5JDLA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 1mm sr2+
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
301
structure length
299
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEENKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Uncharacterized membrane protein MJ0091
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
total genus 113
structure length 299
sequence length 301
ec nomenclature
pdb deposition date 2016-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdlA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdlA02
5HXRA 5JDMA 5HWXA 5JDQA 5HXSA 5HXHA 5HWYA 5JDHA 5JDNA 5HYAA 5JDLA 5HXEA 5JDFA 3V5UA 5JDGA 5HXCA 3V5SA
chains in the Genus database with same CATH superfamily
3ZMVB 2N9DA 3N2KE 4KP3C 3CQCB 4L9IA 3AE2A 3N9PA 3FXDB 2AE9A 5AQPB 5ADXL 2Y48B 3CQGB 3W15B 2YK0A 5AQSB 5IUXA 4CI2B 4W8PA 4GIWA 2LRLA 2D0TA 1I6ZA 2C5IT 1NEKA 3JC6C 1MMGA 3RLFF 4IE5A 5JVDE 1SE7A 3VR8A 5J2UE 2IC6A 2CXFA 3DYJA 2KGXA 4H63H 4OHFA 3EDUA 3QK6A 3K8PC 2JQKA 2C5JA 2X66A 2RA1A 3ZT7A 1QUUA 3WAKA 2V7JA 2UXBT 4ANJA 3QC9A 5A1LA 1IJ6A 3LK2B 3P50A 4EIWA 4LF8T 1HTJF 3QNUA 3I0OA 5JR9B 3JADA 1OEDA 5CJ5A 2BG9B 4IHJE 2CXDA 3PJAA 2UUBT 2X9HA 4DV6T 5FNVE 1ZOYA 1H7CA 4IDNA 3N9NA 2VVSA 5FZTA 2YKSA 1W0BA 4X62T 4Z8XA 2XQ5A 4H9SE 3UQ4A 4CI3B 2KINB 2XQ6A 3PUQA 5LYJE 4NXMT 2ZM2A 4AQYT 3PDYA 3QUJA 3PE0A 4G63A 5LHHB 2RPAA 3RYFE 2DI4A 2OA5A 4IDPA 4U72A 5JR9C 2BG9C 2YDRA 1HG2A 2NWBA 3C64A 4OK0A 4U31A 5JRCB 2ZMAA 3VR9A 3VRBA 2E9XD 2LJLA 5JREA 1E2AA 2WY2A 5AQHB 2WZHA 4P0AA 4ZZCA 2BKOA 2H7OA 4UVBB 5L3DB 2HN1A 3L09A 4HFVA 2LT3A 1LVKA 4COFA 3WI3A 4AKGA 2BG9A 2LM9A 4AIUA 2IUBA 3ETVA 3TLTA 2XJ7A 3JAFA 2N2NA 1R8IA 1LKXA 3EABA 3J9X1 3GWHA 2A72A 4QX8B 4DUYT 3TLWA 3ZC1A 2KSRA 4JI0T 4CI1B 5AQGB 3B13A 2I6HA 5DQWA 4GK0E 2FJBA 2CPTA 3Q5EA 3U3IA 1YKEB 4KHPT 3AE7A 5ABFB 3DTOA 3ZT6A 5H6QB 2X9WA 2LOPA 5FVLA 1W0AA 2H3RA 2H7VC 4EB6E 3UU4A 2VB6A 1HR0T 5LGNB 2M6BA 3KDSE 4HGAA 3OTOT 4ZHQE 4HTEA 4U7IA 2QRXA 2XAJB 5AQVB 5FXWA 3KBUA 4GK5E 5EK4A 3AE4A 4IIJE 5AFUL 4U7YA 3P4RA 5AQMB 2DHRA 3OPCA 1O3XA 5LJMA 1MMAA 3KV5A 2WWUA 4XAXB 1N32T 2V8SV 3NZPA 3LBXB 3UUBA 2CE7A 4UF0B 2ZLYA 3ESLA 4EAHA 1X9BA 4YY3T 2LHNA 3DJBA 2VURA 3SRZA 4EEBA 3RF1A 3PUGA 4IE4A 5ETWA 2IC9A 4X64T 4DR5T 5ABFA 4A5XA 3MJXA 4GOUA 1HFAA 2L10A 3O1IA 4WBOA 2MYSA 4MBQA 2KWHA 5HEOA 3ETUA 3E08A 2MOZA 2V7IA 4LMLA 2V26A 4DBRA 2K24A 3IA3A 4IE0A 3ONJA 5C8YE 3T8OA 3CX6B 1ZHCA 3B5MA 1VRBA 4JLEA 5FY7A 3L39A 3K3QC 2YDSA 1HX1B 2XM1A 2E8IA 2VASA 2BKNA 3N9OA 2M67A 3CPZA 4DR7T 5FVKA 4BAYB 2FUPA 1KEYA 3LBXA 5FXVA 2WU2A 1G8XA 5JDHA 4UF0A 4BJNA 3N2GE 3CKDA 4EV6A 2BDEA 2UUCT 3X1DA 3HKEE 2NTXA 1ZEEA 3RKOA 3TLSA 4YTNA 2PFVA 1SHZC 3IF8B 4U74A 4JUYA 3UTKA 4X1IE 4CXYA 1UUSA 2UXCT 4MHCA 3DP7A 2OLTA 3MK7C 4PK4A 3M3ZB 5EZYE 3AECA 3I9WA 4ECGA 4DV3T 4I50E 5IYZE 3UT5E 1DU2A 4HFIA 5KMGP 4HWFA 5M4YA 3AAAB 2ZM8A 4Z90A 2YU2A 2L8KA 4JI8T 3MZKB 2MPKA 5AQOB 4NIQA 4LFCT 2JQQA 2PG8A 4TWHA 3M65A 2V7LA 5JDMA 2CXLA 1FMVA 2K3WA 3ZMUB 2D5UA 2NOXA 3ZN0B 1HNZT 2G0UA 4ILBA 2Z6EA 2UXDT 5CGMA 4E7SA 5LBQB 4NXNT 4KX6A 1OEDE 2WDQA 4JV5T 4JEHB 3CX8B 2WSSV 5JDLA 4ZI2D 4DV4T 1OWAA 3ONLC 3FYQA 4TWFA 2YU1A 2JRKA 2L9QA 5LNKA 2EHOB 3MKDA 2CLYB 2HHHT 5L3CB 3AE9A 2GK9A 2Q9QB 5JDNA 2JQ9A 1WLXA 3FZFB 4UXNB 3UUXB 3F31A 4O4IE 1BR4A 2C5KT 2W63A 5L3EB 5JDQA 3NWIA 1IJ5A 2ACZA 3AEEA 1Z0PA 4QWNB 3BK9A 3AB3B 4DIDB 3CK6A 1U4QA 2LSKA 2K48A 4DMVA 4DV0T 3OVUA 4H9OC 2SPCA 2WMOA 3ANWB 3BQIA 3ZYMA 2EHOC 2LKGA 4YJ2E 2BVMA 2IIUA 4MALA 2CLYC 1D1AA 4QH1A 2X0HA 2Q9QC 3O1HA 2F4VT 4CN1A 3P4WA 3H3MA 4PAGA 2Y8DA 2XAGB 2KMFA 2WBLA 3ZMZB 2EHOA 4UVCB 2VKOA 4IDQA 2FJEA 2CM0A 3RQUA 2ODVA 2V6XA 2KNDA 3NRYA 2QA7A 2Q9QA 4LMJA 4B3MT 1HX8A 2WCAA 2LSIA 5HCJA 1W9RA 3ZMSB 2X0CA 3FZMB 4UV9B 4DMWA 3EI0A 4PW8A 4O2AE 4ZS3A 4ZS2A 3RGLA 3AAIA 2WDRA 4JI2T 3HR0A 1JNZA 1NAFA 2XAFB 5HEJA 1LVFA 3ANWA 2NW8A 2NP9A 3T1YT 2XQ3A 3AEGA 5BR8T 2MAWA 3RRWA 1D0YA 5HXHA 3EUHA 3FBLA 5JQGE 3BQLA 3C4ZA 3MXZA 4TX5A 3AE6A 1S35A 4LF4T 3FZHB 3AE3A 3PUSA 4P0BA 3C51A 5LBMA 3GN5B 3Q5DA 3UQ7A 2W0GA 2VKHA 2XY8B 3P4PA 4HFBA 4UELA 4EYUA 4JI7T 4EGWA 5C2TA 5HWXA 4AXPA 4DR1T 3KV6A 1XZYA 4ERRA 5C3JA 4AKHA 2LEHA 2J47A 1X79A 2YINA 2BBJA 4DR2T 2CA5A 4YXDA 3GMIA 4WZXA 5L3FB 2DWGA 1WR6A 4DR3T 4JI3T 1HCIA 4YFSA 1FEWA 3LK42 4LF5T 3UUNA 3A7MA 1YW0A 2VKJA 2MTQA 1MMDA 2WMNA 2X0YA 3VRAA 3IBPA 4JYAT 4JI5T 