5JDNA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 10 mm na+ and 10mm sr2+
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
301
structure length
297
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium-calcium exchanger NCX_Mj
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 130
structure length 297
sequence length 301
ec nomenclature
pdb deposition date 2016-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdnA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdnA02
5HXHA 5JDHA 5HYAA 5JDFA 5JDLA 5JDNA 5HXRA 5HWYA 5JDGA 5HXEA 3V5SA 5HXSA 5HXCA 5HWXA 5JDMA 3V5UA 5JDQA
chains in the Genus database with same CATH superfamily
2XAHB 5KX5E 5EZYE 4JI3T 2QVAA 2YOEA 1LKXA 1VOMA 5ETWA 2M67A 5HEHA 4HFDA 1N34T 2YN6A 3PDYA 2NW9A 3PUQA 2IC9A 5AQUB 3MZKB 1LVFA 3VHLA 2XQ9A 3E0ZA 5AQRB 1MNEA 4WNKA 2D5UA 4ZI2D 3HI2A 4KMCA 4GK5E 1HX1B 5HXEA 1IAPA 5L3CB 3N5LA 1KK7A 2QA7A 5GONE 4B3TT 3C50A 3AE5A 3KFWX 2LHRA 3U3IA 5LP6E 4U3CA 2DHRA 1Z0PA 3L09A 3RIUC 3PE0A 4I50E 4AQFC 4ILUA 2JPFA 4HFVA 2V6YA 2H3RA 4YLHA 3K8PC 4C90A 4BJMA 3Q2MA 3OKQA 5LNKA 4JEUB 1QLBA 3CK6A 1KNZA 3ONLC 1L0VA 4DV7T 2MOZA 4O4LE 1LVKA 1YD8G 3BQKA 2Y48B 3FHNA 2XSAA 3FZMB 2OV9A 1NEKA 5LJMA 4PJNA 2CE7A 4EZ4A 2WBLA 4AKIA 2V7LA 4P09A 4CXXA 2YKSA 4GYSA 3RYCE 3UQ7A 3AAEB 4YY3T 1WRDA 3O9XA 5LBQB 2XQ5A 1WFDA 1W0AA 2QRXA 2YDQA 3RH3A 5IWAT 4PAGA 2CBIA 4HWFA 5LA6E 1WR0A 2ZM0A 2KWIB 2JQQA 2YDSA 3K1SA 2WU2A 3UFEA 5C8YE 3UUXB 4IDNA 3ETUA 3SFEA 3Q5EA 1X9BA 1KEYA 4O8SA 2A9UA 3UU4A 4LF6T 1XMQT 1MMDA 5ABEA 1I94T 3WI3A 3N2KE 4H9SE 3T8OA 2NW8A 3OVUA 3HL6A 3AEGA 4HFCA 3AE4A 5FNVE 5FXZA 4B3ST 3I9YA 4DMWA 3LFMA 3FBLA 3LSVA 2FJAA 4UV9B 2PJQA 4J2CA 2W61A 3ZMZB 2CBJA 3LG7A 2CHNA 1G8XA 1N32T 4L9IA 4ZS2A 3I0OA 4KUMB 2DL1A 4X1YE 4K0UA 1IBKT 2W67A 2FUPA 3VJZA 3PUXF 4OX9T 3AE7A 3HR0A 2L8KA 3GMIA 4AISA 3AE1A 4JI8T 5CA1E 5EK4A 3ZJ2A 5CJ5A 5FVKA 1E2AA 5HXHA 2Q9QB 4ZHQE 3ZLIA 3FXEB 2X9HA 5FZTA 4UVCB 5FXWA 3JAEA 3AVSA 3SOLA 3KDSE 1ZOYA 2XAQB 2IW5B 5JDQA 2AXDS 1D1BA 3S4UA 5JR9C 2CPTA 5LB7B 5JREA 4A97A 3FXDB 5C2TA 4OYJA 2V6XA 4ERRA 1OEDB 2BKPA 2E9XD 3EUHA 3WAKA 4DBRA 4LF5T 4X20E 5FXVA 3P4QA 5IYZE 2VURA 3OJAA 3PUWF 3D0TA 1MMAA 5L3EB 3JC6C 2LM9A 2NOXA 1GQEA 3T1YT 5M4YA 2IUBA 1W9RA 5JDLA 3IEEA 3Q9DA 4WZXA 4DR1T 4DR7T 5LHHB 4L5GA 5LYJE 2EHOB 3OTOT 4DMVA 2UXDT 3ESLA 3ZN1B 3C4ZA 3DYJA 2N9DA 2PG8A 4PFPA 2LSIA 1D0XA 1EZ3A 4QXHB 2LSGA 4CXYA 2VASA 2WQYA 2H89A 5ABFB 3ANWA 4JBWF 2C5JA 5BR8T 1W0BA 3RPUA 4YTNA 5LGTB 1UCUA 2WY2A 5JRCB 3T1HT 1SUMB 4TUYE 2A3DA 2CXDA 4WW0A 4ECGA 4HFIA 2D9DA 2RP4A 2I59A 4DR4T 4NXNT 3ZPOA 4PJMA 4U2ZA 4N78D 2MBGA 3LK2B 1HG2A 2JQ9A 4IE0A 3K3OA 1KNRA 2WB5A 4DR2T 2XPKA 2WMNA 3N2OA 3GN5A 3RIFA 2WS3A 2FJBA 3ZMUB 1OEDE 4BAYB 5LXTE 4BGOA 3KBTA 3NKZA 5HCJA 5HXCA 4ASKA 2BKOA 2FBWA 3C98B 2XQ3A 3WURA 3F2EA 3PUAA 2E9XA 3AEDA 1OXZA 3N9QA 2CWYA 1WLXA 2LSJA 2Y6XA 4PW8A 4QHOA 5KDMC 2X68A 2V5DA 3UTKA 1LRZA 4G63A 3VR9A 1HNZT 5F3JA 2LE8A 2WWUA 4PJLA 4P0BA 5AQTB 2RPAA 1MNDA 2HPJA 3C4XA 1IJ6A 2KWHA 2MYSA 1N33T 3PUZF 2X66A 2XSBA 3ZKRA 5J0ZA 2CRBA 2VKOA 4AQYT 1KNPA 3N9LA 1D0YA 2X9WA 3AXJB 5L47A 1U4QA 2L9QA 1IBMT 5FKYA 2NP9A 1UX4A 3CMLA 2WZIA 4HWIB 1T7SA 5LG3A 2YEVC 4KI0F 2A2FX 1ZEEA 3I9WA 2QGSA 2W0GA 1CHUA 2KBBA 5HEOA 4PK4A 4H9NC 3AY5A 3AA6B 3I1AA 1XDPA 5DQWA 4ZI2C 3UU5A 3OYZA 1WYBA 3ZCJA 3IA3A 2PTFA 2XY8B 2WZHA 3QNUA 3P4WA 5E0OA 3LDQB 3K3NA 1M62A 2XAGB 5AQJB 4ZEYA 3X1DA 4EAHA 5LOVE 4JUYA 3Q5XA 2BG9A 4I43B 2K48A 4H9OC 3NBXX 2BVMA 1BR4A 2HPLA 2VL8A 3N9NA 3BQIA 3N9PA 4EZHA 2IHR1 4PK6A 2BG9B 2YU1A 4HFEA 4B3MT 2VQET 4AKRB 4HFBA 1YKEB 1X79A 3CQGB 3KV5A 2XQ4A 1NWMX 2R6GF 5KMGP 2GK9A 1KF6A 4GKKT 5HEGA 3DP7A 4B6XA 4DUZT 1WCRA 4K0KT 2PFVA 1SE7A 3CQCB 4XBFB 4TN7B 5AQOB 3KVBA 4LF8T 5FY7A 3CX7B 2Y8DA 2CCQA 2NR4A 3QB5A 4HWHA 3AEFA 2H7OA 2UXBT 1R8IA 3UQ4A 2XUEA 2DLRA 4ZZCA 3UU8A 4MHCA 3AE9A 4IL9A 1XZYA 1SA0E 2N2NA 4QH4A 3H3AA 1Z8UA 2ODVA 3PUVF 2IMLA 3ABVA 3ZN0B 3AA0B 3ZYKA 4ZOLE 4OK0A 2BS3A 5L3DB 3AE3A 1BR2A 2Q9QD 2D0TA 5CGMA 2C0SA 4EIWA 3KV9A 2L10A 4WBNE 5DJQC 3SRZA 5LHGB 2V1DB 3KINB 2WMOA 1XNQT 2K3WA 4H9PC 2XQAA 3NVOA 4H63V 3J7Yq 2BG9E 5J2TE 4YT0A 4KHPT 3A5XA 3NZPA 3JADA 2W2UA 3QOFA 3AE2A 4HWDA 3O4XE 1ZV4X 3B13A 1J5WA 3PURA 4U72A 1S94A 3N9OA 3P4RA 4CN4A 3PV0F 5L4EA 3N9MA 3HKCE 1O3XA 2EHOD 2MTCA 4KX6A 1MIWA 4X64T 2OLTA 4OFZA 2CLYB 2XQYA 4TNWA 2J1DG 5AQVB 3AT7A 