5HWXA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and zero ca2+
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
301
structure length
294
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 126
structure length 294
sequence length 301
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hwxA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hwxA02
5HXHA 5JDMA 5HYAA 5JDHA 5HXEA 5HXSA 5JDLA 5JDFA 5JDQA 5JDNA 3V5SA 5HWYA 5JDGA 5HXRA 5HXCA 3V5UA 5HWXA
chains in the Genus database with same CATH superfamily
3B13A 3E0ZA 2DHRA 5H6RB 4H9PC 4QX7B 2BZBA 1MNDA 2JQHA 2A72A 5LOVE 3FHNA 2YN6A 1UCUA 2WM9A 3AE2A 3CQXC 5DQVA 2WU5A 4H9QC 1OEDC 3N9QA 5ABFB 5IWAT 4JI0T 4HN9A 3WAJA 1S35A 2MBGA 4IE4A 2LLYA 3T1YT 3ZC0A 1EZ3A 2E2AA 1E7PA 3VJZA 1HG5A 2UXCT 1IBKT 2N2NA 4NUVA 2KBBA 3NWIA 1W9RA 4MBQA 2K9AA 2DNXA 3EDVA 2L9QA 5HEOA 3ZPOA 2V7JA 2J1DG 4AXPA 4X1YE 2LRLA 4ISTA 5JREA 3N9PA 2XQ6A 4GKKT 3FBLA 4H9RC 5L3CB 4LF9T 2BDEA 2X67A 4F6RC 5F8PA 2BVLA 4YJ3E 3C4ZA 3N9LA 4LMKA 1OXZA 4HFVA 2WWUA 3ZN1B 3PU3A 5LJMA 4HFBA 2EHOC 4JLEA 1XNQT 5J2TE 4DV3T 3PUYF 5JTGA 3EABA 3P4QA 2NW9A 2XM2A 5FXZA 3VHLA 3AA1B 3OPCA 3RI5A 4OFZA 4H9OC 5L3GB 4MALA 4YLHA 1YQ3A 3SS1A 3R84B 3M3ZB 2YDSA 3UUBA 2JPFA 5FXXA 2DCFA 3RYHE 4U31A 2BBHA 2K5BB 5AQLB 3RRCA 3RYFE 2HH7A 2L8KA 3RQWA 3NZPA 3AE3A 2LT3A 2B1EA 3P4WA 2Y48B 3U3IA 4W8PA 5LBQB 5BMVE 3VR8A 3CMLA 3LSVA 2BG9A 2YINA 5LHGB 2DWKA 2XQAA 2VL0A 3FXDB 3JADA 4U33A 3MACA 1M7KA 2JQKA 4O2AE 4LF7T 4KHPT 4O4JE 1Y01A 5FVLA 3VKHA 2IC6A 2FUPA 4H9NC 2LSIA 4UEMA 2FJBA 4XZCA 3PE0A 5C8YE 4X1KE 2XAGB 3UU5A 2M67A 3UFEA 1D0ZA 3O4XE 1ZHCA 4EAHA 5AQPB 4ZOLE 2JQQA 3CX6B 4QXBB 2R6GF 4EB6E 4X66T 3QB5K 1D0YA 1QUUA 2RPAA 5FZTA 3SFEA 3P7IA 4CN4A 2CXFA 1XMQT 4I50E 2FJAA 4XBFB 3RIUC 4BAYB 2BG9E 2YU2A 1HFAA 5AQMB 3I9WA 1WYBA 3JAEA 4HFDA 3WAKA 5CGMA 3G06A 4TWHA 2G0UA 2ODUA 2VKHA 5HYAA 2CRBA 4UVAB 5HEHA 1MIWA 2XPKA 3P4PA 4IDQA 4HKAA 3N9OA 3L09A 3AEBA 4HFEA 2WDRA 4IE6A 4NUUA 4COFA 1S94A 2MYSA 3L8RA 2Q9QA 2X9HA 3RQUA 2IW5B 2H3RA 1VCSA 3AE5A 3L39A 4CXWA 2BS4A 5L2LA 5HEJA 3CKDA 3ZMSB 1J1JA 5AQFB 5F5WA 3UFGA 1B7TA 5LA6E 4EZ4A 4AQGA 5LXTE 3T8OA 4EYYR 5HCJA 2N1GA 2XQ9A 4DV5T 4KP3C 3M1CA 5FXVA 4JI1T 1J5ET 3Q2MA 2P9BA 1D0XA 3AA7B 5FKYA 3AB3B 3Q5XA 3EHZA 1HS7A 4AQFC 4BGOA 4YXDA 2BS3A 1FMWA 4GOUA 4O4LE 5HAXA 1OEDA 1IJ5A 4WBNE 4O8SA 3MA9A 4YJ2E 4UVBB 4EEBA 4E7SA 4V1Av 4ZI2C 3FZKB 5CA1E 3AEDA 2PTFA 3CWZB 3PUZF 2WMNA 2J62A 3AE9A 3QUJA 3I0QA 4CI2B 2CMRA 4JYAT 2CXLA 2J4GA 4TZ4C 3ONXA 3ZLIA 4QX8B 3KV6A 3Q5EA 4YSYA 4NXMT 2V26A 2CLYB 4JI4T 3PDYA 3P50A 4P0BA 4DMWA 4EZHA 2V8SV 5JDMA 2V1DB 2D2SA 4ASKA 2LSYA 4CN1A 1LVKA 4EXTA 1KFYA 2YDRA 3ONLC 2MTQA 2CBIA 1O3XA 3QNUA 4LF6T 2LE8A 3UUMA 3O9XA 4DUYT 3NZQA 5C3JA 2AXDS 4HWFA 4PFPA 3RX6A 5JR9C 1OEDE 3IHRA 3FZHB 4IT4A 2KWHA 1LKXA 3PUVF 5LGUB 2EHOA 2NTYA 3CK6A 3N9NA 3JC6C 3LK2B 2DWGA 2EHOB 5JDNA 2LKHA 3PF0A 2V6YB 1ZEEA 2LKGA 4LF5T 2WWVA 2KVPA 1KEYA 3JAFA 4LMJA 2XUEA 4X64T 2KWIB 3AEGA 5IHYA 5DABA 1QSDA 1T8BA 5AQHB 2M6IA 2XQ3A 1IJ6A 4PK5A 2FBWA 3MJXA 3AA0B 4AKGA 5H6QB 4JEHB 2HN1A 2E9XD 3IEEA 3TKLB 2UUAT 3OVUA 5HXRA 4AIUA 4DR3T 2IIUA 2CPTA 5JDFA 3LBXB 4X20E 4UV8B 3LJCA 4L0RA 5AQIB 2E9XB 2V7IA 4YY3T 3CX7B 3RHWA 4JI7T 4ZI3D 4CI1B 1YW0A 2X0LB 2KXPB 2X0YA 3AVRA 5HWXA 2V5CA 4QHOA 3C4WA 4K0KT 2V5DA 3PJAA 5ABHA 4ILCA 3MZKB 2D9DA 4KI0F 4UV9B 2HHHT 1YD8G 1MMGA 4JI3T 3ZYMA 4GK5E 3UU3A 2VWAA 2WQYA 3HR0A 1JNZA 1KK7A 4K0UA 1NEKA 3UULA 3BQKA 4OYJA 4DMVA 3TLWA 3HKEE 1LRZA 4ZS3A 2LSJA 2BS2A 2UUBT 3C4XA 2I0MA 1E2AA 5KDMC 4UF0A 2WAUA 4QH5A 3RKOA 3ZT7A 3BK9A 4GYSA 1G8XA 4CZZB 3KFWX 3TLSA 2ACZA 3FXEB 3T1HT 1WRDA 3RIUA 3PUQA 3IBPA 4NIQA 5JDQA 3PV0F 4TWFA 5L3FB 3C98B 2D0UA 3WURA 2L10A 5A1LA 4MFRA 3UU8A 5F3JA 2XSAA 2UXDT 2QGSA 3M65A 3AE6A 5JDGA 4DBQA 3PUWF 3V5SA 2M6BA 4F7GB 4X65T 2ZMAA 2D0TA 4DNDA 3V5UA 2XAFB 3N5LA 2JMKA 3K3NA 3AAEB 4PK6A 3RPUA 3DJBA 3ZSSA 3AXJA 4I43B 3A8YC 2UUCT 3ZYLA 5LMNT 4J2CA 5ADXL 5FY7A 3U78A 4CI3B 1D1AA 2VURA 2YKSA 2YEVC 3CQGB 4OYKA 4IDOA 1YQ4A 3PTRB 3RIAA 1UURA 4UR9A 3S4UA 1QLBA 4ZZBA 3KV9A 3N2KE 2XZEA 5LHIB 3O1IA 2IDOB 2I59A 4AQFA 3OBVE 1U5PA 4IE0A 5CJ5A 3DP7A 5L4HA 3RYIE 1YKEB 2YK0A 3F57A 4OK0A 3UUNA 4AKIA 4DVDA 2WY2A 5AQTB 4X62T 4WW0A 5HCMA 3EVYA 2C5KT 3H3MA 1VRBA 2LSGA 3SRZA 2NOXA 2IAKA 5FP3A 2QA7A 1NAFA 2WSSV 3ZYKA 3UU6A 3UQ7A 3ZMVB 2CCQA 2Y6XA 3L3PA 5FXWA 