5JDLA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 1mm sr2+
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
301
structure length
299
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEENKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
molecule keywords Uncharacterized membrane protein MJ0091
total genus 113
structure length 299
sequence length 301
ec nomenclature
pdb deposition date 2016-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdlA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdlA02
5HXHA 5JDMA 5JDFA 5JDGA 3V5UA 5HYAA 5HXRA 5HWXA 5JDQA 5HXSA 5JDLA 5HXEA 3V5SA 5HWYA 5JDHA 5JDNA 5HXCA
chains in the Genus database with same CATH superfamily
1WRDA 3RIAA 3A7MA 3AE2A 5AQJB 2RA1A 3PUZF 2BS4A 4HFVA 3C4ZA 3ZMSB 1GQEA 4LFCT 3HI2A 4OK0A 3MKDA 2X9WA 4Z90A 1LRZA 4CN6A 2VQFT 2VKOA 4UF0A 5LJMA 1HNWT 4W8PA 3RH3A 5CFBA 4JI3T 2VB6A 2BG9E 1IBLT 2V7KA 1HG2A 4WNKA 1FIOA 4X1IE 5LNKA 5J2TE 3GMIA 2E9XC 3KV4A 4LFAT 2H89A 5HXEA 4ZI3D 2WBLA 4AI6A 4CI1B 2MTCA 4WYVA 2KBBA 4X1YE 1YXRA 3RYFE 4DBQA 5J0ZA 5LMNT 1SA0E 2LSYA 5LMUT 3QK6A 4MHCA 4ONRA 5A1LA 5F3JA 4X62T 1H7CA 3RC3A 1YQ4A 3N9MA 2WAUA 3AE6A 4PK5A 3FHNA 5L3DB 4I50E 3RX6A 3ZC0A 3A8YC 3TLWA 1XMOT 3JC6D 5JR9C 1WYBA 1E2AA 3B57A 5AQHB 2LSGA 3N5LA 3ZSSA 3IBPA 3NVOA 3RLFF 4JI1T 2L8KA 4KI0F 4NUVA 1U4QA 2PJQA 3BQKA 3BQIA 4EV6A 4X66T 3UULA 4TNVA 4DNDA 5HXSA 1I6ZA 3OTOT 1UURA 3FZMB 4I4TE 1FMWA 3MJXA 2NWBA 3OJAA 2LSJA 3DTOA 5EK4A 3PURA 4EIWA 4DV2T 4LF4T 4XAXB 3L8RA 4CXXA 3ONJA 2MPKA 3P50A 5HEOA 4UELA 3RQUA 4AKHA 3Q9DA 3LJCA 2XSAA 4U2ZA 3WI3A 1ZEEA 4H9PC 5L3CB 4UV8B 2VASA 4DV3T 1LKXA 5FXXA 1D1BA 1S94A 2NP9A 3EHZA 5AQMB 4MFRA 1YQ3A 4ZI2D 3TLSA 5ABHA 2KNDA 1VOMA 3R6NA 4GOUA 4EAHA 5LYJE 4OHFA 3HKBE 1UK5A 1US7B 5IHYA 2Z6EA 3VKHA 2AE9A 2VKJA 1W9RA 1L0VA 3WURA 1IJ5A 2VWAA 4YJ3E 3ZT6A 4DR3T 1MMDA 5M4YA 5C8YE 3E22E 3AE5A 1S35A 2I59A 2BKPA 2CXDA 3D0TA 3JCFA 2CXLA 2W00A 3P4RA 2WDVA 3PU3A 3RYCE 1J5ET 4LMJA 1N34T 3NKZA 5FL0A 3EI0A 2JQHA 2UXXB 2XZEA 3PTRB 3QNUA 4IDZA 2D5UA 4UF0B 4U2YA 5JR9B 2VQET 3AEFA 4ZZCA 4O2AE 4WW0A 1LVFA 2CWOA 5ETWA 4LMLA 1MIWA 2ODVA 4HWCA 4O8SA 3LK3B 3NWIA 4CI3B 1N32T 2H7VC 2HPJA 1MNEA 5L4EA 4DV4T 3ZMZB 2LHRA 4EZHA 3MZKB 2BVMA 2E9XB 2E9XD 4UR9A 3CQCB 5JDFA 5LHHB 1FJGT 1UCUA 4YHJA 3DJBA 3P8CD 3C50A 3CVRA 2JMHA 2X51A 2LRKA 3KVAA 4LMKA 5DJQC 5AQGB 5HCMA 4B6XA 2CCQA 2NW7A 3ZYKA 3CQXC 3CPZA 3LBXB 3RHWA 3UUNA 2DWGA 5JTGA 1J5WA 1T7SA 2C5JA 3JC6C 3FZKB 3PUWF 1Y64B 4UV9B 5LB7B 1NEKA 4EXTA 2OA5A 1XDOA 2KINB 5FL1A 4UVAB 1HR0T 2NOXA 2OV9A 3S4UA 3IF8B 3RPUA 2A72A 1T72A 2C0SA 2KLQA 2WU5A 5HEJA 5FXZA 4HFBA 4O4HE 4B3ST 2BZBA 2V7IA 5AQKB 3ETVA 4X65T 1O3XA 4BJNA 2YDRA 1WYCA 4EGWA 3LG7A 3ZC1A 4MALA 2H7OA 1ZKEA 3SS1A 3L09A 2XSBA 1NWMX 2BKNA 4HWFA 5AQTB 4DV0T 4LF7T 5KDMC 4YTMA 3EVYA 3E08A 5FXVA 4ZI2C 3AE9A 1HFAA 2WP9A 4ILUA 3RYIE 2X0LB 2WQYA 1D1CA 2XQ9A 2UXBT 4U3CA 3Q5EA 1IBKT 2KT9A 2BBJA 3AA0B 1V9DA 2I0MA 2EHOA 4HFHA 4ZS3A 5LA6E 5FY7A 4WBNE 5JRCA 2V5DA 3ZYMA 4MLKA 3GN5B 1OWAA 3C4XA 4ERRA 2V26A 4DMVA 2JJ9A 3PU8A 2GK9A 3M65A 2XAHB 5DQWA 3HR0A 3AT7A 4LF5T 1HX1B 2XAQB 4AIUA 3CKDA 2UXDT 1FMVA 2X0YA 2X67A 2KWHA 2JIWA 4FJOA 4I55E 5J2UE 2XQAA 3PF0A 3N2GE 3ZT7A 2VVSA 3FBLA 2HN1A 4ILAA 2CPTA 4IDPA 3VRAA 4XBFB 4AKLA 2B76A 1W09A 2DWKA 3B13A 5EZYE 4H9NC 4V1Av 2DCFA 1ZOYA 2K9AA 2YU2A 2IDOB 2FJBA 3AE8A 5HXRA 3IHRA 2UUBT 2XY8B 3OKQA 2YDQA 2NR4A 4ZEYA 2XQ4A 4L0RA 3N9LA 3ESLA 3ONXA 4HGAA 5AQQB 4A97A 5ADXL 5CGMA 2V6XA 1Y01A 4PK6A 5LHIB 4O2BE 2CE7A 2J47A 3KDSE 3O1HA 3M3ZB 5AQSB 2C5KT 4PK4A 4WBOA 3RQWA 2V1DB 4X5TA 2LSIA 4KHPT 1NAFA 3Q2MA 5CB4E 2VL8A 2ZM0A 3FXEB 4HKAA 4DMWA 4TX5A 2QRXA 2VVNA 2WU2A 2X0HA 4H63V 5TAOA 4ANJA 2KVPA 2K5BB 1HCIA 2XM1A 2XAGB 1D1AA 4JBWF 4XZCA 4C90A 3ZMTB 2WS3A 3AE7A 3I1AA 3O4XE 5AQLB 1W0AA 3MK7C 4AISA 4CN1A 3FBZA 3KVBA 2Y48B 4DVDA 2UXCT 5HXHA 4IE0A 2YEVC 4X1KE 3HA4A 3EABA 3AEAA 5CA0E 1JNZA 2AXDS 4QH5A 3VR9A 2BG9A 3FB2A 3TLVA 2BVLA 5HYAA 5BR8T 2EHOD 3H3AA 1N33T 3RIFA 3UFGA 3RF1A 4P09A 2KGXA 5LP6E 2PFVA 1IZNB 3VRBA 3PUQA 3F57A 2C5IT 1SHZC 2Q9QA 3PUVF 3N9PA 3P7IA 4HWIB 4KMCA 4GKJT 2XUEA 4I0UA 3I9WA 5ABFB 3AVSA 2CMRA 2DI4A 5AQUB 4YT0A 4JI0T 5ABEA 4LFBT 4HE8A 3CMLA 3LSVA 3P4PA 3PV0F 3KV9A 2CWYA 4JV5T 1Z8UA 3RRCA 3VJZA 4J2CA 4QKNA 2J4GA 2A9UA 4N78D 1KFYA 2H3RA 2D9DA 3LBXA 4H9OC 4OYKA 5LCYA 3UQ4A 3VU7H 4CQIA 2LKHA 2VURA 5C2TA 2YU1A 