2BVLA 3AVRA 5L3GB 4DV1T 2MTQA 2VKJA 1MIYA 4IDPA 3UUMA 3P7IA 3F31A 4EEDA 3VR8A 5FL0A 2P9BA 3RQWA 3Q5WA 4QH5A 3UFGA 2X0CA 1HFAA 4X66T 1XMOT 3ZMSB 1HR0T 2FJEA 3ZYLA 3U78A 2UUBT 1T8BA 3NWIA 3FB2A 3LJCA 1SJ8A 1I6ZA 4MALA 4MFRA 5A1LA 2MPKA 3MXZA 4ANJA 3EVYA 5LMNT 2E9XC 1KFYA 3RYIE 4HE8A 4UEMA 3ZJ1A 2Q9QA 3AB3B 4EGWA 2NTXA 4UVBB 2KSRA 3PHF1 4DV3T 5EK3A 2B1EA 3UULA 1IJ5A 3RF1A 4DVDA 5AQHB 4E7ZA 2HHHT 3GWHA 4X62T 4JI0T 2K9AA 5HEUA 4CQIA 3CX8B 1M7KA 4DV4T 4FI5A 5DABA 3RIUA 4UELA 3ZSTA 3EAMA 2X51A 4O4IE 2QYWA 5H6RB 2UU9T 1OEDA 2JQHA 2B76A 4Z8XA 4LFCT 4H9QC 4IE4A 1XNRT 4PK5A 3IHRA 4TWHA 4U33A 4XAXB 5HXRA 2H7VC 4CI1B 2CHOA 3A7MA 4LF9T 2JQKA 3AEBA 1ZP0A 2JRKA 4COFA 2N1GA 1WYCA 2WP9A 4YJ3E 3FZLB 3AEEA 2BBHA 2IIUA 3FZKB 4IE5A 3CPZA 5LG4A 4HN9A 5HCMA 3ZCIA 2VWAA 4DR5T 2CWOA 2EHOA 4E7SA 4TWFA 5FYMA 4ISSA 3PU3A 5L3BB 1UURA 4HKAA 2LKHA 3OBVE 2L7NA 2XQ7A 3QC9A 1W09A 1YQ3A 3UU3A 4KBMB 3V5UA 4YSXA 3RRWA 4P0AA 2VQFT 4P1NA 1WR6A 5ABFA 5LCYA 1OWAA 2K5BB 4AXPA 2VK9A 2LKGA 3BK9A 4XZCA 1E1HB 5FL1A 5L3FB 5ABGA 1FEWA 4HWCA 4IGUA 3PJAA 5HXSA 1V9DA 5AQQB 2DI4A 2ODUA 2I0MA 4NIQA 3ONXA 2I6HA 2XHEB 5JRCA 2YDRA 2LHNA 3RX6A 3DTOA 4O2AE 2VVSA 4LMLA 4FJOA 3DJBA 3I0QA 3PUYF 4I55E 4UF0A 3M65A 3AE6A 3ZT6A 1US7B 2ZM8A 4UF0B 3KVAA 3UT5E 1NAFA 5CB4E 5CFBA 2UUCT 4EYUA 2V7KA 5IHYA 3EABA 4AKHA 2C5IT 4DBQA 5HYAA 2XM2A 3ZT7A 3PTRB 5AQIB 4UVAB 2D2SA 3FYQA 4LF7T 3C64A 2VL0A 4DV6T 3ZC1A 4DUYT 2L3LA 4DNDA 2KNDA 2CM0A 1QUUA 5JVDE 1QSDA 2XQ6A 4YSYA 3RC3A 2DCFA 3KBUA 4IREA 1T98A 5FVLA 4IIJE 5JQGE 2KINB 3H37A 5LHIB 5J2UE 4U31A 1FJGT 3CIRA 1D1CA 2NW7A 5C3JA 3FZFB 3UU6A 1VRBA 2MAWA 3PU8A 4YFSA 1VCSA 5HWYA 2KLQA 2CMRA 4IDQA 5FP3A 2LM2A 3AXJA 3EDUA 4QXCB 2XQ8A 4ZI3D 5IUXA 3ONJA 4YXDA 3NRYA 3A8YC 4CXWA 4DV2T 4PFOA 3L8RA 5JR9A 4U7IA 3QUJA 2M6BA 4JLEA 4IDOA 2E2AA 3VKHA 3HKDE 5JDHA 2LSKA 5JR9B 2LOSA 2LRKA 2ES0A 4YJ2E 4JV5T 2UUAT 3SWHA 3O1HA 2XM1A 1HNWT 3HKEE 1HCIA 2V26A 2W66A 4ILAA 5HEJA 1NENA 3AAIA 2X67A 4HTEA 4Z90A 1XDOA 1SHZC 4U2YA 5AQLB 4QKNA 3AA1B 2LSYA 2X9YA 3CKDA 1MIVA 5J1GA 5DQVA 1Y01A 2DWGA 4UXNB 1J5ET 2UXXB 2V7MA 2WDRA 4O4HE 2UXNB 4PJJA 4H9RC 3RQUA 1E7PA 5FXXA 5LBMA 4LF4T 3NRXA 3PF0A 5JDFA 2JMKA 4WYVA 3BQLA 2V5CA 3SFDA 1HF8A 2BS4A 2CEAA 1XWMA 4AKLA 3GA8A 4QX7B 4UIGA 3MA9A 2Q9QC 4A5XA 4HFHA 1CUNA 4UR9A 1D0ZA 2PBIA 3ZYMA 3ZC0A 2WAUA 3AECA 3CWZB 4H63H 5BMVE 3AA7B 2YU2A 3MKDA 3AEAA 2IAKA 3P50A 1HS7A 4DO0A 3TLTA 3EHZA 4WBOA 3EI0A 4AIUA 4A56A 1OEDC 4PNIA 5TAOA 5HAXA 5LMUT 5FMNA 4EYYR 5JDNA 2D0UA 5H6QB 2JIWA 4CI2B 3AE8A 2V6YB 2ZM6T 4ILBA 3LBXA 5JTGA 1DU2A 3RLFF 3QB5K 4U74A 5AQFB 2JMHA 3RYFE 3ETVA 3VRBA 2EHOC 3CX6B 3LBXB 5ABHA 2LOPA 1T72A 1UX5A 4TZ4C 2ACZA 4GOUA 2E8IA 4F7GB 3JCFA 2RA1A 4O2BE 3RYHE 4JI2T 3OPCA 4ILCA 3LK42 2NWBA 2ZM2A 4OYKA 4DIDB 2DWKA 4EB6E 4HEAA 1HG5A 4EXTA 2LEHA 1YW0A 1FMWA 5JH7E 3HKBE 3CVRA 4TNVA 4QX8B 2XZEA 4X1IE 2W00A 3VKGA 4MBQA 3AAAB 4LMKA 3ZMTB 1N36T 1U5PA 5FY0A 3QK6A 2CA5A 4ADZA 4TV8E 1BR0A 4IL4A 2ZLYA 2VKHA 3RGLA 2YINA 1S35A 2LRLA 3R6NA 4QWNB 3ZEFB 3PUGA 4JEHB 2YK0A 3RKOA 3H3MA 3LK3B 2HN2A 2LQUA 4YTMA 2ACXA 2IC6A 4AQGA 4X1KE 1JNZA 4EEBA 3R84B 4Z91A 1ZHCA 5T1DA 3TLSA 4HGAA 3M1CA 2C5KT 5LGNB 1HX8A 5AQPB 3P4PA 2BDEA 4ZZBA 4GK0E 3Q5DA 3RIAA 4ZI7E 3V5SA 4TV9E 3E22E 2AE9A 1MMGA 3WAJA 3PUSA 4M1PA 4NUUA 2KT9A 3VRAA 4O4JE 1HNXT 3O1IA 3FZHB 2LLYA 4GIWA 4YSZA 4AQFA 2UXCT 4CN1A 2W62A 4DV0T 4QH1A 5AFUL 2V8SV 2KZ7B 3J9X1 1FMVA 4QXBB 2XAJB 3TKLB 2ZMAA 3TLVA 1ZKEA 3O1JA 1BR1A 2CXFA 4DR3T 1UGOA 2E5LT 4DR6T 1SJ7A 3M3ZB 4YTPA 3E08A 4Q25A 4IE7A 3C4WA 3MACA 5L4HA 5FY1A 2G0UA 2LT3A 2JJ9A 2IDOB 3C51A 3TLWA 4W8PA 4G2AA 4GKJT 4I0UA 4LFBT 3SS1A 5ADXL 2XAFB 1Y64B 1JNRA 2WDVA 4BJNA 2BBJA 2KMFA 4JI7T 2X0HA 2V7JA 4DV5T 4C91A 4X5TA 3ZT5A 2J47A 5CA0E 5AQKB 4A98A 1YKHB 1H7CA 3B5MA 1B7TA 4TWDA 4TX5A 3EDVA 4ISTA 2BG9C 4JYAT 4LFAT 4JI1T 3JAFA 4IE6A 3K3QC 4L0RA 4BA9A 4NXMT 5JDMA 3ANWB 2NTYA 1G73A 3RRCA 3JC6D 4CI3B 4X65T 3NZQA 2WWVA 3TLUA 2HN1A 3OYXA 2BKNA 1YXRA 4I4TE 2XJ7A 2LJLA 4IHJE 3KV6A 2WDQA 3IBPA 2HH7A 4ZI3C 5JDGA 4AI6A 3P8CD 4B3RT 5F5WA 2WSSV 3G06A 4KP3C 4ZXLA 4LMJA 5AQGB 1VCTA 3L39A 5AQNB 5LJNA 2SPCA 4F6RC 2WU5A 4JI5T 3VU7H 5KXJA 4IT4A 3GN5B 2X0YA 2CXLA 3PJAJ 1AJ3A 2Z6EA 5AQMB 3RHWA 2K24A 4NPPA 4OHFA 3W15B 2H88A 3P4SA 4ZS3A 4GYRA 4YHJA 2V7IA 4IDZA 3RI5A 1J1JA 2E9XB 3MJXA 2WCAA 2E5VA 2X9XA 3WSCA 2KGXA 3HA4A 5AQSB 2XASB 2FJDA 2A72A 2BS2A 2OA5A 5EK2A 1D1AA 3IF8B 2KXPB 1YQ4A 4KHZF 2VKDA 2J62A 4U7YA 4UV8B 2X0LB 5LGUB 5L2LA 5F8PA 3UUBA 2WM9A 2W4XA 2J4GA 1UUSA 4EV6A 3FBZA 4EOZB 2VVNA 1IBLT 4ONRA 1IZNB 2BZBA 2VB6A 3F57A 1HTJF 1FIOA 2DNXA 3L3PA 2KVPA 4JI6T 3B57A 3UUNA 4AKGA 4CN6A 4CZZB 1UK5A 3ZMVB 3MK7C 4YHHT 3N2GE 2F4VT 1MMNA 2CLYC 3ZSSA 4V1Av 2W63A 2M6IA 3CQXC 4NUVA 3RKGA 4JI4T 3KV4A 3RC8A 5HWXA 2XTLA 4MLKA 4F8HA