4YTMA 3NBXX 2ZM8A 4GKJT 2CWOA 5FY1A 1WCRA 1NWMX 2V6XA 2QRXA 4HWDA 2WB5A 4HWHA 5HXCA 1HNXT 3NRXA 2KGXA 1WLXA 2W0GA 2KT9A 4H63V 4TWDA 1XMOT 5JH7E 1AJ3A 3MKDA 3UUXB 5FY0A 4TNVA 4OX9T 5JR9A 2BG9B 4B3ST 3LK3B 4DR5T 4A97A 3ZCIA 4GIWA 4LFAT 1U4QA 4N78D 3ZMTB 1WR6A 2VKDA 3EAMA 4ILBA 2CHNA 3CVRA 2VK9A 1XZYA 2LHNA 4HEAA 3SWHA 3KVAA 5LB7B 5AQOB 2W67A 3WSCA 1KNZA 4ZS2A 2XHEB 2ZM2A 3UTKA 2K48A 4ZI3C 1Z8UA 1HCIA 5EZYE 4YFSA 4UXNB 3UT5E 2W66A 5AQGB 2BBJA 1JNRA 2KZ7B 5EK4A 3AEFA 4TUYE 4KUMB 2KNDA 2WU2A 4JEUB 4JI5T 4LFBT 2JJ9A 1H7CA 2VVSA 5AQRB 3UU4A 3HI2A 3K3OA 4YTNA 4QH1A 2CWYA 2IC9A 2VL8A 3ESLA 4Z8XA 4HFCA 2LJLA 2X0CA 1M62A 5HWYA 4YTPA 4LF8T 2Q9QD 2E5LT 3AY5A 5DQWA 5AQSB 3AE7A 3FZMB 3AE4A 2XASB 3RC3A 1FJGT 1UX5A 5FYMA 2Q9QB 3ZJ2A 2MTCA 2V7LA 3ZSTA 4IGUA 1J5WA 1L0VA 2XQYA 2C0SA 2ODVA 3I0OA 3RYCE 2VKJA 2WS3A 2QYWA 2IMLA 2VVNA 3GWHA 3SFDA 5KX5E 3VKGA 3N2GE 3OYXA 2CXDA 3I9YA 4IDNA 2ES0A 5LHHB 2XTLA 3AA6B 4I4TE 2UU9T 2KSRA 4B6XA 2UXXB 2K24A 5L3BB 1HX8A 4AQYT 4F8HA 2A2FX 5T1DA 3QOFA 4IE7A 1OEDB 1HNWT 4MLKA 4AKHA 2PJQA 5FVKA 4NXNT 3Q5DA 2W00A 4WNKA 2PG8A 5FL0A 4PNIA 4DIDB 4U72A 4E7ZA 5LCYA 5HEUA 4HWIB 4HE8A 4ONRA 3P8CD 3KV5A 5DJQC 5HEGA 4HGAA 5HXHA 2YDQA 5CB4E 5J1GA 2K3WA 2WMOA 4P0AA 4I55E 3HA4A 2DI4A 1N36T 2LEHA 3FYQA 2XQ5A 4HFHA 2DL1A 3PUSA 3QK6A 4KMCA 4A98A 1T72A 4C90A 2ZM0A 5GONE 2EHOD 4B3TT 5JVDE 3GN5A 1SJ7A 4GK0E 4H9SE 3RRWA 2VQFT 3AECA 1MIVA 2Z6EA 3ZT5A 1FEWA 1KNRA 3O1JA 3TLUA 1BR2A 3KINB 4WYVA 4U3CA 2BKPA 1BR4A 5LBMA 3AE1A 4ZZCA 2N9DA 2WZHA 2XQ4A 4L5GA 1N33T 4I0UA 3A7MA 3HKCE 3E08A 2W2UA 2RA1A 4GYRA 5IUXA 1T98A 4IDPA 2UXNB 3KBUA 2WDQA 3H37A 2XAHB 3ZEFB 1UX4A 3KVBA 5LYJE 3LFMA 3AE8A 4EYUA 1W09A 4ILUA 4ERRA 5AQNB 1E1HB 1KNPA 4KHZF 2HPLA 3ZMZB 2J47A 4DR6T 2WCAA 2X9WA 4YHJA 2LM2A 1T7SA 5CA0E 4AKRB 4P1NA 3H3AA 4XAXB 5LGNB 2LOPA 3JCFA 3BQIA 2XY8B 3SOLA 2JMHA 4DV0T 3OTOT 5BR8T 3RIFA 2X51A 2X66A 4DV7T 1BR0A 2XM1A 2DLRA 3X1DA 2H89A 2A9UA 2KMFA 5J0ZA 4IL4A 5LMUT 4EIWA 1R8IA 4YSZA 1N34T 4UF0B 4PJNA 4PJMA 5LG3A 2KLQA 3EDUA 2XAJB 4LMLA 2PBIA 1I94T 3B5MA 4ISSA 3IA3A 2C5JA 5AQUB 4TNWA 3VRBA 3DTOA 4X1IE 4IREA 4CXXA 1ZP0A 2B76A 3NKZA 3PU8A 5ABFA 5FNVE 5ABEA 4EOZB 4WZXA 2SPCA 3FZLB 3OYZA 4DO0A 5CFBA 4LFCT 4ZXLA 4IE5A 5L3EB 2V7MA 3VU7H 4ZI7E 5KXJA 3Q9DA 2ACXA 4QXCB 4QKNA 3AXJB 3PUAA 4IDZA 3LDQB 2IUBA 3LK42 4UIGA 2CLYC 2WDVA 2QVAA 2X0HA 3AEAA 5AQVB 1IBMT 1D1CA 3J7Yq 2LHRA 1IZNB 3AAIA 4DR2T 4O4IE 1Z0PA 1KF6A 4EGWA 2PFVA 2RP4A 2ZLYA 2VB6A 4ZI2D 4DV4T 4JBWF 3PHF1 3PURA 4DV6T 3ONJA 3RKGA 2NWBA 3ABVA 1Y64B 2Y8DA 4TX5A 1IAPA 3RF1A 2XJ7A 2LM9A 3F31A 4PAGA 2LOSA 3P4RA 3FZFB 3ZJ1A 5HXSA 1IBLT 2WP9A 2C5IT 4H63H 4WBOA 1V9DA 5LNKA 4DR7T 1HR0T 2MAWA 3EI0A 5JQGE 3TLVA 4IIJE 4ILAA 3KDSE 1US7B 4Z90A 4DUZT 5JRCA 5ETWA 5JRCB 1GQEA 2V7KA 1SJ8A 3VR9A 4IL9A 1WR0A 2CBJA 4QH4A 2CEAA 1WFDA 5L47A 3AT7A 3JC6D 3ZMUB 5JR9B 1FMVA 4U7YA 3RGLA 2E9XC 2E8IA 4DV2T 1ZV4X 3FBZA 4JI8T 1W0BA 4JI6T 4ECGA 4Q25A 2YU1A 1YXRA 2XAQB 3DYJA 1UGOA 4G2AA 3RC8A 4TV8E 2JRKA 3CQCB 2W63A 2NTXA 4EEDA 2OA5A 4JUYA 3C51A 2W61A 3Q5WA 3QB5A 5HXEA 4JI2T 4KX6A 3PJAJ 1OWAA 2CE7A 2YOEA 4AI6A 3KV4A 3ETUA 4NPPA 3KBTA 4U2ZA 4YSXA 3MXZA 3N2OA 2IHR1 3QC9A 4AKLA 1LVFA 4LF4T 2XQ8A 1VOMA 3RH3A 2JQ9A 4X5TA 3A5XA 1NENA 4PFOA 3HKBE 3RLFF 5FL1A 1XWMA 3O1HA 4P09A 2D5UA 1ZOYA 3NRYA 4TV9E 5AQKB 4QXHB 1W0AA 1N32T 2NR4A 2VASA 1HG2A 3BQLA 2XSBA 3PUGA 4UELA 4DR4T 2H7VC 3K8PC 1UK5A 5L4EA 5LG4A 2NW8A 4FJOA 5LJNA 4B3RT 1SE7A 1CHUA 5JDHA 3NVOA 3FB2A 4U2YA 3N9MA 4ZHQE 1YKHB 2L3LA 3VRAA 4CQIA 2MOZA 4EV6A 3B57A 3K1SA 2HN2A 2X9YA 2MPKA 1WYCA 1X79A 1SHZC 3C50A 3ZC1A 4ANJA 5AQJB 3W15B 5KMGP 2H7OA 4IHJE 3ZKRA 4M1PA 2F4VT 4UVCB 5IYZE 2OV9A 4PW8A 2BVMA 5E0OA 1VCTA 3ZCJA 4FI5A 2LQUA 2VKOA 1HF8A 1HNZT 5LGTB 1MMAA 3D0TA 1FIOA 4OHFA 1DU2A 4BJMA 4HWCA 3GA8A 5JDLA 3IF8B 1MMNA 3AVSA 3UQ4A 5EK2A 1G73A 4U74A 4Z91A 4U7IA 3HKDE 2LRKA 3WI3A 5FMNA 2KINB 2A3DA 3OKQA 1CUNA 4HTEA 3GMIA 3ANWA 3OJAA 3CX8B 2W62A 3ANWB 3GN5B 2CHOA 4AISA 4KBMB 5AQQB 2GK9A 2X68A 2FJEA 5L3DB 3CPZA 5TAOA 3AAAB 1ZKEA 4BA9A 5J2UE 2BG9C 4JV5T 1XDPA 1SUMB 1MMDA 2AE9A 2I6HA 3EUHA 4O4HE 1UUSA 1XDOA 1MIYA 1I6ZA 4QWNB 5LP6E 2OLTA 4ZEYA 2V6YA 4TN7B 3CIRA 4DV1T 2NP9A 3ZN0B 3E22E 4PK4A 3LG7A 4C91A 4CN6A 4ADZA 2X9XA 1HTJF 4B3MT 2UXBT 4YT0A 4HFIA 4DR1T 1MNEA 3HL6A 2FJDA 5M4YA 3ETVA 1BR1A 3P4SA 4PJLA 2VQET 4DBRA 3C64A 3LBXA 2HPJA 4CXYA 2L7NA 2E9XA 1SA0E 5C2TA 5ABGA 1D1BA 3R6NA 2H88A 3ZT6A 4PJJA 2E5VA 2NW7A 2WBLA 3F2EA 2WZIA 3PUXF 2W4XA 2LSKA 2CA5A 4L9IA 3TLTA 3I1AA 4A5XA 1X9BA 2BKNA 2BKOA 2Q9QC 3J9X1 2JIWA 5EK3A 1XNRT 3AEEA 4O2BE 2XQ7A 5AFUL 4G63A 3MK7C 4BJNA 4MHCA 2ZM6T 4YHHT 2CM0A 1HX1B 3K3QC 4A56A