2E5LT 4KBMB 1ZKEA 3WSCA 2RP4A 5EK2A 2NTYA 2ODUA 5FP3A 4HWDA 2LLYA 4YJ3E 3PJAJ 3SFDA 3AY5A 4QXHB 5TAOA 3AT7A 4EXTA 1BR1A 5JR9A 2W62A 2FJDA 1J5ET 2BS4A 5LG4A 2KLQA 3OBVE 2WP9A 5L3GB 2V5CA 3KV9A 5L4HA 5AQTB 3ZMTB 2B1EA 5HCMA 5JDFA 3JC6D 2IW5B 4EYYR 2D9DA 2BVLA 4KI0F 2XM2A 4PFOA 3RC3A 4HEAA 2M6IA 3EAMA 1KFYA 4IL9A 4L5GA 3PUZF 3PTRB 3GA8A 1EZ3A 3UULA 3K3NA 4I55E 2V5DA 4DNDA 4YT0A 1WRDA 5JRCA 4ZEYA 2LSJA 3O1JA 3PURA 5FY1A 1N34T 4BGOA 5LJNA 2W2UA 2XSAA 5CB4E 4UR9A 4K0UA 3WAJA 5LA6E 3RYIE 5KDMC 2LM2A 3J7Yq 4GYRA 5AQJB 1BR2A 3ONXA 3H3AA 4FJOA 3VKHA 4LF9T 3E0ZA 5HEUA 4XZCA 4CQIA 2CBIA 5FL0A 4PK6A 2JMHA 4NUUA 4YSZA 1NENA 5DQVA 3RIAA 2WZIA 5HYAA 5HXRA 2A9UA 2V1DB 2LRKA 1D0XA 3M1CA 3ZKRA 4O4HE 2W4XA 4TV8E 2ZM6T 2X9XA 4Q25A 3N2OA 4PNIA 5AQKB 2XZEA 3FBZA 4U3CA 4AKIA 3VHLA 1T98A 5HAXA 4HFDA 3RQWA 2QYWA 4KHZF 5AQFB 5LB7B 2A2FX 5FKYA 3LG7A 2IDOB 2WS3A 4TZ4C 4DV7T 1FIOA 4IE6A 4X1KE 3IHRA 3LDQB 3LK3B 1YKHB 5AQNB 2CMRA 2BS2A 3ZCJA 1D0ZA 2YOEA 4QKNA 2LE8A 3TLVA 4A98A 3ZEFB 3D0TA 2CEAA 2XAQB 4LF6T 2MBGA 3ZPOA 2H88A 2W00A 1B7TA 2W66A 1XMQT 4LFAT 2CWYA 3RIUC 4TWDA 5LMNT 2PBIA 1MIVA 2LSYA 3LJCA 5F5WA 4JI1T 4IDOA 4OFZA 3K3OA 3AEDA 4X20E 4OYJA 1WCRA 2NR4A 1FMWA 2IMLA 1MIYA 4HWCA 3RIUA 3JAEA 3CVRA 4O8SA 3IEEA 4DO0A 3AEAA 1M62A 3O9XA 4PFPA 2KXPB 2XASB 5JDGA 5FMNA 4HFEA 1SJ7A 4GKJT 2HPJA 5BMVE 4LFBT 2YDQA 5IHYA 3HI2A 4AQFC 2I59A 3C50A 3OKQA 4V1Av 5ABEA 1WYBA 3U78A 5HXCA 3RHWA 3KVAA 4U2ZA 2Y6XA 4CXWA 2CBJA 2CHNA 4ILUA 3RIFA 1WYCA 4J2CA 5J0ZA 1XNQT 5E0OA 3WURA 2X0LB 4AQFA 4ASKA 1UGOA 5HEHA 2BBHA 3KBTA 5LCYA 2VQET 2LKHA 4TUYE 4F6RC 1HG5A 5L3BB 2FJAA 4ZI3D 3AA7B 1V9DA 2XQ4A 1CUNA 3UFGA 3F57A 2XUEA 1KNPA 2PJQA 4O4JE 3H37A 2I0MA 3E22E 5AQUB 2L7NA 2XQ9A 1T8BA 4ISTA 3UU5A 4GKKT 1MNDA 4OYKA 3KFWX 2ACXA 4TNVA 3S4UA 2AXDS 1HF8A 5J2TE 1UK5A 3OYXA 4N78D 2VQFT 3N9QA 1S94A 5LHGB 1IBLT 4EZ4A 2E9XB 2BG9E 4DVDA 5GONE 5HEGA 4IGUA 4BJMA 1HNXT 4ZI7E 1VCTA 1E1HB 3F2EA 3VU7H 3QB5K 4I0UA 4AKLA 3C4WA 4UIGA 3SS1A 2N1GA 2J4GA 3SFEA 4Z91A 3HKCE 5CA1E 3KV4A 1SUMB 4B3TT 1ZP0A 3ZJ2A 4U2YA 1UURA 3R84B 2LQUA 3RKGA 2XQ8A 2NW7A 4IL4A 2D2SA 1IBKT 2E9XC 3SOLA 3UU3A 3V5UA 4GYSA 1OEDB 3OYZA 1N36T 5FXZA 1L0VA 4PJNA 3NKZA 4ADZA 2DL1A 4ISSA 5FYMA 3FZLB 3KINB 2E9XA 4H9RC 2D0UA 4F7GB 4CZZB 2LOSA 2CRBA 2WB5A 4WW0A 4ILAA 2BS3A 4U33A 2UXXB 1E7PA 4WBNE 1GQEA 3CQXC 3RI5A 2XPKA 4TN7B 3ZCIA 1XWMA 2XQYA 1OEDC 4FI5A 4X1YE 2JJ9A 4KMCA 3AVRA 1VCSA 5F3JA 1T7SA 4QH4A 2WAUA 4B3RT 2WM9A 2LHRA 3EVYA 3AE5A 4IDZA 1VOMA 2W67A 3MACA 5L4EA 2EHOD 4B3ST 3C4XA 4XBFB 4ZXLA 1XMOT 3L3PA 4YSYA 2XQ7A 4C90A 4E7ZA 5HXEA 2Q9QD 3Q5WA 2FBWA 2JMKA 1N33T 3MA9A 4HE8A 2X68A 2HN2A 3NVOA 4YSXA 1M7KA 2YEVC 4HKAA 4JEUB 3AA6B 3EHZA 1CHUA 1XDPA 1KNZA 3K1SA 4H9PC 4X66T 2IAKA 3PF0A 3GN5A 4DR6T 4X5TA 4K0KT 4JI4T 5AQQB 1XDOA 3PV0F 3I0QA 1IAPA 4YHJA 2VWAA 3V5SA 2UUAT 4LMKA 5HXSA 3RYHE 3P4SA 3AE8A 1YQ3A 3ZSSA 5AQLB 2L3LA 5CFBA 2CHOA 5LHIB 2MTCA 1YXRA 3RYCE 3CWZB 2WDVA 4IREA 4PK5A 2X51A 2JIWA 2IHR1 2VVNA 3HA4A 2X67A 4PJJA 4EEDA 4AISA 4YTMA 4P09A 4YHHT 4A97A 5LMUT 3RH3A 2JQHA 2XHEB 2E5VA 4O2BE 5LGUB 2CWOA 3P7IA 3SWHA 3VJZA 5J1GA 5FY0A 4AI6A 2BZBA 3N9LA 3NZQA 4F8HA 2K9AA 3I1AA 3FXEB 4NPPA 4ZZBA 3HL6A 1U5PA 4IE7A 3A5XA 3JCFA 3PUXF 3L8RA 3NBXX 2V7KA 1IZNB 3ZJ1A 5LOVE 3AVSA 4UVAB 5L47A 4H9QC 4DUZT 4QXCB 4QH5A 5DABA 5ABGA 2V7MA 4H9NC 4AQGA 2WWVA 2XQAA 2UU9T 4ONRA 4P1NA 5JH7E 2DLRA 2LSGA 2R6GF 4DR4T 5H6RB 3RC8A 3FZKB 4UEMA 3HKBE 3NRXA 4EZHA 3PU8A 3B57A 2W61A 3KVBA 4LF7T 4OX9T 1KF6A 5LGTB 3LFMA 3ZN1B 4DV1T 2QVAA 4HWHA 2PTFA 4ZI2C 4TV9E 1NWMX 5LG3A 4UV8B 5L2LA 2VKDA 1SJ8A 4TNWA 2YN6A 3R6NA 3ZLIA 3QB5A 3AAEB 2KVPA 3CX7B 4X65T 4WNKA 4C91A 2V6YB 2KBBA 4I43B 4AKRB 2ES0A 3FB2A 4MFRA 4ZOLE 1UX4A 4ZI3C 2X9YA 2J1DG 3CIRA 4KUMB 4MLKA 5HWYA 1LRZA 4ILCA 3UU8A 1IBMT 5ABHA 3PHF1 5FXXA 1QLBA 2UXNB 1XNRT 1WFDA 3Q9DA 4QHOA 1SA0E 1WR0A 3ZYKA 2XTLA 2DNXA 1KK7A 2VL0A 1OXZA 1YD8G 3AA0B 3T1HT 4JI6T 3OJAA 3RX6A 4EOZB 3Q5XA 1Y64B 5KXJA 4YTPA 2DWKA 1I94T 1G73A 4M1PA 4DV5T 1ZV4X 4HN9A 4NUVA 1T72A 4HFHA 2V6YA 3P4QA 2H89A 4L0RA 3C98B 5LXTE 3CMLA 3PUWF 2C0SA 2ZM0A 1J1JA 2WU5A 3PUVF 2CCQA 1QSDA 4PJMA 4BA9A 3HKDE 2XSBA 1D1CA 3ABVA 2QGSA 3I9YA 1JNRA 3AXJB 5EK3A 1HNWT 1UCUA 3RRCA 3QOFA 4DBQA 1AJ3A 3Q2MA 3FHNA 4CXXA 5AQIB 2DCFA 4A56A 4YLHA 2VK9A 5KX5E 4HWIB 4QX7B 4H63V 3BQKA 1Z8UA 4G2AA 3AA1B 4QXBB 2NW9A 1KNRA 1FJGT 1HS7A 2K5BB 2OV9A 1W09A 2HH7A 5IWAT 1MNEA 1UX5A 3N9MA 3LSVA 3EDVA 3ZSTA 5AQRB 5CA0E 3TLUA 1MMNA 3ZT5A 3ZC0A 3PUAA 2HPLA 2JPFA 3UFEA 4CN4A 3O4XE 2BKPA 1YQ4A 1BR0A 2P9BA 2J62A 1US7B 4IT4A 2B76A 3RPUA 2XAHB 3AXJA 4WYVA 3A8YC 4PJLA 3UUMA 1D1BA 3AEFA 2E2AA 4HFCA 2WQYA 3ZYLA 5DJQC 3TKLB 3PU3A 5T1DA 3AEBA 3UU6A 1MIWA 4B6XA 1Y01A 4JBWF 5FL1A 3AE1A 4O4LE 3VKGA 2KZ7B 3P8CD 4DV2T 5JTGA 3N5LA 2A3DA 4CN6A 3G06A 1J5WA 5F8PA 3PUYF 2KWIB 2KT9A 4I4TE 2VL8A 5LP6E
