5JDNA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 10 mm na+ and 10mm sr2+
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
301
structure length
297
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords sodium-calcium exchanger NCX_Mj
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
total genus 130
structure length 297
sequence length 301
ec nomenclature
pdb deposition date 2016-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdnA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdnA02
5HXEA 5JDFA 5HWYA 5HXHA 3V5UA 5JDLA 5JDMA 5HXSA 5JDQA 5JDNA 5JDHA 5HXRA 3V5SA 5HYAA 5HWXA 5HXCA 5JDGA
chains in the Genus database with same CATH superfamily
2H7OA 4NXMT 2DWKA 3NZPA 3AE1A 3VU7H 1MIWA 1MIVA 5L3DB 2D0UA 2HN1A 4WZXA 3U3IA 1BR0A 4X20E 5ABHA 3AE8A 3RGLA 2ODUA 5EK2A 3PHF1 2JPFA 5JRCA 4PJJA 5HEJA 4ZI2D 3OKQA 1ZOYA 2VL0A 3UU4A 2F4VT 5DABA 2BKNA 4DR4T 2LE8A 3JCFA 4PJMA 2Q9QA 2V6YB 3Q5WA 4LFBT 3DP7A 1HNXT 5EZYE 2X68A 1E1HB 3ONLC 1WR6A 3UUMA 3LK2B 3LSVA 3F2EA 5LBQB 2VKDA 3KV6A 4HWDA 1FMWA 3UU8A 3AXJB 3TKLB 3UUXB 4DUZT 3AY5A 4JI8T 1WR0A 3ANWB 1U4QA 3LJCA 4X62T 2E2AA 2WU2A 3ZN0B 2UUBT 1W0BA 3FZKB 3PU8A 4BAYB 4YLHA 4IE7A 1VCTA 3RIAA 3F31A 5FY1A 3CMLA 3HI2A 1R8IA 1UUSA 1NWMX 4X5TA 2L3LA 4PAGA 4ANJA 2X9WA 3PURA 2X9YA 4JLEA 3O9XA 4AKGA 2KNDA 2XPKA 2V5CA 2Q9QD 2KBBA 1MNEA 3ZJ2A 3M65A 5JDLA 3PUXF 4X66T 2WP9A 2K9AA 2IAKA 2V7MA 3I0QA 2CRBA 4NIQA 3EDVA 4TWDA 2UUAT 1IBKT 4CXXA 5AFUL 2WS3A 2XQYA 2V7KA 2JMHA 2KT9A 3S4UA 4PK6A 3VJZA 3AA1B 3R84B 1WRDA 3GA8A 2BBJA 2ODVA 5FVKA 1J1JA 3ETVA 3KFWX 4DR3T 3FBLA 4P0AA 2KINB 5LHIB 2DWGA 3UTKA 1HF8A 2ACXA 4YHJA 3V5UA 4G63A 4MALA 1XDPA 3LG7A 2LSIA 1N34T 5FKYA 2N9DA 5JDHA 2XQ5A 1BR2A 2NW8A 2M6IA 2KMFA 5ABFA 4DR6T 3AA0B 5JDMA 1XMOT 4GYRA 4AQGA 2NOXA 5F3JA 2OA5A 4X1IE 2MAWA 4EYYR 5CB4E 3OTOT 5LMUT 4PK5A 3SS1A 1IBLT 2M6BA 4EYUA 4IHJE 2VURA 2A9UA 5HXCA 3CQGB 3ANWA 4ILCA 1VRBA 5LOVE 5KDMC 2L9QA 3MKDA 3F57A 2YN6A 3H3AA 3ZCIA 1WCRA 2XHEB 4LF8T 5FNVE 4C90A 4ADZA 5LJMA 5L3CB 3IA3A 4ZS2A 1N32T 3VR9A 4IT4A 3OYXA 3W15B 2XQ8A 2XSBA 3V5SA 2K24A 2LM2A 2E5LT 1UX4A 4OHFA 3A8YC 2XUEA 3P8CD 3N2OA 3FYQA 3EVYA 2W63A 4NUUA 2XQ7A 1HS7A 3QK6A 4IGUA 5BMVE 2RA1A 1BR1A 1YKHB 3CVRA 3KV9A 3P7IA 3HL6A 3P4RA 2WCAA 1KNZA 2CHOA 4KX6A 2WDVA 5AQVB 2KXPB 3N9LA 4JI5T 3UU5A 2JQHA 2NWBA 2VVNA 4KHZF 4G2AA 4ZI3D 4TZ4C 4XZCA 5IHYA 3EABA 5HEHA 5J2TE 2C0SA 3GN5A 2B76A 2ZM2A 4DO0A 2YU1A 2Q9QC 3FXEB 5JDFA 2XJ7A 2H88A 4IDOA 4V1Av 3ZMZB 2FJBA 3HR0A 5BR8T 4PK4A 4AQYT 1OEDB 4FJOA 4AKLA 3AVSA 4LF4T 2A72A 2QA7A 4PW8A 3N2KE 2KSRA 2VKOA 2R6GF 1FMVA 2OV9A 4TN7B 2BS2A 5JR9B 3CWZB 3VKHA 5JQGE 4AKIA 2VQET 4U3CA 4B3MT 3ZT7A 5LMNT 1NEKA 2WAUA 5LGUB 1US7B 2LEHA 3FBZA 2HN2A 2XQ4A 2WMNA 5FXXA 3C4ZA 2D0TA 5LA6E 2WZIA 4L0RA 2WDQA 2BZBA 5JH7E 4LF5T 2IW5B 5L3GB 3VR8A 2J47A 4IDZA 3ZKRA 2ES0A 2XSAA 3MA9A 1HNZT 2W2UA 3H3MA 4AISA 4YHHT 4O2AE 5L3EB 3ZSTA 2NTYA 5F5WA 4DV6T 2DL1A 1WFDA 3AE5A 4AXPA 3B5MA 4DMWA 3ZT5A 2CHNA 4PNIA 5LHHB 2YKSA 2YDRA 1YQ3A 1KFYA 4O4LE 3RQWA 2ZM8A 2AE9A 4YSYA 3PUQA 3MXZA 3PJAJ 4EB6E 4DUYT 1SJ8A 3ESLA 2BDEA 2IUBA 4CI1B 4QHOA 4WNKA 5FVLA 4HFBA 3MJXA 2LJLA 4JEHB 1HTJF 1N36T 1XNQT 2XTLA 2V7JA 1Z8UA 3C98B 1D1AA 5FL0A 1D1CA 2VB6A 2CLYC 1OWAA 2LHNA 3E08A 3K3NA 1BR4A 3UT5E 2V8SV 1X9BA 5L4HA 2E9XB 3AEGA 5FY7A 5AQJB 1MMAA 2BG9B 5F8PA 4DV0T 4ILAA 1X79A 2MTQA 1OEDA 2WU5A 4P1NA 2W66A 3FB2A 1S94A 4Z90A 3CX6B 3RYCE 3GMIA 4GK0E 5LG4A 2UXXB 1U5PA 4YFSA 4DBQA 4EEBA 1ZEEA 2DLRA 5AQTB 4AQFA 5JR9A 3PUVF 3IF8B 2VASA 3J9X1 1T8BA 1QUUA 4TUYE 5AQHB 4A5XA 2LLYA 2LSKA 3KVAA 2YDQA 1H7CA 2BG9E 3NZQA 5HEUA 5HWXA 1ZKEA 5LNKA 3ZC0A 2PBIA 1VOMA 2WM9A 2WY2A 4B6XA 2HPJA 2WMOA 2MPKA 4QX8B 1V9DA 5HCJA 4U2YA 4TX5A 4F8HA 2XAHB 4KUMB 2XAGB 4H9PC 2N2NA 2KVPA 3AA6B 3ZYKA 5HXRA 1O3XA 2K3WA 2KGXA 4GKJT 3L8RA 1D0ZA 4CXWA 3E22E 4P0BA 4ZZCA 1E7PA 4U74A 4UVAB 3K8PC 4UEMA 2JJ9A 3KV4A 2WBLA 2KWHA 4LFCT 1E2AA 1CHUA 1HX8A 2W0GA 4O4IE 3R6NA 2E5VA 4HFEA 2MYSA 4ZXLA 5HYAA 3RYHE 2HPLA 2NR4A 3Q5XA 4HWHA 2LHRA 5FYMA 5IWAT 4OFZA 4UR9A 4ZOLE 4AKHA 3RX6A 3EHZA 3C4WA 2E8IA 1QLBA 2FJEA 4O8SA 3UUBA 5AQRB 2EHOB 2XZEA 5HXEA 3VKGA 1MMDA 4U31A 3PUZF 4JI2T 1HG2A 4GYSA 5L2LA 1XZYA 4IE5A 4FI5A 3IEEA 3UUNA 5FZTA 2ZM0A 5HEGA 4EOZB 4B3TT 2CM0A 3PF0A 2WQYA 3QB5K 4HEAA 1Z0PA 4CXYA 2CWOA 3RIFA 3SRZA 2VKJA 3N9PA 4IE6A 2PJQA 2FBWA 1NAFA 1SJ7A 4E7SA 4WYVA 