chains in the Genus database with same CATH topology
1O3XA 3B13A 2LE8A 3E0ZA 3UUMA 4WBOA 5DQWA 3O9XA 3NZQA 1V9DA 2DHRA 5LNKA 5H6RB 4H9PC 2XASB 4PFPA 4QX7B 3RC3A 3RX6A 5JR9C 3IHRA 2BZBA 1MNDA 2A72A 5JQGE 5LOVE 2KWHA 4IIJE 1UX5A 5FYMA 1LKXA 2Q9QB 3ZJ2A 3FHNA 3KDSE 1US7B 2MTCA 2V7LA 1UCUA 5JRCA 5ETWA 2EHOA 2NTYA 3N9NA 5LGUB 2WM9A 3JC6C 3LK2B 2DWGA 5JRCB 2EHOB 4IGUA 2V7KA 5JDNA 2XQYA 3PF0A 2CEAA 1ZEEA 3CQXC 5DQVA 2C0SA 2ODVA 3I0OA 4H9QC 3RYCE 3AT7A 2VKJA 3JC6D 3N9QA 4HN9A 3ZMUB 2XUEA 5JR9B 3WAJA 1S35A 1FMVA 2MBGA 2KWIB 4IE4A 3ZC0A 1EZ3A 5IHYA 5DABA 3GWHA 1QSDA 5KX5E 3VKGA 2E9XC 2E8IA 3N2GE 3OYXA 2CXDA 3I9YA 1ZV4X 3VJZA 3FBZA 2ES0A 1HG5A 5LHHB 2XTLA 4ECGA 3AA6B 2N2NA 4I4TE 4B6XA 1IJ6A 2UXXB 4PK5A 4NUVA 3MJXA 3AA0B 4AKGA 2YU1A 5H6QB 2K24A 5L3BB 1HX8A 4JEHB 3IEEA 2E9XD 2XAQB 4G2AA 3RC8A 3TKLB 2A2FX 4MBQA 4TV8E 2JRKA 2K9AA 5T1DA 2DNXA 4IE7A 3CQCB 3EDVA 5HXRA 2L9QA 3ZPOA 2W63A 2NTXA 2V7JA 4MLKA 2J1DG 2OA5A 4JUYA 4X1YE 4AXPA 3C51A 3LBXB 5JDFA 4X20E 4AKHA 2PJQA 4ISTA 4UV8B 2W61A 3LJCA 4L0RA 2W00A 3Q5WA 2E9XB 5HXEA 4WNKA 2PG8A 5JREA 3N9PA 2V7IA 4PNIA 4U72A 3CX7B 1OWAA 2CE7A 4ZI3D 3FBLA 1YW0A 4H9RC 4CI1B 2X0LB 5LCYA 2KXPB 4E7ZA 3AVRA 5HWXA 4QHOA 4AI6A 4HE8A 5L3CB 3C4WA 3P8CD 4ONRA 3KV4A 3KV5A 2BDEA 5DJQC 2X67A 3ETUA 3MZKB 4HGAA 4F6RC 5HXHA 3KBTA 5F8PA 4UV9B 2BVLA 3MXZA 3N2OA 4YJ3E 3C4ZA 3N9LA 1YD8G 5CB4E 3QC9A 4AKLA 5J1GA 1LVFA 1OXZA 1MMGA 2WMOA 4GK5E 4HFVA 3ZYMA 4P0AA 4I55E 2WWUA 3HA4A 3ZN1B 1VOMA 3RH3A 3PU3A 2DI4A 2VWAA 5LJMA 3A5XA 2LEHA 3HR0A 3HKBE 4PFOA 2EHOC 4JLEA 1KK7A 4K0UA 3UULA 3PUSA 3QK6A 3BQKA 4KMCA 4OYJA 4DMVA 3O1HA 5J2TE 3HKEE 4P09A 4C90A 1LRZA 4ZS3A 2ZM0A 2LSJA 5GONE 2D5UA 3C4XA 3NRYA 5KDMC 2EHOD 4TV9E 4QXHB 5JVDE 2NW9A 5FXZA 3GN5A 4UF0A 2VASA 2WAUA 3VHLA 3AA1B 4GK0E 3RKOA 4H9SE 3RRWA 3BK9A 4OFZA 4H9OC 4GYSA 1G8XA 4CZZB 5L3GB 1HG2A 3BQLA 3KFWX 1MIVA 4MALA 2Z6EA 3FXEB 3PUGA 4UELA 4YLHA 3SS1A 1WRDA 3R84B 3PUQA 1FEWA 2H7VC 3K8PC 3IBPA 5JDQA 5LG4A 2NW8A 5L3FB 2JPFA 5FXXA 3C98B 2D0UA 4FJOA 5LJNA 3O1JA 5JDHA 2DCFA 3RYHE 1BR2A 3WURA 2K5BB 3KINB 5A1LA 3RRCA 3FB2A 4MFRA 5F3JA 3RYFE 2HH7A 1BR4A 2L8KA 2QGSA 3N9MA 1YKHB 2L3LA 3NZPA 5LBMA 4CQIA 4ZHQE 2MOZA 2LT3A 2N9DA 2B1EA 3M65A 2Y48B 3U3IA 4L5GA 5JDGA 5LBQB 5BMVE 3CMLA 4DBQA 3V5SA 2YINA 3B57A 3HKCE 3E08A 2RA1A 4GYRA 5LHGB 1T98A 2X9YA 2DWKA 2ZMAA 1WYCA 2D0TA 4DNDA 1X79A 1SHZC 3V5UA 2UXNB 3C50A 3FXDB 3KBUA 2XAFB 3MACA 3ZC1A 3H37A 2XAHB 3N5LA 3ZEFB 4ANJA 1UX4A 2JMKA 4O2AE 3KVBA 5LYJE 3K3NA 3LFMA 4O4JE 3AAEB 4PK6A 3W15B 5KMGP 3VKHA 2IC6A 4EYUA 2H7OA 3RPUA 4IHJE 3DJBA 4H9NC 4I43B 4M1PA 2LSIA 4ILUA 3ZYLA 4J2CA 4ERRA 4UEMA 4UVCB 4XZCA 5ADXL 5IYZE 3PE0A 5FY7A 1E1HB 5C8YE 3U78A 4PW8A 4CI3B 4X1KE 1D1AA 2HPLA 2XAGB 2BVMA 2M67A 2YEVC 3CQGB 4OYKA 5E0OA 3UFEA 3ZMZB 2X9WA 3ZCJA 4FI5A 3PTRB 4YHJA 2LQUA 1D0ZA 2VKOA 3O4XE 1HF8A 5CA0E 5LGTB 1MMAA 1ZHCA 3S4UA 4AKRB 3D0TA 4EAHA 4ZOLE 2JQQA 1FIOA 3KV9A 3CX6B 4QXBB 3N2KE 3H3AA 4OHFA 4XAXB 4EB6E 5LGNB 2LOPA 1D0YA 1QUUA 5LHIB 3P7IA 3BQIA 4BJMA 3O1IA 3GA8A 2I59A 5JDLA 3IF8B 1MMNA 2CXFA 3OBVE 4AQFA 1U5PA 3AVSA 4IE0A 4I50E 3SOLA 3DP7A 5EK2A 3RYIE 4XBFB 1G73A 2JMHA 4U74A 4BAYB 3HKDE 1YKEB 2YK0A 2YU2A 1HFAA 2X51A 3F57A 4OK0A 2X66A 3UUNA 3WI3A 3I9WA 2KINB 5FMNA 1WYBA 1BR0A 4AKIA 2DLRA 3WAKA 4DVDA 2A3DA 3OKQA 1CUNA 4HTEA 4WW0A 3EVYA 2KMFA 2C5KT 3GMIA 1VRBA 2G0UA 3ANWA 4EIWA 2ODUA 3OJAA 3CX8B 2VKHA 2W62A 2LSGA 3ANWB 3GN5B 3SRZA 4KBMB 4UF0B 5HYAA 4UVAB 4PJNA 4PJMA 2NOXA 1MIWA 2GK9A 2X68A 2IAKA 5FP3A 2KLQA 2QA7A 5L3DB 3CPZA 5TAOA 1NAFA 2WSSV 3AAAB 1ZKEA 3ZYKA 4BA9A 4HKAA 3EDUA 5J2UE 3N9OA 3L09A 4IE6A 2XAJB 1MMDA 4NUUA 3EUHA 2PBIA 4ISSA 1S94A 3ZMVB 2MYSA 4O4HE 2CCQA 2Y6XA 3L3PA 5FXWA 2C5JA 3NBXX 1MIYA 2Q9QA 2X9HA 2ZM8A 2IW5B 2CWOA 2H3RA 5FY1A 3DTOA 1NWMX 4QWNB 5LP6E 4X1IE 5HXCA 4CXWA 5L2LA 3CKDA 3ZMSB 3NRXA 1WLXA 2W0GA 2KT9A 4CXXA 4H63V 1B7TA 5LA6E 4TN7B 3PU8A 5JH7E 4EZ4A 5FNVE 1AJ3A 3MKDA 4EOZB 4AQGA 3UUXB 5FY0A 2NP9A 3ZN0B 2SPCA 3E22E 4PK4A 3LG7A 5JR9A 4C91A 5LXTE 4ADZA 3LK3B 3T8OA 3OYZA 4DO0A 2X9XA 4EYYR 1HTJF 4IE5A 3ZCIA 