chains in the Genus database with same CATH topology
2D5UA 2NOXA 3ZN0B 5DQVA 3ZMVB 2N9DA 3N2KE 4KP3C 2G0UA 3CQCB 5HYAA 2Z6EA 5HXRA 4L9IA 5LHIB 3N9PA 2MTCA 3FXDB 2V1DB 5ADXL 2Y48B 3RYCE 3CQGB 4E7SA 3CWZB 5LBQB 1D0XA 3M1CA 4PK5A 4O4HE 4TV8E 2X51A 3W15B 2X9XA 4JEHB 2YK0A 3CX8B 2WSSV 3N2OA 4PNIA 5JDLA 4ZI2D 3HA4A 4CI2B 3FBZA 4GIWA 1OWAA 2X67A 4AKIA 3VHLA 1T98A 2D0TA 4PJJA 2C5IT 2YU1A 5HAXA 3JC6C 1MMGA 2JRKA 2L9QA 5LNKA 4P09A 2EHOB 3MKDA 4IE5A 2CLYB 5L3CB 5JVDE 2GK9A 3RH3A 2A2FX 5J2UE 2Q9QB 5JDNA 3LG7A 2XHEB 4TZ4C 1WLXA 2IC6A 1FIOA 4O2BE 2CXFA 4UXNB 5LGUB 4IE6A 4X1KE 3IHRA 2CWOA 3P7IA 3UUXB 4H63H 3LK3B 4OHFA 1YKHB 3SWHA 3VJZA 3EDUA 3QK6A 3F31A 3K8PC 4O4IE 5J1GA 1BR4A 2C5KT 2W63A 2C5JA 2X66A 5JDQA 5L3EB 2CMRA 2RA1A 1IJ5A 5FY0A 3ZCJA 4AI6A 1D0ZA 1QUUA 3WAKA 2BZBA 2V7JA 1Z0PA 4ANJA 3QC9A 4QKNA 4QWNB 2LE8A 3BK9A 5A1LA 3AB3B 1IJ6A 3N9LA 3NZQA 3ZEFB 3D0TA 2CEAA 1U4QA 2XAQB 2LSKA 2K48A 2K9AA 3LK2B 2MBGA 3I1AA 3FXEB 4DMVA 4EIWA 4H9OC 3ZPOA 3HL6A 1HTJF 2SPCA 1U5PA 2WMOA 3ANWB 4IE7A 3BQIA 3I0OA 3ZYMA 5JR9B 2W00A 1B7TA 2EHOC 4YJ2E 4IHJE 2CWYA 3A5XA 2CXDA 2BVMA 2X9HA 4MALA 2CLYC 1D1AA 5FNVE 1H7CA 2PBIA 1MIVA 3NBXX 2Q9QC 2LSYA 2V7KA 3N9NA 1IZNB 3O1HA 5LOVE 3ZJ1A 3AVSA 4UVAB 3LJCA 4H9QC 4PAGA 2Y8DA 4Z8XA 4OFZA 3K3OA 2XAGB 4X20E 4H9SE 4QXCB 4OYJA 4CI3B 2KINB 2KMFA 2WBLA 3ZMZB 1FMWA 2EHOA 5DABA 4UVCB 2VKOA 3PUQA 1MIYA 5LYJE 2V7MA 4H9NC 4AQGA 2ZM2A 2CM0A 3PDYA 2ODVA 2KNDA 3QUJA 4ONRA 3NRYA 2QA7A 3PE0A 4G63A 3CVRA 4O8SA 5LHHB 2Q9QA 5JH7E 3RYFE 3IEEA 4DO0A 2DLRA 3O9XA 1HX8A 2DI4A 4PFPA 2KXPB 2LSGA 2OA5A 2XASB 2LSIA 5JDGA 4U72A 5JR9C 5H6RB 5FMNA 3ZMSB 1HG2A 3RC8A 2NWBA 3C64A 4OK0A 2HPJA 4UEMA 4UV9B 5BMVE 2ZMAA 5JRCB 3HKBE 3NRXA 4DMWA 4PW8A 5IHYA 3HI2A 4AQFC 4EZHA 2I59A 3C50A 4O2AE 2E9XD 3PU8A 4ZS3A 2LJLA 3OKQA 4V1Av 5JREA 1WYBA 3B57A 4P0AA 2W61A 3U78A 4ZS2A 5HXCA 2H7OA 4UVBB 3AAIA 3KVBA 5L3DB 3KVAA 3HR0A 5LGTB 4CXWA 2Y6XA 3LFMA 3ZN1B 1NAFA 2XAFB 3L09A 4HFVA 4ZI2C 1LVFA 4ILUA 2LT3A 1NWMX 3ANWA 2NW8A 4TV9E 1LVKA 1WYCA 2NP9A 4UV8B 3WI3A 4J2CA 5L2LA 4AKGA 2LM9A 3ETVA 5E0OA 3WURA 3RRWA 2X0LB 2VKDA 1D0YA 2N2NA 5HXHA 4AQFA 4ASKA 3EUHA 3FBLA 5JQGE 3R6NA 3BQLA 3C4ZA 3MXZA 3ZLIA 4TX5A 3AAEB 3KBTA 1LKXA 3CX7B 5LCYA 1S35A 3J9X1 4WNKA 3GWHA 4TUYE 4C91A 4F6RC 4I43B 2A72A 1HG5A 4QX8B 4AKRB 5L3BB 3ZC1A 5LBMA 3PUSA 4P0BA 2ES0A 3C51A 4CI1B 3GN5B 4ZI3D 3FB2A 4MFRA 3B13A 4ZOLE 3AA7B 1UX4A 5DQWA 1V9DA 2W0GA 1CUNA 4ZI3C 2X9YA 2J1DG 4GK0E 2VKHA 4KUMB 4MLKA 5HWYA 1LRZA 2XUEA 3F57A 2PJQA 4O4JE 3U3IA 3H37A 1YKEB 3E22E 3PHF1 5FXXA 2UXNB 3DTOA 4UELA 4ISTA 1MNDA 4OYKA 4EYUA 3KFWX 2ACXA 5H6QB 2X9WA 3S4UA 2LOPA 5J2TE 1HF8A 3Q9DA 4QHOA 5HWXA 4AXPA 3KV6A 1SA0E 2H3RA 3OYXA 2H7VC 4EB6E 4N78D 2VB6A 3N9QA 3ZYKA 1S94A 5LHGB 4ERRA 2XTLA 2DNXA 1KK7A 5LGNB 1OXZA 3KDSE 4HGAA 1YD8G 2E9XB 4EZ4A 2LEHA 4ZHQE 4DVDA 4HTEA 3AA0B 4AKHA 2XAJB 1X79A 5GONE 5FXWA 3KBUA 4GK5E 2YINA 5EK4A 4IGUA 4IIJE 3OJAA 3RX6A 4EOZB 3Q5XA 4BJMA 5AFUL 2CA5A 1Y64B 4ZI7E 1E1HB 3F2EA 3GMIA 2DWKA 3VU7H 2DHRA 5L3FB 1O3XA 4AKLA 5LJMA 1G73A 4M1PA 1MMAA 2DWGA 3C4WA 1WR6A 4UIGA 1ZV4X 2WWUA 3KV5A 4HN9A 4XAXB 3SS1A 2N1GA 3NZPA 4NUVA 3LBXB 3HKCE 5CA1E 1HCIA 3KV4A 2CE7A 4YFSA 4UF0B 1FEWA 3LK42 3UUNA 2ZLYA 3ESLA 3ZJ2A 1YW0A 4EAHA 2VKJA 4L0RA 2MTQA 1MMDA 2WMNA 3C98B 3IBPA 5LXTE 3CMLA 2C0SA 2ZM0A 2LHNA 3DJBA 3SRZA 3R84B 4KBMB 2LQUA 1ZKEA 2CCQA 3WSCA 2RP4A 5EK2A 2NW7A 2NTYA 2D2SA 3PUGA 2E9XC 4IE4A 5ETWA 2ODUA 2IC9A 1QSDA 5FP3A 3SOLA 4PJMA 4BA9A 4YJ3E 3V5UA 3HKDE 4GYSA 1D1CA 2QGSA 3I9YA 4QXHB 3OYZA 5TAOA 3MJXA 4GOUA 1HFAA 3AT7A 4EXTA 1BR1A 5EK3A 3O1IA 5FXZA 5JR9A 2W62A 4WBOA 2MYSA 1UCUA 4MBQA 2KLQA 2KWHA 5LG4A 3RRCA 4PJNA 3OBVE 4DBQA 4ADZA 5L3GB 1AJ3A 3Q2MA 3FHNA 3ETUA 4CXXA 4ISSA 5FYMA 3E08A 2MOZA 2DCFA 2V7IA 3KV9A 4A56A 3ZMTB 2B1EA 4YLHA 2V26A 2VK9A 4DBRA 2K24A 3KINB 2E9XA 4H9RC 2D0UA 4IE0A 5JDFA 5C8YE 3JC6D 3T8OA 5KX5E 2IW5B 3CX6B 4QX7B 4CZZB 1ZHCA 4EYYR 4H63V 3BQKA 