3HKEE 5JRCB 3ZLIA 4DUYT 4DR4T 1HG5A 3PUXF 5FNVE 4YSXA 2QA7A 3FZFB 3X1DA 1BR4A 5C3JA 5JDGA 4UXNB 1KNZA 4EYUA 3C98B 4BGOA 2D2SA 1HF8A 3OYXA 3ZKRA 5JDQA 3K3NA 4M1PA 2X9HA 4CI2B 5L3GB 2D0UA 4YY3T 2YK0A 4NXMT 1WR6A 4TWFA 3UU8A 4YSYA 3VHLA 4ECGA 3N9OA 4A56A 3VKGA 4YTNA 3NBXX 4QXCB 4IT4A 5KMGP 3UUMA 1VCTA 2RP4A 4IHJE 2E5LT 3SFDA 4QXBB 2CA5A 2W0GA 4EZ4A 4YXDA 3AAEB 5L3BB 2FUPA 2CHNA 4H63H 4JI4T 3QUJA 4UIGA 4QWNB 3SRZA 4H9RC 2WMOA 2ZMAA 1YKEB 4OYJA 2CRBA 1WCRA 2VKDA 2Y6XA 2XPKA 3IEEA 3T8OA 1SJ8A 1QUUA 2X0CA 3V5SA 5L3EB 1D0ZA 2ZM6T 4P1NA 2DLRA 3FZHB 2YDSA 1E1HB 4TWDA 3ZCIA 2IW5B 4BJMA 4COFA 5FY1A 1E7PA 2Q9QD 2CHOA 4AXPA 4O4JE 4JEHB 1ZHCA 2NTYA 3RIUC 3ABVA 5HEHA 4ZS2A 2A2FX 3CIRA 4G2AA 3U78A 3KBTA 5CA1E 1OEDB 1YKHB 3AEBA 2DHRA 5HCJA 2P9BA 3MACA 3TLUA 2FJEA 4KHZF 4GK0E 3ZT5A 5HXCA 3O9XA 5LGUB 4HFIA 4C91A 3AEGA 3ZJ2A 2J1DG 2EHOC 2LE8A 3Q5XA 1IAPA 3QOFA 3FYQA 4ZI7E 2XHEB 4UVCB 2YKSA 2WDQA 3CX6B 5FMNA 4AQFA 2BG9B 3RIUA 2IC6A 2XQ8A 4X64T 5FZTA 1B7TA 2WB5A 3PUGA 5HEUA 3UU4A 3V5UA 2WM9A 4A5XA 4EYYR 1SJ7A 3PHF1 2WZHA 1XMQT 2LSKA 3F2EA 4H9QC 4HWHA 2IIUA 5AQNB 2MYSA 3H3MA 4ISSA 2N1GA 2IUBA 2BS3A 1Z0PA 2X9YA 1HS7A 1QLBA 4O4IE 2M6BA 3SOLA 3HL6A 3JAFA 1X79A 1XDPA 4JUYA 3AEEA 4DR6T 1BR2A 5AQRB 2V5CA 3PUAA 4X20E 3EDVA 4ILCA 2ACZA 4K0KT 4JYAT 4E7ZA 2G0UA 5BMVE 3AEDA 2WDRA 2XTLA 2HPLA 4B3RT 4IE5A 1MIYA 2XQYA 2YOEA 3EAMA 2XQ5A 3OPCA 2WCAA 3KV5A 1UX4A 5HAXA 3VR8A 3K8PC 2K24A 1U5PA 2LKGA 4HTEA 4A98A 5JH7E 4DV5T 3Q5DA 4WZXA 3UUXB 3O1IA 2V8SV 3AA1B 4TV9E 5FYMA 5LG4A 2CM0A 4YLHA 5LG3A 2XJ7A 5LHGB 2NTXA 4AQYT 1T8BA 1N36T 2ZLYA 5AQIB 2E5VA 2XAFB 3AB3B 1KK7A 2MAWA 4GYSA 2L3LA 3KFWX 1HNXT 2L10A 4ADZA 2Q9QB 3RKOA 5H6QB 3P4WA 3GA8A 4CXWA 5L3FB 1JNRA 2L9QA 1MMNA 1WFDA 2WY2A 2X66A 3C64A 3KINB 1OEDA 3LK42 2MBGA 4DR5T 1CUNA 2YN6A 2F4VT 4B3TT 4HFEA 2V6YB 3AA7B 1W0BA 2E8IA 1M62A 4IE6A 2DNXA 3K1SA 2JMKA 2XASB 4Q25A 2CBJA 2FJAA 1SUMB 2IC9A 3AXJB 4IL9A 3J9X1 2Q9QC 4TNWA 2JRKA 3LDQB 2IAKA 1XWMA 4OFZA 4TZ4C 4UVBB 3MXZA 5AQPB 2WMNA 4B3MT 5LBMA 3FXDB 5F8PA 5KX5E 4P0BA 3H37A 3CQGB 4I43B 4U7IA 3C51A 2KSRA 2W2UA 3CWZB 3QB5A 5IYZE 4E7SA 1UX5A 2LM2A 4ZOLE 2KWIB 5J1GA 1WLXA 1MMGA 2CLYC 3AE4A 3DP7A 5HWXA 5JR9A 5IWAT 4AKIA 4EB6E 4QX7B 1M7KA 3SFEA 3N9QA 2X9XA 2KMFA 2VK9A 2VL0A 3ETUA 4FI5A 5JDNA 2UXNB 2CEAA 2V7JA 1MIVA 3AVRA 2IMLA 3AE1A 3P4SA 3P4QA 4KBMB 4ILBA 4DIDB 4DV6T 2LQUA 5FVKA 4TN7B 5LJNA 2H88A 4NIQA 3RRWA 3J7Yq 2LOSA 2LJLA 2K3WA 5HWYA 3ZN1B 3RKGA 4KP3C 3N2KE 1MNDA 1VRBA 4JEUB 2CLYB 4O4LE 2PTFA 4Z91A 4YTPA 2WZIA 1UGOA 2LEHA 1X9BA 2BG9C 2LLYA 5LXTE 3NRXA 1OXZA 2YINA 3AXJA 4AKRB 4DV1T 1J1JA 3QC9A 5F5WA 3U3IA 5CJ5A 3DYJA 3AAIA 5FP3A 2LM9A 2XQ6A 4HWDA 3TLTA 1IBMT 2XM2A 1G73A 2N9DA 2ODUA 1I94T 3WSCA 4JI6T 2NW9A 4LF9T 5GONE 5LGTB 4L9IA 4ZZBA 3RGLA 3UT5E 1OEDE 2XQ7A 3E0ZA 3T1HT 2N2NA 5T1DA 5FXWA 4U7YA 2JQQA 3AAAB 4PFOA 3WAKA 2JQKA 4EEBA 2CXFA 4F6RC 5JDLA 2JPFA 5E0OA 3OVUA 4IE4A 2W66A 5KXJA 4JI8T 1D0XA 4JI7T 4LF8T 2W61A 3FZLB 3IA3A 2V7LA 3JADA 4ISTA 1FEWA 1EZ3A 4QH4A 3UU5A 2J62A 3I9YA 4F7GB 4IIJE 3C4WA 3PE0A 2LRLA 3PJAA 4GYRA 4U33A 4JI5T 3TKLB 3ZEFB 5JDHA 2L7NA 2LHNA 3CX8B 4UEMA 2UU9T 4DR2T 2UUCT 2LOPA 2QGSA 4CZZB 4PJNA 2BDEA 4NXNT 3KV6A 1XNQT 2IHR1 4PAGA 4QHOA 4DR1T 2HH7A 2KXPB 5EK3A 2VKHA 3O1JA 1MMAA 5AQOB 5JDMA 4IDOA 2PG8A 3T1YT 1DU2A 3CX7B 4YHHT 2K48A 2QYWA 1SE7A 1HX8A 2NW8A 4TUYE 4YJ2E 4DUZT 3RC8A 1G8XA 4JI2T 4MBQA 1KNRA 4DBRA 3UU6A 3RI5A 3ANWB 4QH1A 3LFMA 3ZYLA 2FJDA 2ZM2A 3UFEA 3OBVE 3ZMVB 4PNIA 5FY0A 3PDYA 4U74A 2ZM8A 2WSSV 3EDUA 2R6GF 4HN9A 4NUUA 4DV7T 2ES0A 4YSZA 3Q5WA 1T98A 4ASKA 4P0AA 3HKDE 4GIWA 3BQLA 3ONLC 3NZPA 1HTJF 2SPCA 4H9SE 5DQVA 1CHUA 4CXYA 4QX8B 1WR0A 5FVLA 4U72A 2LT3A 3BK9A 4PW8A 4ZI3C 3WAJA 4HFCA 5AQVB 3L3PA 2CBIA 3AECA 2M6IA 3ZMUB 4GKKT 2QVAA 3PUSA 4KUMB 2KZ7B 2XAJB 5ABGA 2BS2A 2PBIA 3ANWA 4OX9T 1KEYA 3AE3A 4BA9A 1ZV4X 3HKCE 3KBUA 3N2OA 3JAEA 4ZXLA 3UUBA 3L39A 3PUYF 3MA9A 2V7MA 4HEAA 4IE7A 1QSDA 1LVKA 2D0TA 3B5MA 4LF6T 2E2AA 1KNPA 3ZN0B 2DL1A 2B1EA 4YFSA 4AQFC 5JREA 4DR7T 1R8IA 4PJJA 3NZQA 3I0OA 3M1CA 4GK5E 3UU3A 2ACXA 2X68A 2W63A 3I0QA 2FBWA 2Y8DA 4CN4A 3SWHA 4Z8XA 2W4XA 5JVDE 3AA6B 3AY5A 1UUSA 3ZCJA 4TV8E 2A3DA 3GWHA 3CK6A 5DABA 3R84B 5JQGE 4G63A 3QB5K 1D0YA 3UTKA 4F8HA 5FKYA 4L5GA 5AQFB 2W62A 2MOZA 1KF6A 3ZPOA 5AFUL 2UUAT 5L2LA 2RPAA 5IUXA 4JLEA 2JQ9A 2XQ3A 3PJAJ 4AQGA 1IJ6A 2I6HA 2MTQA 3ZJ1A 4BAYB 3K3OA 4PJMA 5EK2A 1HNZT 4TWHA 4DO0A 2HHHT 3F31A 5LBQB 3LK2B 1XZYA 4PFPA 4IDQA 1YW0A 5H6RB 2WWUA 1AJ3A 3A5XA 4AKGA 1ZP0A 2V6YA 1BR1A 5L4HA 2OLTA 4ZHQE 2M67A 4U31A 1BR0A 4IGUA 5LOVE 4EOZB 3UQ7A 4IREA 2BBHA 3GN5A 3G06A 5L47A 4IL4A 1XNRT 4PJLA 1NENA 3RYHE 3K3QC 2EHOB 5ABFA 3OYZA 1YD8G 3ZSTA 3NRYA 1VCSA 4HFDA 3N9NA 1OEDC 4IDNA 5HEGA 3W15B 4EEDA 5LGNB 2WWVA 2BKOA 2HN2A 3EUHA 4K0UA 4NPPA 4QXHB 4KX6A 2W67A 2E9XA