2N1GA 5L3EB 2V7MA 4GIWA 3VU7H 4ZI7E 3Q9DA 1U4QA 4N78D 3ZMTB 1WR6A 2VKDA 4KP3C 3M1CA 5FXVA 3Q2MA 2P9BA 1D0XA 3AA7B 2ACXA 3CVRA 2VK9A 4QXCB 1MNEA 3AB3B 4QKNA 2LHNA 3HL6A 3Q5XA 4HEAA 3SWHA 3KVAA 1HS7A 4AQFC 4BGOA 3PUAA 5M4YA 4IDZA 3ETVA 3WSCA 3LK42 1KNZA 1FMWA 4GOUA 1BR1A 4O4LE 4ZS2A 4UIGA 2CLYC 5HAXA 2XHEB 1IJ5A 4PJLA 2ZM2A 4O8SA 2K48A 3MA9A 3UTKA 4ZI3C 4DBRA 4WBNE 4UVBB 3C64A 3LBXA 2HPJA 4YJ2E 4E7SA 4CXYA 4V1Av 1HCIA 4ZI2C 1D1CA 5EZYE 3J7Yq 2E9XA 4YFSA 4UXNB 2LHRA 1SA0E 5CA1E 3UT5E 1IZNB 3AAIA 1D1BA 3CWZB 4O4IE 3R6NA 1Z0PA 2WMNA 2KZ7B 2PFVA 3QUJA 4PJJA 5EK4A 3I0QA 4CI2B 2CMRA 2NW7A 2RP4A 2ZLYA 2VB6A 4TUYE 2WBLA 4KUMB 3F2EA 2CXLA 4TZ4C 2KNDA 3ONXA 3ZLIA 4QX8B 4ZI2D 2LSKA 4JEUB 2CA5A 3KV6A 4L9IA 2JJ9A 3PHF1 1H7CA 2V26A 2CLYB 3I1AA 3PDYA 3PURA 2NWBA 4P0BA 4DMWA 4EZHA 1Y64B 2Y8DA 2V1DB 2D2SA 2Q9QC 3J9X1 5EK3A 3HI2A 4TX5A 4ASKA 3K3OA 5JDMA 2LSYA 4O2BE 1IAPA 1LVKA 2LM9A 2CWYA 3F31A 5AFUL 2IC9A 4G63A 4EXTA 2VL8A 3ESLA 4PAGA 4Z8XA 2LOSA 3MK7C 2LJLA 4BJNA 4MHCA 3ZJ1A 5HXSA 2C5IT 5HWYA 2CM0A 3K3QC 2MTQA 2Q9QD 4A56A 4H63H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXH A;  5JDM A;  5HYA A;  5JDH A;  5HXE A;  5HXS A;  5JDL A;  5JDF A;  5JDQ A;  5JDN A;  3V5S A;  5HWY A;  5JDG A;  5HXR A;  5HXC A;  3V5U A;  5HWX A; 
#chains in the Genus database with same CATH topology
 3B13 A;  3E0Z A;  2DHR A;  5H6R B;  4H9P C;  4QX7 B;  2BZB A;  1MND A;  2JQH A;  2A72 A;  5LOV E;  3FHN A;  2YN6 A;  1UCU A;  2WM9 A;  3AE2 A;  3CQX C;  5DQV A;  2WU5 A;  4H9Q C;  1OED C;  3N9Q A;  5ABF B;  5IWA T;  4JI0 T;  4HN9 A;  3WAJ A;  1S35 A;  2MBG A;  4IE4 A;  2LLY A;  3T1Y T;  3ZC0 A;  1EZ3 A;  2E2A A;  1E7P A;  3VJZ A;  1HG5 A;  2UXC T;  1IBK T;  2N2N A;  4NUV A;  2KBB A;  3NWI A;  1W9R A;  4MBQ A;  2K9A A;  2DNX A;  3EDV A;  2L9Q A;  5HEO A;  3ZPO A;  2V7J A;  2J1D G;  4AXP A;  4X1Y E;  2LRL A;  4IST A;  5JRE A;  3N9P A;  2XQ6 A;  4GKK T;  3FBL A;  4H9R C;  5L3C B;  4LF9 T;  2BDE A;  2X67 A;  4F6R C;  5F8P A;  2BVL A;  4YJ3 E;  3C4Z A;  3N9L A;  4LMK A;  1OXZ A;  4HFV A;  2WWU A;  3ZN1 B;  3PU3 A;  5LJM A;  4HFB A;  2EHO C;  4JLE A;  1XNQ T;  5J2T E;  4DV3 T;  3PUY F;  5JTG A;  3EAB A;  3P4Q A;  2NW9 A;  2XM2 A;  5FXZ A;  3VHL A;  3AA1 B;  3OPC A;  3RI5 A;  4OFZ A;  4H9O C;  5L3G B;  4MAL A;  4YLH A;  1YQ3 A;  3SS1 A;  3R84 B;  3M3Z B;  2YDS A;  3UUB A;  2JPF A;  5FXX A;  2DCF A;  3RYH E;  4U31 A;  2BBH A;  2K5B B;  5AQL B;  3RRC A;  3RYF E;  2HH7 A;  2L8K A;  3RQW A;  3NZP A;  3AE3 A;  2LT3 A;  2B1E A;  3P4W A;  2Y48 B;  3U3I A;  4W8P A;  5LBQ B;  5BMV E;  3VR8 A;  3CML A;  3LSV A;  2BG9 A;  2YIN A;  5LHG B;  2DWK A;  2XQA A;  2VL0 A;  3FXD B;  3JAD A;  4U33 A;  3MAC A;  1M7K A;  2JQK A;  4O2A E;  4LF7 T;  4KHP T;  4O4J E;  1Y01 A;  5FVL A;  3VKH A;  2IC6 A;  2FUP A;  4H9N C;  2LSI A;  4UEM A;  2FJB A;  4XZC A;  3PE0 A;  5C8Y E;  4X1K E;  2XAG B;  3UU5 A;  2M67 A;  3UFE A;  1D0Z A;  3O4X E;  1ZHC A;  4EAH A;  5AQP B;  4ZOL E;  2JQQ A;  3CX6 B;  4QXB B;  2R6G F;  4EB6 E;  4X66 T;  3QB5 K;  1D0Y A;  1QUU A;  2RPA A;  5FZT A;  3SFE A;  3P7I A;  4CN4 A;  2CXF A;  1XMQ T;  4I50 E;  2FJA A;  4XBF B;  3RIU C;  4BAY B;  2BG9 E;  2YU2 A;  1HFA A;  5AQM B;  3I9W A;  1WYB A;  3JAE A;  4HFD A;  3WAK A;  5CGM A;  3G06 A;  4TWH A;  2G0U A;  2ODU A;  2VKH A;  5HYA A;  2CRB A;  4UVA B;  5HEH A;  1MIW A;  2XPK A;  3P4P A;  4IDQ A;  4HKA A;  3N9O A;  3L09 A;  3AEB A;  4HFE A;  2WDR A;  4IE6 A;  4NUU A;  4COF A;  1S94 A;  2MYS A;  3L8R A;  2Q9Q A;  2X9H A;  3RQU A;  2IW5 B;  2H3R A;  1VCS A;  3AE5 A;  3L39 A;  4CXW A;  2BS4 A;  5L2L A;  5HEJ A;  3CKD A;  3ZMS B;  1J1J A;  5AQF B;  5F5W A;  3UFG A;  1B7T A;  5LA6 E;  4EZ4 A;  4AQG A;  5LXT E;  3T8O A;  4EYY R;  5HCJ A;  2N1G A;  2XQ9 A;  4DV5 T;  4KP3 C;  3M1C A;  5FXV A;  4JI1 T;  1J5E T;  3Q2M A;  2P9B A;  1D0X A;  3AA7 B;  5FKY A;  3AB3 B;  3Q5X A;  3EHZ A;  1HS7 A;  4AQF C;  4BGO A;  4YXD A;  2BS3 A;  1FMW A;  4GOU A;  4O4L E;  5HAX A;  1OED A;  1IJ5 A;  4WBN E;  4O8S A;  3MA9 A;  4YJ2 E;  4UVB B;  4EEB A;  4E7S A;  4V1A v;  4ZI2 C;  3FZK B;  5CA1 E;  3AED A;  2PTF A;  3CWZ B;  3PUZ F;  2WMN A;  2J62 A;  3AE9 A;  3QUJ A;  3I0Q A;  4CI2 B;  2CMR A;  4JYA T;  2CXL A;  2J4G A;  4TZ4 C;  3ONX A;  3ZLI A;  4QX8 B;  3KV6 A;  3Q5E A;  4YSY A;  4NXM T;  