2BVLA 1VRBA 2LOSA 4JLEA 4PFOA 3RC3A 5FY7A 4HEAA 4G2AA 3K3QC 3AA1B 4WW0A 2E8IA 2VASA 2UXXB 4L5GA 4WBNE 4QXBB 2NW9A 3CQXC 3PTRB 3GA8A 3N9OA 2M67A 3CPZA 4BAYB 1HS7A 2K5BB 1EZ3A 4TN7B 3ZCIA 2XQYA 3UULA 3LBXA 5FXVA 4FI5A 3K3NA 4X1YE 2JJ9A 4KMCA 3AVRA 1G8XA 2HH7A 4I55E 5JDHA 4DNDA 4UF0A 1MNEA 1UX5A 3N9MA 4BJNA 3EDVA 5F3JA 3N2GE 3CKDA 2BDEA 3HKEE 2NTXA 1ZEEA 3RKOA 1WRDA 2WAUA 5JRCA 2WM9A 5CA0E 2PFVA 2LHRA 3EVYA 1MMNA 1SHZC 3ZC0A 2LSJA 3PUAA 4IDZA 3IF8B 3O1JA 2HPLA 4U74A 2JPFA 3PURA 5FY1A 4JUYA 3UTKA 4X1IE 1VOMA 3UFEA 4CXYA 3MACA 4MHCA 3O4XE 4BGOA 2EHOD 3DP7A 1BR0A 5LJNA 2P9BA 3C4XA 3MK7C 4XBFB 1US7B 4PK4A 3RPUA 2XAHB 3L3PA 5CB4E 5EZYE 4C90A 4E7ZA 5HXEA 2Q9QD 3Q5WA 3I9WA 4ECGA 4I50E 2JMKA 4K0UA 5IYZE 3UT5E 4PJLA 3WAJA 3UUMA 1D1BA 5LA6E 3RYIE 3MA9A 4HE8A 2X68A 5KDMC 3J7Yq 3ZYLA 5DJQC 3TKLB 4GYRA 5KMGP 2YEVC 3PU3A 5T1DA 1BR2A 4HKAA 5M4YA 1MIWA 4JEUB 3ONXA 4B6XA 3AAAB 2ZM8A 3AA6B 2YU2A 3H3AA 4FJOA 2L8KA 4O4LE 3VKHA 1KNZA 3VKGA 2KZ7B 3P8CD 3MZKB 4H9PC 3E0ZA 2IAKA 3PF0A 3GN5A 3N5LA 4XZCA 4CQIA 2A3DA 2JQQA 2PG8A 4PK6A 3I0QA 1IAPA 4YHJA 3M65A 2JMHA 2V7LA 2VWAA 4NUUA 5F8PA 3V5SA 5JDMA 2CXLA 5HXSA 1FMVA 3RYHE 2KWIB 2KT9A 3ZMUB 4I4TE 2VL8A 5LP6E 2L3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXR A;  5JDM A;  5HWX A;  5JDQ A;  5HXS A;  5HXH A;  5HWY A;  5JDH A;  5JDN A;  5HYA A;  5JDL A;  5HXE A;  5JDF A;  3V5U A;  5JDG A;  5HXC A;  3V5S A; 
#chains in the Genus database with same CATH topology
 3ZMV B;  2N9D A;  3N2K E;  4KP3 C;  3CQC B;  4L9I A;  3AE2 A;  3N9P A;  3FXD B;  2AE9 A;  5AQP B;  5ADX L;  2Y48 B;  3CQG B;  3W15 B;  2YK0 A;  5AQS B;  5IUX A;  4CI2 B;  4W8P A;  4GIW A;  2LRL A;  2D0T A;  1I6Z A;  2C5I T;  1NEK A;  3JC6 C;  1MMG A;  3RLF F;  4IE5 A;  5JVD E;  1SE7 A;  3VR8 A;  5J2U E;  2IC6 A;  2CXF A;  3DYJ A;  2KGX A;  4H63 H;  4OHF A;  3EDU A;  3QK6 A;  3K8P C;  2JQK A;  2C5J A;  2X66 A;  2RA1 A;  3ZT7 A;  1QUU A;  3WAK A;  2V7J A;  2UXB T;  4ANJ A;  3QC9 A;  5A1L A;  1IJ6 A;  3LK2 B;  3P50 A;  4EIW A;  4LF8 T;  1HTJ F;  3QNU A;  3I0O A;  5JR9 B;  3JAD A;  1OED A;  5CJ5 A;  2BG9 B;  4IHJ E;  2CXD A;  3PJA A;  2UUB T;  2X9H A;  4DV6 T;  5FNV E;  1ZOY A;  1H7C A;  4IDN A;  3N9N A;  2VVS A;  5FZT A;  2YKS A;  1W0B A;  4X62 T;  4Z8X A;  2XQ5 A;  4H9S E;  3UQ4 A;  4CI3 B;  2KIN B;  2XQ6 A;  3PUQ A;  5LYJ E;  4NXM T;  2ZM2 A;  4AQY T;  3PDY A;  3QUJ A;  3PE0 A;  4G63 A;  5LHH B;  2RPA A;  3RYF E;  2DI4 A;  2OA5 A;  4IDP A;  4U72 A;  5JR9 C;  2BG9 C;  2YDR A;  1HG2 A;  2NWB A;  3C64 A;  4OK0 A;  4U31 A;  5JRC B;  2ZMA A;  3VR9 A;  3VRB A;  2E9X D;  2LJL A;  5JRE A;  1E2A A;  2WY2 A;  5AQH B;  2WZH A;  4P0A A;  4ZZC A;  2BKO A;  2H7O A;  4UVB B;  5L3D B;  2HN1 A;  3L09 A;  4HFV A;  2LT3 A;  1LVK A;  4COF A;  3WI3 A;  4AKG A;  2BG9 A;  2LM9 A;  4AIU A;  2IUB A;  3ETV A;  3TLT A;  2XJ7 A;  3JAF A;  2N2N A;  1R8I A;  1LKX A;  3EAB A;  3J9X 1;  3GWH A;  2A72 A;  4QX8 B;  4DUY T;  3TLW A;  3ZC1 A;  2KSR A;  4JI0 T;  4CI1 B;  5AQG B;  3B13 A;  2I6H A;  5DQW A;  4GK0 E;  2FJB A;  2CPT A;  3Q5E A;  3U3I A;  1YKE B;  4KHP T;  3AE7 A;  5ABF B;  3DTO A;  3ZT6 A;  5H6Q B;  2X9W A;  2LOP A;  5FVL A;  1W0A A;  2H3R A;  2H7V C;  4EB6 E;  3UU4 A;  2VB6 A;  1HR0 T;  5LGN B;  2M6B A;  3KDS E;  4HGA A;  3OTO T;  4ZHQ E;  4HTE A;  4U7I A;  2QRX A;  2XAJ B;  5AQV B;  5FXW A;  3KBU A;  4GK5 E;  5EK4 A;  3AE4 A;  4IIJ E;  5AFU L;  4U7Y A;  3P4R A;  5AQM B;  2DHR A;  3OPC A;  1O3X A;  5LJM A;  1MMA A;  3KV5 A;  2WWU A;  4XAX B;  1N32 T;  2V8S V;  3NZP A;  3LBX B;  3UUB A;  2CE7 A;  4UF0 B;  2ZLY A;  3ESL A;  4EAH A;  1X9B A;  4YY3 T;  2LHN A;  3DJB A;  2VUR A;  3SRZ A;  4EEB A;  3RF1 A;  3PUG A;  4IE4 A;  5ETW A;  2IC9 A;  4X64 T;  4DR5 T;  5ABF A;  4A5X A;  3MJX A;  4GOU A;  1HFA A;  2L10 A;  3O1I A;  4WBO A;  2MYS A;  4MBQ A;  2KWH A;  5HEO A;  3ETU A;  3E08 A;  2MOZ A;  2V7I A;  4LML A;  2V26 A;  4DBR A;  2K24 A;  3IA3 A;  4IE0 A;  3ONJ A;  5C8Y E;  3T8O A;  3CX6 B;  1ZHC A;  3B5M A;  1VRB A;  4JLE A;  5FY7 A;  3L39 A;  3K3Q C;  2YDS A;  1HX1 B;  2XM1 A;  2E8I A;  2VAS A;  2BKN A;  3N9O A;  2M67 A;  3CPZ A;  4DR7 T;  5FVK A;  4BAY B;  2FUP A;  1KEY A;  3LBX A;  5FXV A;  2WU2 A;  1G8X A;  5JDH A;  4UF0 A;  4BJN A;  3N2G E;  3CKD A;  4EV6 A;  2BDE A;  2UUC T;  3X1D A;  3HKE E;  2NTX A;  1ZEE A;  3RKO A;  