chains in the Genus database with same CATH topology
2XAHB 4CQIA 5KX5E 3CX8B 1UX5A 4FI5A 2WMNA 4TZ4C 3N2OA 5DABA 5EZYE 3GN5A 4UELA 4GOUA 3ZMUB 2E8IA 2X51A 4BAYB 4O4IE 5LXTE 5H6RB 4BGOA 2RA1A 1LKXA 3KBTA 4O2BE 3RYHE 1VOMA 5ETWA 2M67A 5HXCA 4ASKA 4Z8XA 3C98B 4H9QC 4IE4A 3LK42 3PDYA 3WURA 2NWBA 2ZM2A 3F2EA 4PK5A 4OYKA 2NW9A 3IHRA 2DWKA 3PUAA 2E9XA 4EB6E 4HEAA 4XAXB 1HG5A 5HXRA 3PUQA 2H7VC 2IC9A 3N9QA 1OXZA 4EXTA 2CWYA 4CI1B 2LEHA 1YW0A 1LVFA 3MZKB 1FMWA 5JH7E 3HKBE 2JRKA 3CVRA 4QX8B 3VHLA 1WLXA 2N1GA 1WYCA 2LSJA 4X1IE 2W00A 4YJ3E 3VKGA 4MBQA 3AAAB 2Y6XA 4PW8A 3E0ZA 4IE5A 3ZMTB 3CPZA 5LG4A 4HN9A 4QHOA 3ZCIA 1MNEA 5KDMC 4WNKA 2D5UA 2VWAA 4ZI2D 1U5PA 5FY0A 3HI2A 2X68A 3QK6A 2CWOA 2EHOA 4E7SA 2CA5A 1LRZA 3UTKA 4ADZA 4G63A 5FYMA 4TV8E 4ISSA 1BR0A 3PU3A 5L3BB 2ZLYA 4KMCA 4GK5E 5F3JA 5HXEA 4HKAA 2LE8A 1IAPA 2WWUA 5L3CB 4PJLA 3N5LA 1KK7A 2VKHA 3OBVE 2YINA 1S35A 4P0BA 2QA7A 5GONE 3QC9A 3C50A 1MNDA 4KBMB 3V5UA 2HPJA 3R6NA 3C4XA 4QWNB 1IJ6A 2KWHA 3RRWA 3ZEFB 4P0AA 3PUGA 4JEHB 1WR6A 3KFWX 2MYSA 2LHRA 5LCYA 2X66A 2YK0A 3U3IA 1OWAA 3RKOA 3LK3B 2K5BB 4AXPA 2VK9A 5LP6E 3BK9A 2LQUA 4XZCA 1E1HB 5L3FB 2VKOA 1FEWA 2DHRA 1Z0PA 1D0YA 3N9LA 4IGUA 2X9WA 5HXSA 2ACXA 3L09A 1V9DA 1U4QA 2IC6A 2L9QA 3PE0A 4I50E 2DI4A 2ODUA 4ILUA 4X1KE 4AQFC 2JPFA 4AQGA 4HFVA 2NP9A 1UX4A 3ONXA 3CMLA 2H3RA 4YLHA 2XHEB 5JRCA 3K8PC 3R84B 1ZHCA 5T1DA 4C90A 2LHNA 3RX6A 3DTOA 4BJMA 4O2AE 2YEVC 2A2FX 3Q2MA 4HGAA 1ZEEA 3OKQA 5LNKA 3I9WA 3M1CA 2QGSA 2W0GA 4FJOA 3DJBA 4JEUB 2C5KT 5LGNB 1HX8A 3I0QA 1KNZA 2BDEA 4PK4A 2MOZA 4O4LE 4I55E 4UF0A 1LVKA 3M65A 4H9NC 4GK0E 3AA6B 4ZI7E 3I1AA 1YD8G 3V5SA 4TV9E 5DQWA 3E22E 3BQKA 4ZI2C 2Y48B 1MMGA 3OYZA 3FHNA 1WYBA 1US7B 3ZCJA 2ZM8A 4UF0B 3WAJA 3PUSA 3KVAA 4M1PA 4NUUA 1NAFA 3UT5E 5CB4E 5LJMA 4PJNA 2KT9A 2CE7A 4EZ4A 4EYUA 2WBLA 2V7KA 4O4JE 5IHYA 5E0OA 4AKIA 2V7LA 3O1IA 4AKHA 2C5IT 4P09A 4DBQA 5HYAA 4CXXA 4GYSA 3RYCE 4GIWA 3AAEB 3K3NA 4AQFA 1WRDA 2W62A 3PTRB 3O9XA 5LBQB 5AFUL 2XAGB 2KZ7B 3J9X1 1FMVA 2D2SA 4UVAB 3RH3A 3C64A 4PAGA 5LA6E 3ZC1A 4QXBB 4EAHA 2XAJB 3TKLB 5LOVE 2ZM0A 2KWIB 2JQQA 2L3LA 2ZMAA 2KNDA 4DNDA 2CM0A 4JUYA 1QUUA 5JVDE 3UFEA 1QSDA 1ZKEA 3O1JA 1BR1A 2CXFA 3Q5XA 4I43B 2K48A 4H9OC 3NBXX 5C8YE 3UUXB 3RC3A 2DCFA 2BVMA 1BR4A 3KBUA 2HPLA 2VL8A 3ETUA 3N9NA 3BQIA 3N9PA 1T98A 4EZHA 4PK6A 4IIJE 4O8SA 5JQGE 2KINB 3H37A 3E08A 5LHIB 5J2UE 2YU1A 4IE7A 3C4WA 3MACA 1D1CA 2NW7A 1MMDA 4AKRB 5FY1A 2G0UA 2LT3A 2JJ9A 3C51A 1YKEB 1X79A 1VRBA 3N2KE 3PU8A 4YFSA 3WI3A 4H9SE 3T8OA 2NW8A 3CQGB 3HL6A 3KV5A 5HWYA 2KLQA 4G2AA 2CMRA 5FP3A 1NWMX 5KMGP 2GK9A 3SS1A 5ADXL 2XAFB 5FNVE 1Y64B 5FXZA 4BJNA 3DP7A 3I9YA 2KMFA 4B6XA 3EDUA 4QXCB 4ZI3D 4DMWA 3LFMA 2PFVA 3FBLA 3CQCB 4UV9B 3NRYA 2PJQA 4J2CA 2V7JA 2W61A 3ZMZB 4CXWA 4XBFB 4C91A 3LG7A 4PFOA 5CA0E 1G8XA 4TN7B 5JR9A 1YKHB 4L9IA 4ZS2A 3QUJA 3KVBA 1H7CA 3I0OA 4JLEA 4KUMB 1B7TA 5FY7A 3CX7B 2Y8DA 3VKHA 4X1YE 4K0UA 2CCQA 4TX5A 3EDVA 3HKDE 5JDHA 2LSKA 4ISTA 3VJZA 2H7OA 5JR9B 2LOSA 3HR0A 2L8KA 2XUEA 2ES0A 2DLRA 4IE6A 4YJ2E 4MHCA 3SWHA 3O1HA 3GMIA 1SA0E 3K3QC 4L0RA 4BA9A 2N2NA 5JDMA 3ANWB 3HKEE 1HCIA 2NTYA 3H3AA 2V26A 2ODVA 1G73A 3RRCA 5CA1E 3JC6D 4CI3B 5EK4A 3ZN0B 3NZQA 3ZJ2A 3AAIA 3AA0B 3ZYKA 2X67A 4HTEA 4ZOLE 4OK0A 5L3DB 3OYXA 1BR2A 2Q9QD 1SHZC 2D0TA 4QKNA 2C0SA 3AA1B 2LSYA 2X9YA 4EIWA 4I4TE 3CKDA 5HXHA 1MIVA 5J1GA 3KV9A 2LJLA 4IHJE 5DQVA 3KV6A 2Q9QB 4WBNE 4ZHQE 2DWGA 3IBPA 4UXNB 5DJQC 3ZLIA 2HH7A 3FXEB 4ZI3C 2X9HA 5JDGA 4AI6A 4UVCB 5FXWA 3P8CD 3SRZA 5LHGB 3AVSA 2V1DB 3KINB 2WMOA 2WSSV 4H9PC 3SOLA 2UXXB 3KDSE 4H63V 2V7MA 3J7Yq 5J2TE 4KP3C 2XAQB 2IW5B 5JDQA 4O4HE 2UXNB 4PJJA 3A5XA 3NZPA 1D1BA 4H9RC 3S4UA 5LJNA 5JR9C 2SPCA 4F6RC 3VU7H 5FXXA 5LBMA 5JREA 3GN5B 3O4XE 2CXLA 1AJ3A 2Z6EA 3FXDB 3NRXA 2K24A 4OYJA 3PF0A 5JDFA 4ERRA 1ZV4X 3B13A 2JMKA 2E9XD 4OHFA 3EUHA 3W15B 3WAKA 3PURA 3BQLA 4ZS3A 4GYRA 4DBRA 4YHJA 4X20E 4U72A 5FXVA 5IYZE 1S94A 2V7IA 3N9OA 4IDZA 3OJAA 2E9XB 1HF8A 3MJXA 3D0TA 1MMAA 2CEAA 2X9XA 