chains in the Genus database with same CATH topology
1WRDA 2RA1A 4HFVA 3C4ZA 3ZMSB 3HI2A 4OK0A 3MKDA 2X9WA 1LRZA 2VKOA 4UF0A 5LJMA 3RH3A 2VB6A 2V7KA 1HG2A 4WNKA 1FIOA 4X1IE 5LNKA 5J2TE 3GMIA 2E9XC 3KV4A 5HXEA 4ZI3D 2WBLA 4AI6A 4CI1B 2MTCA 4X1YE 3RYFE 4DBQA 5T1DA 1SA0E 2LSYA 3QK6A 4MHCA 4ONRA 5A1LA 5F3JA 1H7CA 3RC3A 3N9MA 2WAUA 4PK5A 5L3DB 3FHNA 4I50E 3RX6A 3ZC0A 3JC6D 5JR9C 1WYBA 3B57A 2LSGA 3N5LA 3IBPA 2L8KA 4NUVA 1U4QA 2PJQA 3BQKA 3BQIA 3UULA 4DNDA 5HXSA 4I4TE 1FMWA 3MJXA 2NWBA 3OJAA 2LSJA 3DTOA 5EK4A 3PURA 4EIWA 4XAXB 4CXXA 4UELA 4AKHA 3Q9DA 3LJCA 3WI3A 1ZEEA 4H9PC 5L3CB 4UV8B 2VASA 1LKXA 5FXXA 1D1BA 1S94A 2NP9A 4MFRA 4ZI2D 2KNDA 1VOMA 3R6NA 4GOUA 4EAHA 5LYJE 4OHFA 3HKBE 5IHYA 1US7B 2Z6EA 3VKHA 2VKJA 1IJ5A 2VWAA 4YJ3E 1MMDA 5M4YA 5C8YE 3E22E 1S35A 2I59A 3D0TA 2CXDA 3RYCE 2CXLA 2W00A 3PU3A 2UXXB 4IDZA 4UF0B 3PTRB 2D5UA 5JR9B 4O2AE 4WW0A 1LVFA 2CWOA 5ETWA 1MIWA 2ODVA 4O8SA 3LK3B 4CI3B 2H7VC 2HPJA 1MNEA 3ZMZB 2LHRA 4EZHA 3MZKB 2BVMA 2E9XB 2E9XD 5JDFA 3CQCB 5LHHB 1UCUA 4YHJA 3DJBA 3P8CD 3C50A 3CVRA 2JMHA 2X51A 3KVAA 5DJQC 4B6XA 2CCQA 2NW7A 3ZYKA 3CQXC 3CPZA 3LBXB 3UUNA 2DWGA 2C5JA 3WURA 3JC6C 4UV9B 1Y64B 4EXTA 2OA5A 2KINB 4UVAB 2NOXA 3S4UA 3IF8B 3RPUA 2A72A 2C0SA 2KLQA 5FXZA 4O4HE 2BZBA 2V7IA 3ETVA 1O3XA 4BJNA 1WYCA 3LG7A 3ZC1A 4MALA 2H7OA 1ZKEA 3SS1A 3L09A 1NWMX 5KDMC 3EVYA 3E08A 5FXVA 4ZI2C 1HFAA 4ILUA 3RYIE 2X0LB 1D1CA 2KT9A 3AA0B 1V9DA 5JRCA 2EHOA 5LA6E 4ZS3A 5FY7A 4WBNE 3ZYMA 4MLKA 3GN5B 1OWAA 3C4XA 4ERRA 2V26A 4DMVA 2JJ9A 3PU8A 2GK9A 3M65A 2XAHB 5DQWA 3HR0A 3AT7A 2XAQB 3CKDA 1FMVA 2X67A 2KWHA 4FJOA 4I55E 5J2UE 3PF0A 3N2GE 3FBLA 4AKLA 2DWKA 3B13A 5EZYE 4H9NC 4V1Av 2DCFA 2YU2A 2K9AA 5HXRA 3IHRA 3OKQA 4L0RA 3N9LA 3ESLA 3ONXA 4HGAA 5ADXL 5LHIB 4PK6A 4O2BE 2CE7A 3O1HA 3KDSE 2C5KT 4PK4A 4WBOA 2V1DB 2LSIA 1NAFA 3Q2MA 5CB4E 2VL8A 2ZM0A 3FXEB 4HKAA 4DMWA 4TX5A 5HYAA 5HWXA 4H63V 5TAOA 4ANJA 2K5BB 1HCIA 2XAGB 1D1AA 4XZCA 4C90A 3ZMTB 3O4XE 3I1AA 3MK7C 3FBZA 3KVBA 2Y48B 4DVDA 5HXHA 4IE0A 2YEVC 4X1KE 3HA4A 5CA0E 3FB2A 2BVLA 2EHOD 3H3AA 4P09A 5LP6E 2PFVA 1IZNB 3PUQA 3F57A 2C5IT 1SHZC 2Q9QA 3N9PA 3P7IA 4KMCA 2XUEA 3I9WA 3AVSA 2CMRA 2DI4A 4HE8A 3CMLA 3KV9A 2CWYA 3RRCA 3VJZA 4J2CA 4QKNA 4N78D 3LBXA 2H3RA 4H9OC 5LCYA 3VU7H 4OYKA 4CQIA 5BMVE 4XBFB 2YU1A 3HKEE 5JRCB 3ZLIA 1HG5A 5FNVE 2QA7A 1BR4A 5JDGA 4UXNB 4EYUA 3C98B 4BGOA 2D2SA 1HF8A 3OYXA 5L3GB 5JDQA 3K3NA 4M1PA 2X9HA 4CI2B 2D0UA 2YK0A 1WR6A 4ECGA 3VHLA 3N9OA 4A56A 3VKGA 3NBXX 4QXCB 5KMGP 3UUMA 2RP4A 4IHJE 4QXBB 2CA5A 2W0GA 4EZ4A 3AAEB 5L3BB 4H63H 3QUJA 4UIGA 4QWNB 3SRZA 4H9RC 2WMOA 2ZMAA 1YKEB 4OYJA 3T8OA 2Y6XA 2VKDA 3IEEA 1QUUA 3V5SA 5L3EB 1D0ZA 2DLRA 1E1HB 3ZCIA 2IW5B 4BJMA 5FY1A 2Q9QD 4AXPA 4O4JE 4JEHB 1ZHCA 2NTYA 4ZS2A 2A2FX 4G2AA 3U78A 3KBTA 5CA1E 1YKHB 2DHRA 2P9BA 3MACA 4GK0E 5HXCA 3O9XA 5LGUB 4C91A 3ZJ2A 2J1DG 2EHOC 2LE8A 3Q5XA 1IAPA 4ZI7E 2XHEB 4UVCB 3CX6B 5FMNA 4AQFA 2IC6A 1B7TA 3PUGA 3V5UA 4EYYR 3PHF1 2WM9A 2LSKA 3F2EA 4H9QC 2MYSA 4ISSA 2N1GA 1HS7A 1Z0PA 2X9YA 4O4IE 3SOLA 3HL6A 4JUYA 1X79A 1BR2A 3PUAA 4X20E 3EDVA 4E7ZA 2G0UA 2XTLA 2HPLA 4IE5A 1MIYA 2XQYA 3KV5A 1UX4A 5HAXA 3K8PC 2K24A 1U5PA 4HTEA 5JH7E 3UUXB 3O1IA 3AA1B 4TV9E 5LG4A 5FYMA 5LHGB 2CM0A 4YLHA 2NTXA 2ZLYA 1KNZA 2XAFB 3AB3B 4GYSA 1KK7A 2L3LA 3KFWX 4ADZA 2Q9QB 3RKOA 5H6QB 3GA8A 4CXWA 5L3FB 2L9QA 3C64A 1MMNA 3KINB 2X66A 3LK42 3OBVE 2MBGA 1CUNA 3AA7B 2E8IA 4IE6A 2DNXA 2JMKA 2XASB 2IC9A 3J9X1 2Q9QC 2JRKA 2IAKA 4OFZA 4TZ4C 4UVBB 3MXZA 2WMNA 5LBMA 3FXDB 5F8PA 5KX5E 4P0BA 3H37A 3CQGB 4I43B 3C51A 3CWZB 5IYZE 4E7SA 1UX5A 4ZOLE 2KWIB 5J1GA 1WLXA 1MMGA 2CLYC 4AKIA 3DP7A 5JR9A 4EB6E 4QX7B 3N9QA 2X9XA 2KMFA 2VK9A 4FI5A 3ETUA 5JDNA 2UXNB 2CEAA 2V7JA 1MIVA 3AVRA 4KBMB 2LQUA 4TN7B 5LJNA 3RRWA 3J7Yq 2LOSA 2LJLA 5HWYA 3ZN1B 4KP3C 3N2KE 1MNDA 1VRBA 4JEUB 2CLYB 4O4LE 5LXTE 2LEHA 3NRXA 1OXZA 2YINA 4AKRB 3QC9A 3U3IA 3AAIA 5FP3A 2LM9A 1G73A 2N9DA 2ODUA 3WSCA 2NW9A 5GONE 5LGTB 4L9IA 3UT5E 3E0ZA 