3TLS A;  4YTN A;  2PFV A;  1SHZ C;  3IF8 B;  4U74 A;  4JUY A;  3UTK A;  4X1I E;  4CXY A;  1UUS A;  2UXC T;  4MHC A;  3DP7 A;  2OLT A;  3MK7 C;  4PK4 A;  3M3Z B;  5EZY E;  3AEC A;  3I9W A;  4ECG A;  4DV3 T;  4I50 E;  5IYZ E;  3UT5 E;  1DU2 A;  4HFI A;  5KMG P;  4HWF A;  5M4Y A;  3AAA B;  2ZM8 A;  4Z90 A;  2YU2 A;  2L8K A;  4JI8 T;  3MZK B;  2MPK A;  5AQO B;  4NIQ A;  4LFC T;  2JQQ A;  2PG8 A;  4TWH A;  3M65 A;  2V7L A;  5JDM A;  2CXL A;  1FMV A;  2K3W A;  3ZMU B;  2D5U A;  2NOX A;  3ZN0 B;  1HNZ T;  2G0U A;  4ILB A;  2Z6E A;  2UXD T;  5CGM A;  4E7S A;  5LBQ B;  4NXN T;  4KX6 A;  1OED E;  2WDQ A;  4JV5 T;  4JEH B;  3CX8 B;  2WSS V;  5JDL A;  4ZI2 D;  4DV4 T;  1OWA A;  3ONL C;  3FYQ A;  4TWF A;  2YU1 A;  2JRK A;  2L9Q A;  5LNK A;  2EHO B;  3MKD A;  2CLY B;  2HHH T;  5L3C B;  3AE9 A;  2GK9 A;  2Q9Q B;  5JDN A;  2JQ9 A;  1WLX A;  3FZF B;  4UXN B;  3UUX B;  3F31 A;  4O4I E;  1BR4 A;  2C5K T;  2W63 A;  5L3E B;  5JDQ A;  3NWI A;  1IJ5 A;  2ACZ A;  3AEE A;  1Z0P A;  4QWN B;  3BK9 A;  3AB3 B;  4DID B;  3CK6 A;  1U4Q A;  2LSK A;  2K48 A;  4DMV A;  4DV0 T;  3OVU A;  4H9O C;  2SPC A;  2WMO A;  3ANW B;  3BQI A;  3ZYM A;  2EHO C;  2LKG A;  4YJ2 E;  2BVM A;  2IIU A;  4MAL A;  2CLY C;  1D1A A;  4QH1 A;  2X0H A;  2Q9Q C;  3O1H A;  2F4V T;  4CN1 A;  3P4W A;  3H3M A;  4PAG A;  2Y8D A;  2XAG B;  2KMF A;  2WBL A;  3ZMZ B;  2EHO A;  4UVC B;  2VKO A;  4IDQ A;  2FJE A;  2CM0 A;  3RQU A;  2ODV A;  2V6X A;  2KND A;  3NRY A;  2QA7 A;  2Q9Q A;  4LMJ A;  4B3M T;  1HX8 A;  2WCA A;  2LSI A;  5HCJ A;  1W9R A;  3ZMS B;  2X0C A;  3FZM B;  4UV9 B;  4DMW A;  3EI0 A;  4PW8 A;  4O2A E;  4ZS3 A;  4ZS2 A;  3RGL A;  3AAI A;  2WDR A;  4JI2 T;  3HR0 A;  1JNZ A;  1NAF A;  2XAF B;  5HEJ A;  1LVF A;  3ANW A;  2NW8 A;  2NP9 A;  3T1Y T;  2XQ3 A;  3AEG A;  5BR8 T;  2MAW A;  3RRW A;  1D0Y A;  5HXH A;  3EUH A;  3FBL A;  5JQG E;  3BQL A;  3C4Z A;  3MXZ A;  4TX5 A;  3AE6 A;  1S35 A;  4LF4 T;  3FZH B;  3AE3 A;  3PUS A;  4P0B A;  3C51 A;  5LBM A;  3GN5 B;  3Q5D A;  3UQ7 A;  2W0G A;  2VKH A;  2XY8 B;  3P4P A;  4HFB A;  4UEL A;  4EYU A;  4JI7 T;  4EGW A;  5C2T A;  5HWX A;  4AXP A;  4DR1 T;  3KV6 A;  1XZY A;  4ERR A;  5C3J A;  4AKH A;  2LEH A;  2J47 A;  1X79 A;  2YIN A;  2BBJ A;  4DR2 T;  2CA5 A;  4YXD A;  3GMI A;  4WZX A;  5L3F B;  2DWG A;  1WR6 A;  4DR3 T;  4JI3 T;  1HCI A;  4YFS A;  1FEW A;  3LK4 2;  4LF5 T;  3UUN A;  3A7M A;  1YW0 A;  2VKJ A;  2MTQ A;  1MMD A;  2WMN A;  2X0Y A;  3VRA A;  3IBP A;  4JYA T;  4JI5 T;  2E5L T;  4KBM B;  1ZKE A;  3WSC A;  2RP4 A;  5EK2 A;  2NTY A;  2ODU A;  5FP3 A;  4HWD A;  2LLY A;  4YJ3 E;  3PJA J;  3SFD A;  3AY5 A;  4QXH B;  5TAO A;  3AT7 A;  4EXT A;  1BR1 A;  5JR9 A;  2W62 A;  2FJD A;  1J5E T;  2BS4 A;  5LG4 A;  2KLQ A;  3OBV E;  2WP9 A;  5L3G B;  2V5C A;  3KV9 A;  5L4H A;  5AQT B;  3ZMT B;  2B1E A;  5HCM A;  5JDF A;  3JC6 D;  2IW5 B;  4EYY R;  2D9D A;  2BVL A;  4KI0 F;  2XM2 A;  4PFO A;  3RC3 A;  4HEA A;  2M6I A;  3EAM A;  1KFY A;  4IL9 A;  4L5G A;  3PUZ F;  3PTR B;  3GA8 A;  1EZ3 A;  3UUL A;  3K3N A;  4I55 E;  2V5D A;  4DND A;  4YT0 A;  1WRD A;  5JRC A;  4ZEY A;  2LSJ A;  3O1J A;  3PUR A;  5FY1 A;  1N34 T;  4BGO A;  5LJN A;  2W2U A;  2XSA A;  5CB4 E;  4UR9 A;  4K0U A;  3WAJ A;  5LA6 E;  3RYI E;  5KDM C;  2LM2 A;  3J7Y q;  4GYR A;  5AQJ B;  1BR2 A;  3ONX A;  3H3A A;  4FJO A;  3VKH A;  4LF9 T;  3E0Z A;  5HEU A;  4XZC A;  4CQI A;  2CBI A;  5FL0 A;  4PK6 A;  2JMH A;  4NUU A;  4YSZ A;  1NEN A;  5DQV A;  3RIA A;  2WZI A;  5HYA A;  5HXR A;  2A9U A;  2V1D B;  2LRK A;  1D0X A;  3M1C A;  3ZKR A;  4O4H E;  2W4X A;  4TV8 E;  2ZM6 T;  2X9X A;  4Q25 A;  3N2O A;  4PNI A;  5AQK B;  2XZE A;  3FBZ A;  4U3C A;  4AKI A;  3VHL A;  1T98 A;  5HAX A;  4HFD A;  3RQW A;  2QYW A;  4KHZ F;  5AQF B;  5LB7 B;  2A2F X;  5FKY A;  3LG7 A;  2IDO B;  2WS3 A;  4TZ4 C;  4DV7 T;  1FIO A;  4IE6 A;  4X1K E;  3IHR A;  3LDQ B;  3LK3 B;  1YKH B;  5AQN B;  2CMR A;  2BS2 A;  3ZCJ A;  1D0Z A;  2YOE A;  4QKN A;  2LE8 A;  3TLV A;  4A98 A;  3ZEF B;  3D0T A;  2CEA A;  2XAQ B;  4LF6 T;  2MBG A;  3ZPO A;  2H88 A;  2W00 A;  1B7T A;  2W66 A;  1XMQ T;  4LFA T;  2CWY A;  3RIU C;  4TWD A;  5LMN T;  2PBI A;  1MIV A;  2LSY A;  3LJC A;  5F5W A;  4JI1 T;  4IDO A;  4OFZ A;  3K3O A;  3AED A;  4X20 E;  4OYJ A;  1WCR A;  2NR4 A;  1FMW A;  2IML A;  1MIY A;  4HWC