5JTGA 2WDRA 5AQUB 4YTPA 4IE0A 1LKXA 1YKEB 1OXZA 4CN1A 3ETUA 4L5GA 4ILBA 3PTRB 2I6HA 4UF0B 2V7LA 2QGSA 2W62A 3N9QA 4ISSA 5ADXL 2X0CA 4IDPA 2LKGA 2OLTA 5AQNB 3T8OA 5FMNA 3ZC1A 2L10A 3B13A 1HR0T 1XWMA 2X67A 3AA7B 1FJGT 3PU3A 2E9XD 4CZZB 4HN9A 3I1AA 3JC6D 3I9WA 4TNVA 2X0HA 5AQSB 2XASB 4DNDA 5LGNB 1LVFA 4EIWA 4YTNA 2N1GA 2V6YA 3U78A 2XM1A 2LKHA 4K0UA 3PDYA 3J7Yq 5CA0E 1KEYA 4A98A 3Q5DA 1B7TA 4MHCA 4EZ4A 3RIUA 4KP3C 3AXJA 1MMNA 4GK5E 5CA1E 1I6ZA 4ZI2C 3KBTA 1D0YA 4K0KT 2B1EA 3AAAB 1T7SA 4OYKA 4PJLA 2XY8B 5HWYA 3ZJ1A 1ZHCA 3AECA 3OPCA 4GKKT 3RF1A 3AE3A 4IL4A 4Z91A 5LXTE 2YEVC 5CGMA 5L3BB 1HNWT 4N78D 4ECGA 4AQFC 3FXDB 5AQPB 3UFEA 4EXTA 2VQFT 3NBXX 3PUGA 5KXJA 5ETWA 2CE7A 3UULA 2K5BB 1IJ5A 1YXRA 1Y64B 5AQIB 3HKBE 3AEDA 2G0UA 2JQKA 3CK6A 4PFOA 4H63V 2L8KA 2I59A 3P4WA 1AJ3A 3VHLA 2LM9A 2YK0A 3EI0A 5AQMB 4YSXA 5L47A 4YJ2E 4JV5T 5C3JA 4ASKA 4HWIB 3BQIA 1J5ET 4UF0A 3LK42 4JI0T 1LRZA 2Y8DA 4ZEYA 3PE0A 2CPTA 3RH3A 3TLTA 2IIUA 3AT7A 4KBMB 2CMRA 2EHOD 2CBIA 2WB5A 2M67A 2VK9A 2MBGA 2JMKA 3FHNA 1UX5A 2BS4A 5LGTB 2ACZA 3KINB 3C50A 3M1CA 5CFBA 3BK9A 4OX9T 1N33T 5M4YA 2H7VC 3RYIE 3ZMVB 4LF9T 2WWUA 3HKDE 3AB3B 3O1JA 5GONE 4BA9A 4QX7B 1XDOA 3AAIA 5E0OA 4QH4A 5A1LA 3RC3A 5IUXA 2MTCA 1IJ6A 3ZCJA 1W09A 3ONXA 4DIDB 1W9RA 2I0MA 4ZZBA 3KDSE 5HAXA 3LK3B 4ZS3A 4MBQA 2CXFA 3KBUA 4HWFA 2ZMAA 4DBRA 3KV5A 4KI0F 5FXZA 4ONRA 2K48A 2UXBT 2L7NA 1WLXA 2LOSA 3AE4A 3O1HA 3Q2MA 1SHZC 1W0AA 4JBWF 4I55E 4QH1A 2VKHA 2FJDA 3X1DA 3RRWA 3ZT6A 5FY0A 4LMLA 3AE2A 2UXCT 5LB7B 4W8PA 5FXVA 4QH5A 4JYAT 1T72A 1KK7A 2BBHA 3SFDA 3CKDA 3FZFB 5JRCB 2IC9A 2J1DG 4ZHQE 3P4SA 4I50E 2LSYA 3L09A 4OYJA 3HA4A 3ZPOA 2PFVA 4TV8E 2GK9A 5LJNA 2Q9QB 3CQXC 5LHGB 2WZHA 3AEAA 1I94T 5FP3A 5AQGB 2XAQB 4U7YA 3ZYLA 4HTEA 2QRXA 4LFAT 2NP9A 2UXNB 4TV9E 3JADA 5C8YE 3ZEFB 4UXNB 3QUJA 5H6RB 4LMKA 1G73A 5TAOA 3RYFE 4HGAA 3AEEA 3P4QA 3UU3A 4CQIA 2Z6EA 3RIUC 5JDGA 1SUMB 2W00A 3RI5A 4ZI3C 2CA5A 5DQWA 4IL9A 2IHR1 5AQFB 4I43B 4HE8A 4EV6A 3CX8B 5AQQB 4IDNA 4EEDA 4HFDA 2JIWA 4I4TE 2BS3A 1ZP0A 5IYZE 4JI1T 4BJMA 2IDOB 5LCYA 3BQLA 2IMLA 2VWAA 3E0ZA 5J2UE 4ILUA 5L3FB 1JNRA 4X65T 2QYWA 2LOPA 3PUYF 3D0TA 2LQUA 1CUNA 2JRKA 4MLKA 4DV1T 4WW0A 3A5XA 5DQVA 3C4XA 5JREA 4O4JE 2ZLYA 1UGOA 4B3RT 4YT0A 3LBXB 2SPCA 5FXWA 4TWHA 4QXBB 3O1IA 2XQAA 4UV9B 1GQEA 4GOUA 2DHRA 4WBNE 3PUAA 4UVCB 3A7MA 2BVLA 4F7GB 1DU2A 2NTXA 4JI3T 2DI4A 3KVBA 2H89A 4UIGA 2P9BA 1D0XA 5AQLB 3AVRA 3NVOA 1L0VA 3DTOA 5ABFB 4EAHA 2CLYB 2MOZA 3NRXA 4UV8B 4CI2B 3K3OA 4QWNB 4TWFA 3RKOA 5LYJE 3EDUA 4HFVA 2BKPA 4DR2T 2LRKA 3FZHB 1UURA 3WAKA 4H9RC 3AE7A 5LG3A 3AEBA 3MZKB 2CXLA 3VRBA 5HEOA 5JVDE 3C64A 1IAPA 4U33A 4DMVA 2RPAA 4ZI7E 3ABVA 3RHWA 2E9XA 2V26A 2BG9A 4DV3T 2DCFA 2JQ9A 3JAEA 1WYBA 3TLUA 4CN4A 1KNPA 3UU6A 2W61A 5J1GA 2V5DA 5LBMA 4J2CA 3N9MA 4XAXB 4H63H 4ISTA 2VVSA 2QVAA 2C5JA 4YSZA 2CXDA 3WSCA 4F6RC 3M3ZB 4C91A 2X9HA 2WSSV 4JI6T 2YU2A 1LVKA 3CQCB 3N9NA 3WI3A 4DV2T 1HG5A 4HFIA 2H3RA 3FZMB 4UVBB 4HWCA 1FEWA 1T98A 4BGOA 3ZLIA 4HFCA 1IZNB 4A56A 3GN5B 3LBXA 3UFGA 2XAFB 3ZMTB 1YQ4A 5AQOB 2V1DB 1MIYA 3QB5A 4YJ3E 4IE4A 1XMQT 2X0YA 3PV0F 5H6QB 1M7KA 4KMCA 3CPZA 4H9OC 3NWIA 2BVMA 4MFRA 2X66A 4U72A 4YTMA 2FJAA 2XQ9A 4DR1T 4EZHA 1G8XA 3ONJA 4COFA 4KHPT 2J4GA 1WYCA 1Y01A 4OK0A 4PJNA 5DJQC 5EK3A 3DYJA 1OEDC 2HHHT 2VL8A 2V6XA 3IBPA 3OYZA 4A97A 1UK5A 4O2BE 2EHOA 3I9YA 3LFMA 2C5IT 2XQ6A 1KNRA 1YD8G 4E7ZA 3DJBA 5JR9C 5HXHA 1SE7A 4DVDA 4LF6T 2W67A 2X0LB 2JQQA 2KLQA 3PJAA 3O4XE 2A3DA 3MACA 2AXDS 3OVUA 3RLFF 3ZMUB 4CI3B 2LSGA 3B57A 5LP6E 3RPUA 3L3PA 2J62A 4H9NC 2LRLA 4AKRB 3BQKA 2ZM6T 1QSDA 4AI6A 4GIWA 5JDQA 4HFHA 5KMGP 4QXHB 4IIJE 5CJ5A 3UQ4A 4QKNA 1HCIA 1D1BA 3RC8A 3PUSA 3TLWA 2C5KT 3SFEA 2NW9A 4U7IA 5JDNA 3NRYA 2UXDT 2KZ7B 3P50A 4M1PA 4NXNT 3LDQB 3QOFA 5HCMA 4JUYA 4X64T 4YXDA 4DV5T 4ERRA 4Q25A 4HKAA 4NUVA 3MK7C 3H37A 4O4HE 5ABGA 3TLSA 3QC9A 2RP4A 5AQKB 4U2ZA 3VRAA 3ZSSA 3N2GE 2BKOA 3N5LA 5L4EA 4AIUA 2CCQA 2E9XC 2HH7A 4BJNA 3T1HT 3CX7B 2BG9C 3JC6C 3HKEE 2LT3A 1YW0A 3JAFA 3ZYMA 1M62A 4H9SE 1NENA 4B3ST 3K3QC 4QXCB 3ZMSB 3NKZA 4UELA 2PG8A 3WURA 2DNXA 2W4XA 3FZLB 2A2FX 1OEDE 3PUWF 2YOEA 4NPPA 4WBOA 1MNDA 3SOLA 1IBMT 4L9IA 5HXSA 4LMJA 4P09A 3QNUA 2CEAA 5EK4A 3RRCA 1XNRT 3AEFA 1ZV4X 5FL1A 4DV7T 3AE9A 1VCSA 3RKGA 1KF6A 2X51A 3WAJA 5KX5E 1MMGA 1SA0E 4JI4T 2PTFA 3ZN1B 4LF7T 3SWHA 3AAEB 2FUPA 2Y6XA 3IHRA 2YDSA 3TLVA 2IC6A 2NW7A 3CIRA 1UCUA 4X1KE 2UUCT 4TNWA 3K1SA 3C51A 4DR7T 4X1YE 4YY3T 2CWYA 2XQ3A 3UQ7A 3OBVE 3P4PA 2D9DA 2V7IA 2D2SA 5J0ZA 2D5UA 3AE6A 1EZ3A 4DV4T 3HKCE 2Y48B 3GWHA 3EUHA 4IREA 3Q5EA 3I0OA 2CBJA 3OJAA 3Q9DA 4XBFB 1HFAA 4H9QC 1J5WA 2XAJB 3EAMA 1FIOA 4PFPA 5C2TA 2XM2A 3G06A 1S35A 4IDQA 3T1YT 4CN6A 4I0UA 4JI7T 4JEUB 2KWIB 4DR5T 3N9OA 2X9XA 1JNZA 2YINA 2EHOC 2WWVA 1HX1B 2LSJA 5ABEA 3RQUA 3L39A 4EGWA 5T1DA 4Z8XA 2UU9T