5L3EB 3WSCA 3JC6C 4AKLA 3HA4A 2LM9A 3N9MA 2NOXA 3GA8A 4QX7B 4UIGA 3HKCE 1O3XA 2XASB 5M4YA 3MA9A 2EHOD 2Q9QC 2MTCA 2A72A 2OA5A 5JDLA 1CUNA 1MIWA 5EK2A 3IEEA 4OFZA 3Q9DA 1D1AA 2CLYB 3IF8B 1D0ZA 2KXPB 4L5GA 2XQYA 5LHHB 2J1DG 3AT7A 5LYJE 2EHOB 2PBIA 2BVLA 3AVRA 2VKDA 5L3GB 4UV8B 3ZYMA 4DMVA 2X0LB 3ZC0A 2MTQA 2VKJA 2WAUA 5LGUB 3ESLA 5L2LA 5F8PA 3ZN1B 3C4ZA 1MIYA 2N9DA 3CWZB 4H63H 5BMVE 3UUMA 2PG8A 3AA7B 4PFPA 2LSIA 2WM9A 1D0XA 3P7IA 3F31A 2YU2A 2P9BA 1EZ3A 3MKDA 2IAKA 3Q5WA 4QXHB 2LSGA 4CXYA 2VASA 3FBZA 1HS7A 4EOZB 3K3OA 4DO0A 1HFAA 3ANWA 2C5JA 4ONRA 4WBOA 3ZMSB 1IZNB 3ZYLA 3U78A 4A56A 3RPUA 4PNIA 2BZBA 5TAOA 3FB2A 2VB6A 5HAXA 3LJCA 5LGTB 4MALA 4MFRA 1UCUA 5A1LA 3F57A 5FMNA 1HTJF 4EYYR 3MXZA 4ANJA 1FIOA 3EVYA 5JDNA 2D0UA 2E9XC 5H6QB 4CI2B 2DNXA 3L3PA 5JRCB 3RYIE 4HE8A 4UEMA 3B57A 3UUNA 4AKGA 4TUYE 3ZJ1A 2A3DA 2CXDA 3LBXA 4CZZB 3ZMVB 2Q9QA 3AB3B 3MK7C 2NTXA 4WW0A 3N2GE 4ECGA 4UVBB 2RP4A 3PHF1 4U74A 1MMNA 2I59A 2CLYC 2JMHA 5EK3A 3RYFE 2B1EA 3ETVA 4V1Av 3UULA 2W63A 1IJ5A 4DVDA 3ZPOA 2EHOC 4PJMA 3CX6B 3CQXC 3LBXB 4NUVA 4E7ZA 3GWHA 2K9AA 2LOPA 3KV4A 4N78D 2MBGA 3RC8A 3LK2B 1HG2A 5HWXA 4IE0A 2XTLA 4MLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXH A;  5JDH A;  5HYA A;  5JDF A;  5JDL A;  5JDN A;  5HXR A;  5HWY A;  5JDG A;  5HXE A;  3V5S A;  5HXS A;  5HXC A;  5HWX A;  5JDM A;  3V5U A;  5JDQ A; 
#chains in the Genus database with same CATH topology
 2XAH B;  5KX5 E;  5EZY E;  4JI3 T;  2QVA A;  2YOE A;  1LKX A;  1VOM A;  5ETW A;  2M67 A;  5HEH A;  4HFD A;  1N34 T;  2YN6 A;  3PDY A;  2NW9 A;  3PUQ A;  2IC9 A;  5AQU B;  3MZK B;  1LVF A;  3VHL A;  2XQ9 A;  3E0Z A;  5AQR B;  1MNE A;  4WNK A;  2D5U A;  4ZI2 D;  3HI2 A;  4KMC A;  4GK5 E;  1HX1 B;  5HXE A;  1IAP A;  5L3C B;  3N5L A;  1KK7 A;  2QA7 A;  5GON E;  4B3T T;  3C50 A;  3AE5 A;  3KFW X;  2LHR A;  3U3I A;  5LP6 E;  4U3C A;  2DHR A;  1Z0P A;  3L09 A;  3RIU C;  3PE0 A;  4I50 E;  4AQF C;  4ILU A;  2JPF A;  4HFV A;  2V6Y A;  2H3R A;  4YLH A;  3K8P C;  4C90 A;  4BJM A;  3Q2M A;  3OKQ A;  5LNK A;  4JEU B;  1QLB A;  3CK6 A;  1KNZ A;  3ONL C;  1L0V A;  4DV7 T;  2MOZ A;  4O4L E;  1LVK A;  1YD8 G;  3BQK A;  2Y48 B;  3FHN A;  2XSA A;  3FZM B;  2OV9 A;  1NEK A;  5LJM A;  4PJN A;  2CE7 A;  4EZ4 A;  2WBL A;  4AKI A;  2V7L A;  4P09 A;  4CXX A;  2YKS A;  4GYS A;  3RYC E;  3UQ7 A;  3AAE B;  4YY3 T;  1WRD A;  3O9X A;  5LBQ B;  2XQ5 A;  1WFD A;  1W0A A;  2QRX A;  2YDQ A;  3RH3 A;  5IWA T;  4PAG A;  2CBI A;  4HWF A;  5LA6 E;  1WR0 A;  2ZM0 A;  2KWI B;  2JQQ A;  2YDS A;  3K1S A;  2WU2 A;  3UFE A;  5C8Y E;  3UUX B;  4IDN A;  3ETU A;  3SFE A;  3Q5E A;  1X9B A;  1KEY A;  4O8S A;  2A9U A;  3UU4 A;  4LF6 T;  1XMQ T;  1MMD A;  5ABE A;  1I94 T;  3WI3 A;  3N2K E;  4H9S E;  3T8O A;  2NW8 A;  3OVU A;  3HL6 A;  3AEG A;  4HFC A;  3AE4 A;  5FNV E;  5FXZ A;  4B3S T;  3I9Y A;  4DMW A;  3LFM A;  3FBL A;  3LSV A;  2FJA A;  4UV9 B;  2PJQ A;  4J2C A;  2W61 A;  3ZMZ B;  2CBJ A;  3LG7 A;  2CHN A;  1G8X A;  1N32 T;  4L9I A;  4ZS2 A;  3I0O A;  4KUM B;  2DL1 A;  4X1Y E;  4K0U A;  1IBK T;  2W67 A;  2FUP A;  3VJZ A;  3PUX F;  4OX9 T;  3AE7 A;  3HR0 A;  2L8K A;  3GMI A;  4AIS A;  3AE1 A;  4JI8 T;  5CA1 E;  5EK4 A;  3ZJ2 A;  5CJ5 A;  5FVK A;  1E2A A;  5HXH A;  2Q9Q B;  4ZHQ E;  3ZLI A;  3FXE B;  2X9H A;  5FZT A;  4UVC B;  5FXW A;  3JAE A;  3AVS A;  3SOL A;  3KDS E;  1ZOY A;  2XAQ B;  2IW5 B;  5JDQ A;  2AXD S;  1D1B A;  3S4U A;  5JR9 C;  2CPT A;  5LB7 B;  5JRE A;  4A97 A;  3FXD B;  5C2T A;  4OYJ A;  2V6X A;  4ERR A;  1OED B;  2BKP A;  2E9X D;  3EUH A;  3WAK A;  4DBR A;  4LF5 T;  4X20 E;  5FXV A;  3P4Q A;  5IYZ E;  2VUR A;  3OJA A;  3PUW F;  3D0T A;  1MMA A;  5L3E B;  3JC6 C;  2LM9 A;  2NOX A;  1GQE A;  3T1Y T;  5M4Y A;  2IUB A;  1W9R A;  5JDL A;  3IEE A;  3Q9D A;  4WZX A;  4DR1 T;  4DR7 T;  5LHH B;  4L5G A;  5LYJ E;  2EHO B;  3OTO T;  4DMV A;  2UXD T;  3ESL A;  3ZN1 B;  3C4Z A;  3DYJ A;  2N9D A;  2PG8 A;  4PFP A;  2LSI A;  1D0X A;  1EZ3 A;  4QXH B;  2LSG A;  4CXY A;  2VAS A;  2WQY A;  2H89 A;  5ABF B;  3ANW A;  4JBW F;  2C5J A;  5BR8 T;  1W0B A;  3RPU A;  4YTN A;  5LGT B;  1UCU A;  2WY2 A;  5JRC B;  3T1H T;  1SUM B;  4TUY E;  2A3D A;  2CXD A;  4WW0 A;  4ECG A;  4HFI A;  2D9D A;  2RP4 A;  2I59 A;  4DR4 T;  4NXN T;  3ZPO A;  4PJM A;  4U2Z A;  4N78 D;  2MBG A;  3LK2 B;  1HG2 