A;  3RIU A;  3JAE A;  3CVR A;  4O8S A;  3IEE A;  4DO0 A;  3AEA A;  1M62 A;  3O9X A;  4PFP A;  2KXP B;  2XAS B;  5JDG A;  5FMN A;  4HFE A;  1SJ7 A;  4GKJ T;  2HPJ A;  5BMV E;  4LFB T;  2YDQ A;  5IHY A;  3HI2 A;  4AQF C;  2I59 A;  3C50 A;  3OKQ A;  4V1A v;  5ABE A;  1WYB A;  3U78 A;  5HXC A;  3RHW A;  3KVA A;  4U2Z A;  2Y6X A;  4CXW A;  2CBJ A;  2CHN A;  4ILU A;  3RIF A;  1WYC A;  4J2C A;  5J0Z A;  1XNQ T;  5E0O A;  3WUR A;  2X0L B;  4AQF A;  4ASK A;  1UGO A;  5HEH A;  2BBH A;  3KBT A;  5LCY A;  2VQE T;  2LKH A;  4TUY E;  4F6R C;  1HG5 A;  5L3B B;  2FJA A;  4ZI3 D;  3AA7 B;  1V9D A;  2XQ4 A;  1CUN A;  3UFG A;  3F57 A;  2XUE A;  1KNP A;  2PJQ A;  4O4J E;  3H37 A;  2I0M A;  3E22 E;  5AQU B;  2L7N A;  2XQ9 A;  1T8B A;  4IST A;  3UU5 A;  4GKK T;  1MND A;  4OYK A;  3KFW X;  2ACX A;  4TNV A;  3S4U A;  2AXD S;  1HF8 A;  5J2T E;  1UK5 A;  3OYX A;  4N78 D;  2VQF T;  3N9Q A;  1S94 A;  5LHG B;  1IBL T;  4EZ4 A;  2E9X B;  2BG9 E;  4DVD A;  5GON E;  5HEG A;  4IGU A;  4BJM A;  1HNX T;  4ZI7 E;  1VCT A;  1E1H B;  3F2E A;  3VU7 H;  3QB5 K;  4I0U A;  4AKL A;  3C4W A;  4UIG A;  3SS1 A;  2N1G A;  2J4G A;  3SFE A;  4Z91 A;  3HKC E;  5CA1 E;  3KV4 A;  1SUM B;  4B3T T;  1ZP0 A;  3ZJ2 A;  4U2Y A;  1UUR A;  3R84 B;  2LQU A;  3RKG A;  2XQ8 A;  2NW7 A;  4IL4 A;  2D2S A;  1IBK T;  2E9X C;  3SOL A;  3UU3 A;  3V5U A;  4GYS A;  1OED B;  3OYZ A;  1N36 T;  5FXZ A;  1L0V A;  4PJN A;  3NKZ A;  4ADZ A;  2DL1 A;  4ISS A;  5FYM A;  3FZL B;  3KIN B;  2E9X A;  4H9R C;  2D0U A;  4F7G B;  4CZZ B;  2LOS A;  2CRB A;  2WB5 A;  4WW0 A;  4ILA A;  2BS3 A;  4U33 A;  2UXX B;  1E7P A;  4WBN E;  1GQE A;  3CQX C;  3RI5 A;  2XPK A;  4TN7 B;  3ZCI A;  1XWM A;  2XQY A;  1OED C;  4FI5 A;  4X1Y E;  2JJ9 A;  4KMC A;  3AVR A;  1VCS A;  5F3J A;  1T7S A;  4QH4 A;  2WAU A;  4B3R T;  2WM9 A;  2LHR A;  3EVY A;  3AE5 A;  4IDZ A;  1VOM A;  2W67 A;  3MAC A;  5L4E A;  2EHO D;  4B3S T;  3C4X A;  4XBF B;  4ZXL A;  1XMO T;  3L3P A;  4YSY A;  2XQ7 A;  4C90 A;  4E7Z A;  5HXE A;  2Q9Q D;  3Q5W A;  2FBW A;  2JMK A;  1N33 T;  3MA9 A;  4HE8 A;  2X68 A;  2HN2 A;  3NVO A;  4YSX A;  1M7K A;  2YEV C;  4HKA A;  4JEU B;  3AA6 B;  3EHZ A;  1CHU A;  1XDP A;  1KNZ A;  3K1S A;  4H9P C;  4X66 T;  2IAK A;  3PF0 A;  3GN5 A;  4DR6 T;  4X5T A;  4K0K T;  4JI4 T;  5AQQ B;  1XDO A;  3PV0 F;  3I0Q A;  1IAP A;  4YHJ A;  2VWA A;  3V5S A;  2UUA T;  4LMK A;  5HXS A;  3RYH E;  3P4S A;  3AE8 A;  1YQ3 A;  3ZSS A;  5AQL B;  2L3L A;  5CFB A;  2CHO A;  5LHI B;  2MTC A;  1YXR A;  3RYC E;  3CWZ B;  2WDV A;  4IRE A;  4PK5 A;  2X51 A;  2JIW A;  2IHR 1;  2VVN A;  3HA4 A;  2X67 A;  4PJJ A;  4EED A;  4AIS A;  4YTM A;  4P09 A;  4YHH T;  4A97 A;  5LMU T;  3RH3 A;  2JQH A;  2XHE B;  2E5V A;  4O2B E;  5LGU B;  2CWO A;  3P7I A;  3SWH A;  3VJZ A;  5J1G A;  5FY0 A;  4AI6 A;  2BZB A;  3N9L A;  3NZQ A;  4F8H A;  2K9A A;  3I1A A;  3FXE B;  4NPP A;  4ZZB A;  3HL6 A;  1U5P A;  4IE7 A;  3A5X A;  3JCF A;  3PUX F;  3L8R A;  3NBX X;  2V7K A;  1IZN B;  3ZJ1 A;  5LOV E;  3AVS A;  4UVA B;  5L47 A;  4H9Q C;  4DUZ T;  4QXC B;  4QH5 A;  5DAB A;  5ABG A;  2V7M A;  4H9N C;  4AQG A;  2WWV A;  2XQA A;  2UU9 T;  4ONR A;  4P1N A;  5JH7 E;  2DLR A;  2LSG A;  2R6G F;  4DR4 T;  5H6R B;  3RC8 A;  3FZK B;  4UEM A;  3HKB E;  3NRX A;  4EZH A;  3PU8 A;  3B57 A;  2W61 A;  3KVB A;  4LF7 T;  4OX9 T;  1KF6 A;  5LGT B;  3LFM A;  3ZN1 B;  4DV1 T;  2QVA A;  4HWH A;  2PTF A;  4ZI2 C;  4TV9 E;  1NWM X;  5LG3 A;  4UV8 B;  5L2L A;  2VKD A;  1SJ8 A;  4TNW A;  2YN6 A;  3R6N A;  3ZLI A;  3QB5 A;  3AAE B;  2KVP A;  3CX7 B;  4X65 T;  4WNK A;  4C91 A;  2V6Y B;  2KBB A;  4I43 B;  4AKR B;  2ES0 A;  3FB2 A;  4MFR A;  4ZOL E;  1UX4 A;  4ZI3 C;  2X9Y A;  2J1D G;  3CIR A;  4KUM B;  4MLK A;  5HWY A;  1LRZ A;  4ILC A;  3UU8 A;  1IBM T;  5ABH A;  3PHF 1;  5FXX A;  1QLB A;  2UXN B;  1XNR T;  1WFD A;  3Q9D A;  4QHO A;  1SA0 E;  1WR0 A;  3ZYK A;  2XTL A;  2DNX A;  1KK7 A;  2VL0 A;  1OXZ A;  1YD8 G;  3AA0 B;  3T1H T;  4JI6 T;  3OJA A;  3RX6 A;  4EOZ B;  3Q5X A;  1Y64 B;  5KXJ A;  4YTP A;  2DWK A;  1I94 T;  1G73 A;  4M1P A;  4DV5 T;  1ZV4 X;  4HN9 A;  4NUV A;  1T72 A;  4HFH A;  2V6Y A;  3P4Q A;  2H89 A;  4L0R A;  3C98 B;  5LXT E;  3CML A;  3PUW F;  2C0S A;  2ZM0 A;  1J1J A;  2WU5 A;  3PUV F;  2CCQ A;  1QSD A;  4PJM A;  4BA9 A;  3HKD E;  2XSB A;  1D1C A;  