2N2NA 5FXWA 2JQQA 3AAAB 4PFOA 3WAKA 2CXFA 4F6RC 5JDLA 2JPFA 5E0OA 4IE4A 1D0XA 2W61A 4ISTA 2V7LA 1FEWA 1EZ3A 3I9YA 4IIJE 3C4WA 3PE0A 3TKLB 3ZEFB 4GYRA 5JDHA 2LHNA 3CX8B 4UEMA 2LOPA 2QGSA 4CZZB 4PJNA 2BDEA 3KV6A 4PAGA 4QHOA 2HH7A 2KXPB 5EK3A 2VKHA 3O1JA 1MMAA 5JDMA 2PG8A 3CX7B 2K48A 2NW8A 1HX8A 4TUYE 4YJ2E 3RC8A 1G8XA 4MBQA 4DBRA 3ANWB 3ZYLA 3LFMA 2ZM2A 3UFEA 3ZMVB 4PNIA 5FY0A 3PDYA 4U74A 2ZM8A 2WSSV 3EDUA 4NUUA 4HN9A 2ES0A 3Q5WA 1T98A 4ASKA 4P0AA 3HKDE 4GIWA 3BQLA 3NZPA 1HTJF 2SPCA 4H9SE 5DQVA 4CXYA 4QX8B 4U72A 2LT3A 3BK9A 4PW8A 4ZI3C 3WAJA 3ZMUB 3L3PA 4KUMB 3PUSA 2KZ7B 2XAJB 2PBIA 3ANWA 4BA9A 1ZV4X 3HKCE 3KBUA 3N2OA 3MA9A 2V7MA 4HEAA 4IE7A 1QSDA 1LVKA 2D0TA 3ZN0B 2B1EA 4YFSA 4AQFC 5JREA 4PJJA 3NZQA 3I0OA 3M1CA 4GK5E 2ACXA 2X68A 2W63A 3I0QA 2Y8DA 3SWHA 4Z8XA 5JVDE 3AA6B 3ZCJA 4TV8E 2A3DA 3GWHA 5DABA 3R84B 5JQGE 4G63A 1D0YA 3UTKA 4L5GA 2W62A 2MOZA 3ZPOA 5AFUL 5L2LA 4JLEA 4BAYB 4AQGA 1IJ6A 3ZJ1A 2MTQA 3K3OA 4PJMA 5EK2A 4DO0A 3F31A 5LBQB 3LK2B 4PFPA 5H6RB 1AJ3A 1YW0A 2WWUA 4AKGA 3A5XA 1BR1A 4ZHQE 2M67A 1BR0A 4IGUA 5LOVE 4EOZB 3GN5A 4PJLA 3RYHE 3K3QC 2EHOB 3OYZA 1YD8G 3NRYA 3W15B 3N9NA 5LGNB 3EUHA 4K0UA 4QXHB 2E9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXH A;  5JDM A;  5JDF A;  5JDG A;  3V5U A;  5HYA A;  5HXR A;  5HWX A;  5JDQ A;  5HXS A;  5JDL A;  5HXE A;  3V5S A;  5HWY A;  5JDH A;  5JDN A;  5HXC A; 
#chains in the Genus database with same CATH topology
 1WRD A;  3RIA A;  3A7M A;  3AE2 A;  5AQJ B;  2RA1 A;  3PUZ F;  2BS4 A;  4HFV A;  3C4Z A;  3ZMS B;  1GQE A;  4LFC T;  3HI2 A;  4OK0 A;  3MKD A;  2X9W A;  4Z90 A;  1LRZ A;  4CN6 A;  2VQF T;  2VKO A;  4UF0 A;  5LJM A;  1HNW T;  4W8P A;  3RH3 A;  5CFB A;  4JI3 T;  2VB6 A;  2BG9 E;  1IBL T;  2V7K A;  1HG2 A;  4WNK A;  1FIO A;  4X1I E;  5LNK A;  5J2T E;  3GMI A;  2E9X C;  3KV4 A;  4LFA T;  2H89 A;  5HXE A;  4ZI3 D;  2WBL A;  4AI6 A;  4CI1 B;  2MTC A;  4WYV A;  2KBB A;  4X1Y E;  1YXR A;  3RYF E;  4DBQ A;  5J0Z A;  5LMN T;  1SA0 E;  2LSY A;  5LMU T;  3QK6 A;  4MHC A;  4ONR A;  5A1L A;  5F3J A;  4X62 T;  1H7C A;  3RC3 A;  1YQ4 A;  3N9M A;  2WAU A;  3AE6 A;  4PK5 A;  3FHN A;  5L3D B;  4I50 E;  3RX6 A;  3ZC0 A;  3A8Y C;  3TLW A;  1XMO T;  3JC6 D;  5JR9 C;  1WYB A;  1E2A A;  3B57 A;  5AQH B;  2LSG A;  3N5L A;  3ZSS A;  3IBP A;  3NVO A;  3RLF F;  4JI1 T;  2L8K A;  4KI0 F;  4NUV A;  1U4Q A;  2PJQ A;  3BQK A;  3BQI A;  4EV6 A;  4X66 T;  3UUL A;  4TNV A;  4DND A;  5HXS A;  1I6Z A;  3OTO T;  1UUR A;  3FZM B;  4I4T E;  1FMW A;  3MJX A;  2NWB A;  3OJA A;  2LSJ A;  3DTO A;  5EK4 A;  3PUR A;  4EIW A;  4DV2 T;  4LF4 T;  4XAX B;  3L8R A;  4CXX A;  3ONJ A;  2MPK A;  3P50 A;  5HEO A;  4UEL A;  3RQU A;  4AKH A;  3Q9D A;  3LJC A;  2XSA A;  4U2Z A;  3WI3 A;  1ZEE A;  4H9P C;  5L3C B;  4UV8 B;  2VAS A;  4DV3 T;  1LKX A;  5FXX A;  1D1B A;  1S94 A;  2NP9 A;  3EHZ A;  5AQM B;  4MFR A;  1YQ3 A;  4ZI2 D;  3TLS A;  5ABH A;  2KND A;  1VOM A;  3R6N A;  4GOU A;  4EAH A;  5LYJ E;  4OHF A;  3HKB E;  1UK5 A;  1US7 B;  5IHY A;  2Z6E A;  3VKH A;  2AE9 A;  2VKJ A;  1W9R A;  1L0V A;  3WUR A;  1IJ5 A;  2VWA A;  4YJ3 E;  3ZT6 A;  4DR3 T;  1MMD A;  5M4Y A;  5C8Y E;  3E22 E;  3AE5 A;  1S35 A;  2I59 A;  2BKP A;  2CXD A;  3D0T A;  3JCF A;  2CXL A;  2W00 A;  3P4R A;  2WDV A;  3PU3 A;  3RYC E;  1J5E T;  4LMJ A;  1N34 T;  3NKZ A;  5FL0 A;  3EI0 A;  2JQH A;  2UXX B;  2XZE A;  3PTR B;  3QNU A;  4IDZ A;  2D5U A;  4UF0 B;  4U2Y A;  5JR9 B;  2VQE T;  3AEF A;  4ZZC A;  4O2A E;  4WW0 A;  1LVF A;  2CWO A;  5ETW A;  4LML A;  1MIW A;  2ODV A;  4HWC A;  4O8S A;  3LK3 B;  3NWI A;  4CI3 B;  1N32 T;  2H7V C;  2HPJ A;  1MNE A;  5L4E A;  4DV4 T;  3ZMZ B;  2LHR A;  4EZH A;  3MZK B;  2BVM A;  2E9X B;  2E9X D;  4UR9 A;  3CQC B;  5JDF A;  5LHH B;  1FJG T;  1UCU A;  4YHJ A;  3DJB A;  3P8C D;  3C50 A;  3CVR A;  2JMH A;  2X51 A;  2LRK A;  3KVA A;  4LMK A;  5DJQ C;  5AQG B;  5HCM A;  4B6X A;  2CCQ A;  2NW7 A;  3ZYK A;  3CQX C;  3CPZ A;  3LBX B;  3RHW A;  3UUN A;  2DWG A;  5JTG A;  1J5W A;  1T7S A;  2C5J A;  3JC6 C;  3FZK B;  3PUW F;  1Y64 B;  4UV9 B;  5LB7 B;  1NEK A;  4EXT A;  2OA5 A;  1XDO A;  2KIN B;  5FL1 A;  4UVA B;  1HR0 T;  2NOX A;  2OV9 A;  3S4U A;  3IF8 B;  3RPU A;  2A72 A;  1T72 A;  2C0S A;  2KLQ A;  2WU5 A;  5HEJ A;  5FXZ A;  4HFB A;  4O4H E;  4B3S T;  2BZB A;  2V7I A;  5AQK B;  