A;  2JQ9 A;  4IE0 A;  3K3O A;  1KNR A;  2WB5 A;  4DR2 T;  2XPK A;  2WMN A;  3N2O A;  3GN5 A;  3RIF A;  2WS3 A;  2FJB A;  3ZMU B;  1OED E;  4BAY B;  5LXT E;  4BGO A;  3KBT A;  3NKZ A;  5HCJ A;  5HXC A;  4ASK A;  2BKO A;  2FBW A;  3C98 B;  2XQ3 A;  3WUR A;  3F2E A;  3PUA A;  2E9X A;  3AED A;  1OXZ A;  3N9Q A;  2CWY A;  1WLX A;  2LSJ A;  2Y6X A;  4PW8 A;  4QHO A;  5KDM C;  2X68 A;  2V5D A;  3UTK A;  1LRZ A;  4G63 A;  3VR9 A;  1HNZ T;  5F3J A;  2LE8 A;  2WWU A;  4PJL A;  4P0B A;  5AQT B;  2RPA A;  1MND A;  2HPJ A;  3C4X A;  1IJ6 A;  2KWH A;  2MYS A;  1N33 T;  3PUZ F;  2X66 A;  2XSB A;  3ZKR A;  5J0Z A;  2CRB A;  2VKO A;  4AQY T;  1KNP A;  3N9L A;  1D0Y A;  2X9W A;  3AXJ B;  5L47 A;  1U4Q A;  2L9Q A;  1IBM T;  5FKY A;  2NP9 A;  1UX4 A;  3CML A;  2WZI A;  4HWI B;  1T7S A;  5LG3 A;  2YEV C;  4KI0 F;  2A2F X;  1ZEE A;  3I9W A;  2QGS A;  2W0G A;  1CHU A;  2KBB A;  5HEO A;  4PK4 A;  4H9N C;  3AY5 A;  3AA6 B;  3I1A A;  1XDP A;  5DQW A;  4ZI2 C;  3UU5 A;  3OYZ A;  1WYB A;  3ZCJ A;  3IA3 A;  2PTF A;  2XY8 B;  2WZH A;  3QNU A;  3P4W A;  5E0O A;  3LDQ B;  3K3N A;  1M62 A;  2XAG B;  5AQJ B;  4ZEY A;  3X1D A;  4EAH A;  5LOV E;  4JUY A;  3Q5X A;  2BG9 A;  4I43 B;  2K48 A;  4H9O C;  3NBX X;  2BVM A;  1BR4 A;  2HPL A;  2VL8 A;  3N9N A;  3BQI A;  3N9P A;  4EZH A;  2IHR 1;  4PK6 A;  2BG9 B;  2YU1 A;  4HFE A;  4B3M T;  2VQE T;  4AKR B;  4HFB A;  1YKE B;  1X79 A;  3CQG B;  3KV5 A;  2XQ4 A;  1NWM X;  2R6G F;  5KMG P;  2GK9 A;  1KF6 A;  4GKK T;  5HEG A;  3DP7 A;  4B6X A;  4DUZ T;  1WCR A;  4K0K T;  2PFV A;  1SE7 A;  3CQC B;  4XBF B;  4TN7 B;  5AQO B;  3KVB A;  4LF8 T;  5FY7 A;  3CX7 B;  2Y8D A;  2CCQ A;  2NR4 A;  3QB5 A;  4HWH A;  3AEF A;  2H7O A;  2UXB T;  1R8I A;  3UQ4 A;  2XUE A;  2DLR A;  4ZZC A;  3UU8 A;  4MHC A;  3AE9 A;  4IL9 A;  1XZY A;  1SA0 E;  2N2N A;  4QH4 A;  3H3A A;  1Z8U A;  2ODV A;  3PUV F;  2IML A;  3ABV A;  3ZN0 B;  3AA0 B;  3ZYK A;  4ZOL E;  4OK0 A;  2BS3 A;  5L3D B;  3AE3 A;  1BR2 A;  2Q9Q D;  2D0T A;  5CGM A;  2C0S A;  4EIW A;  3KV9 A;  2L10 A;  4WBN E;  5DJQ C;  3SRZ A;  5LHG B;  2V1D B;  3KIN B;  2WMO A;  1XNQ T;  2K3W A;  4H9P C;  2XQA A;  3NVO A;  4H63 V;  3J7Y q;  2BG9 E;  5J2T E;  4YT0 A;  4KHP T;  3A5X A;  3NZP A;  3JAD A;  2W2U A;  3QOF A;  3AE2 A;  4HWD A;  3O4X E;  1ZV4 X;  3B13 A;  1J5W A;  3PUR A;  4U72 A;  1S94 A;  3N9O A;  3P4R A;  4CN4 A;  3PV0 F;  5L4E A;  3N9M A;  3HKC E;  1O3X A;  2EHO D;  2MTC A;  4KX6 A;  1MIW A;  4X64 T;  2OLT A;  4OFZ A;  2CLY B;  2XQY A;  4TNW A;  2J1D G;  5AQV B;  3AT7 A;  2BVL A;  3AVR A;  5L3G B;  4DV1 T;  2MTQ A;  2VKJ A;  1MIY A;  4IDP A;  3UUM A;  3P7I A;  3F31 A;  4EED A;  3VR8 A;  5FL0 A;  2P9B A;  3RQW A;  3Q5W A;  4QH5 A;  3UFG A;  2X0C A;  1HFA A;  4X66 T;  1XMO T;  3ZMS B;  1HR0 T;  2FJE A;  3ZYL A;  3U78 A;  2UUB T;  1T8B A;  3NWI A;  3FB2 A;  3LJC A;  1SJ8 A;  1I6Z A;  4MAL A;  4MFR A;  5A1L A;  2MPK A;  3MXZ A;  4ANJ A;  3EVY A;  5LMN T;  2E9X C;  1KFY A;  3RYI E;  4HE8 A;  4UEM A;  3ZJ1 A;  2Q9Q A;  3AB3 B;  4EGW A;  2NTX A;  4UVB B;  2KSR A;  3PHF 1;  4DV3 T;  5EK3 A;  2B1E A;  3UUL A;  1IJ5 A;  3RF1 A;  4DVD A;  5AQH B;  4E7Z A;  2HHH T;  3GWH A;  4X62 T;  4JI0 T;  2K9A A;  5HEU A;  4CQI A;  3CX8 B;  1M7K A;  4DV4 T;  4FI5 A;  5DAB A;  3RIU A;  4UEL A;  3ZST A;  3EAM A;  2X51 A;  4O4I E;  2QYW A;  5H6R B;  2UU9 T;  1OED A;  2JQH A;  2B76 A;  4Z8X A;  4LFC T;  4H9Q C;  4IE4 A;  1XNR T;  4PK5 A;  3IHR A;  4TWH A;  4U33 A;  4XAX B;  5HXR A;  2H7V C;  4CI1 B;  2CHO A;  3A7M A;  4LF9 T;  2JQK A;  3AEB A;  1ZP0 A;  2JRK A;  4COF A;  2N1G A;  1WYC A;  2WP9 A;  4YJ3 E;  3FZL B;  3AEE A;  2BBH A;  2IIU A;  3FZK B;  4IE5 A;  3CPZ A;  5LG4 A;  4HN9 A;  5HCM A;  3ZCI A;  2VWA A;  4DR5 T;  2CWO A;  2EHO A;  4E7S A;  4TWF A;  5FYM A;  4ISS A;  3PU3 A;  5L3B B;  1UUR A;  4HKA A;  2LKH A;  3OBV E;  2L7N A;  2XQ7 A;  3QC9 A;  1W09 A;  1YQ3 A;  3UU3 A;  4KBM B;  3V5U A;  4YSX A;  3RRW A;  4P0A A;  2VQF T;  4P1N A;  1WR6 A;  5ABF A;  5LCY A;  1OWA A;  2K5B B;  4AXP A;  2VK9 A;  2LKG A;  3BK9 A;  4XZC A;  1E1H B;  5FL1 A;  5L3F B;  5ABG A;  1FEW A;  4HWC A;  4IGU A;  3PJA A;  5HXS A;  1V9D A;  5AQQ B;  2DI4 A;  2ODU A;  2I0M A;  4NIQ A;  3ONX A;  2I6H A;  2XHE B;  5JRC A;  2YDR A;  2LHN A;  3RX6 A;  3DTO A;  4O2A E;  2VVS A;  4LML A;  