chains in the Genus database with same CATH topology
3UFEA 4H63H 4ISTA 4EXTA 2H7OA 4IDZA 2DWKA 3NZPA 3VU7H 1MIWA 2C5JA 3NBXX 3PUGA 5ETWA 2CE7A 2CXDA 1MIVA 3UULA 5L3DB 2D0UA 2K5BB 4F6RC 3WSCA 1IJ5A 2ES0A 3MA9A 3U3IA 1Y64B 4C91A 2X9HA 2WSSV 1BR0A 2YU2A 3HKBE 2G0UA 4X20E 4PFOA 1LVKA 3CQCB 2ODUA 3N9NA 4H63V 5EK2A 3WI3A 4O2AE 5L3EB 2L8KA 1HG5A 3PHF1 2I59A 2NTYA 1AJ3A 3VHLA 2LM9A 2JPFA 2H3RA 2YK0A 4AXPA 4UVBB 4DMWA 1FEWA 4PNIA 5JRCA 1T98A 4PJJA 4YJ2E 5LHHB 4BGOA 4ZI2D 3OKQA 3ZLIA 4O4LE 1IZNB 4A56A 4ASKA 2ZM8A 3BQIA 5DABA 3GN5B 3LBXA 2XAFB 3PUQA 3MXZA 4UF0A 3LK42 4EB6E 1LRZA 2Y8DA 3ZMTB 2V1DB 3PE0A 1MIYA 4YJ3E 3ESLA 4IE4A 3RH3A 2BDEA 2LE8A 4PJMA 4CI1B 4QHOA 4WNKA 5H6QB 2Q9QA 4KMCA 3AT7A 3Q5WA 3DP7A 3CPZA 3MJXA 2LJLA 4JEHB 5EZYE 1HTJF 4H9OC 4KBMB 2CMRA 2EHOD 2BVMA 4MFRA 2X68A 1E1HB 2X66A 1WR6A 2M67A 2VK9A 2XTLA 2V7JA 2MBGA 2JMKA 4U72A 3UUMA 3LK2B 3F2EA 5LBQB 2VKDA 3FHNA 3KV6A 3C98B 1D1AA 1UX5A 1FMWA 1G8XA 4EZHA 1D1CA 5LGTB 3TKLB 3UUXB 2VB6A 3KINB 3C50A 2CLYC 3M1CA 1OWAA 2LHNA 3ANWB 3E08A 3K3NA 1BR4A 1U4QA 3BK9A 3LJCA 5M4YA 2H7VC 3RYIE 3UT5E 2E9XB 3ZN0B 1WYCA 5FY7A 4OK0A 3ZMVB 1MMAA 2WWUA 4PJNA 3HKDE 5DJQC 5EK3A 5F8PA 3PU8A 1X79A 2MTQA 4BAYB 3AB3B 2VL8A 3O1JA 4YLHA 3IBPA 5GONE 4BA9A 4QX7B 3AAIA 3FB2A 1S94A 5E0OA 4IE7A 3OYZA 5A1LA 3CX6B 3RC3A 3RYCE 2MTCA 3GMIA 1IJ6A 4GK0E 4O2BE 2EHOA 3F31A 3ZCJA 5LG4A 3I9YA 2UXXB 3ONXA 3LFMA 2C5IT 5FY1A 3CMLA 3HI2A 1U5PA 4YFSA 4DBQA 3KDSE 1NWMX 1ZEEA 1YD8G 2L3LA 3DJBA 4PAGA 2DLRA 4E7ZA 5HAXA 5JR9C 3LK3B 5HXHA 4ANJA 4AQFA 4ZS3A 5JR9A 4DVDA 3IF8B 2VASA 4MBQA 2CXFA 2X0LB 2JQQA 3KBUA 3J9X1 2X9WA 2KLQA 3PURA 2ZMAA 2X9YA 1QUUA 4DBRA 3O4XE 4JLEA 2A3DA 4TUYE 3MACA 3KV5A 3O9XA 5FXZA 4ONRA 2K48A 1WLXA 2LSKA 3KVAA 2LOSA 3O1HA 3Q2MA 4AKGA 1SHZC 4CI3B 3ZMUB 2KNDA 4I55E 2VKHA 2LSGA 3B57A 5LP6E 3RPUA 3RRWA 1H7CA 2Q9QD 5FY0A 1MNEA 3L3PA 3NZQA 4H9NC 3ZJ2A 5HWXA 1ZKEA 5LNKA 5FXVA 3M65A 5JDLA 4AKRB 3ZC0A 3BQKA 1KK7A 2K9AA 2PBIA 2IAKA 2V7MA 3I0QA 1QSDA 4AI6A 1VOMA 4GIWA 3EDVA 2WM9A 3CKDA 4B6XA 2HPJA 2WMOA 4CXXA 4QX8B 1V9DA 2XQYA 5AFUL 2V7KA 5JDQA 5JRCB 2JMHA 2KT9A 3S4UA 2IC9A 4PK6A 5KMGP 4QXHB 4IIJE 3VJZA 4TX5A 2XAHB 3AA1B 4QKNA 4KUMB 3R84B 2J1DG 1HCIA 1D1BA 1WRDA 4ZHQE 3RC8A 3PUSA 3GA8A 4I50E 2ODVA 2XAGB 2LSYA 3L09A 4H9PC 2C5KT 2N2NA 3AA6B 3ETVA 3KFWX 3ZYKA 4OYJA 2NW9A 5HXRA 1O3XA 3HA4A 3ZPOA 2PFVA 3FBLA 4P0AA 5JDNA 2KINB 2DWGA 2GK9A 4TV8E 5LHIB 1D0ZA 4CXWA 3E22E 4P0BA 3UTKA 2Q9QB 3NRYA 5LJNA 1HF8A 2ACXA 4U74A 3CQXC 4UVAB 3K8PC 4UEMA 4YHJA 5LHGB 2JJ9A 3KV4A 2KZ7B 5FP3A 2WBLA 4M1PA 2XAQB 3V5UA 2KWHA 4G63A 3ZYLA 4HTEA 1HX8A 2W0GA 4MALA 4O4IE 4JUYA 3LG7A 2LSIA 2N9DA 3R6NA 5JDHA 2NP9A 2UXNB 1BR2A 4TV9E 2NW8A 4ERRA 5C8YE 4HKAA 2KMFA 2MYSA 4NUVA 3ZEFB 5HYAA 3MK7C 4UXNB 3AA0B 3RYHE 5JDMA 2HPLA 3H37A 4GYRA 3Q5XA 4O4HE 4AQGA 2NOXA 5F3JA 3QUJA 5H6RB 2LHRA 2OA5A 3QC9A 5FYMA 2RP4A 4X1IE 1G73A 4OFZA 4EYYR 5TAOA 5CB4E 4ZOLE 4AKHA 3N2GE 3RYFE 4PK5A 4HGAA 3SS1A 3RX6A 4CQIA 2Z6EA 3C4WA 2E8IA 4EYUA 4O8SA 5JDGA 2W00A 4IHJE 3N5LA 2EHOB 5HXCA 4ZI3C 2CA5A 5HXEA 3CQGB 3ANWA 5DQWA 3VKGA 1VRBA 1MMDA 5LOVE 4I43B 4HE8A 2CCQA 5KDMC 3CX8B 2E9XC 1HG2A 4GYSA 2L9QA 3MKDA 5L2LA 2HH7A 4BJNA 4IE5A 3F57A 4FI5A 3IEEA 3UUNA 3CX7B 3H3AA 3JC6C 3ZCIA 3HKEE 2ZM0A 2LT3A 1YW0A 2XHEB 3ZYMA 4I4TE 4EOZB 2CM0A 3PF0A 5FNVE 4H9SE 4C90A 4ADZA 5LJMA 4HEAA 5L3CB 3K3QC 1Z0PA 4CXYA 4QXCB 4ZS2A 5IYZE 4BJMA 2CWOA 3ZMSB 5LCYA 3OYXA 3SRZA 4UELA 2PG8A 3BQLA 2VKJA 3W15B 3N9PA 3WURA 2DNXA 2VWAA 4IE6A 3E0ZA 2PJQA 3V5SA 2K24A 5J2UE 1UX4A 2A2FX 1NAFA 4OHFA 4ILUA 2XUEA 3P8CD 4E7SA 5L3FB 3N2OA 4WBOA 1MNDA 3SOLA 3EVYA 2LOPA 4L9IA 5HXSA 4P09A 3D0TA 2W63A 2LQUA 1CUNA 4NUUA 2JRKA 4MLKA 2CEAA 4WW0A 3A5XA 5DQVA 3C4XA 5EK4A 5JREA 1HS7A 4O4JE 3QK6A 4IGUA 4IE0A 5BMVE 1LKXA 2RA1A 1YKEB 3RRCA 1OXZA 3ETUA 4L5GA 1BR1A 1YKHB 2ZLYA 1ZV4X 3PTRB 3CVRA 3LBXB 2SPCA 4UF0B 2V7LA 2QGSA 2X51A 3KV9A 5FXWA 2W62A 3N9QA 4ISSA 4QXBB 5ADXL 3P7IA 3HL6A 3WAJA 5KX5E 1MMGA 1SA0E 