3ETV A;  4X65 T;  1O3X A;  4BJN A;  2YDR A;  1WYC A;  4EGW A;  3LG7 A;  3ZC1 A;  4MAL A;  2H7O A;  1ZKE A;  3SS1 A;  3L09 A;  2XSB A;  1NWM X;  2BKN A;  4HWF A;  5AQT B;  4DV0 T;  4LF7 T;  5KDM C;  4YTM A;  3EVY A;  3E08 A;  5FXV A;  4ZI2 C;  3AE9 A;  1HFA A;  2WP9 A;  4ILU A;  3RYI E;  2X0L B;  2WQY A;  1D1C A;  2XQ9 A;  2UXB T;  4U3C A;  3Q5E A;  1IBK T;  2KT9 A;  2BBJ A;  3AA0 B;  1V9D A;  2I0M A;  2EHO A;  4HFH A;  4ZS3 A;  5LA6 E;  5FY7 A;  4WBN E;  5JRC A;  2V5D A;  3ZYM A;  4MLK A;  3GN5 B;  1OWA A;  3C4X A;  4ERR A;  2V26 A;  4DMV A;  2JJ9 A;  3PU8 A;  2GK9 A;  3M65 A;  2XAH B;  5DQW A;  3HR0 A;  3AT7 A;  4LF5 T;  1HX1 B;  2XAQ B;  4AIU A;  3CKD A;  2UXD T;  1FMV A;  2X0Y A;  2X67 A;  2KWH A;  2JIW A;  4FJO A;  4I55 E;  5J2U E;  2XQA A;  3PF0 A;  3N2G E;  3ZT7 A;  2VVS A;  3FBL A;  2HN1 A;  4ILA A;  2CPT A;  4IDP A;  3VRA A;  4XBF B;  4AKL A;  2B76 A;  1W09 A;  2DWK A;  3B13 A;  5EZY E;  4H9N C;  4V1A v;  2DCF A;  1ZOY A;  2K9A A;  2YU2 A;  2IDO B;  2FJB A;  3AE8 A;  5HXR A;  3IHR A;  2UUB T;  2XY8 B;  3OKQ A;  2YDQ A;  2NR4 A;  4ZEY A;  2XQ4 A;  4L0R A;  3N9L A;  3ESL A;  3ONX A;  4HGA A;  5AQQ B;  4A97 A;  5ADX L;  5CGM A;  2V6X A;  1Y01 A;  4PK6 A;  5LHI B;  4O2B E;  2CE7 A;  2J47 A;  3KDS E;  3O1H A;  3M3Z B;  5AQS B;  2C5K T;  4PK4 A;  4WBO A;  3RQW A;  2V1D B;  4X5T A;  2LSI A;  4KHP T;  1NAF A;  3Q2M A;  5CB4 E;  2VL8 A;  2ZM0 A;  3FXE B;  4HKA A;  4DMW A;  4TX5 A;  2QRX A;  2VVN A;  2WU2 A;  2X0H A;  4H63 V;  5TAO A;  4ANJ A;  2KVP A;  2K5B B;  1HCI A;  2XM1 A;  2XAG B;  1D1A A;  4JBW F;  4XZC A;  4C90 A;  3ZMT B;  2WS3 A;  3AE7 A;  3I1A A;  3O4X E;  5AQL B;  1W0A A;  3MK7 C;  4AIS A;  4CN1 A;  3FBZ A;  3KVB A;  2Y48 B;  4DVD A;  2UXC T;  5HXH A;  4IE0 A;  2YEV C;  4X1K E;  3HA4 A;  3EAB A;  3AEA A;  5CA0 E;  1JNZ A;  2AXD S;  4QH5 A;  3VR9 A;  2BG9 A;  3FB2 A;  3TLV A;  2BVL A;  5HYA A;  5BR8 T;  2EHO D;  3H3A A;  1N33 T;  3RIF A;  3UFG A;  3RF1 A;  4P09 A;  2KGX A;  5LP6 E;  2PFV A;  1IZN B;  3VRB A;  3PUQ A;  3F57 A;  2C5I T;  1SHZ C;  2Q9Q A;  3PUV F;  3N9P A;  3P7I A;  4HWI B;  4KMC A;  4GKJ T;  2XUE A;  4I0U A;  3I9W A;  5ABF B;  3AVS A;  2CMR A;  2DI4 A;  5AQU B;  4YT0 A;  4JI0 T;  5ABE A;  4LFB T;  4HE8 A;  3CML A;  3LSV A;  3P4P A;  3PV0 F;  3KV9 A;  2CWY A;  4JV5 T;  1Z8U A;  3RRC A;  3VJZ A;  4J2C A;  4QKN A;  2J4G A;  2A9U A;  4N78 D;  1KFY A;  2H3R A;  2D9D A;  3LBX A;  4H9O C;  4OYK A;  5LCY A;  3UQ4 A;  3VU7 H;  4CQI A;  2LKH A;  2VUR A;  5C2T A;  2YU1 A;  3HKE E;  5JRC B;  3ZLI A;  4DUY T;  4DR4 T;  1HG5 A;  3PUX F;  5FNV E;  4YSX A;  2QA7 A;  3FZF B;  3X1D A;  1BR4 A;  5C3J A;  5JDG A;  4UXN B;  1KNZ A;  4EYU A;  3C98 B;  4BGO A;  2D2S A;  1HF8 A;  3OYX A;  3ZKR A;  5JDQ A;  3K3N A;  4M1P A;  2X9H A;  4CI2 B;  5L3G B;  2D0U A;  4YY3 T;  2YK0 A;  4NXM T;  1WR6 A;  4TWF A;  3UU8 A;  4YSY A;  3VHL A;  4ECG A;  3N9O A;  4A56 A;  3VKG A;  4YTN A;  3NBX X;  4QXC B;  4IT4 A;  5KMG P;  3UUM A;  1VCT A;  2RP4 A;  4IHJ E;  2E5L T;  3SFD A;  4QXB B;  2CA5 A;  2W0G A;  4EZ4 A;  4YXD A;  3AAE B;  5L3B B;  2FUP A;  2CHN A;  4H63 H;  4JI4 T;  3QUJ A;  4UIG A;  4QWN B;  3SRZ A;  4H9R C;  2WMO A;  2ZMA A;  1YKE B;  4OYJ A;  2CRB A;  1WCR A;  2VKD A;  2Y6X A;  2XPK A;  3IEE A;  3T8O A;  1SJ8 A;  1QUU A;  2X0C A;  3V5S A;  5L3E B;  1D0Z A;  2ZM6 T;  4P1N A;  2DLR A;  3FZH B;  2YDS A;  1E1H B;  4TWD A;  3ZCI A;  2IW5 B;  4BJM A;  4COF A;  5FY1 A;  1E7P A;  2Q9Q D;  2CHO A;  4AXP A;  4O4J E;  4JEH B;  1ZHC A;  2NTY A;  3RIU C;  3ABV A;  5HEH A;  4ZS2 A;  2A2F X;  3CIR A;  4G2A A;  3U78 A;  3KBT A;  5CA1 E;  1OED B;  1YKH B;  3AEB A;  2DHR A;  5HCJ A;  2P9B A;  3MAC A;  3TLU A;  2FJE A;  4KHZ F;  4GK0 E;  3ZT5 A;  5HXC A;  3O9X A;  5LGU B;  4HFI A;  4C91 A;  3AEG A;  3ZJ2 A;  2J1D G;  2EHO C;  2LE8 A;  3Q5X A;  1IAP A;  3QOF A;  3FYQ A;  4ZI7 E;  2XHE B;  4UVC B;  2YKS A;  2WDQ A;  3CX6 B;  5FMN A;  4AQF A;  2BG9 B;  3RIU A;  2IC6 A;  2XQ8 A;  4X64 T;  5FZT A;  1B7T A;  2WB5 A;  3PUG A;  5HEU A;  3UU4 A;  3V5U A;  2WM9 A;  4A5X A;  4EYY R;  1SJ7 A;  3PHF 1;  2WZH A;  1XMQ T;  2LSK A;  3F2E A;  4H9Q C;  4HWH A;  2IIU A;  5AQN B;  2MYS A;  3H3M A;  4ISS A;  2N1G A;  2IUB A;  2BS3 A;  1Z0P A;  2X9Y A;  1HS7 A;  1QLB A;  4O4I E;  2M6B A;  3SOL A;  3HL6 A;  3JAF A;  