4FJO A;  3DJB A;  3I0Q A;  3PUY F;  4I55 E;  4UF0 A;  3M65 A;  3AE6 A;  3ZT6 A;  1US7 B;  2ZM8 A;  4UF0 B;  3KVA A;  3UT5 E;  1NAF A;  5CB4 E;  5CFB A;  2UUC T;  4EYU A;  2V7K A;  5IHY A;  3EAB A;  4AKH A;  2C5I T;  4DBQ A;  5HYA A;  2XM2 A;  3ZT7 A;  3PTR B;  5AQI B;  4UVA B;  2D2S A;  3FYQ A;  4LF7 T;  3C64 A;  2VL0 A;  4DV6 T;  3ZC1 A;  4DUY T;  2L3L A;  4DND A;  2KND A;  2CM0 A;  1QUU A;  5JVD E;  1QSD A;  2XQ6 A;  4YSY A;  3RC3 A;  2DCF A;  3KBU A;  4IRE A;  1T98 A;  5FVL A;  4IIJ E;  5JQG E;  2KIN B;  3H37 A;  5LHI B;  5J2U E;  4U31 A;  1FJG T;  3CIR A;  1D1C A;  2NW7 A;  5C3J A;  3FZF B;  3UU6 A;  1VRB A;  2MAW A;  3PU8 A;  4YFS A;  1VCS A;  5HWY A;  2KLQ A;  2CMR A;  4IDQ A;  5FP3 A;  2LM2 A;  3AXJ A;  3EDU A;  4QXC B;  2XQ8 A;  4ZI3 D;  5IUX A;  3ONJ A;  4YXD A;  3NRY A;  3A8Y C;  4CXW A;  4DV2 T;  4PFO A;  3L8R A;  5JR9 A;  4U7I A;  3QUJ A;  2M6B A;  4JLE A;  4IDO A;  2E2A A;  3VKH A;  3HKD E;  5JDH A;  2LSK A;  5JR9 B;  2LOS A;  2LRK A;  2ES0 A;  4YJ2 E;  4JV5 T;  2UUA T;  3SWH A;  3O1H A;  2XM1 A;  1HNW T;  3HKE E;  1HCI A;  2V26 A;  2W66 A;  4ILA A;  5HEJ A;  1NEN A;  3AAI A;  2X67 A;  4HTE A;  4Z90 A;  1XDO A;  1SHZ C;  4U2Y A;  5AQL B;  4QKN A;  3AA1 B;  2LSY A;  2X9Y A;  3CKD A;  1MIV A;  5J1G A;  5DQV A;  1Y01 A;  2DWG A;  4UXN B;  1J5E T;  2UXX B;  2V7M A;  2WDR A;  4O4H E;  2UXN B;  4PJJ A;  4H9R C;  3RQU A;  1E7P A;  5FXX A;  5LBM A;  4LF4 T;  3NRX A;  3PF0 A;  5JDF A;  2JMK A;  4WYV A;  3BQL A;  2V5C A;  3SFD A;  1HF8 A;  2BS4 A;  2CEA A;  1XWM A;  4AKL A;  3GA8 A;  4QX7 B;  4UIG A;  3MA9 A;  2Q9Q C;  4A5X A;  4HFH A;  1CUN A;  4UR9 A;  1D0Z A;  2PBI A;  3ZYM A;  3ZC0 A;  2WAU A;  3AEC A;  3CWZ B;  4H63 H;  5BMV E;  3AA7 B;  2YU2 A;  3MKD A;  3AEA A;  2IAK A;  3P50 A;  1HS7 A;  4DO0 A;  3TLT A;  3EHZ A;  4WBO A;  3EI0 A;  4AIU A;  4A56 A;  1OED C;  4PNI A;  5TAO A;  5HAX A;  5LMU T;  5FMN A;  4EYY R;  5JDN A;  2D0U A;  5H6Q B;  2JIW A;  4CI2 B;  3AE8 A;  2V6Y B;  2ZM6 T;  4ILB A;  3LBX A;  5JTG A;  1DU2 A;  3RLF F;  3QB5 K;  4U74 A;  5AQF B;  2JMH A;  3RYF E;  3ETV A;  3VRB A;  2EHO C;  3CX6 B;  3LBX B;  5ABH A;  2LOP A;  1T72 A;  1UX5 A;  4TZ4 C;  2ACZ A;  4GOU A;  2E8I A;  4F7G B;  3JCF A;  2RA1 A;  4O2B E;  3RYH E;  4JI2 T;  3OPC A;  4ILC A;  3LK4 2;  2NWB A;  2ZM2 A;  4OYK A;  4DID B;  2DWK A;  4EB6 E;  4HEA A;  1HG5 A;  4EXT A;  2LEH A;  1YW0 A;  1FMW A;  5JH7 E;  3HKB E;  3CVR A;  4TNV A;  4QX8 B;  2XZE A;  4X1I E;  2W00 A;  3VKG A;  4MBQ A;  3AAA B;  4LMK A;  3ZMT B;  1N36 T;  1U5P A;  5FY0 A;  3QK6 A;  2CA5 A;  4ADZ A;  4TV8 E;  1BR0 A;  4IL4 A;  2ZLY A;  2VKH A;  3RGL A;  2YIN A;  1S35 A;  2LRL A;  3R6N A;  4QWN B;  3ZEF B;  3PUG A;  4JEH B;  2YK0 A;  3RKO A;  3H3M A;  3LK3 B;  2HN2 A;  2LQU A;  4YTM A;  2ACX A;  2IC6 A;  4AQG A;  4X1K E;  1JNZ A;  4EEB A;  3R84 B;  4Z91 A;  1ZHC A;  5T1D A;  3TLS A;  4HGA A;  3M1C A;  2C5K T;  5LGN B;  1HX8 A;  5AQP B;  3P4P A;  2BDE A;  4ZZB A;  4GK0 E;  3Q5D A;  3RIA A;  4ZI7 E;  3V5S A;  4TV9 E;  3E22 E;  2AE9 A;  1MMG A;  3WAJ A;  3PUS A;  4M1P A;  4NUU A;  2KT9 A;  3VRA A;  4O4J E;  1HNX T;  3O1I A;  3FZH B;  2LLY A;  4GIW A;  4YSZ A;  4AQF A;  2UXC T;  4CN1 A;  2W62 A;  4DV0 T;  4QH1 A;  5AFU L;  2V8S V;  2KZ7 B;  3J9X 1;  1FMV A;  4QXB B;  2XAJ B;  3TKL B;  2ZMA A;  3TLV A;  1ZKE A;  3O1J A;  1BR1 A;  2CXF A;  4DR3 T;  1UGO A;  2E5L T;  4DR6 T;  1SJ7 A;  3M3Z B;  4YTP A;  3E08 A;  4Q25 A;  4IE7 A;  3C4W A;  3MAC A;  5L4H A;  5FY1 A;  2G0U A;  2LT3 A;  2JJ9 A;  2IDO B;  3C51 A;  3TLW A;  4W8P A;  4G2A A;  4GKJ T;  4I0U A;  4LFB T;  3SS1 A;  5ADX L;  2XAF B;  1Y64 B;  1JNR A;  2WDV A;  4BJN A;  2BBJ A;  2KMF A;  4JI7 T;  2X0H A;  2V7J A;  4DV5 T;  4C91 A;  4X5T A;  3ZT5 A;  2J47 A;  5CA0 E;  5AQK B;  4A98 A;  1YKH B;  1H7C A;  3B5M A;  1B7T A;  4TWD A;  4TX5 A;  3EDV A;  4IST A;  2BG9 C;  4JYA T;  4LFA T;  4JI1 T;  3JAF A;  4IE6 A;  3K3Q C;  4L0R A;  4BA9 A;  4NXM T;  5JDM A;  3ANW B;  2NTY A;  1G73 A;  3RRC A;  3JC6 D;  4CI3 B;  4X65 T;  3NZQ A;  2WWV A;  3TLU A;  2HN1 A;  3OYX A;  2BKN A;  1YXR A;  4I4T E;  2XJ7 A;  2LJL A;  4IHJ E;  3KV6 A;  2WDQ A;  3IBP A;  2HH7 A;  4ZI3 C;  5JDG A;  4AI6 A;  3P8C D;  4B3R T;  5F5W A;  2WSS V;  3G06 A;  4KP3 C;  4ZXL A;  4LMJ A;  5AQG B;  1VCT A;  3L39 A;  5AQN