3ABV A;  2QGS A;  3I9Y A;  1JNR A;  3AXJ B;  5EK3 A;  1HNW T;  1UCU A;  3RRC A;  3QOF A;  4DBQ A;  1AJ3 A;  3Q2M A;  3FHN A;  4CXX A;  5AQI B;  2DCF A;  4A56 A;  4YLH A;  2VK9 A;  5KX5 E;  4HWI B;  4QX7 B;  4H63 V;  3BQK A;  1Z8U A;  4G2A A;  3AA1 B;  4QXB B;  2NW9 A;  1KNR A;  1FJG T;  1HS7 A;  2K5B B;  2OV9 A;  1W09 A;  2HH7 A;  5IWA T;  1MNE A;  1UX5 A;  3N9M A;  3LSV A;  3EDV A;  3ZST A;  5AQR B;  5CA0 E;  3TLU A;  1MMN A;  3ZT5 A;  3ZC0 A;  3PUA A;  2HPL A;  2JPF A;  3UFE A;  4CN4 A;  3O4X E;  2BKP A;  1YQ4 A;  1BR0 A;  2P9B A;  2J62 A;  1US7 B;  4IT4 A;  2B76 A;  3RPU A;  2XAH B;  3AXJ A;  4WYV A;  3A8Y C;  4PJL A;  3UUM A;  1D1B A;  3AEF A;  2E2A A;  4HFC A;  2WQY A;  3ZYL A;  5DJQ C;  3TKL B;  3PU3 A;  5T1D A;  3AEB A;  3UU6 A;  1MIW A;  4B6X A;  1Y01 A;  4JBW F;  5FL1 A;  3AE1 A;  4O4L E;  3VKG A;  2KZ7 B;  3P8C D;  4DV2 T;  5JTG A;  3N5L A;  2A3D A;  4CN6 A;  3G06 A;  1J5W A;  5F8P A;  3PUY F;  2KWI B;  2KT9 A;  4I4T E;  2VL8 A;  5LP6 E; 
#chains in the Genus database with same CATH homology
 2D5U A;  2NOX A;  3ZN0 B;  5DQV A;  3ZMV B;  2N9D A;  3N2K E;  4KP3 C;  2G0U A;  3CQC B;  5HYA A;  2Z6E A;  5HXR A;  4L9I A;  5LHI B;  3N9P A;  2MTC A;  3FXD B;  2V1D B;  5ADX L;  2Y48 B;  3RYC E;  3CQG B;  4E7S A;  3CWZ B;  5LBQ B;  1D0X A;  3M1C A;  4PK5 A;  4O4H E;  4TV8 E;  2X51 A;  3W15 B;  2X9X A;  4JEH B;  2YK0 A;  3CX8 B;  2WSS V;  3N2O A;  4PNI A;  5JDL A;  4ZI2 D;  3HA4 A;  4CI2 B;  3FBZ A;  4GIW A;  1OWA A;  2X67 A;  4AKI A;  3VHL A;  1T98 A;  2D0T A;  4PJJ A;  2C5I T;  2YU1 A;  5HAX A;  3JC6 C;  1MMG A;  2JRK A;  2L9Q A;  5LNK A;  4P09 A;  2EHO B;  3MKD A;  4IE5 A;  2CLY B;  5L3C B;  5JVD E;  2GK9 A;  3RH3 A;  2A2F X;  5J2U E;  2Q9Q B;  5JDN A;  3LG7 A;  2XHE B;  4TZ4 C;  1WLX A;  2IC6 A;  1FIO A;  4O2B E;  2CXF A;  4UXN B;  5LGU B;  4IE6 A;  4X1K E;  3IHR A;  2CWO A;  3P7I A;  3UUX B;  4H63 H;  3LK3 B;  4OHF A;  1YKH B;  3SWH A;  3VJZ A;  3EDU A;  3QK6 A;  3F31 A;  3K8P C;  4O4I E;  5J1G A;  1BR4 A;  2C5K T;  2W63 A;  2C5J A;  2X66 A;  5JDQ A;  5L3E B;  2CMR A;  2RA1 A;  1IJ5 A;  5FY0 A;  3ZCJ A;  4AI6 A;  1D0Z A;  1QUU A;  3WAK A;  2BZB A;  2V7J A;  1Z0P A;  4ANJ A;  3QC9 A;  4QKN A;  4QWN B;  2LE8 A;  3BK9 A;  5A1L A;  3AB3 B;  1IJ6 A;  3N9L A;  3NZQ A;  3ZEF B;  3D0T A;  2CEA A;  1U4Q A;  2XAQ B;  2LSK A;  2K48 A;  2K9A A;  3LK2 B;  2MBG A;  3I1A A;  3FXE B;  4DMV A;  4EIW A;  4H9O C;  3ZPO A;  3HL6 A;  1HTJ F;  2SPC A;  1U5P A;  2WMO A;  3ANW B;  4IE7 A;  3BQI A;  3I0O A;  3ZYM A;  5JR9 B;  2W00 A;  1B7T A;  2EHO C;  4YJ2 E;  4IHJ E;  2CWY A;  3A5X A;  2CXD A;  2BVM A;  2X9H A;  4MAL A;  2CLY C;  1D1A A;  5FNV E;  1H7C A;  2PBI A;  1MIV A;  3NBX X;  2Q9Q C;  2LSY A;  2V7K A;  3N9N A;  1IZN B;  3O1H A;  5LOV E;  3ZJ1 A;  3AVS A;  4UVA B;  3LJC A;  4H9Q C;  4PAG A;  2Y8D A;  4Z8X A;  4OFZ A;  3K3O A;  2XAG B;  4X20 E;  4H9S E;  4QXC B;  4OYJ A;  4CI3 B;  2KIN B;  2KMF A;  2WBL A;  3ZMZ B;  1FMW A;  2EHO A;  5DAB A;  4UVC B;  2VKO A;  3PUQ A;  1MIY A;  5LYJ E;  2V7M A;  4H9N C;  4AQG A;  2ZM2 A;  2CM0 A;  3PDY A;  2ODV A;  2KND A;  3QUJ A;  4ONR A;  3NRY A;  2QA7 A;  3PE0 A;  4G63 A;  3CVR A;  4O8S A;  5LHH B;  2Q9Q A;  5JH7 E;  3RYF E;  3IEE A;  4DO0 A;  2DLR A;  3O9X A;  1HX8 A;  2DI4 A;  4PFP A;  2KXP B;  2LSG A;  2OA5 A;  2XAS B;  2LSI A;  5JDG A;  4U72 A;  5JR9 C;  5H6R B;  5FMN A;  3ZMS B;  1HG2 A;  3RC8 A;  2NWB A;  3C64 A;  4OK0 A;  2HPJ A;  4UEM A;  4UV9 B;  5BMV E;  2ZMA A;  5JRC B;  3HKB E;  3NRX A;  4DMW A;  4PW8 A;  5IHY A;  3HI2 A;  4AQF C;  4EZH A;  2I59 A;  3C50 A;  4O2A E;  2E9X D;  3PU8 A;  4ZS3 A;  2LJL A;  3OKQ A;  4V1A v;  5JRE A;  1WYB A;  3B57 A;  4P0A A;  2W61 A;  3U78 A;  4ZS2 A;  5HXC A;  2H7O A;  4UVB B;  3AAI A;  3KVB A;  5L3D B;  3KVA A;  3HR0 A;  5LGT B;  4CXW A;  2Y6X A;  3LFM A;  3ZN1 B;  1NAF A;  2XAF B;  3L09 A;  4HFV A;  4ZI2 C;  1LVF A;  4ILU A;  2LT3 A;  1NWM X;  3ANW A;  2NW8 A;  4TV9 E;  1LVK A;  1WYC A;  2NP9 A;  4UV8 B;  3WI3 A;  4J2C A;  5L2L A;  4AKG A;  2LM9 A;  3ETV A;  5E0O A;  3WUR A;  3RRW A;  2X0L B;  2VKD A;  1D0Y A;  2N2N A;  5HXH A;  4AQF A;  4ASK A;  3EUH A;  3FBL A;  5JQG E;  3R6N A;  3BQL A;  3C4Z A;  3MXZ A;  3ZLI A;  4TX5 A;  3AAE B;  3KBT A;  1LKX A;  3CX7 B;  5LCY A;  1S35 A;  3J9X 1;  4WNK A;  3GWH A;  