1X79 A;  1XDP A;  4JUY A;  3AEE A;  4DR6 T;  1BR2 A;  5AQR B;  2V5C A;  3PUA A;  4X20 E;  3EDV A;  4ILC A;  2ACZ A;  4K0K T;  4JYA T;  4E7Z A;  2G0U A;  5BMV E;  3AED A;  2WDR A;  2XTL A;  2HPL A;  4B3R T;  4IE5 A;  1MIY A;  2XQY A;  2YOE A;  3EAM A;  2XQ5 A;  3OPC A;  2WCA A;  3KV5 A;  1UX4 A;  5HAX A;  3VR8 A;  3K8P C;  2K24 A;  1U5P A;  2LKG A;  4HTE A;  4A98 A;  5JH7 E;  4DV5 T;  3Q5D A;  4WZX A;  3UUX B;  3O1I A;  2V8S V;  3AA1 B;  4TV9 E;  5FYM A;  5LG4 A;  2CM0 A;  4YLH A;  5LG3 A;  2XJ7 A;  5LHG B;  2NTX A;  4AQY T;  1T8B A;  1N36 T;  2ZLY A;  5AQI B;  2E5V A;  2XAF B;  3AB3 B;  1KK7 A;  2MAW A;  4GYS A;  2L3L A;  3KFW X;  1HNX T;  2L10 A;  4ADZ A;  2Q9Q B;  3RKO A;  5H6Q B;  3P4W A;  3GA8 A;  4CXW A;  5L3F B;  1JNR A;  2L9Q A;  1MMN A;  1WFD A;  2WY2 A;  2X66 A;  3C64 A;  3KIN B;  1OED A;  3LK4 2;  2MBG A;  4DR5 T;  1CUN A;  2YN6 A;  2F4V T;  4B3T T;  4HFE A;  2V6Y B;  3AA7 B;  1W0B A;  2E8I A;  1M62 A;  4IE6 A;  2DNX A;  3K1S A;  2JMK A;  2XAS B;  4Q25 A;  2CBJ A;  2FJA A;  1SUM B;  2IC9 A;  3AXJ B;  4IL9 A;  3J9X 1;  2Q9Q C;  4TNW A;  2JRK A;  3LDQ B;  2IAK A;  1XWM A;  4OFZ A;  4TZ4 C;  4UVB B;  3MXZ A;  5AQP B;  2WMN A;  4B3M T;  5LBM A;  3FXD B;  5F8P A;  5KX5 E;  4P0B A;  3H37 A;  3CQG B;  4I43 B;  4U7I A;  3C51 A;  2KSR A;  2W2U A;  3CWZ B;  3QB5 A;  5IYZ E;  4E7S A;  1UX5 A;  2LM2 A;  4ZOL E;  2KWI B;  5J1G A;  1WLX A;  1MMG A;  2CLY C;  3AE4 A;  3DP7 A;  5HWX A;  5JR9 A;  5IWA T;  4AKI A;  4EB6 E;  4QX7 B;  1M7K A;  3SFE A;  3N9Q A;  2X9X A;  2KMF A;  2VK9 A;  2VL0 A;  3ETU A;  4FI5 A;  5JDN A;  2UXN B;  2CEA A;  2V7J A;  1MIV A;  3AVR A;  2IML A;  3AE1 A;  3P4S A;  3P4Q A;  4KBM B;  4ILB A;  4DID B;  4DV6 T;  2LQU A;  5FVK A;  4TN7 B;  5LJN A;  2H88 A;  4NIQ A;  3RRW A;  3J7Y q;  2LOS A;  2LJL A;  2K3W A;  5HWY A;  3ZN1 B;  3RKG A;  4KP3 C;  3N2K E;  1MND A;  1VRB A;  4JEU B;  2CLY B;  4O4L E;  2PTF A;  4Z91 A;  4YTP A;  2WZI A;  1UGO A;  2LEH A;  1X9B A;  2BG9 C;  2LLY A;  5LXT E;  3NRX A;  1OXZ A;  2YIN A;  3AXJ A;  4AKR B;  4DV1 T;  1J1J A;  3QC9 A;  5F5W A;  3U3I A;  5CJ5 A;  3DYJ A;  3AAI A;  5FP3 A;  2LM9 A;  2XQ6 A;  4HWD A;  3TLT A;  1IBM T;  2XM2 A;  1G73 A;  2N9D A;  2ODU A;  1I94 T;  3WSC A;  4JI6 T;  2NW9 A;  4LF9 T;  5GON E;  5LGT B;  4L9I A;  4ZZB A;  3RGL A;  3UT5 E;  1OED E;  2XQ7 A;  3E0Z A;  3T1H T;  2N2N A;  5T1D A;  5FXW A;  4U7Y A;  2JQQ A;  3AAA B;  4PFO A;  3WAK A;  2JQK A;  4EEB A;  2CXF A;  4F6R C;  5JDL A;  2JPF A;  5E0O A;  3OVU A;  4IE4 A;  2W66 A;  5KXJ A;  4JI8 T;  1D0X A;  4JI7 T;  4LF8 T;  2W61 A;  3FZL B;  3IA3 A;  2V7L A;  3JAD A;  4IST A;  1FEW A;  1EZ3 A;  4QH4 A;  3UU5 A;  2J62 A;  3I9Y A;  4F7G B;  4IIJ E;  3C4W A;  3PE0 A;  2LRL A;  3PJA A;  4GYR A;  4U33 A;  4JI5 T;  3TKL B;  3ZEF B;  5JDH A;  2L7N A;  2LHN A;  3CX8 B;  4UEM A;  2UU9 T;  4DR2 T;  2UUC T;  2LOP A;  2QGS A;  4CZZ B;  4PJN A;  2BDE A;  4NXN T;  3KV6 A;  1XNQ T;  2IHR 1;  4PAG A;  4QHO A;  4DR1 T;  2HH7 A;  2KXP B;  5EK3 A;  2VKH A;  3O1J A;  1MMA A;  5AQO B;  5JDM A;  4IDO A;  2PG8 A;  3T1Y T;  1DU2 A;  3CX7 B;  4YHH T;  2K48 A;  2QYW A;  1SE7 A;  1HX8 A;  2NW8 A;  4TUY E;  4YJ2 E;  4DUZ T;  3RC8 A;  1G8X A;  4JI2 T;  4MBQ A;  1KNR A;  4DBR A;  3UU6 A;  3RI5 A;  3ANW B;  4QH1 A;  3LFM A;  3ZYL A;  2FJD A;  2ZM2 A;  3UFE A;  3OBV E;  3ZMV B;  4PNI A;  5FY0 A;  3PDY A;  4U74 A;  2ZM8 A;  2WSS V;  3EDU A;  2R6G F;  4HN9 A;  4NUU A;  4DV7 T;  2ES0 A;  4YSZ A;  3Q5W A;  1T98 A;  4ASK A;  4P0A A;  3HKD E;  4GIW A;  3BQL A;  3ONL C;  3NZP A;  1HTJ F;  2SPC A;  4H9S E;  5DQV A;  1CHU A;  4CXY A;  4QX8 B;  1WR0 A;  5FVL A;  4U72 A;  2LT3 A;  3BK9 A;  4PW8 A;  4ZI3 C;  3WAJ A;  4HFC A;  5AQV B;  3L3P A;  2CBI A;  3AEC A;  2M6I A;  3ZMU B;  4GKK T;  2QVA A;  3PUS A;  4KUM B;  2KZ7 B;  2XAJ B;  5ABG A;  2BS2 A;  2PBI A;  3ANW A;  4OX9 T;  1KEY A;  3AE3 A;  4BA9 A;  1ZV4 X;  3HKC E;  3KBU A;  3N2O A;  3JAE A;  4ZXL A;  3UUB A;  3L39 A;  3PUY F;  3MA9 A;  2V7M A;  4HEA A;  4IE7 A;  1QSD A;  1LVK A;  2D0T A;  3B5M A;  4LF6 T;  2E2A A;  1KNP A;  3ZN0 B;  2DL1 A;  2B1E A;  4YFS A;  4AQF C;  5JRE A;  4DR7 T;  1R8I A;  4PJJ A;  3NZQ A;  3I0O A;  3M1C A;  4GK5 E;  3UU3 A;  2ACX A;  2X68 A;  2W63 A;  3I0Q A;  2FBW A;  2Y8D A;  4CN4 A;  3SWH A;  4Z8X A;  2W4X A;  5JVD E;  