NW8 A;  3IF8 B;  5DAB A;  2X9Y A;  1G8X A;  2XAS B;  3CKD A;  1D1A A;  2X51 A;  3KV9 A;  2IC9 A;  4BJN A;  2K9A A;  3UTK A;  4IDZ A;  2IC6 A;  4H63 V;  4O8S A;  1VOM A;  5KMG P;  4QX7 B;  3H37 A;  4Z8X A;  2NW9 A;  2KXP B;  4X1K E;  2CLY B;  3WSC A;  3NBX X;  3OYX A;  4XAX B;  4ZS2 A;  5DQW A;  1US7 B;  3NZP A;  2A72 A;  3AB3 B;  2A2F X;  4UEM A;  3N2K E;  2V7K A;  3FBZ A;  2X9W A;  2NWB A;  3HR0 A;  5EK4 A;  2C0S A;  2XAJ B;  3KV5 A;  4L0R A;  2N2N A;  4QKN A;  2ZLY A;  3CQG B;  4GK5 E;  2DLR A;  1MND A;  1YKE B;  3MJX A;  1HS7 A;  4BGO A;  4UVB B;  1HX8 A;  2VKD A;  2L3L A;  3GWH A;  2VKH A;  2Z6E A;  4FI5 A;  5LBQ B;  2NW7 A;  4HKA A;  4PNI A;  3VJZ A;  4G2A A;  5LCY A;  2VKO A;  5KX5 E;  3WAK A;  5FP3 A;  2KZ7 B;  1BR1 A;  3O1J A;  3MK7 C;  2E9X A;  3WUR A;  4DBR A;  1ZV4 X;  3ZJ1 A;  4AI6 A;  4AQG A;  1KNZ A;  2IAK A;  2W62 A;  4PK5 A;  1SHZ C;  3AAE B;  5IHY A;  5LYJ E;  5JDF A;  3C4W A;  3HKE E;  2ZM0 A;  2PBI A;  4GYS A;  4C91 A;  4EXT A;  5FXW A;  4O4J E;  4AKG A;  1HF8 A;  3LFM A;  4GYR A;  1FIO A;  2CLY C;  4ZI7 E;  5TAO A;  3UUX B;  5H6Q B;  2KWH A;  3Q2M A;  4PFP A;  2W0G A;  3F2E A;  5LP6 E;  1HG5 A;  3Q5W A;  2E9X D;  3JC6 C;  3UUN A;  2KT9 A;  2D0U A;  3FXE B;  4IST A;  3WAJ A;  5L3G B;  5JR9 B;  4HGA A;  4ONR A;  2BZB A;  3RYC E;  3SS1 A;  3HA4 A;  3CQX C;  4UV9 B;  5JRC A;  2ZMA A;  3RRW A;  2LM9 A;  3MAC A;  3KBT A;  2JMK A;  3LK2 B;  5FY7 A;  2LSJ A;  3GN5 A;  4HE8 A;  2KIN B;  2NP9 A;  3P7I A;  4UXN B;  2LQU A;  5FXV A;  4GK0 E;  4GIW A;  4UVA B;  3IEE A;  3RH3 A;  1BR2 A;  4EYU A;  2VAS A;  2C5I T;  2DNX A;  2Y8D A;  5GON E;  3OKQ A;  1AJ3 A;  2YU2 A;  5JR9 A;  3ONX A;  2W63 A;  1LKX A;  3AA6 B;  3UT5 E;  2WAU A;  3RRC A;  1D1B A;  4IE6 A;  3FB2 A;  1X79 A;  4JUY A;  2CE7 A;  2NTY A;  2A3D A;  1OWA A;  3EVY A;  4AKL A;  3M1C A;  3LJC A;  2VK9 A;  4E7Z A;  4JEU B;  3N9N A;  3C51 A;  1V9D A;  3KFW X;  4EB6 E;  4ZI3 D;  4ZI2 C;  4UV8 B;  2LOS A;  1BR0 A;  3RYH E;  4WW0 A;  4QXH B;  3PUS A;  3AA1 B;  3SRZ A;  3UUM A;  3I1A A;  5JQG E;  4C90 A;  4AQF A;  4U72 A;  2EHO D;  3S4U A;  4BJM