4TUY E;  4C91 A;  4F6R C;  4I43 B;  2A72 A;  1HG5 A;  4QX8 B;  4AKR B;  5L3B B;  3ZC1 A;  5LBM A;  3PUS A;  4P0B A;  2ES0 A;  3C51 A;  4CI1 B;  3GN5 B;  4ZI3 D;  3FB2 A;  4MFR A;  3B13 A;  4ZOL E;  3AA7 B;  1UX4 A;  5DQW A;  1V9D A;  2W0G A;  1CUN A;  4ZI3 C;  2X9Y A;  2J1D G;  4GK0 E;  2VKH A;  4KUM B;  4MLK A;  5HWY A;  1LRZ A;  2XUE A;  3F57 A;  2PJQ A;  4O4J E;  3U3I A;  3H37 A;  1YKE B;  3E22 E;  3PHF 1;  5FXX A;  2UXN B;  3DTO A;  4UEL A;  4IST A;  1MND A;  4OYK A;  4EYU A;  3KFW X;  2ACX A;  5H6Q B;  2X9W A;  3S4U A;  2LOP A;  5J2T E;  1HF8 A;  3Q9D A;  4QHO A;  5HWX A;  4AXP A;  3KV6 A;  1SA0 E;  2H3R A;  3OYX A;  2H7V C;  4EB6 E;  4N78 D;  2VB6 A;  3N9Q A;  3ZYK A;  1S94 A;  5LHG B;  4ERR A;  2XTL A;  2DNX A;  1KK7 A;  5LGN B;  1OXZ A;  3KDS E;  4HGA A;  1YD8 G;  2E9X B;  4EZ4 A;  2LEH A;  4ZHQ E;  4DVD A;  4HTE A;  3AA0 B;  4AKH A;  2XAJ B;  1X79 A;  5GON E;  5FXW A;  3KBU A;  4GK5 E;  2YIN A;  5EK4 A;  4IGU A;  4IIJ E;  3OJA A;  3RX6 A;  4EOZ B;  3Q5X A;  4BJM A;  5AFU L;  2CA5 A;  1Y64 B;  4ZI7 E;  1E1H B;  3F2E A;  3GMI A;  2DWK A;  3VU7 H;  2DHR A;  5L3F B;  1O3X A;  4AKL A;  5LJM A;  1G73 A;  4M1P A;  1MMA A;  2DWG A;  3C4W A;  1WR6 A;  4UIG A;  1ZV4 X;  2WWU A;  3KV5 A;  4HN9 A;  4XAX B;  3SS1 A;  2N1G A;  3NZP A;  4NUV A;  3LBX B;  3HKC E;  5CA1 E;  1HCI A;  3KV4 A;  2CE7 A;  4YFS A;  4UF0 B;  1FEW A;  3LK4 2;  3UUN A;  2ZLY A;  3ESL A;  3ZJ2 A;  1YW0 A;  4EAH A;  2VKJ A;  4L0R A;  2MTQ A;  1MMD A;  2WMN A;  3C98 B;  3IBP A;  5LXT E;  3CML A;  2C0S A;  2ZM0 A;  2LHN A;  3DJB A;  3SRZ A;  3R84 B;  4KBM B;  2LQU A;  1ZKE A;  2CCQ A;  3WSC A;  2RP4 A;  5EK2 A;  2NW7 A;  2NTY A;  2D2S A;  3PUG A;  2E9X C;  4IE4 A;  5ETW A;  2ODU A;  2IC9 A;  1QSD A;  5FP3 A;  3SOL A;  4PJM A;  4BA9 A;  4YJ3 E;  3V5U A;  3HKD E;  4GYS A;  1D1C A;  2QGS A;  3I9Y A;  4QXH B;  3OYZ A;  5TAO A;  3MJX A;  4GOU A;  1HFA A;  3AT7 A;  4EXT A;  1BR1 A;  5EK3 A;  3O1I A;  5FXZ A;  5JR9 A;  2W62 A;  4WBO A;  2MYS A;  1UCU A;  4MBQ A;  2KLQ A;  2KWH A;  5LG4 A;  3RRC A;  4PJN A;  3OBV E;  4DBQ A;  4ADZ A;  5L3G B;  1AJ3 A;  3Q2M A;  3FHN A;  3ETU A;  4CXX A;  4ISS A;  5FYM A;  3E08 A;  2MOZ A;  2DCF A;  2V7I A;  3KV9 A;  4A56 A;  3ZMT B;  2B1E A;  4YLH A;  2V26 A;  2VK9 A;  4DBR A;  2K24 A;  3KIN B;  2E9X A;  4H9R C;  2D0U A;  4IE0 A;  5JDF A;  5C8Y E;  3JC6 D;  3T8O A;  5KX5 E;  2IW5 B;  3CX6 B;  4QX7 B;  4CZZ B;  1ZHC A;  4EYY R;  4H63 V;  3BQK A;  2BVL A;  1VRB A;  2LOS A;  4JLE A;  4PFO A;  3RC3 A;  5FY7 A;  4HEA A;  4G2A A;  3K3Q C;  3AA1 B;  4WW0 A;  2E8I A;  2VAS A;  2UXX B;  4L5G A;  4WBN E;  4QXB B;  2NW9 A;  3CQX C;  3PTR B;  3GA8 A;  3N9O A;  2M67 A;  3CPZ A;  4BAY B;  1HS7 A;  2K5B B;  1EZ3 A;  4TN7 B;  3ZCI A;  2XQY A;  3UUL A;  3LBX A;  5FXV A;  4FI5 A;  3K3N A;  4X1Y E;  2JJ9 A;  4KMC A;  3AVR A;  1G8X A;  2HH7 A;  4I55 E;  5JDH A;  4DND A;  4UF0 A;  1MNE A;  1UX5 A;  3N9M A;  4BJN A;  3EDV A;  5F3J A;  3N2G E;  3CKD A;  2BDE A;  3HKE E;  2NTX A;  1ZEE A;  3RKO A;  1WRD A;  2WAU A;  5JRC A;  2WM9 A;  5CA0 E;  2PFV A;  2LHR A;  3EVY A;  1MMN A;  1SHZ C;  3ZC0 A;  2LSJ A;  3PUA A;  4IDZ A;  3IF8 B;  3O1J A;  2HPL A;  4U74 A;  2JPF A;  3PUR A;  5FY1 A;  4JUY A;  3UTK A;  4X1I E;  1VOM A;  3UFE A;  4CXY A;  3MAC A;  4MHC A;  3O4X E;  4BGO A;  2EHO D;  3DP7 A;  1BR0 A;  5LJN A;  2P9B A;  3C4X A;  3MK7 C;  4XBF B;  1US7 B;  4PK4 A;  3RPU A;  2XAH B;  3L3P A;  5CB4 E;  5EZY E;  4C90 A;  4E7Z A;  5HXE A;  2Q9Q D;  3Q5W A;  3I9W A;  4ECG A;  4I50 E;  2JMK A;  4K0U A;  5IYZ E;  3UT5 E;  4PJL A;  3WAJ A;  3UUM A;  1D1B A;  5LA6 E;  3RYI E;  3MA9 A;  4HE8 A;  2X68 A;  5KDM C;  3J7Y q;  3ZYL A;  5DJQ C;  3TKL B;  4GYR A;  5KMG P;  2YEV C;  3PU3 A;  5T1D A;  1BR2 A;  4HKA A;  5M4Y A;  1MIW A;  4JEU B;  3ONX A;  4B6X A;  3AAA B;  2ZM8 A;  3AA6 B;  2YU2 A;  3H3A A;  4FJO A;  2L8K A;  4O4L E;  3VKH A;  1KNZ A;  3VKG A;  2KZ7 B;  3P8C D;  3MZK B;  4H9P C;  3E0Z A;  2IAK A;  3PF0 A;  3GN5 A;  3N5L A;  4XZC A;  4CQI A;  2A3D A;  2JQQ A;  2PG8 A;  4PK6 A;  3I0Q A;  1IAP A;  4YHJ A;  3M65 A;  2JMH A;  2V7L A;  2VWA A;  4NUU A;  5F8P A;  3V5S A;  5JDM A;  2CXL A;  5HXS A;  1FMV A;  3RYH E;  2KWI B;  2KT9 A;  3ZMU B;  4I4T E;  2VL8 A;  5LP6 E;  2L3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...