3AA6 B;  3AY5 A;  1UUS A;  3ZCJ A;  4TV8 E;  2A3D A;  3GWH A;  3CK6 A;  5DAB A;  3R84 B;  5JQG E;  4G63 A;  3QB5 K;  1D0Y A;  3UTK A;  4F8H A;  5FKY A;  4L5G A;  5AQF B;  2W62 A;  2MOZ A;  1KF6 A;  3ZPO A;  5AFU L;  2UUA T;  5L2L A;  2RPA A;  5IUX A;  4JLE A;  2JQ9 A;  2XQ3 A;  3PJA J;  4AQG A;  1IJ6 A;  2I6H A;  2MTQ A;  3ZJ1 A;  4BAY B;  3K3O A;  4PJM A;  5EK2 A;  1HNZ T;  4TWH A;  4DO0 A;  2HHH T;  3F31 A;  5LBQ B;  3LK2 B;  1XZY A;  4PFP A;  4IDQ A;  1YW0 A;  5H6R B;  2WWU A;  1AJ3 A;  3A5X A;  4AKG A;  1ZP0 A;  2V6Y A;  1BR1 A;  5L4H A;  2OLT A;  4ZHQ E;  2M67 A;  4U31 A;  1BR0 A;  4IGU A;  5LOV E;  4EOZ B;  3UQ7 A;  4IRE A;  2BBH A;  3GN5 A;  3G06 A;  5L47 A;  4IL4 A;  1XNR T;  4PJL A;  1NEN A;  3RYH E;  3K3Q C;  2EHO B;  5ABF A;  3OYZ A;  1YD8 G;  3ZST A;  3NRY A;  1VCS A;  4HFD A;  3N9N A;  1OED C;  4IDN A;  5HEG A;  3W15 B;  4EED A;  5LGN B;  2WWV A;  2BKO A;  2HN2 A;  3EUH A;  4K0U A;  4NPP A;  4QXH B;  4KX6 A;  2W67 A;  2E9X A; 
#chains in the Genus database with same CATH homology
 1WRD A;  2RA1 A;  4HFV A;  3C4Z A;  3ZMS B;  3HI2 A;  4OK0 A;  3MKD A;  2X9W A;  1LRZ A;  2VKO A;  4UF0 A;  5LJM A;  3RH3 A;  2VB6 A;  2V7K A;  1HG2 A;  4WNK A;  1FIO A;  4X1I E;  5LNK A;  5J2T E;  3GMI A;  2E9X C;  3KV4 A;  5HXE A;  4ZI3 D;  2WBL A;  4AI6 A;  4CI1 B;  2MTC A;  4X1Y E;  3RYF E;  4DBQ A;  5T1D A;  1SA0 E;  2LSY A;  3QK6 A;  4MHC A;  4ONR A;  5A1L A;  5F3J A;  1H7C A;  3RC3 A;  3N9M A;  2WAU A;  4PK5 A;  5L3D B;  3FHN A;  4I50 E;  3RX6 A;  3ZC0 A;  3JC6 D;  5JR9 C;  1WYB A;  3B57 A;  2LSG A;  3N5L A;  3IBP A;  2L8K A;  4NUV A;  1U4Q A;  2PJQ A;  3BQK A;  3BQI A;  3UUL A;  4DND A;  5HXS A;  4I4T E;  1FMW A;  3MJX A;  2NWB A;  3OJA A;  2LSJ A;  3DTO A;  5EK4 A;  3PUR A;  4EIW A;  4XAX B;  4CXX A;  4UEL A;  4AKH A;  3Q9D A;  3LJC A;  3WI3 A;  1ZEE A;  4H9P C;  5L3C B;  4UV8 B;  2VAS A;  1LKX A;  5FXX A;  1D1B A;  1S94 A;  2NP9 A;  4MFR A;  4ZI2 D;  2KND A;  1VOM A;  3R6N A;  4GOU A;  4EAH A;  5LYJ E;  4OHF A;  3HKB E;  5IHY A;  1US7 B;  2Z6E A;  3VKH A;  2VKJ A;  1IJ5 A;  2VWA A;  4YJ3 E;  1MMD A;  5M4Y A;  5C8Y E;  3E22 E;  1S35 A;  2I59 A;  3D0T A;  2CXD A;  3RYC E;  2CXL A;  2W00 A;  3PU3 A;  2UXX B;  4IDZ A;  4UF0 B;  3PTR B;  2D5U A;  5JR9 B;  4O2A E;  4WW0 A;  1LVF A;  2CWO A;  5ETW A;  1MIW A;  2ODV A;  4O8S A;  3LK3 B;  4CI3 B;  2H7V C;  2HPJ A;  1MNE A;  3ZMZ B;  2LHR A;  4EZH A;  3MZK B;  2BVM A;  2E9X B;  2E9X D;  5JDF A;  3CQC B;  5LHH B;  1UCU A;  4YHJ A;  3DJB A;  3P8C D;  3C50 A;  3CVR A;  2JMH A;  2X51 A;  3KVA A;  5DJQ C;  4B6X A;  2CCQ A;  2NW7 A;  3ZYK A;  3CQX C;  3CPZ A;  3LBX B;  3UUN A;  2DWG A;  2C5J A;  3WUR A;  3JC6 C;  4UV9 B;  1Y64 B;  4EXT A;  2OA5 A;  2KIN B;  4UVA B;  2NOX A;  3S4U A;  3IF8 B;  3RPU A;  2A72 A;  2C0S A;  2KLQ A;  5FXZ A;  4O4H E;  2BZB A;  2V7I A;  3ETV A;  1O3X A;  4BJN A;  1WYC A;  3LG7 A;  3ZC1 A;  4MAL A;  2H7O A;  1ZKE A;  3SS1 A;  3L09 A;  1NWM X;  5KDM C;  3EVY A;  3E08 A;  5FXV A;  4ZI2 C;  1HFA A;  4ILU A;  3RYI E;  2X0L B;  1D1C A;  2KT9 A;  3AA0 B;  1V9D A;  5JRC A;  2EHO A;  5LA6 E;  4ZS3 A;  5FY7 A;  4WBN E;  3ZYM A;  4MLK A;  3GN5 B;  1OWA A;  3C4X A;  4ERR A;  2V26 A;  4DMV A;  2JJ9 A;  3PU8 A;  2GK9 A;  3M65 A;  2XAH B;  5DQW A;  3HR0 A;  3AT7 A;  2XAQ B;  3CKD A;  1FMV A;  2X67 A;  2KWH A;  4FJO A;  4I55 E;  5J2U E;  3PF0 A;  3N2G E;  3FBL A;  4AKL A;  2DWK A;  3B13 A;  5EZY E;  4H9N C;  4V1A v;  2DCF A;  2YU2 A;  2K9A A;  5HXR A;  3IHR A;  3OKQ A;  4L0R A;  3N9L A;  3ESL A;  3ONX A;  4HGA A;  5ADX L;  5LHI B;  4PK6 A;  4O2B E;  2CE7 A;  3O1H A;  3KDS E;  2C5K T;  4PK4 A;  4WBO A;  2V1D B;  2LSI A;  1NAF A;  3Q2M A;  5CB4 E;  2VL8 A;  2ZM0 A;  3FXE B;  4HKA A;  4DMW A;  4TX5 A;  5HYA A;  5HWX A;  4H63 V;  5TAO A;  4ANJ A;  2K5B B;  1HCI A;  2XAG B;  1D1A A;  4XZC A;  4C90 A;  3ZMT B;  3O4X E;  3I1A A;  3MK7 C;  3FBZ A;  3KVB A;  2Y48 B;  4DVD A;  5HXH A;  4IE0 A;  2YEV C;  4X1K E;  3HA4 A;  5CA0 E;  3FB2 A;  2BVL A;  2EHO D;  3H3A A;  4P09 A;  5LP6 E;  2PFV A;  1IZN B;  3PUQ A;  3F57 A;  2C5I T;  1SHZ C;  2Q9Q A;  3N9P A;  3P7I A;  4KMC A;  2XUE A;  3I9W A;  3AVS A;  2CMR A;  2DI4 A;  4HE8 A;  3CML A;  3KV9 A;  2CWY A;  3RRC A;  3VJZ A;  4J2C A;  4QKN A;  4N78 D;  3LBX A;  2H3R A;  4H9O C;  5LCY A;  3VU7 