2V26 A;  2CLY B;  4JI4 T;  3PDY A;  3P50 A;  4P0B A;  4DMW A;  4EZH A;  2V8S V;  5JDM A;  2V1D B;  2D2S A;  4ASK A;  2LSY A;  4CN1 A;  1LVK A;  4EXT A;  1KFY A;  2YDR A;  3ONL C;  2MTQ A;  2CBI A;  1O3X A;  3QNU A;  4LF6 T;  2LE8 A;  3UUM A;  3O9X A;  4DUY T;  3NZQ A;  5C3J A;  2AXD S;  4HWF A;  4PFP A;  3RX6 A;  5JR9 C;  1OED E;  3IHR A;  3FZH B;  4IT4 A;  2KWH A;  1LKX A;  3PUV F;  5LGU B;  2EHO A;  2NTY A;  3CK6 A;  3N9N A;  3JC6 C;  3LK2 B;  2DWG A;  2EHO B;  5JDN A;  2LKH A;  3PF0 A;  2V6Y B;  1ZEE A;  2LKG A;  4LF5 T;  2WWV A;  2KVP A;  1KEY A;  3JAF A;  4LMJ A;  2XUE A;  4X64 T;  2KWI B;  3AEG A;  5IHY A;  5DAB A;  1QSD A;  1T8B A;  5AQH B;  2M6I A;  2XQ3 A;  1IJ6 A;  4PK5 A;  2FBW A;  3MJX A;  3AA0 B;  4AKG A;  5H6Q B;  4JEH B;  2HN1 A;  2E9X D;  3IEE A;  3TKL B;  2UUA T;  3OVU A;  5HXR A;  4AIU A;  4DR3 T;  2IIU A;  2CPT A;  5JDF A;  3LBX B;  4X20 E;  4UV8 B;  3LJC A;  4L0R A;  5AQI B;  2E9X B;  2V7I A;  4YY3 T;  3CX7 B;  3RHW A;  4JI7 T;  4ZI3 D;  4CI1 B;  1YW0 A;  2X0L B;  2KXP B;  2X0Y A;  3AVR A;  5HWX A;  2V5C A;  4QHO A;  3C4W A;  4K0K T;  2V5D A;  3PJA A;  5ABH A;  4ILC A;  3MZK B;  2D9D A;  4KI0 F;  4UV9 B;  2HHH T;  1YD8 G;  1MMG A;  4JI3 T;  3ZYM A;  4GK5 E;  3UU3 A;  2VWA A;  2WQY A;  3HR0 A;  1JNZ A;  1KK7 A;  4K0U A;  1NEK A;  3UUL A;  3BQK A;  4OYJ A;  4DMV A;  3TLW A;  3HKE E;  1LRZ A;  4ZS3 A;  2LSJ A;  2BS2 A;  2UUB T;  3C4X A;  2I0M A;  1E2A A;  5KDM C;  4UF0 A;  2WAU A;  4QH5 A;  3RKO A;  3ZT7 A;  3BK9 A;  4GYS A;  1G8X A;  4CZZ B;  3KFW X;  3TLS A;  2ACZ A;  3FXE B;  3T1H T;  1WRD A;  3RIU A;  3PUQ A;  3IBP A;  4NIQ A;  5JDQ A;  3PV0 F;  4TWF A;  5L3F B;  3C98 B;  2D0U A;  3WUR A;  2L10 A;  5A1L A;  4MFR A;  3UU8 A;  5F3J A;  2XSA A;  2UXD T;  2QGS A;  3M65 A;  3AE6 A;  5JDG A;  4DBQ A;  3PUW F;  3V5S A;  2M6B A;  4F7G B;  4X65 T;  2ZMA A;  2D0T A;  4DND A;  3V5U A;  2XAF B;  3N5L A;  2JMK A;  3K3N A;  3AAE B;  4PK6 A;  3RPU A;  3DJB A;  3ZSS A;  3AXJ A;  4I43 B;  3A8Y C;  2UUC T;  3ZYL A;  5LMN T;  4J2C A;  5ADX L;  5FY7 A;  3U78 A;  4CI3 B;  1D1A A;  2VUR A;  2YKS A;  2YEV C;  3CQG B;  4OYK A;  4IDO A;  1YQ4 A;  3PTR B;  3RIA A;  1UUR A;  4UR9 A;  3S4U A;  1QLB A;  4ZZB A;  3KV9 A;  3N2K E;  2XZE A;  5LHI B;  3O1I A;  2IDO B;  2I59 A;  4AQF A;  3OBV E;  1U5P A;  4IE0 A;  5CJ5 A;  3DP7 A;  5L4H A;  3RYI E;  1YKE B;  2YK0 A;  3F57 A;  4OK0 A;  3UUN A;  4AKI A;  4DVD A;  2WY2 A;  5AQT B;  4X62 T;  4WW0 A;  5HCM A;  3EVY A;  2C5K T;  3H3M A;  1VRB A;  2LSG A;  3SRZ A;  2NOX A;  2IAK A;  5FP3 A;  2QA7 A;  1NAF A;  2WSS V;  3ZYK A;  3UU6 A;  3UQ7 A;  3ZMV B;  2CCQ A;  2Y6X A;  3L3P A;  5FXW A;  4YTM A;  3NBX X;  2ZM8 A;  4GKJ T;  2CWO A;  5FY1 A;  1WCR A;  1NWM X;  2V6X A;  2QRX A;  4HWD A;  2WB5 A;  4HWH A;  5HXC A;  1HNX T;  3NRX A;  2KGX A;  1WLX A;  2W0G A;  2KT9 A;  4H63 V;  4TWD A;  1XMO T;  5JH7 E;  1AJ3 A;  3MKD A;  3UUX B;  5FY0 A;  4TNV A;  4OX9 T;  5JR9 A;  2BG9 B;  4B3S T;  3LK3 B;  4DR5 T;  4A97 A;  3ZCI A;  4GIW A;  4LFA T;  1U4Q A;  4N78 D;  3ZMT B;  1WR6 A;  2VKD A;  3EAM A;  4ILB A;  2CHN A;  3CVR A;  2VK9 A;  1XZY A;  2LHN A;  4HEA A;  3SWH A;  3KVA A;  5LB7 B;  5AQO B;  2W67 A;  3WSC A;  1KNZ A;  4ZS2 A;  2XHE B;  2ZM2 A;  3UTK A;  2K48 A;  4ZI3 C;  1Z8U A;  1HCI A;  5EZY E;  4YFS A;  4UXN B;  3UT5 E;  2W66 A;  5AQG B;  2BBJ A;  1JNR A;  2KZ7 B;  5EK4 A;  3AEF A;  4TUY E;  4KUM B;  2KND A;  2WU2 A;  4JEU B;  4JI5 T;  4LFB T;  2JJ9 A;  1H7C A;  2VVS A;  5AQR B;  3UU4 A;  3HI2 A;  3K3O A;  4YTN A;  4QH1 A;  2CWY A;  2IC9 A;  2VL8 A;  3ESL A;  4Z8X A;  4HFC A;  2LJL A;  2X0C A;  1M62 A;  5HWY A;  4YTP A;  4LF8 T;  2Q9Q D;  2E5L T;  3AY5 A;  5DQW A;  5AQS B;  3AE7 A;  3FZM B;  3AE4 A;  2XAS B;  3RC3 A;  1FJG T;  1UX5 A;  5FYM A;  2Q9Q B;  3ZJ2 A;  2MTC A;  2V7L A;  3ZST A;  4IGU A;  1J5W A;  1L0V A;  2XQY A;  2C0S A;  2ODV A;  3I0O A;  3RYC E;  2VKJ A;  2WS3 A;  2QYW A;  2IML A;  2VVN A;  3GWH A;  3SFD A;  5KX5 E;  3VKG A;  3N2G E;  3OYX A;  2CXD A;  3I9Y A;  4IDN A;  2ES0 A;  5LHH B;  2XTL A;  3AA6 B;  4I4T E;  2UU9 T;  2KSR A;  4B6X A;  2UXX B;  2K24 A;  5L3B B;  1HX8 A;  4AQY T;  4F8H A;  2A2F X;  5T1D A;  3QOF A;  4IE7 A;  1OED B;  1HNW T;  4MLK A;  4AKH A;  2PJQ A;  5FVK A;  4NXN T;  3Q5D A;  2W00 A;  4WNK