3O1IA 1KNZA 4UV9B 3T8OA 4GOUA 5FMNA 3ZC1A 2DHRA 3ZN1B 4WBNE 3SWHA 2KXPB 3N9LA 3B13A 3AAEB 2NWBA 2Y6XA 3PUAA 2BVLA 3IHRA 4UVCB 2IC6A 4G2AA 4ZI3D 2X67A 3AA7B 2NW7A 3PU3A 1UCUA 2NTXA 4X1KE 2DI4A 3KVBA 4UIGA 3C51A 2P9BA 1D0XA 4TZ4C 2E9XD 4X1YE 2CWYA 4CZZB 4XZCA 5IHYA 3AVRA 4HN9A 5J2TE 3OBVE 2C0SA 3GN5A 2ZM2A 3I1AA 3JC6D 3DTOA 2V7IA 4EAHA 2D2SA 3I9WA 2CLYB 2D5UA 4DO0A 2MOZA 2YU1A 1EZ3A 2Q9QC 2XASB 4DNDA 3NRXA 3FXEB 5JDFA 4UV8B 5LGNB 4CI2B 3K3OA 4QWNB 1LVFA 3HKCE 4V1Av 3RKOA 4EIWA 2Y48B 3ZMZB 5LYJE 2N1GA 3GWHA 3HR0A 3U78A 3EDUA 4HFVA 4K0UA 4PK4A 3PDYA 3J7Yq 3WAKA 4H9RC 5CA0E 4FJOA 3EUHA 3AVSA 4AKLA 3I0OA 3OJAA 3Q9DA 4XBFB 1HFAA 1B7TA 4MHCA 2A72A 4EZ4A 2QA7A 4PW8A 4H9QC 3MZKB 4KP3C 1MMNA 2CXLA 4GK5E 5CA1E 3N2KE 4ZI2C 3KBTA 1D0YA 2XAJB 5JVDE 3C64A 2B1EA 1IAPA 3AAAB 2VKOA 4DMVA 1FMVA 1FIOA 4TN7B 4PFPA 4OYKA 4ZI7E 2E9XA 2V26A 1S35A 4PJLA 5JR9B 5HWYA 3ZJ1A 1ZHCA 3CWZB 3VKHA 5JQGE 4AKIA 2DCFA 4JEUB 2KWIB 3N9OA 2X9XA 1WYBA 2WAUA 2YINA 2EHOC 5LGUB 5LXTE 2YEVC 1US7B 5L3BB 2LSJA 2LEHA 3FBZA 2W61A 4N78D 4ECGA 2WMNA 5FXXA 3C4ZA 5J1GA 2D0TA 5LA6E 4AQFC 5T1DA 5LBMA 4L0RA 4J2CA 3FXDB 2BZBA 5JH7E 4Z8XA 3N9MA 4XAXB 2IW5B 5L3GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXE A;  5JDF A;  5HWY A;  5HXH A;  3V5U A;  5JDL A;  5JDM A;  5HXS A;  5JDQ A;  5JDN A;  5JDH A;  5HXR A;  3V5S A;  5HYA A;  5HWX A;  5HXC A;  5JDG A; 
#chains in the Genus database with same CATH topology
 2H7O A;  4NXM T;  2DWK A;  3NZP A;  3AE1 A;  3VU7 H;  1MIW A;  1MIV A;  5L3D B;  2D0U A;  2HN1 A;  4WZX A;  3U3I A;  1BR0 A;  4X20 E;  5ABH A;  3AE8 A;  3RGL A;  2ODU A;  5EK2 A;  3PHF 1;  2JPF A;  5JRC A;  4PJJ A;  5HEJ A;  4ZI2 D;  3OKQ A;  1ZOY A;  2VL0 A;  3UU4 A;  2F4V T;  5DAB A;  2BKN A;  4DR4 T;  2LE8 A;  3JCF A;  4PJM A;  2Q9Q A;  2V6Y B;  3Q5W A;  4LFB T;  3DP7 A;  1HNX T;  5EZY E;  2X68 A;  1E1H B;  3ONL C;  1WR6 A;  3UUM A;  3LK2 B;  3LSV A;  3F2E A;  5LBQ B;  2VKD A;  3KV6 A;  4HWD A;  1FMW A;  3UU8 A;  3AXJ B;  3TKL B;  3UUX B;  4DUZ T;  3AY5 A;  4JI8 T;  1WR0 A;  3ANW B;  1U4Q A;  3LJC A;  4X62 T;  2E2A A;  2WU2 A;  3ZN0 B;  2UUB T;  1W0B A;  3FZK B;  3PU8 A;  4BAY B;  4YLH A;  4IE7 A;  1VCT A;  3RIA A;  3F31 A;  5FY1 A;  3CML A;  3HI2 A;  1R8I A;  1UUS A;  1NWM X;  4X5T A;  2L3L A;  4PAG A;  4ANJ A;  2X9W A;  3PUR A;  2X9Y A;  4JLE A;  3O9X A;  4AKG A;  2KND A;  2XPK A;  2V5C A;  2Q9Q D;  2KBB A;  1MNE A;  3ZJ2 A;  3M65 A;  5JDL A;  3PUX F;  4X66 T;  2WP9 A;  2K9A A;  2IAK A;  2V7M A;  3I0Q A;  2CRB A;  4NIQ A;  3EDV A;  4TWD A;  2UUA T;  1IBK T;  4CXX A;  5AFU L;  2WS3 A;  2XQY A;  2V7K A;  2JMH A;  2KT9 A;  3S4U A;  4PK6 A;  3VJZ A;  3AA1 B;  3R84 B;  1WRD A;  3GA8 A;  2BBJ A;  2ODV A;  5FVK A;  1J1J A;  3ETV A;  3KFW X;  4DR3 T;  3FBL A;  4P0A A;  2KIN B;  5LHI B;  2DWG A;  3UTK A;  1HF8 A;  2ACX A;  4YHJ A;  3V5U A;  4G63 A;  4MAL A;  1XDP A;  3LG7 A;  2LSI A;  1N34 T;  5FKY A;  2N9D A;  5JDH A;  2XQ5 A;  1BR2 A;  2NW8 A;  2M6I A;  2KMF A;  5ABF A;  4DR6 T;  3AA0 B;  5JDM A;  1XMO T;  4GYR A;  4AQG A;  2NOX A;  5F3J A;  2OA5 A;  4X1I E;  2MAW A;  4EYY R;  5CB4 E;  3OTO T;  5LMU T;  4PK5 A;  3SS1 A;  1IBL T;  2M6B A;  4EYU A;  4IHJ E;  2VUR A;  2A9U A;  5HXC A;  3CQG B;  3ANW A;  4ILC A;  1VRB A;  5LOV E;  5KDM C;  2L9Q A;  3MKD A;  3F57 A;  2YN6 A;  3H3A A;  3ZCI A;  1WCR A;  2XHE B;  4LF8 T;  5FNV E;  4C90 A;  4ADZ A;  5LJM A;  5L3C B;  3IA3 A;  4ZS2 A;  1N32 T;  3VR9 A;  4IT4 A;  3OYX A;  3W15 B;  2XQ8 A;  2XSB A;  3V5S A;  2K24 A;  2LM2 A;  2E5L T;  1UX4 A;  4OHF A;  3A8Y C;  2XUE A;  3P8C D;  3N2O A;  3FYQ A;  3EVY A;  2W63 A;  4NUU A;  2XQ7 A;  1HS7 A;  3QK6 A;  4IGU A;  5BMV E;  2RA1 A;  1BR1 A;  1YKH B;  3CVR A;  3KV9 A;  3P7I A;  3HL6 A;  3P4R A;  2WCA A;  1KNZ A;  2CHO A;  4KX6 A;  2WDV A;  5AQV B;  2KXP B;  3N9L A;  4JI5 T;  3UU5 A;  2JQH A;  2NWB A;  2VVN A;  4KHZ F;  4G2A A;  4ZI3 D;  4TZ4 C;  4XZC A;  5IHY A;  3EAB A;  5HEH A;  5J2T E;  2C0S A;  3GN5 A;  2B76 A;  2ZM2 A;  4DO0 A;  2YU1 A;  2Q9Q C;  3FXE B;  5JDF A;  2XJ7 A;  2H88 A;  4IDO A;  4V1A v;  3ZMZ B;  2FJB A;  3HR0 A;  5BR8 T;  4PK4 A;  4AQY T;  1OED B;  4FJO A;  4AKL A;  3AVS A;  4LF4 T;  2A72 A;  2QA7 A;  4PW8 A;  3N2K E;  2KSR A;  2VKO A;  2R6G F;  1FMV A;  2OV9 A;  4TN7 B;  2BS2 A;  5JR9 B;  3CWZ B;  3VKH A;  5JQG E;  4AKI