B;  5LJN A;  2SPC A;  4F6R C;  2WU5 A;  4JI5 T;  3VU7 H;  5KXJ A;  4IT4 A;  3GN5 B;  2X0Y A;  2CXL A;  3PJA J;  1AJ3 A;  2Z6E A;  5AQM B;  3RHW A;  2K24 A;  4NPP A;  4OHF A;  3W15 B;  2H88 A;  3P4S A;  4ZS3 A;  4GYR A;  4YHJ A;  2V7I A;  4IDZ A;  3RI5 A;  1J1J A;  2E9X B;  3MJX A;  2WCA A;  2E5V A;  2X9X A;  3WSC A;  2KGX A;  3HA4 A;  5AQS B;  2XAS B;  2FJD A;  2A72 A;  2BS2 A;  2OA5 A;  5EK2 A;  1D1A A;  3IF8 B;  2KXP B;  1YQ4 A;  4KHZ F;  2VKD A;  2J62 A;  4U7Y A;  4UV8 B;  2X0L B;  5LGU B;  5L2L A;  5F8P A;  3UUB A;  2WM9 A;  2W4X A;  2J4G A;  1UUS A;  4EV6 A;  3FBZ A;  4EOZ B;  2VVN A;  1IBL T;  4ONR A;  1IZN B;  2BZB A;  2VB6 A;  3F57 A;  1HTJ F;  1FIO A;  2DNX A;  3L3P A;  2KVP A;  4JI6 T;  3B57 A;  3UUN A;  4AKG A;  4CN6 A;  4CZZ B;  1UK5 A;  3ZMV B;  3MK7 C;  4YHH T;  3N2G E;  2F4V T;  1MMN A;  2CLY C;  3ZSS A;  4V1A v;  2W63 A;  2M6I A;  3CQX C;  4NUV A;  3RKG A;  4JI4 T;  3KV4 A;  3RC8 A;  5HWX A;  2XTL A;  4MLK A;  4F8H A; 
#chains in the Genus database with same CATH homology
 2XAH B;  4CQI A;  5KX5 E;  3CX8 B;  1UX5 A;  4FI5 A;  2WMN A;  4TZ4 C;  3N2O A;  5DAB A;  5EZY E;  3GN5 A;  4UEL A;  4GOU A;  3ZMU B;  2E8I A;  2X51 A;  4BAY B;  4O4I E;  5LXT E;  5H6R B;  4BGO A;  2RA1 A;  1LKX A;  3KBT A;  4O2B E;  3RYH E;  1VOM A;  5ETW A;  2M67 A;  5HXC A;  4ASK A;  4Z8X A;  3C98 B;  4H9Q C;  4IE4 A;  3LK4 2;  3PDY A;  3WUR A;  2NWB A;  2ZM2 A;  3F2E A;  4PK5 A;  4OYK A;  2NW9 A;  3IHR A;  2DWK A;  3PUA A;  2E9X A;  4EB6 E;  4HEA A;  4XAX B;  1HG5 A;  5HXR A;  3PUQ A;  2H7V C;  2IC9 A;  3N9Q A;  1OXZ A;  4EXT A;  2CWY A;  4CI1 B;  2LEH A;  1YW0 A;  1LVF A;  3MZK B;  1FMW A;  5JH7 E;  3HKB E;  2JRK A;  3CVR A;  4QX8 B;  3VHL A;  1WLX A;  2N1G A;  1WYC A;  2LSJ A;  4X1I E;  2W00 A;  4YJ3 E;  3VKG A;  4MBQ A;  3AAA B;  2Y6X A;  4PW8 A;  3E0Z A;  4IE5 A;  3ZMT B;  3CPZ A;  5LG4 A;  4HN9 A;  4QHO A;  3ZCI A;  1MNE A;  5KDM C;  4WNK A;  2D5U A;  2VWA A;  4ZI2 D;  1U5P A;  5FY0 A;  3HI2 A;  2X68 A;  3QK6 A;  2CWO A;  2EHO A;  4E7S A;  2CA5 A;  1LRZ A;  3UTK A;  4ADZ A;  4G63 A;  5FYM A;  4TV8 E;  4ISS A;  1BR0 A;  3PU3 A;  5L3B B;  2ZLY A;  4KMC A;  4GK5 E;  5F3J A;  5HXE A;  4HKA A;  2LE8 A;  1IAP A;  2WWU A;  5L3C B;  4PJL A;  3N5L A;  1KK7 A;  2VKH A;  3OBV E;  2YIN A;  1S35 A;  4P0B A;  2QA7 A;  5GON E;  3QC9 A;  3C50 A;  1MND A;  4KBM B;  3V5U A;  2HPJ A;  3R6N A;  3C4X A;  4QWN B;  1IJ6 A;  2KWH A;  3RRW A;  3ZEF B;  4P0A A;  3PUG A;  4JEH B;  1WR6 A;  3KFW X;  2MYS A;  2LHR A;  5LCY A;  2X66 A;  2YK0 A;  3U3I A;  1OWA A;  3RKO A;  3LK3 B;  2K5B B;  4AXP A;  2VK9 A;  5LP6 E;  3BK9 A;  2LQU A;  4XZC A;  1E1H B;  5L3F B;  2VKO A;  1FEW A;  2DHR A;  1Z0P A;  1D0Y A;  3N9L A;  4IGU A;  2X9W A;  5HXS A;  2ACX A;  3L09 A;  1V9D A;  1U4Q A;  2IC6 A;  2L9Q A;  3PE0 A;  4I50 E;  2DI4 A;  2ODU A;  4ILU A;  4X1K E;  4AQF C;  2JPF A;  4AQG A;  4HFV A;  2NP9 A;  1UX4 A;  3ONX A;  3CML A;  2H3R A;  4YLH A;  2XHE B;  5JRC A;  3K8P C;  3R84 B;  1ZHC A;  5T1D A;  4C90 A;  2LHN A;  3RX6 A;  3DTO A;  4BJM A;  4O2A E;  2YEV C;  2A2F X;  3Q2M A;  4HGA A;  1ZEE A;  3OKQ A;  5LNK A;  3I9W A;  3M1C A;  2QGS A;  2W0G A;  4FJO A;  3DJB A;  4JEU B;  2C5K T;  5LGN B;  1HX8 A;  3I0Q A;  1KNZ A;  2BDE A;  4PK4 A;  2MOZ A;  4O4L E;  4I55 E;  4UF0 A;  1LVK A;  3M65 A;  4H9N C;  4GK0 E;  3AA6 B;  4ZI7 E;  3I1A A;  1YD8 G;  3V5S A;  4TV9 E;  5DQW A;  3E22 E;  3BQK A;  4ZI2 C;  2Y48 B;  1MMG A;  3OYZ A;  3FHN A;  1WYB A;  1US7 B;  3ZCJ A;  2ZM8 A;  4UF0 B;  3WAJ A;  3PUS A;  3KVA A;  4M1P A;  4NUU A;  1NAF A;  3UT5 E;  5CB4 E;  5LJM A;  4PJN A;  2KT9 A;  2CE7 A;  4EZ4 A;  4EYU A;  2WBL A;  2V7K A;  4O4J E;  5IHY A;  5E0O A;  4AKI A;  2V7L A;  3O1I A;  4AKH A;  2C5I T;  4P09 A;  4DBQ A;  5HYA A;  4CXX A;  4GYS A;  3RYC E;  4GIW A;  3AAE B;  3K3N A;  4AQF A;  1WRD A;  2W62 A;  3PTR B;  3O9X A;  5LBQ B;  5AFU L;  2XAG B;  2KZ7 B;  3J9X 1;  1FMV A;  2D2S A;  4UVA B;  3RH3 A;  3C64 A;  4PAG A;  5LA6 E;  3ZC1 A;  4QXB B;  4EAH A;  2XAJ B;  3TKL B;  5LOV E;  2ZM0 A;  2KWI B;  2JQQ A;  2L3L A;  2ZMA A;  2KND A;  4DND A;  2CM0 A;  4JUY A;  1QUU A;  5JVD E;  3UFE A;  1QSD A;  1ZKE A;  3O1J A;  1BR1 A;  2CXF A;  3Q5X A;  4I43 B;  2K48 A;  4H9O C;  3NBX X;  5C8Y E;  3UUX B;  3RC3 A;  2DCF A;  2BVM A;  1BR4 A;  