A;  2PG8 A;  5FL0 A;  4PNI A;  4DID B;  4U72 A;  4E7Z A;  5LCY A;  5HEU A;  4HWI B;  4HE8 A;  4ONR A;  3P8C D;  3KV5 A;  5DJQ C;  5HEG A;  4HGA A;  5HXH A;  2YDQ A;  5CB4 E;  5J1G A;  2K3W A;  2WMO A;  4P0A A;  4I55 E;  3HA4 A;  2DI4 A;  1N36 T;  2LEH A;  3FYQ A;  2XQ5 A;  4HFH A;  2DL1 A;  3PUS A;  3QK6 A;  4KMC A;  4A98 A;  1T72 A;  4C90 A;  2ZM0 A;  5GON E;  2EHO D;  4B3T T;  5JVD E;  3GN5 A;  1SJ7 A;  4GK0 E;  4H9S E;  3RRW A;  2VQF T;  3AEC A;  1MIV A;  2Z6E A;  3ZT5 A;  1FEW A;  1KNR A;  3O1J A;  3TLU A;  1BR2 A;  3KIN B;  4WYV A;  4U3C A;  2BKP A;  1BR4 A;  5LBM A;  3AE1 A;  4ZZC A;  2N9D A;  2WZH A;  2XQ4 A;  4L5G A;  1N33 T;  4I0U A;  3A7M A;  3HKC E;  3E08 A;  2W2U A;  2RA1 A;  4GYR A;  5IUX A;  1T98 A;  4IDP A;  2UXN B;  3KBU A;  2WDQ A;  3H37 A;  2XAH B;  3ZEF B;  1UX4 A;  3KVB A;  5LYJ E;  3LFM A;  3AE8 A;  4EYU A;  1W09 A;  4ILU A;  4ERR A;  5AQN B;  1E1H B;  1KNP A;  4KHZ F;  2HPL A;  3ZMZ B;  2J47 A;  4DR6 T;  2WCA A;  2X9W A;  4YHJ A;  2LM2 A;  1T7S A;  5CA0 E;  4AKR B;  4P1N A;  3H3A A;  4XAX B;  5LGN B;  2LOP A;  3JCF A;  3BQI A;  2XY8 B;  3SOL A;  2JMH A;  4DV0 T;  3OTO T;  5BR8 T;  3RIF A;  2X51 A;  2X66 A;  4DV7 T;  1BR0 A;  2XM1 A;  2DLR A;  3X1D A;  2H89 A;  2A9U A;  2KMF A;  5J0Z A;  4IL4 A;  5LMU T;  4EIW A;  1R8I A;  4YSZ A;  1N34 T;  4UF0 B;  4PJN A;  4PJM A;  5LG3 A;  2KLQ A;  3EDU A;  2XAJ B;  4LML A;  2PBI A;  1I94 T;  3B5M A;  4ISS A;  3IA3 A;  2C5J A;  5AQU B;  4TNW A;  3VRB A;  3DTO A;  4X1I E;  4IRE A;  4CXX A;  1ZP0 A;  2B76 A;  3NKZ A;  3PU8 A;  5ABF A;  5FNV E;  5ABE A;  4EOZ B;  4WZX A;  2SPC A;  3FZL B;  3OYZ A;  4DO0 A;  5CFB A;  4LFC T;  4ZXL A;  4IE5 A;  5L3E B;  2V7M A;  3VU7 H;  4ZI7 E;  5KXJ A;  3Q9D A;  2ACX A;  4QXC B;  4QKN A;  3AXJ B;  3PUA A;  4IDZ A;  3LDQ B;  2IUB A;  3LK4 2;  4UIG A;  2CLY C;  2WDV A;  2QVA A;  2X0H A;  3AEA A;  5AQV B;  1IBM T;  1D1C A;  3J7Y q;  2LHR A;  1IZN B;  3AAI A;  4DR2 T;  4O4I E;  1Z0P A;  1KF6 A;  4EGW A;  2PFV A;  2RP4 A;  2ZLY A;  2VB6 A;  4ZI2 D;  4DV4 T;  4JBW F;  3PHF 1;  3PUR A;  4DV6 T;  3ONJ A;  3RKG A;  2NWB A;  3ABV A;  1Y64 B;  2Y8D A;  4TX5 A;  1IAP A;  3RF1 A;  2XJ7 A;  2LM9 A;  3F31 A;  4PAG A;  2LOS A;  3P4R A;  3FZF B;  3ZJ1 A;  5HXS A;  1IBL T;  2WP9 A;  2C5I T;  4H63 H;  4WBO A;  1V9D A;  5LNK A;  4DR7 T;  1HR0 T;  2MAW A;  3EI0 A;  5JQG E;  3TLV A;  4IIJ E;  4ILA A;  3KDS E;  1US7 B;  4Z90 A;  4DUZ T;  5JRC A;  5ETW A;  5JRC B;  1GQE A;  2V7K A;  1SJ8 A;  3VR9 A;  4IL9 A;  1WR0 A;  2CBJ A;  4QH4 A;  2CEA A;  1WFD A;  5L47 A;  3AT7 A;  3JC6 D;  3ZMU B;  5JR9 B;  1FMV A;  4U7Y A;  3RGL A;  2E9X C;  2E8I A;  4DV2 T;  1ZV4 X;  3FBZ A;  4JI8 T;  1W0B A;  4JI6 T;  4ECG A;  4Q25 A;  2YU1 A;  1YXR A;  2XAQ B;  3DYJ A;  1UGO A;  4G2A A;  3RC8 A;  4TV8 E;  2JRK A;  3CQC B;  2W63 A;  2NTX A;  4EED A;  2OA5 A;  4JUY A;  3C51 A;  2W61 A;  3Q5W A;  3QB5 A;  5HXE A;  4JI2 T;  4KX6 A;  3PJA J;  1OWA A;  2CE7 A;  2YOE A;  4AI6 A;  3KV4 A;  3ETU A;  4NPP A;  3KBT A;  4U2Z A;  4YSX A;  3MXZ A;  3N2O A;  2IHR 1;  3QC9 A;  4AKL A;  1LVF A;  4LF4 T;  2XQ8 A;  1VOM A;  3RH3 A;  2JQ9 A;  4X5T A;  3A5X A;  1NEN A;  4PFO A;  3HKB E;  3RLF F;  5FL1 A;  1XWM A;  3O1H A;  4P09 A;  2D5U A;  1ZOY A;  3NRY A;  4TV9 E;  5AQK B;  4QXH B;  1W0A A;  1N32 T;  2NR4 A;  2VAS A;  1HG2 A;  3BQL A;  2XSB A;  3PUG A;  4UEL A;  4DR4 T;  2H7V C;  3K8P C;  1UK5 A;  5L4E A;  5LG4 A;  2NW8 A;  4FJO A;  5LJN A;  4B3R T;  1SE7 A;  1CHU A;  5JDH A;  3NVO A;  3FB2 A;  4U2Y A;  3N9M A;  4ZHQ E;  1YKH B;  2L3L A;  3VRA A;  4CQI A;  2MOZ A;  4EV6 A;  3B57 A;  3K1S A;  2HN2 A;  2X9Y A;  2MPK A;  1WYC A;  1X79 A;  1SHZ C;  3C50 A;  3ZC1 A;  4ANJ A;  5AQJ B;  3W15 B;  5KMG P;  2H7O A;  4IHJ E;  3ZKR A;  4M1P A;  2F4V T;  4UVC B;  5IYZ E;  2OV9 A;  4PW8 A;  2BVM A;  5E0O A;  1VCT A;  3ZCJ A;  4FI5 A;  2LQU A;  2VKO A;  1HF8 A;  1HNZ T;  5LGT B;  1MMA A;  3D0T A;  1FIO A;  4OHF A;  1DU2 A;  4BJM A;  4HWC A;  3GA8 A;  5JDL A;  3IF8 B;  1MMN A;  3AVS A;  3UQ4 A;  5EK2 A;  1G73 A;  4U74 A;  4Z91 A;  4U7I A;  3HKD E;  2LRK A;  3WI3 A;  5FMN A;  2KIN B;  2A3D A;  3OKQ A;  1CUN A;  4HTE A;  3GMI A;  3ANW A;  3OJA A;  3CX8 B;  2W62 A;  3ANW B;  3GN5 B;  2CHO A;  4AIS A;  4KBM B;  5AQQ B;  2GK9 A;  2X68 A;  2FJE A;  5L3D