H;  4OYK A;  4CQI A;  5BMV E;  4XBF B;  2YU1 A;  3HKE E;  5JRC B;  3ZLI A;  1HG5 A;  5FNV E;  2QA7 A;  1BR4 A;  5JDG A;  4UXN B;  4EYU A;  3C98 B;  4BGO A;  2D2S A;  1HF8 A;  3OYX A;  5L3G B;  5JDQ A;  3K3N A;  4M1P A;  2X9H A;  4CI2 B;  2D0U A;  2YK0 A;  1WR6 A;  4ECG A;  3VHL A;  3N9O A;  4A56 A;  3VKG A;  3NBX X;  4QXC B;  5KMG P;  3UUM A;  2RP4 A;  4IHJ E;  4QXB B;  2CA5 A;  2W0G A;  4EZ4 A;  3AAE B;  5L3B B;  4H63 H;  3QUJ A;  4UIG A;  4QWN B;  3SRZ A;  4H9R C;  2WMO A;  2ZMA A;  1YKE B;  4OYJ A;  3T8O A;  2Y6X A;  2VKD A;  3IEE A;  1QUU A;  3V5S A;  5L3E B;  1D0Z A;  2DLR A;  1E1H B;  3ZCI A;  2IW5 B;  4BJM A;  5FY1 A;  2Q9Q D;  4AXP A;  4O4J E;  4JEH B;  1ZHC A;  2NTY A;  4ZS2 A;  2A2F X;  4G2A A;  3U78 A;  3KBT A;  5CA1 E;  1YKH B;  2DHR A;  2P9B A;  3MAC A;  4GK0 E;  5HXC A;  3O9X A;  5LGU B;  4C91 A;  3ZJ2 A;  2J1D G;  2EHO C;  2LE8 A;  3Q5X A;  1IAP A;  4ZI7 E;  2XHE B;  4UVC B;  3CX6 B;  5FMN A;  4AQF A;  2IC6 A;  1B7T A;  3PUG A;  3V5U A;  4EYY R;  3PHF 1;  2WM9 A;  2LSK A;  3F2E A;  4H9Q C;  2MYS A;  4ISS A;  2N1G A;  1HS7 A;  1Z0P A;  2X9Y A;  4O4I E;  3SOL A;  3HL6 A;  4JUY A;  1X79 A;  1BR2 A;  3PUA A;  4X20 E;  3EDV A;  4E7Z A;  2G0U A;  2XTL A;  2HPL A;  4IE5 A;  1MIY A;  2XQY A;  3KV5 A;  1UX4 A;  5HAX A;  3K8P C;  2K24 A;  1U5P A;  4HTE A;  5JH7 E;  3UUX B;  3O1I A;  3AA1 B;  4TV9 E;  5LG4 A;  5FYM A;  5LHG B;  2CM0 A;  4YLH A;  2NTX A;  2ZLY A;  1KNZ A;  2XAF B;  3AB3 B;  4GYS A;  1KK7 A;  2L3L A;  3KFW X;  4ADZ A;  2Q9Q B;  3RKO A;  5H6Q B;  3GA8 A;  4CXW A;  5L3F B;  2L9Q A;  3C64 A;  1MMN A;  3KIN B;  2X66 A;  3LK4 2;  3OBV E;  2MBG A;  1CUN A;  3AA7 B;  2E8I A;  4IE6 A;  2DNX A;  2JMK A;  2XAS B;  2IC9 A;  3J9X 1;  2Q9Q C;  2JRK A;  2IAK A;  4OFZ A;  4TZ4 C;  4UVB B;  3MXZ A;  2WMN A;  5LBM A;  3FXD B;  5F8P A;  5KX5 E;  4P0B A;  3H37 A;  3CQG B;  4I43 B;  3C51 A;  3CWZ B;  5IYZ E;  4E7S A;  1UX5 A;  4ZOL E;  2KWI B;  5J1G A;  1WLX A;  1MMG A;  2CLY C;  4AKI A;  3DP7 A;  5JR9 A;  4EB6 E;  4QX7 B;  3N9Q A;  2X9X A;  2KMF A;  2VK9 A;  4FI5 A;  3ETU A;  5JDN A;  2UXN B;  2CEA A;  2V7J A;  1MIV A;  3AVR A;  4KBM B;  2LQU A;  4TN7 B;  5LJN A;  3RRW A;  3J7Y q;  2LOS A;  2LJL A;  5HWY A;  3ZN1 B;  4KP3 C;  3N2K E;  1MND A;  1VRB A;  4JEU B;  2CLY B;  4O4L E;  5LXT E;  2LEH A;  3NRX A;  1OXZ A;  2YIN A;  4AKR B;  3QC9 A;  3U3I A;  3AAI A;  5FP3 A;  2LM9 A;  1G73 A;  2N9D A;  2ODU A;  3WSC A;  2NW9 A;  5GON E;  5LGT B;  4L9I A;  3UT5 E;  3E0Z A;  2N2N A;  5FXW A;  2JQQ A;  3AAA B;  4PFO A;  3WAK A;  2CXF A;  4F6R C;  5JDL A;  2JPF A;  5E0O A;  4IE4 A;  1D0X A;  2W61 A;  4IST A;  2V7L A;  1FEW A;  1EZ3 A;  3I9Y A;  4IIJ E;  3C4W A;  3PE0 A;  3TKL B;  3ZEF B;  4GYR A;  5JDH A;  2LHN A;  3CX8 B;  4UEM A;  2LOP A;  2QGS A;  4CZZ B;  4PJN A;  2BDE A;  3KV6 A;  4PAG A;  4QHO A;  2HH7 A;  2KXP B;  5EK3 A;  2VKH A;  3O1J A;  1MMA A;  5JDM A;  2PG8 A;  3CX7 B;  2K48 A;  2NW8 A;  1HX8 A;  4TUY E;  4YJ2 E;  3RC8 A;  1G8X A;  4MBQ A;  4DBR A;  3ANW B;  3ZYL A;  3LFM A;  2ZM2 A;  3UFE A;  3ZMV B;  4PNI A;  5FY0 A;  3PDY A;  4U74 A;  2ZM8 A;  2WSS V;  3EDU A;  4NUU A;  4HN9 A;  2ES0 A;  3Q5W A;  1T98 A;  4ASK A;  4P0A A;  3HKD E;  4GIW A;  3BQL A;  3NZP A;  1HTJ F;  2SPC A;  4H9S E;  5DQV A;  4CXY A;  4QX8 B;  4U72 A;  2LT3 A;  3BK9 A;  4PW8 A;  4ZI3 C;  3WAJ A;  3ZMU B;  3L3P A;  4KUM B;  3PUS A;  2KZ7 B;  2XAJ B;  2PBI A;  3ANW A;  4BA9 A;  1ZV4 X;  3HKC E;  3KBU A;  3N2O A;  3MA9 A;  2V7M A;  4HEA A;  4IE7 A;  1QSD A;  1LVK A;  2D0T A;  3ZN0 B;  2B1E A;  4YFS A;  4AQF C;  5JRE A;  4PJJ A;  3NZQ A;  3I0O A;  3M1C A;  4GK5 E;  2ACX A;  2X68 A;  2W63 A;  3I0Q A;  2Y8D A;  3SWH A;  4Z8X A;  5JVD E;  3AA6 B;  3ZCJ A;  4TV8 E;  2A3D A;  3GWH A;  5DAB A;  3R84 B;  5JQG E;  4G63 A;  1D0Y A;  3UTK A;  4L5G A;  2W62 A;  2MOZ A;  3ZPO A;  5AFU L;  5L2L A;  4JLE A;  4BAY B;  4AQG A;  1IJ6 A;  3ZJ1 A;  2MTQ A;  3K3O A;  4PJM A;  5EK2 A;  4DO0 A;  3F31 A;  5LBQ B;  3LK2 B;  4PFP A;  5H6R B;  1AJ3 A;  1YW0 A;  2WWU A;  4AKG A;  3A5X A;  1BR1 A;  4ZHQ E;  2M67 A;  1BR0 A;  4IGU A;  5LOV E;  4EOZ B;  3GN5 A;  4PJL A;  3RYH E;  3K3Q C;  2EHO B;  3OYZ A;  1YD8 G;  3NRY A;  3W15 B;  3N9N A;  5LGN B;  3EUH A;  4K0U A;  4QXH B;  2E9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...