3KBU A;  2HPL A;  2VL8 A;  3ETU A;  3N9N A;  3BQI A;  3N9P A;  1T98 A;  4EZH A;  4PK6 A;  4IIJ E;  4O8S A;  5JQG E;  2KIN B;  3H37 A;  3E08 A;  5LHI B;  5J2U E;  2YU1 A;  4IE7 A;  3C4W A;  3MAC A;  1D1C A;  2NW7 A;  1MMD A;  4AKR B;  5FY1 A;  2G0U A;  2LT3 A;  2JJ9 A;  3C51 A;  1YKE B;  1X79 A;  1VRB A;  3N2K E;  3PU8 A;  4YFS A;  3WI3 A;  4H9S E;  3T8O A;  2NW8 A;  3CQG B;  3HL6 A;  3KV5 A;  5HWY A;  2KLQ A;  4G2A A;  2CMR A;  5FP3 A;  1NWM X;  5KMG P;  2GK9 A;  3SS1 A;  5ADX L;  2XAF B;  5FNV E;  1Y64 B;  5FXZ A;  4BJN A;  3DP7 A;  3I9Y A;  2KMF A;  4B6X A;  3EDU A;  4QXC B;  4ZI3 D;  4DMW A;  3LFM A;  2PFV A;  3FBL A;  3CQC B;  4UV9 B;  3NRY A;  2PJQ A;  4J2C A;  2V7J A;  2W61 A;  3ZMZ B;  4CXW A;  4XBF B;  4C91 A;  3LG7 A;  4PFO A;  5CA0 E;  1G8X A;  4TN7 B;  5JR9 A;  1YKH B;  4L9I A;  4ZS2 A;  3QUJ A;  3KVB A;  1H7C A;  3I0O A;  4JLE A;  4KUM B;  1B7T A;  5FY7 A;  3CX7 B;  2Y8D A;  3VKH A;  4X1Y E;  4K0U A;  2CCQ A;  4TX5 A;  3EDV A;  3HKD E;  5JDH A;  2LSK A;  4IST A;  3VJZ A;  2H7O A;  5JR9 B;  2LOS A;  3HR0 A;  2L8K A;  2XUE A;  2ES0 A;  2DLR A;  4IE6 A;  4YJ2 E;  4MHC A;  3SWH A;  3O1H A;  3GMI A;  1SA0 E;  3K3Q C;  4L0R A;  4BA9 A;  2N2N A;  5JDM A;  3ANW B;  3HKE E;  1HCI A;  2NTY A;  3H3A A;  2V26 A;  2ODV A;  1G73 A;  3RRC A;  5CA1 E;  3JC6 D;  4CI3 B;  5EK4 A;  3ZN0 B;  3NZQ A;  3ZJ2 A;  3AAI A;  3AA0 B;  3ZYK A;  2X67 A;  4HTE A;  4ZOL E;  4OK0 A;  5L3D B;  3OYX A;  1BR2 A;  2Q9Q D;  1SHZ C;  2D0T A;  4QKN A;  2C0S A;  3AA1 B;  2LSY A;  2X9Y A;  4EIW A;  4I4T E;  3CKD A;  5HXH A;  1MIV A;  5J1G A;  3KV9 A;  2LJL A;  4IHJ E;  5DQV A;  3KV6 A;  2Q9Q B;  4WBN E;  4ZHQ E;  2DWG A;  3IBP A;  4UXN B;  5DJQ C;  3ZLI A;  2HH7 A;  3FXE B;  4ZI3 C;  2X9H A;  5JDG A;  4AI6 A;  4UVC B;  5FXW A;  3P8C D;  3SRZ A;  5LHG B;  3AVS A;  2V1D B;  3KIN B;  2WMO A;  2WSS V;  4H9P C;  3SOL A;  2UXX B;  3KDS E;  4H63 V;  2V7M A;  3J7Y q;  5J2T E;  4KP3 C;  2XAQ B;  2IW5 B;  5JDQ A;  4O4H E;  2UXN B;  4PJJ A;  3A5X A;  3NZP A;  1D1B A;  4H9R C;  3S4U A;  5LJN A;  5JR9 C;  2SPC A;  4F6R C;  3VU7 H;  5FXX A;  5LBM A;  5JRE A;  3GN5 B;  3O4X E;  2CXL A;  1AJ3 A;  2Z6E A;  3FXD B;  3NRX A;  2K24 A;  4OYJ A;  3PF0 A;  5JDF A;  4ERR A;  1ZV4 X;  3B13 A;  2JMK A;  2E9X D;  4OHF A;  3EUH A;  3W15 B;  3WAK A;  3PUR A;  3BQL A;  4ZS3 A;  4GYR A;  4DBR A;  4YHJ A;  4X20 E;  4U72 A;  5FXV A;  5IYZ E;  1S94 A;  2V7I A;  3N9O A;  4IDZ A;  3OJA A;  2E9X B;  1HF8 A;  3MJX A;  3D0T A;  1MMA A;  2CEA A;  2X9X A;  5L3E B;  3WSC A;  3JC6 C;  4AKL A;  3HA4 A;  2LM9 A;  3N9M A;  2NOX A;  3GA8 A;  4QX7 B;  4UIG A;  3HKC E;  1O3X A;  2XAS B;  5M4Y A;  3MA9 A;  2EHO D;  2Q9Q C;  2MTC A;  2A72 A;  2OA5 A;  5JDL A;  1CUN A;  1MIW A;  5EK2 A;  3IEE A;  4OFZ A;  3Q9D A;  1D1A A;  2CLY B;  3IF8 B;  1D0Z A;  2KXP B;  4L5G A;  2XQY A;  5LHH B;  2J1D G;  3AT7 A;  5LYJ E;  2EHO B;  2PBI A;  2BVL A;  3AVR A;  2VKD A;  5L3G B;  4UV8 B;  3ZYM A;  4DMV A;  2X0L B;  3ZC0 A;  2MTQ A;  2VKJ A;  2WAU A;  5LGU B;  3ESL A;  5L2L A;  5F8P A;  3ZN1 B;  3C4Z A;  1MIY A;  2N9D A;  3CWZ B;  4H63 H;  5BMV E;  3UUM A;  2PG8 A;  3AA7 B;  4PFP A;  2LSI A;  2WM9 A;  1D0X A;  3P7I A;  3F31 A;  2YU2 A;  2P9B A;  1EZ3 A;  3MKD A;  2IAK A;  3Q5W A;  4QXH B;  2LSG A;  4CXY A;  2VAS A;  3FBZ A;  1HS7 A;  4EOZ B;  3K3O A;  4DO0 A;  1HFA A;  3ANW A;  2C5J A;  4ONR A;  4WBO A;  3ZMS B;  1IZN B;  3ZYL A;  3U78 A;  4A56 A;  3RPU A;  4PNI A;  2BZB A;  5TAO A;  3FB2 A;  2VB6 A;  5HAX A;  3LJC A;  5LGT B;  4MAL A;  4MFR A;  1UCU A;  5A1L A;  3F57 A;  5FMN A;  1HTJ F;  4EYY R;  3MXZ A;  4ANJ A;  1FIO A;  3EVY A;  5JDN A;  2D0U A;  2E9X C;  5H6Q B;  4CI2 B;  2DNX A;  3L3P A;  5JRC B;  3RYI E;  4HE8 A;  4UEM A;  3B57 A;  3UUN A;  4AKG A;  4TUY E;  3ZJ1 A;  2A3D A;  2CXD A;  3LBX A;  4CZZ B;  3ZMV B;  2Q9Q A;  3AB3 B;  3MK7 C;  2NTX A;  4WW0 A;  3N2G E;  4ECG A;  4UVB B;  2RP4 A;  3PHF 1;  4U74 A;  1MMN A;  2I59 A;  2CLY C;  2JMH A;  5EK3 A;  3RYF E;  2B1E A;  3ETV A;  4V1A v;  3UUL A;  2W63 A;  1IJ5 A;  4DVD A;  3ZPO A;  2EHO C;  4PJM A;  3CX6 B;  3CQX C;  3LBX B;  4NUV A;  4E7Z A;  3GWH A;  2K9A A;  2LOP A;  3KV4 A;  4N78 D;  2MBG A;  3RC8 A;  3LK2 B;  1HG2 A;  5HWX A;  4IE0 A;  2XTL A;  4MLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...