A;  2VQE T;  4U3C A;  4B3M T;  3ZT7 A;  5LMN T;  1NEK A;  2WAU A;  5LGU B;  1US7 B;  2LEH A;  3FBZ A;  2HN2 A;  2XQ4 A;  2WMN A;  5FXX A;  3C4Z A;  2D0T A;  5LA6 E;  2WZI A;  4L0R A;  2WDQ A;  2BZB A;  5JH7 E;  4LF5 T;  2IW5 B;  5L3G B;  3VR8 A;  2J47 A;  4IDZ A;  3ZKR A;  2ES0 A;  2XSA A;  3MA9 A;  1HNZ T;  2W2U A;  3H3M A;  4AIS A;  4YHH T;  4O2A E;  5L3E B;  3ZST A;  2NTY A;  5F5W A;  4DV6 T;  2DL1 A;  1WFD A;  3AE5 A;  4AXP A;  3B5M A;  4DMW A;  3ZT5 A;  2CHN A;  4PNI A;  5LHH B;  2YKS A;  2YDR A;  1YQ3 A;  1KFY A;  4O4L E;  3RQW A;  2ZM8 A;  2AE9 A;  4YSY A;  3PUQ A;  3MXZ A;  3PJA J;  4EB6 E;  4DUY T;  1SJ8 A;  3ESL A;  2BDE A;  2IUB A;  4CI1 B;  4QHO A;  4WNK A;  5FVL A;  4HFB A;  3MJX A;  2LJL A;  4JEH B;  1HTJ F;  1N36 T;  1XNQ T;  2XTL A;  2V7J A;  1Z8U A;  3C98 B;  1D1A A;  5FL0 A;  1D1C A;  2VB6 A;  2CLY C;  1OWA A;  2LHN A;  3E08 A;  3K3N A;  1BR4 A;  3UT5 E;  2V8S V;  1X9B A;  5L4H A;  2E9X B;  3AEG A;  5FY7 A;  5AQJ B;  1MMA A;  2BG9 B;  5F8P A;  4DV0 T;  4ILA A;  1X79 A;  2MTQ A;  1OED A;  2WU5 A;  4P1N A;  2W66 A;  3FB2 A;  1S94 A;  4Z90 A;  3CX6 B;  3RYC E;  3GMI A;  4GK0 E;  5LG4 A;  2UXX B;  1U5P A;  4YFS A;  4DBQ A;  4EEB A;  1ZEE A;  2DLR A;  5AQT B;  4AQF A;  5JR9 A;  3PUV F;  3IF8 B;  2VAS A;  3J9X 1;  1T8B A;  1QUU A;  4TUY E;  5AQH B;  4A5X A;  2LLY A;  2LSK A;  3KVA A;  2YDQ A;  1H7C A;  2BG9 E;  3NZQ A;  5HEU A;  5HWX A;  1ZKE A;  5LNK A;  3ZC0 A;  2PBI A;  1VOM A;  2WM9 A;  2WY2 A;  4B6X A;  2HPJ A;  2WMO A;  2MPK A;  4QX8 B;  1V9D A;  5HCJ A;  4U2Y A;  4TX5 A;  4F8H A;  2XAH B;  4KUM B;  2XAG B;  4H9P C;  2N2N A;  2KVP A;  3AA6 B;  3ZYK A;  5HXR A;  1O3X A;  2K3W A;  2KGX A;  4GKJ T;  3L8R A;  1D0Z A;  4CXW A;  3E22 E;  4P0B A;  4ZZC A;  1E7P A;  4U74 A;  4UVA B;  3K8P C;  4UEM A;  2JJ9 A;  3KV4 A;  2WBL A;  2KWH A;  4LFC T;  1E2A A;  1CHU A;  1HX8 A;  2W0G A;  4O4I E;  3R6N A;  2E5V A;  4HFE A;  2MYS A;  4ZXL A;  5HYA A;  3RYH E;  2HPL A;  2NR4 A;  3Q5X A;  4HWH A;  2LHR A;  5FYM A;  5IWA T;  4OFZ A;  4UR9 A;  4ZOL E;  4AKH A;  3RX6 A;  3EHZ A;  3C4W A;  2E8I A;  1QLB A;  2FJE A;  4O8S A;  3UUB A;  5AQR B;  2EHO B;  2XZE A;  5HXE A;  3VKG A;  1MMD A;  4U31 A;  3PUZ F;  4JI2 T;  1HG2 A;  4GYS A;  5L2L A;  1XZY A;  4IE5 A;  4FI5 A;  3IEE A;  3UUN A;  5FZT A;  2ZM0 A;  5HEG A;  4EOZ B;  4B3T T;  2CM0 A;  3PF0 A;  2WQY A;  3QB5 K;  4HEA A;  1Z0P A;  4CXY A;  2CWO A;  3RIF A;  3SRZ A;  2VKJ A;  3N9P A;  4IE6 A;  2PJQ A;  2FBW A;  1NAF A;  1SJ7 A;  4E7S A;  4WYV A;  5JTG A;  2WDR A;  5AQU B;  4YTP A;  4IE0 A;  1LKX A;  1YKE B;  1OXZ A;  4CN1 A;  3ETU A;  4L5G A;  4ILB A;  3PTR B;  2I6H A;  4UF0 B;  2V7L A;  2QGS A;  2W62 A;  3N9Q A;  4ISS A;  5ADX L;  2X0C A;  4IDP A;  2LKG A;  2OLT A;  5AQN B;  3T8O A;  5FMN A;  3ZC1 A;  2L10 A;  3B13 A;  1HR0 T;  1XWM A;  2X67 A;  3AA7 B;  1FJG T;  3PU3 A;  2E9X D;  4CZZ B;  4HN9 A;  3I1A A;  3JC6 D;  3I9W A;  4TNV A;  2X0H A;  5AQS B;  2XAS B;  4DND A;  5LGN B;  1LVF A;  4EIW A;  4YTN A;  2N1G A;  2V6Y A;  3U78 A;  2XM1 A;  2LKH A;  4K0U A;  3PDY A;  3J7Y q;  5CA0 E;  1KEY A;  4A98 A;  3Q5D A;  1B7T A;  4MHC A;  4EZ4 A;  3RIU A;  4KP3 C;  3AXJ A;  1MMN A;  4GK5 E;  5CA1 E;  1I6Z A;  4ZI2 C;  3KBT A;  1D0Y A;  4K0K T;  2B1E A;  3AAA B;  1T7S A;  4OYK A;  4PJL A;  2XY8 B;  5HWY A;  3ZJ1 A;  1ZHC A;  3AEC A;  3OPC A;  4GKK T;  3RF1 A;  3AE3 A;  4IL4 A;  4Z91 A;  5LXT E;  2YEV C;  5CGM A;  5L3B B;  1HNW T;  4N78 D;  4ECG A;  4AQF C;  3FXD B;  5AQP B;  3UFE A;  4EXT A;  2VQF T;  3NBX X;  3PUG A;  5KXJ A;  5ETW A;  2CE7 A;  3UUL A;  2K5B B;  1IJ5 A;  1YXR A;  1Y64 B;  5AQI B;  3HKB E;  3AED A;  2G0U A;  2JQK A;  3CK6 A;  4PFO A;  4H63 V;  2L8K A;  2I59 A;  3P4W A;  1AJ3 A;  3VHL A;  2LM9 A;  2YK0 A;  3EI0 A;  5AQM B;  4YSX A;  5L47 A;  4YJ2 E;  4JV5 T;  5C3J A;  4ASK A;  4HWI B;  3BQI A;  1J5E T;  4UF0 A;  3LK4 2;  4JI0 T;  1LRZ A;  2Y8D A;  4ZEY A;  3PE0 A;  2CPT A;  3RH3 A;  3TLT A;  2IIU A;  3AT7 A;  4KBM B;  2CMR A;  2EHO D;  2CBI A;  2WB5 A;  2M67 A;  2VK9 A;  2MBG A;  2JMK A;  3FHN A;  1UX5 A;  2BS4 A;  5LGT B;  2ACZ A;  3KIN B;  3C50 A;  3M1C A;  5CFB A;  3BK9 A;  4OX9 T;  1N33 T;  5M4Y A;  2H7V C;  3RYI E;  3ZMV B;  4LF9 T;  2WWU A;  3HKD E;  3AB3 B;  3O1J A;  5GON E;  4BA9 A;  4QX7 B;  1XDO A;  3AAI A;  5E0O