B;  3CPZ A;  5TAO A;  3AAA B;  1ZKE A;  4BA9 A;  5J2U E;  2BG9 C;  4JV5 T;  1XDP A;  1SUM B;  1MMD A;  2AE9 A;  2I6H A;  3EUH A;  4O4H E;  1UUS A;  1XDO A;  1MIY A;  1I6Z A;  4QWN B;  5LP6 E;  2OLT A;  4ZEY A;  2V6Y A;  4TN7 B;  3CIR A;  4DV1 T;  2NP9 A;  3ZN0 B;  3E22 E;  4PK4 A;  3LG7 A;  4C91 A;  4CN6 A;  4ADZ A;  2X9X A;  1HTJ F;  4B3M T;  2UXB T;  4YT0 A;  4HFI A;  4DR1 T;  1MNE A;  3HL6 A;  2FJD A;  5M4Y A;  3ETV A;  1BR1 A;  3P4S A;  4PJL A;  2VQE T;  4DBR A;  3C64 A;  3LBX A;  2HPJ A;  4CXY A;  2L7N A;  2E9X A;  1SA0 E;  5C2T A;  5ABG A;  1D1B A;  3R6N A;  2H88 A;  3ZT6 A;  4PJJ A;  2E5V A;  2NW7 A;  2WBL A;  3F2E A;  2WZI A;  3PUX F;  2W4X A;  2LSK A;  2CA5 A;  4L9I A;  3TLT A;  3I1A A;  4A5X A;  1X9B A;  2BKN A;  2BKO A;  2Q9Q C;  3J9X 1;  2JIW A;  5EK3 A;  1XNR T;  3AEE A;  4O2B E;  2XQ7 A;  5AFU L;  4G63 A;  3MK7 C;  4BJN A;  4MHC A;  2ZM6 T;  4YHH T;  2CM0 A;  1HX1 B;  3K3Q C;  4A56 A; 
#chains in the Genus database with same CATH homology
 1O3X A;  3B13 A;  2LE8 A;  3E0Z A;  3UUM A;  4WBO A;  5DQW A;  3O9X A;  3NZQ A;  1V9D A;  2DHR A;  5LNK A;  5H6R B;  4H9P C;  2XAS B;  4PFP A;  4QX7 B;  3RC3 A;  3RX6 A;  5JR9 C;  3IHR A;  2BZB A;  1MND A;  2A72 A;  5JQG E;  5LOV E;  2KWH A;  4IIJ E;  1UX5 A;  5FYM A;  1LKX A;  2Q9Q B;  3ZJ2 A;  3FHN A;  3KDS E;  1US7 B;  2MTC A;  2V7L A;  1UCU A;  5JRC A;  5ETW A;  2EHO A;  2NTY A;  3N9N A;  5LGU B;  2WM9 A;  3JC6 C;  3LK2 B;  2DWG A;  5JRC B;  2EHO B;  4IGU A;  2V7K A;  5JDN A;  2XQY A;  3PF0 A;  2CEA A;  1ZEE A;  3CQX C;  5DQV A;  2C0S A;  2ODV A;  3I0O A;  4H9Q C;  3RYC E;  3AT7 A;  2VKJ A;  3JC6 D;  3N9Q A;  4HN9 A;  3ZMU B;  2XUE A;  5JR9 B;  3WAJ A;  1S35 A;  1FMV A;  2MBG A;  2KWI B;  4IE4 A;  3ZC0 A;  1EZ3 A;  5IHY A;  5DAB A;  3GWH A;  1QSD A;  5KX5 E;  3VKG A;  2E9X C;  2E8I A;  3N2G E;  3OYX A;  2CXD A;  3I9Y A;  1ZV4 X;  3VJZ A;  3FBZ A;  2ES0 A;  1HG5 A;  5LHH B;  2XTL A;  4ECG A;  3AA6 B;  2N2N A;  4I4T E;  4B6X A;  1IJ6 A;  2UXX B;  4PK5 A;  4NUV A;  3MJX A;  3AA0 B;  4AKG A;  2YU1 A;  5H6Q B;  2K24 A;  5L3B B;  1HX8 A;  4JEH B;  3IEE A;  2E9X D;  2XAQ B;  4G2A A;  3RC8 A;  3TKL B;  2A2F X;  4MBQ A;  4TV8 E;  2JRK A;  2K9A A;  5T1D A;  2DNX A;  4IE7 A;  3CQC B;  3EDV A;  5HXR A;  2L9Q A;  3ZPO A;  2W63 A;  2NTX A;  2V7J A;  4MLK A;  2J1D G;  2OA5 A;  4JUY A;  4X1Y E;  4AXP A;  3C51 A;  3LBX B;  5JDF A;  4X20 E;  4AKH A;  2PJQ A;  4IST A;  4UV8 B;  2W61 A;  3LJC A;  4L0R A;  2W00 A;  3Q5W A;  2E9X B;  5HXE A;  4WNK A;  2PG8 A;  5JRE A;  3N9P A;  2V7I A;  4PNI A;  4U72 A;  3CX7 B;  1OWA A;  2CE7 A;  4ZI3 D;  3FBL A;  1YW0 A;  4H9R C;  4CI1 B;  2X0L B;  5LCY A;  2KXP B;  4E7Z A;  3AVR A;  5HWX A;  4QHO A;  4AI6 A;  4HE8 A;  5L3C B;  3C4W A;  3P8C D;  4ONR A;  3KV4 A;  3KV5 A;  2BDE A;  5DJQ C;  2X67 A;  3ETU A;  3MZK B;  4HGA A;  4F6R C;  5HXH A;  3KBT A;  5F8P A;  4UV9 B;  2BVL A;  3MXZ A;  3N2O A;  4YJ3 E;  3C4Z A;  3N9L A;  1YD8 G;  5CB4 E;  3QC9 A;  4AKL A;  5J1G A;  1LVF A;  1OXZ A;  1MMG A;  2WMO A;  4GK5 E;  4HFV A;  3ZYM A;  4P0A A;  4I55 E;  2WWU A;  3HA4 A;  3ZN1 B;  1VOM A;  3RH3 A;  3PU3 A;  2DI4 A;  2VWA A;  5LJM A;  3A5X A;  2LEH A;  3HR0 A;  3HKB E;  4PFO A;  2EHO C;  4JLE A;  1KK7 A;  4K0U A;  3UUL A;  3PUS A;  3QK6 A;  3BQK A;  4KMC A;  4OYJ A;  4DMV A;  3O1H A;  5J2T E;  3HKE E;  4P09 A;  4C90 A;  1LRZ A;  4ZS3 A;  2ZM0 A;  2LSJ A;  5GON E;  2D5U A;  3C4X A;  3NRY A;  5KDM C;  2EHO D;  4TV9 E;  4QXH B;  5JVD E;  2NW9 A;  5FXZ A;  3GN5 A;  4UF0 A;  2VAS A;  2WAU A;  3VHL A;  3AA1 B;  4GK0 E;  3RKO A;  4H9S E;  3RRW A;  3BK9 A;  4OFZ A;  4H9O C;  4GYS A;  1G8X A;  4CZZ B;  5L3G B;  1HG2 A;  3BQL A;  3KFW X;  1MIV A;  4MAL A;  2Z6E A;  3FXE B;  3PUG A;  4UEL A;  4YLH A;  3SS1 A;  1WRD A;  3R84 B;  3PUQ A;  1FEW A;  2H7V C;  3K8P C;  3IBP A;  5JDQ A;  5LG4 A;  2NW8 A;  5L3F B;  2JPF A;  5FXX A;  3C98 B;  2D0U A;  4FJO A;  5LJN A;  3O1J A;  5JDH A;  2DCF A;  3RYH E;  1BR2 A;  3WUR A;  2K5B B;  3KIN B;  5A1L A;  3RRC A;  3FB2 A;  4MFR A;  5F3J A;  3RYF E;  2HH7 A;  1BR4 A;  2L8K A;  2QGS A;  3N9M A;  1YKH B;  2L3L A;  3NZP A;  5LBM A;  4CQI A;  4ZHQ E;  2MOZ A;  2LT3 A;  2N9D A;  2B1E A;  3M65 A;  2Y48 B;  3U3I A;  4L5G A;  5JDG A;  5LBQ B;  5BMV E;  3CML A;  4DBQ A;  3V5S A;  