A;  3OJA A;  2X66 A;  1T98 A;  4ADZ A;  1EZ3 A;  5EZY E;  4CXY A;  1MMA A;  3DP7 A;  4MLK A;  2LHR A;  5C8Y E;  2Q9Q A;  3LBX B;  4CQI A;  5JDH A;  4P0A A;  2X68 A;  3IHR A;  4DMV A;  3A5X A;  5LHI B;  4MAL A;  4NUU A;  4N78 D;  2JJ9 A;  2CXD A;  3AA0 B;  4X1Y E;  3ZJ2 A;  3C4X A;  3LK3 B;  1YD8 G;  3Q5X A;  3I9Y A;  4HTE A;  2N9D A;  1IJ5 A;  3CX8 B;  3VHL A;  2WM9 A;  1YKH B;  4L5G A;  5FXX A;  4H9Q C;  2LOP A;  4V1A v;  2XAQ B;  3PDY A;  4EZH A;  1WYB A;  2DHR A;  2XHE B;  3O1H A;  2D2S A;  3EUH A;  2RA1 A;  3N2G E;  4IGU A;  3WI3 A;  3B57 A;  5HAX A;  3J7Y q;  1WRD A;  2PJQ A;  4JEH B;  4KBM B;  5L3E B;  3NRY A;  4G63 A;  1QUU A;  2E8I A;  4M1P A;  2KWI B;  2Q9Q C;  2DWK A;  3ETU A;  3K3N A;  1G73 A;  5BMV E;  4WNK A;  2B1E A;  2XAG B;  2UXN B;  3EDU A;  4DO0 A;  5F3J A;  4CXW A;  4AKR B;  1S35 A;  4QHO A;  4CZZ B;  4X20 E;  1IAP A;  3KVB A;  2E9X B;  3AAI A;  4TZ4 C;  5JDL A;  5LHG B;  5LGN B;  1MIW A;  3BQL A;  4YJ3 E;  2XAH B;  1NAF A;  3PUG A;  4I55 E;  1KK7 A;  3SOL A;  3UFE A;  2YIN A;  4HFV A;  3TKL B;  1D1C A;  1LRZ A;  2VKJ A;  1D0Z A;  4XZC A;  3MXZ A;  4PK6 A;  5AFU L;  3N9M A;  3HKB E;  2MBG A;  4DND A;  3RYF E;  3KDS E;  2VWA A;  4UIG A;  2C5K T;  4BA9 A;  3CX6 B;  3U78 A;  2V7M A;  3ETV A;  4PJL A;  4U74 A;  5HXS A;  2YU1 A;  4MBQ A;  2ODU A;  5FXZ A;  3PHF 1;  2L8K A;  3GA8 A;  4UF0 B;  2XAF B;  3RC8 A;  2C5J A;  2JQQ A;  2Y48 B;  5EK2 A;  3PE0 A;  3UUL A;  2D5U A;  4QWN B;  4CI1 B;  3VKH A;  2X0L B;  1ZEE A;  1WR6 A;  5JDN A;  5KDM C;  1ZHC A;  2JRK A;  3LK4 2;  2V7I A;  3O9X A;  2CM0 A;  1FMW A;  5ETW A;  3C98 B;  1U4Q A;  3M65 A;  4CI3 B;  2K24 A;  3C4Z A;  4H9P C;  1S94 A;  3E0Z A;  4OK0 A;  5CB4 E;  3VKG A;  3AT7 A;  2JPF A;  3HI2 A;  3L3P A;  1MIY A;  2P9B A;  3GN5 B;  3NRX A;  2RP4 A;  4YFS A;  3N9Q A;  4DVD A;  4F6R C;  1HG2 A;  2YK0 A;  4UF0 A;  1ZKE A;  1HFA A;  5JR9 C;  5FYM A;  1HCI A;  2CEA A;  3ZEF B;  3RC3 A;  2YEV C;  5J2U E;  2H7V C;  1MMD A;  3PF0 A;  3E08 A;  2LJL A;  2DI4 A;  4YJ2 E;  2K48 A;  5L3F B;  3N9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...