A;  4QH4 A;  5A1L A;  3RC3 A;  5IUX A;  2MTC A;  1IJ6 A;  3ZCJ A;  1W09 A;  3ONX A;  4DID B;  1W9R A;  2I0M A;  4ZZB A;  3KDS E;  5HAX A;  3LK3 B;  4ZS3 A;  4MBQ A;  2CXF A;  3KBU A;  4HWF A;  2ZMA A;  4DBR A;  3KV5 A;  4KI0 F;  5FXZ A;  4ONR A;  2K48 A;  2UXB T;  2L7N A;  1WLX A;  2LOS A;  3AE4 A;  3O1H A;  3Q2M A;  1SHZ C;  1W0A A;  4JBW F;  4I55 E;  4QH1 A;  2VKH A;  2FJD A;  3X1D A;  3RRW A;  3ZT6 A;  5FY0 A;  4LML A;  3AE2 A;  2UXC T;  5LB7 B;  4W8P A;  5FXV A;  4QH5 A;  4JYA T;  1T72 A;  1KK7 A;  2BBH A;  3SFD A;  3CKD A;  3FZF B;  5JRC B;  2IC9 A;  2J1D G;  4ZHQ E;  3P4S A;  4I50 E;  2LSY A;  3L09 A;  4OYJ A;  3HA4 A;  3ZPO A;  2PFV A;  4TV8 E;  2GK9 A;  5LJN A;  2Q9Q B;  3CQX C;  5LHG B;  2WZH A;  3AEA A;  1I94 T;  5FP3 A;  5AQG B;  2XAQ B;  4U7Y A;  3ZYL A;  4HTE A;  2QRX A;  4LFA T;  2NP9 A;  2UXN B;  4TV9 E;  3JAD A;  5C8Y E;  3ZEF B;  4UXN B;  3QUJ A;  5H6R B;  4LMK A;  1G73 A;  5TAO A;  3RYF E;  4HGA A;  3AEE A;  3P4Q A;  3UU3 A;  4CQI A;  2Z6E A;  3RIU C;  5JDG A;  1SUM B;  2W00 A;  3RI5 A;  4ZI3 C;  2CA5 A;  5DQW A;  4IL9 A;  2IHR 1;  5AQF B;  4I43 B;  4HE8 A;  4EV6 A;  3CX8 B;  5AQQ B;  4IDN A;  4EED A;  4HFD A;  2JIW A;  4I4T E;  2BS3 A;  1ZP0 A;  5IYZ E;  4JI1 T;  4BJM A;  2IDO B;  5LCY A;  3BQL A;  2IML A;  2VWA A;  3E0Z A;  5J2U E;  4ILU A;  5L3F B;  1JNR A;  4X65 T;  2QYW A;  2LOP A;  3PUY F;  3D0T A;  2LQU A;  1CUN A;  2JRK A;  4MLK A;  4DV1 T;  4WW0 A;  3A5X A;  5DQV A;  3C4X A;  5JRE A;  4O4J E;  2ZLY A;  1UGO A;  4B3R T;  4YT0 A;  3LBX B;  2SPC A;  5FXW A;  4TWH A;  4QXB B;  3O1I A;  2XQA A;  4UV9 B;  1GQE A;  4GOU A;  2DHR A;  4WBN E;  3PUA A;  4UVC B;  3A7M A;  2BVL A;  4F7G B;  1DU2 A;  2NTX A;  4JI3 T;  2DI4 A;  3KVB A;  2H89 A;  4UIG A;  2P9B A;  1D0X A;  5AQL B;  3AVR A;  3NVO A;  1L0V A;  3DTO A;  5ABF B;  4EAH A;  2CLY B;  2MOZ A;  3NRX A;  4UV8 B;  4CI2 B;  3K3O A;  4QWN B;  4TWF A;  3RKO A;  5LYJ E;  3EDU A;  4HFV A;  2BKP A;  4DR2 T;  2LRK A;  3FZH B;  1UUR A;  3WAK A;  4H9R C;  3AE7 A;  5LG3 A;  3AEB A;  3MZK B;  2CXL A;  3VRB A;  5HEO A;  5JVD E;  3C64 A;  1IAP A;  4U33 A;  4DMV A;  2RPA A;  4ZI7 E;  3ABV A;  3RHW A;  2E9X A;  2V26 A;  2BG9 A;  4DV3 T;  2DCF A;  2JQ9 A;  3JAE A;  1WYB A;  3TLU A;  4CN4 A;  1KNP A;  3UU6 A;  2W61 A;  5J1G A;  2V5D A;  5LBM A;  4J2C A;  3N9M A;  4XAX B;  4H63 H;  4IST A;  2VVS A;  2QVA A;  2C5J A;  4YSZ A;  2CXD A;  3WSC A;  4F6R C;  3M3Z B;  4C91 A;  2X9H A;  2WSS V;  4JI6 T;  2YU2 A;  1LVK A;  3CQC B;  3N9N A;  3WI3 A;  4DV2 T;  1HG5 A;  4HFI A;  2H3R A;  3FZM B;  4UVB B;  4HWC A;  1FEW A;  1T98 A;  4BGO A;  3ZLI A;  4HFC A;  1IZN B;  4A56 A;  3GN5 B;  3LBX A;  3UFG A;  2XAF B;  3ZMT B;  1YQ4 A;  5AQO B;  2V1D B;  1MIY A;  3QB5 A;  4YJ3 E;  4IE4 A;  1XMQ T;  2X0Y A;  3PV0 F;  5H6Q B;  1M7K A;  4KMC A;  3CPZ A;  4H9O C;  3NWI A;  2BVM A;  4MFR A;  2X66 A;  4U72 A;  4YTM A;  2FJA A;  2XQ9 A;  4DR1 T;  4EZH A;  1G8X A;  3ONJ A;  4COF A;  4KHP T;  2J4G A;  1WYC A;  1Y01 A;  4OK0 A;  4PJN A;  5DJQ C;  5EK3 A;  3DYJ A;  1OED C;  2HHH T;  2VL8 A;  2V6X A;  3IBP A;  3OYZ A;  4A97 A;  1UK5 A;  4O2B E;  2EHO A;  3I9Y A;  3LFM A;  2C5I T;  2XQ6 A;  1KNR A;  1YD8 G;  4E7Z A;  3DJB A;  5JR9 C;  5HXH A;  1SE7 A;  4DVD A;  4LF6 T;  2W67 A;  2X0L B;  2JQQ A;  2KLQ A;  3PJA A;  3O4X E;  2A3D A;  3MAC A;  2AXD S;  3OVU A;  3RLF F;  3ZMU B;  4CI3 B;  2LSG A;  3B57 A;  5LP6 E;  3RPU A;  3L3P A;  2J62 A;  4H9N C;  2LRL A;  4AKR B;  3BQK A;  2ZM6 T;  1QSD A;  4AI6 A;  4GIW A;  5JDQ A;  4HFH A;  5KMG P;  4QXH B;  4IIJ E;  5CJ5 A;  3UQ4 A;  4QKN A;  1HCI A;  1D1B A;  3RC8 A;  3PUS A;  3TLW A;  2C5K T;  3SFE A;  2NW9 A;  4U7I A;  5JDN A;  3NRY A;  2UXD T;  2KZ7 B;  3P50 A;  4M1P A;  4NXN T;  3LDQ B;  3QOF A;  5HCM A;  4JUY A;  4X64 T;  4YXD A;  4DV5 T;  4ERR A;  4Q25 A;  4HKA A;  4NUV A;  3MK7 C;  3H37 A;  4O4H E;  5ABG A;  3TLS A;  3QC9 A;  2RP4 A;  5AQK B;  4U2Z A;  3VRA A;  3ZSS A;  3N2G E;  2BKO A;  3N5L A;  5L4E A;  4AIU A;  2CCQ A;  2E9X C;  2HH7 A;  4BJN A;  3T1H T;  3CX7 B;  2BG9 C;  3JC6 C;  3HKE E;  2LT3 A;  1YW0 A;  3JAF A;  3ZYM A;  1M62 A;  4H9S E;  1NEN A;  4B3S T;  3K3Q C;  4QXC B;  3ZMS B;  3NKZ A;  4UEL A;  2PG8 A;  3WUR A;  2DNX A;  2W4X A;  3FZL B;  2A2F X;  1OED E;  3PUW F;  2YOE A;  4NPP A;  4WBO A;  