2YIN A;  3B57 A;  3HKC E;  3E08 A;  2RA1 A;  4GYR A;  5LHG B;  1T98 A;  2X9Y A;  2DWK A;  2ZMA A;  1WYC A;  2D0T A;  4DND A;  1X79 A;  1SHZ C;  3V5U A;  2UXN B;  3C50 A;  3FXD B;  3KBU A;  2XAF B;  3MAC A;  3ZC1 A;  3H37 A;  2XAH B;  3N5L A;  3ZEF B;  4ANJ A;  1UX4 A;  2JMK A;  4O2A E;  3KVB A;  5LYJ E;  3K3N A;  3LFM A;  4O4J E;  3AAE B;  4PK6 A;  3W15 B;  5KMG P;  3VKH A;  2IC6 A;  4EYU A;  2H7O A;  3RPU A;  4IHJ E;  3DJB A;  4H9N C;  4I43 B;  4M1P A;  2LSI A;  4ILU A;  3ZYL A;  4J2C A;  4ERR A;  4UEM A;  4UVC B;  4XZC A;  5ADX L;  5IYZ E;  3PE0 A;  5FY7 A;  1E1H B;  5C8Y E;  3U78 A;  4PW8 A;  4CI3 B;  4X1K E;  1D1A A;  2HPL A;  2XAG B;  2BVM A;  2M67 A;  2YEV C;  3CQG B;  4OYK A;  5E0O A;  3UFE A;  3ZMZ B;  2X9W A;  3ZCJ A;  4FI5 A;  3PTR B;  4YHJ A;  2LQU A;  1D0Z A;  2VKO A;  3O4X E;  1HF8 A;  5CA0 E;  5LGT B;  1MMA A;  1ZHC A;  3S4U A;  4AKR B;  3D0T A;  4EAH A;  4ZOL E;  2JQQ A;  1FIO A;  3KV9 A;  3CX6 B;  4QXB B;  3N2K E;  3H3A A;  4OHF A;  4XAX B;  4EB6 E;  5LGN B;  2LOP A;  1D0Y A;  1QUU A;  5LHI B;  3P7I A;  3BQI A;  4BJM A;  3O1I A;  3GA8 A;  2I59 A;  5JDL A;  3IF8 B;  1MMN A;  2CXF A;  3OBV E;  4AQF A;  1U5P A;  3AVS A;  4IE0 A;  4I50 E;  3SOL A;  3DP7 A;  5EK2 A;  3RYI E;  4XBF B;  1G73 A;  2JMH A;  4U74 A;  4BAY B;  3HKD E;  1YKE B;  2YK0 A;  2YU2 A;  1HFA A;  2X51 A;  3F57 A;  4OK0 A;  2X66 A;  3UUN A;  3WI3 A;  3I9W A;  2KIN B;  5FMN A;  1WYB A;  1BR0 A;  4AKI A;  2DLR A;  3WAK A;  4DVD A;  2A3D A;  3OKQ A;  1CUN A;  4HTE A;  4WW0 A;  3EVY A;  2KMF A;  2C5K T;  3GMI A;  1VRB A;  2G0U A;  3ANW A;  4EIW A;  2ODU A;  3OJA A;  3CX8 B;  2VKH A;  2W62 A;  2LSG A;  3ANW B;  3GN5 B;  3SRZ A;  4KBM B;  4UF0 B;  5HYA A;  4UVA B;  4PJN A;  4PJM A;  2NOX A;  1MIW A;  2GK9 A;  2X68 A;  2IAK A;  5FP3 A;  2KLQ A;  2QA7 A;  5L3D B;  3CPZ A;  5TAO A;  1NAF A;  2WSS V;  3AAA B;  1ZKE A;  3ZYK A;  4BA9 A;  4HKA A;  3EDU A;  5J2U E;  3N9O A;  3L09 A;  4IE6 A;  2XAJ B;  1MMD A;  4NUU A;  3EUH A;  2PBI A;  4ISS A;  1S94 A;  3ZMV B;  2MYS A;  4O4H E;  2CCQ A;  2Y6X A;  3L3P A;  5FXW A;  2C5J A;  3NBX X;  1MIY A;  2Q9Q A;  2X9H A;  2ZM8 A;  2IW5 B;  2CWO A;  2H3R A;  5FY1 A;  3DTO A;  1NWM X;  4QWN B;  5LP6 E;  4X1I E;  5HXC A;  4CXW A;  5L2L A;  3CKD A;  3ZMS B;  3NRX A;  1WLX A;  2W0G A;  2KT9 A;  4CXX A;  4H63 V;  1B7T A;  5LA6 E;  4TN7 B;  3PU8 A;  5JH7 E;  4EZ4 A;  5FNV E;  1AJ3 A;  3MKD A;  4EOZ B;  4AQG A;  3UUX B;  5FY0 A;  2NP9 A;  3ZN0 B;  2SPC A;  3E22 E;  4PK4 A;  3LG7 A;  5JR9 A;  4C91 A;  5LXT E;  4ADZ A;  3LK3 B;  3T8O A;  3OYZ A;  4DO0 A;  2X9X A;  4EYY R;  1HTJ F;  4IE5 A;  3ZCI A;  2N1G A;  5L3E B;  2V7M A;  4GIW A;  3VU7 H;  4ZI7 E;  3Q9D A;  1U4Q A;  4N78 D;  3ZMT B;  1WR6 A;  2VKD A;  4KP3 C;  3M1C A;  5FXV A;  3Q2M A;  2P9B A;  1D0X A;  3AA7 B;  2ACX A;  3CVR A;  2VK9 A;  4QXC B;  1MNE A;  3AB3 B;  4QKN A;  2LHN A;  3HL6 A;  3Q5X A;  4HEA A;  3SWH A;  3KVA A;  1HS7 A;  4AQF C;  4BGO A;  3PUA A;  5M4Y A;  4IDZ A;  3ETV A;  3WSC A;  3LK4 2;  1KNZ A;  1FMW A;  4GOU A;  1BR1 A;  4O4L E;  4ZS2 A;  4UIG A;  2CLY C;  5HAX A;  2XHE B;  1IJ5 A;  4PJL A;  2ZM2 A;  4O8S A;  2K48 A;  3MA9 A;  3UTK A;  4ZI3 C;  4DBR A;  4WBN E;  4UVB B;  3C64 A;  3LBX A;  2HPJ A;  4YJ2 E;  4E7S A;  4CXY A;  4V1A v;  1HCI A;  4ZI2 C;  1D1C A;  5EZY E;  3J7Y q;  2E9X A;  4YFS A;  4UXN B;  2LHR A;  1SA0 E;  5CA1 E;  3UT5 E;  1IZN B;  3AAI A;  1D1B A;  3CWZ B;  4O4I E;  3R6N A;  1Z0P A;  2WMN A;  2KZ7 B;  2PFV A;  3QUJ A;  4PJJ A;  5EK4 A;  3I0Q A;  4CI2 B;  2CMR A;  2NW7 A;  2RP4 A;  2ZLY A;  2VB6 A;  4TUY E;  2WBL A;  4KUM B;  3F2E A;  2CXL A;  4TZ4 C;  2KND A;  3ONX A;  3ZLI A;  4QX8 B;  4ZI2 D;  2LSK A;  4JEU B;  2CA5 A;  3KV6 A;  4L9I A;  2JJ9 A;  3PHF 1;  1H7C A;  2V26 A;  2CLY B;  3I1A A;  3PDY A;  3PUR A;  2NWB A;  4P0B A;  4DMW A;  4EZH A;  1Y64 B;  2Y8D A;  2V1D B;  2D2S A;  2Q9Q C;  3J9X 1;  5EK3 A;  3HI2 A;  4TX5 A;  4ASK A;  3K3O A;  5JDM A;  2LSY A;  4O2B E;  1IAP A;  1LVK A;  2LM9 A;  2CWY A;  3F31 A;  5AFU L;  2IC9 A;  4G63 A;  4EXT A;  2VL8 A;  3ESL A;  4PAG A;  4Z8X A;  2LOS A;  3MK7 C;  2LJL A;  4BJN A;  4MHC A;  3ZJ1 A;  5HXS A;  2C5I T;  5HWY A;  2CM0 A;  3K3Q C;  2MTQ A;  2Q9Q D;  4A56 A;  4H63 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...