1MND A;  3SOL A;  1IBM T;  4L9I A;  5HXS A;  4LMJ A;  4P09 A;  3QNU A;  2CEA A;  5EK4 A;  3RRC A;  1XNR T;  3AEF A;  1ZV4 X;  5FL1 A;  4DV7 T;  3AE9 A;  1VCS A;  3RKG A;  1KF6 A;  2X51 A;  3WAJ A;  5KX5 E;  1MMG A;  1SA0 E;  4JI4 T;  2PTF A;  3ZN1 B;  4LF7 T;  3SWH A;  3AAE B;  2FUP A;  2Y6X A;  3IHR A;  2YDS A;  3TLV A;  2IC6 A;  2NW7 A;  3CIR A;  1UCU A;  4X1K E;  2UUC T;  4TNW A;  3K1S A;  3C51 A;  4DR7 T;  4X1Y E;  4YY3 T;  2CWY A;  2XQ3 A;  3UQ7 A;  3OBV E;  3P4P A;  2D9D A;  2V7I A;  2D2S A;  5J0Z A;  2D5U A;  3AE6 A;  1EZ3 A;  4DV4 T;  3HKC E;  2Y48 B;  3GWH A;  3EUH A;  4IRE A;  3Q5E A;  3I0O A;  2CBJ A;  3OJA A;  3Q9D A;  4XBF B;  1HFA A;  4H9Q C;  1J5W A;  2XAJ B;  3EAM A;  1FIO A;  4PFP A;  5C2T A;  2XM2 A;  3G06 A;  1S35 A;  4IDQ A;  3T1Y T;  4CN6 A;  4I0U A;  4JI7 T;  4JEU B;  2KWI B;  4DR5 T;  3N9O A;  2X9X A;  1JNZ A;  2YIN A;  2EHO C;  2WWV A;  1HX1 B;  2LSJ A;  5ABE A;  3RQU A;  3L39 A;  4EGW A;  5T1D A;  4Z8X A;  2UU9 T; 
#chains in the Genus database with same CATH homology
 3UFE A;  4H63 H;  4IST A;  4EXT A;  2H7O A;  4IDZ A;  2DWK A;  3NZP A;  3VU7 H;  1MIW A;  2C5J A;  3NBX X;  3PUG A;  5ETW A;  2CE7 A;  2CXD A;  1MIV A;  3UUL A;  5L3D B;  2D0U A;  2K5B B;  4F6R C;  3WSC A;  1IJ5 A;  2ES0 A;  3MA9 A;  3U3I A;  1Y64 B;  4C91 A;  2X9H A;  2WSS V;  1BR0 A;  2YU2 A;  3HKB E;  2G0U A;  4X20 E;  4PFO A;  1LVK A;  3CQC B;  2ODU A;  3N9N A;  4H63 V;  5EK2 A;  3WI3 A;  4O2A E;  5L3E B;  2L8K A;  1HG5 A;  3PHF 1;  2I59 A;  2NTY A;  1AJ3 A;  3VHL A;  2LM9 A;  2JPF A;  2H3R A;  2YK0 A;  4AXP A;  4UVB B;  4DMW A;  1FEW A;  4PNI A;  5JRC A;  1T98 A;  4PJJ A;  4YJ2 E;  5LHH B;  4BGO A;  4ZI2 D;  3OKQ A;  3ZLI A;  4O4L E;  1IZN B;  4A56 A;  4ASK A;  2ZM8 A;  3BQI A;  5DAB A;  3GN5 B;  3LBX A;  2XAF B;  3PUQ A;  3MXZ A;  4UF0 A;  3LK4 2;  4EB6 E;  1LRZ A;  2Y8D A;  3ZMT B;  2V1D B;  3PE0 A;  1MIY A;  4YJ3 E;  3ESL A;  4IE4 A;  3RH3 A;  2BDE A;  2LE8 A;  4PJM A;  4CI1 B;  4QHO A;  4WNK A;  5H6Q B;  2Q9Q A;  4KMC A;  3AT7 A;  3Q5W A;  3DP7 A;  3CPZ A;  3MJX A;  2LJL A;  4JEH B;  5EZY E;  1HTJ F;  4H9O C;  4KBM B;  2CMR A;  2EHO D;  2BVM A;  4MFR A;  2X68 A;  1E1H B;  2X66 A;  1WR6 A;  2M67 A;  2VK9 A;  2XTL A;  2V7J A;  2MBG A;  2JMK A;  4U72 A;  3UUM A;  3LK2 B;  3F2E A;  5LBQ B;  2VKD A;  3FHN A;  3KV6 A;  3C98 B;  1D1A A;  1UX5 A;  1FMW A;  1G8X A;  4EZH A;  1D1C A;  5LGT B;  3TKL B;  3UUX B;  2VB6 A;  3KIN B;  3C50 A;  2CLY C;  3M1C A;  1OWA A;  2LHN A;  3ANW B;  3E08 A;  3K3N A;  1BR4 A;  1U4Q A;  3BK9 A;  3LJC A;  5M4Y A;  2H7V C;  3RYI E;  3UT5 E;  2E9X B;  3ZN0 B;  1WYC A;  5FY7 A;  4OK0 A;  3ZMV B;  1MMA A;  2WWU A;  4PJN A;  3HKD E;  5DJQ C;  5EK3 A;  5F8P A;  3PU8 A;  1X79 A;  2MTQ A;  4BAY B;  3AB3 B;  2VL8 A;  3O1J A;  4YLH A;  3IBP A;  5GON E;  4BA9 A;  4QX7 B;  3AAI A;  3FB2 A;  1S94 A;  5E0O A;  4IE7 A;  3OYZ A;  5A1L A;  3CX6 B;  3RC3 A;  3RYC E;  2MTC A;  3GMI A;  1IJ6 A;  4GK0 E;  4O2B E;  2EHO A;  3F31 A;  3ZCJ A;  5LG4 A;  3I9Y A;  2UXX B;  3ONX A;  3LFM A;  2C5I T;  5FY1 A;  3CML A;  3HI2 A;  1U5P A;  4YFS A;  4DBQ A;  3KDS E;  1NWM X;  1ZEE A;  1YD8 G;  2L3L A;  3DJB A;  4PAG A;  2DLR A;  4E7Z A;  5HAX A;  5JR9 C;  3LK3 B;  5HXH A;  4ANJ A;  4AQF A;  4ZS3 A;  5JR9 A;  4DVD A;  3IF8 B;  2VAS A;  4MBQ A;  2CXF A;  2X0L B;  2JQQ A;  3KBU A;  3J9X 1;  2X9W A;  2KLQ A;  3PUR A;  2ZMA A;  2X9Y A;  1QUU A;  4DBR A;  3O4X E;  4JLE A;  2A3D A;  4TUY E;  3MAC A;  3KV5 A;  3O9X A;  5FXZ A;  4ONR A;  2K48 A;  1WLX A;  2LSK A;  3KVA A;  2LOS A;  3O1H A;  3Q2M A;  4AKG A;  1SHZ C;  4CI3 B;  3ZMU B;  2KND A;  4I55 E;  2VKH A;  2LSG A;  3B57 A;  5LP6 E;  3RPU A;  3RRW A;  1H7C A;  2Q9Q D;  5FY0 A;  1MNE A;  3L3P A;  3NZQ A;  4H9N C;  3ZJ2 A;  5HWX A;  1ZKE A;  5LNK A;  5FXV A;  3M65 A;  5JDL A;  4AKR B;  3ZC0 A;  3BQK A;  1KK7 A;  2K9A A;  2PBI A;  2IAK A;  2V7M A;  3I0Q A;  1QSD A;  4AI6 A;  1VOM A;  4GIW A;  3EDV A;  2WM9 A;  3CKD A;  4B6X A;  2HPJ A;  2WMO A;  4CXX A;  4QX8 B;  1V9D A;  2XQY A;  5AFU L;  2V7K A;  5JDQ A;  5JRC B;  2JMH A;  2KT9 A;  3S4U A;  2IC9 A;  4PK6 A;  5KMG P;  4QXH B;  4IIJ E;  3VJZ A;  4TX5 A;  2XAH B;  3AA1 B;  4QKN A;  4KUM B;  3R84 B;  2J1D G;  1HCI A;  1D1B A;  1WRD A;  4ZHQ E;  3RC8 A;  3PUS A;  3GA8 A;  4I50 E;  2ODV A;  2XAG B;  2LSY A;  3L09 A;  4H9P C;  2C5K T;  2N2N A;  3AA6 B;  3ETV A;  3KFW X;  3ZYK A;  4OYJ A;  2NW9 A;  5HXR A;  1O3X A;  3HA4 A;  3ZPO A;  2PFV A;  3FBL A;  4P0A A;  5JDN A;  2KIN B;  2DWG A;  2GK9 A;  4TV8 E;  5LHI B;  1D0Z A;  4CXW A;  3E22 E;  4P0B A;  3UTK A;  2Q9Q B;  3NRY A;  5LJN A;  1HF8 A;  2ACX A;  4U74 A;  3CQX C;  4UVA B;  3K8P C;  4UEM A;  4YHJ A;  5LHG B;  2JJ9 A;  3KV4 A;  2KZ7 B;  5FP3 A;  2WBL A;  4M1P A;  2XAQ B;  3V5U A;  2KWH A;  4G63 A;  3ZYL A;  4HTE A;  1HX8 A;  2W0G A;  4MAL A;  4O4I E;  4JUY A;  3LG7 A;  2LSI A;  2N9D A;  3R6N A;  5JDH A;  2NP9 A;  2UXN B;  1BR2 A;  4TV9 E;  2NW8 A;  4ERR A;  5C8Y E;  4HKA A;  2KMF A;  2MYS A;  4NUV A;  3ZEF B;  5HYA A;  3MK7 C;  4UXN B;  3AA0 B;  3RYH E;  5JDM A;  2HPL A;  3H37 A;  4GYR A;  3Q5X A;  4O4H E;  4AQG A;  2NOX A;  5F3J A;  3QUJ A;  5H6R B;  2LHR A;  2OA5 A;  3QC9 A;  5FYM A;  2RP4 A;  4X1I E;  1G73 A;  4OFZ A;  4EYY R;  5TAO A;  5CB4 E;  4ZOL E;  4AKH A;  3N2G E;  3RYF E;  4PK5 A;  4HGA A;  3SS1 A;  3RX6 A;  4CQI A;  2Z6E A;  3C4W A;  2E8I A;  4EYU A;  4O8S A;  5JDG A;  2W00 A;  4IHJ E;  3N5L A;  2EHO B;  5HXC A;  4ZI3 C;  2CA5 A;  5HXE A;  3CQG B;  3ANW A;  5DQW A;  3VKG A;  1VRB A;  1MMD A;  5LOV E;  4I43 B;  4HE8 A;  2CCQ A;  5KDM C;  3CX8 B;  2E9X C;  1HG2 A;  4GYS A;  2L9Q A;  3MKD A;  5L2L A;  2HH7 A;  4BJN A;  4IE5 A;  3F57 A;  4FI5 A;  3IEE A;  3UUN A;  3CX7 B;  3H3A A;  3JC6 C;  3ZCI A;  3HKE E;  2ZM0 A;  2LT3 A;  1YW0 A;  2XHE B;  3ZYM A;  4I4T E;  4EOZ B;  2CM0 A;  3PF0 A;  5FNV E;  4H9S E;  4C90 A;  4ADZ A;  5LJM A;  4HEA A;  5L3C B;  3K3Q C;  1Z0P A;  4CXY A;  4QXC B;  4ZS2 A;  5IYZ E;  4BJM A;  2CWO A;  3ZMS B;  5LCY A;  3OYX A;  3SRZ A;  4UEL A;  2PG8 A;  3BQL A;  2VKJ A;  3W15 B;  3N9P A;  3WUR A;  2DNX A;  2VWA A;  4IE6 A;  3E0Z A;  2PJQ A;  3V5S A;  2K24 A;  5J2U E;  1UX4 A;  2A2F X;  1NAF A;  4OHF A;  4ILU A;  2XUE A;  3P8C D;  4E7S A;  5L3F B;  3N2O A;  4WBO A;  1MND A;  3SOL A;  3EVY A;  2LOP A;  4L9I A;  5HXS A;  4P09 A;  3D0T A;  2W63 A;  2LQU A;  1CUN A;  4NUU A;  2JRK A;  4MLK A;  2CEA A;  4WW0 A;  3A5X A;  5DQV A;  3C4X A;  5EK4 A;  5JRE A;  1HS7 A;  4O4J E;  3QK6 A;  4IGU A;  4IE0 A;  5BMV E;  1LKX A;  2RA1 A;  1YKE B;  3RRC A;  1OXZ A;  3ETU A;  4L5G A;  1BR1 A;  1YKH B;  2ZLY A;  1ZV4 X;  3PTR B;  3CVR A;  3LBX B;  2SPC A;  4UF0 B;  2V7L A;  2QGS A;  2X51 A;  3KV9 A;  5FXW A;  2W62 A;  3N9Q A;  4ISS A;  4QXB B;  5ADX L;  3P7I A;  3HL6 A;  3WAJ A;  5KX5 E;  1MMG A;  1SA0 E;  3O1I A;  1KNZ A;  4UV9 B;  3T8O A;  4GOU A;  5FMN A;  3ZC1 A;  2DHR A;  3ZN1 B;  4WBN E;  3SWH A;  2KXP B;  3N9L A;  3B13 A;  3AAE B;  2NWB A;  2Y6X A;  3PUA A;  2BVL A;  3IHR A;  4UVC B;  2IC6 A;  4G2A A;  4ZI3 D;  2X67 A;  3AA7 B;  2NW7 A;  3PU3 A;  1UCU A;  2NTX A;  4X1K E;  2DI4 A;  3KVB A;  4UIG A;  3C51 A;  2P9B A;  1D0X A;  4TZ4 C;  2E9X D;  4X1Y E;  2CWY A;  4CZZ B;  4XZC A;  5IHY A;  3AVR A;  4HN9 A;  5J2T E;  3OBV E;  2C0S A;  3GN5 A;  2ZM2 A;  3I1A A;  3JC6 D;  3DTO A;  2V7I A;  4EAH A;  2D2S A;  3I9W A;  2CLY B;  2D5U A;  4DO0 A;  2MOZ A;  2YU1 A;  1EZ3 A;  2Q9Q C;  2XAS B;  4DND A;  3NRX A;  3FXE B;  5JDF A;  4UV8 B;  5LGN B;  4CI2 B;  3K3O A;  4QWN B;  1LVF A;  3HKC E;  4V1A v;  3RKO A;  4EIW A;  2Y48 B;  3ZMZ B;  5LYJ E;  2N1G A;  3GWH A;  3HR0 A;  3U78 A;  3EDU A;  4HFV A;  4K0U A;  4PK4 A;  3PDY A;  3J7Y q;  3WAK A;  4H9R C;  5CA0 E;  4FJO A;  3EUH A;  3AVS A;  4AKL A;  3I0O A;  3OJA A;  3Q9D A;  4XBF B;  1HFA A;  1B7T A;  4MHC A;  2A72 A;  4EZ4 A;  2QA7 A;  4PW8 A;  4H9Q C;  3MZK B;  4KP3 C;  1MMN A;  2CXL A;  4GK5 E;  5CA1 E;  3N2K E;  4ZI2 C;  3KBT A;  1D0Y A;  2XAJ B;  5JVD E;  3C64 A;  2B1E A;  1IAP A;  3AAA B;  2VKO A;  4DMV A;  1FMV A;  1FIO A;  4TN7 B;  4PFP A;  4OYK A;  4ZI7 E;  2E9X A;  2V26 A;  1S35 A;  4PJL A;  5JR9 B;  5HWY A;  3ZJ1 A;  1ZHC A;  3CWZ B;  3VKH A;  5JQG E;  4AKI A;  2DCF A;  4JEU B;  2KWI B;  3N9O A;  2X9X A;  1WYB A;  2WAU A;  2YIN A;  2EHO C;  5LGU B;  5LXT E;  2YEV C;  1US7 B;  5L3B B;  2LSJ A;  2LEH A;  3FBZ A;  2W61 A;  4N78 D;  4ECG A;  2WMN A;  5FXX A;  3C4Z A;  5J1G A;  2D0T A;  5LA6 E;  4AQF C;  5T1D A;  5LBM A;  4L0R A;  4J2C A;  3FXD B;  2BZB A;  5JH7 E;  4Z8X A;  3N9M A;  4XAX B;  2IW5 B;  5L3G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...