5HWXA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and zero ca2+
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
301
structure length
294
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
molecule keywords sodium,calcium exchanger
total genus 126
structure length 294
sequence length 301
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hwxA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hwxA02
3V5SA 5HWXA 5JDNA 3V5UA 5JDLA 5HYAA 5HXHA 5JDGA 5JDFA 5JDQA 5HXEA 5JDHA 5JDMA 5HXSA 5HWYA 5HXRA 5HXCA
chains in the Genus database with same CATH superfamily
1KK7A 1QLBA 2ZM0A 3QB5K 4K0KT 2XQ4A 4DIDB 5FNVE 4KI0F 5F3JA 4IE4A 3N9PA 4O4IE 1KNZA 2E9XC 2WY2A 3AECA 4I50E 4JI7T 1LKXA 3KFWX 4AI6A 4H63V 3LDQB 4Q25A 2V6YB 3R84B 3WI3A 3C64A 3ZLIA 4CI1B 4UV8B 2LQUA 2L10A 1FIOA 2A9UA 5LBMA 2WCAA 3PTRB 4O2AE 4GYRA 2KVPA 2LOSA 3MACA 3I1AA 3MK7C 1T7SA 4ILBA 5FYMA 3OYZA 4IE0A 4EYUA 4AKGA 4PJMA 2ACZA 1YKHB 3PU8A 2Y8DA 3AE6A 3IHRA 4UELA 1HNZT 4NIQA 3AB3B 3K8PC 5HXCA 3EUHA 5C8YE 4IE5A 5L3FB 2ZM6T 5LGTB 4YJ2E 2W63A 2MAWA 4ZS3A 3N9NA 2WM9A 4JEUB 4HFHA 3AE4A 5JVDE 4ILUA 4BJNA 5LXTE 1G8XA 2LEHA 4A5XA 2V8SV 1OEDC 1Y64B 3ZSSA 4IIJE 2FBWA 2HN2A 4PJJA 4DO0A 4ECGA 5CGMA 1HS7A 3P4WA 4YSXA 5FY0A 3RQWA 5IWAT 4LFBT 2KWHA 3EHZA 4EXTA 1SJ8A 4ZOLE 4L0RA 4TV9E 4XAXB 4AIUA 2DWKA 4UVBB 2YDQA 2UXNB 5AQSB 2IW5B 5IHYA 4A98A 5J2UE 4AQYT 2AXDS 4DR3T 5EK2A 2YU2A 4PAGA 3AEDA 4UVAB 3RGLA 5CB4E 3J9X1 5LJNA 2BVLA 5J2TE 1FJGT 2NTXA 1BR2A 4OYKA 2ZMAA 3N2OA 4ISSA 4TWHA 5FVLA 4EEDA 3UU6A 4YTPA 5JDMA 4ILCA 2WZHA 3BQLA 2BG9B 5LGUB 3RRWA 4O4JE 1ZOYA 2VWAA 2LJLA 2WDQA 3KBTA 5ABGA 1M62A 5ABFB 3JAFA 3PJAJ 2XTLA 4H9QC 3B5MA 2VVNA 2NR4A 5L3DB 4B6XA 2XZEA 4DV7T 2VQFT 2OLTA 5JTGA 4LF7T 2PFVA 3RIAA 4YHHT 2KXPB 4LF9T 4O2BE 5LHGB 2W0GA 4EYYR 2LM9A 4IDNA 3FXDB 2VKDA 2J4GA 2W66A 3PDYA 4PFPA 4TV8E 4TZ4C 1J5ET 2UU9T 2X9XA 2W67A 1MIYA 4B3MT 4EGWA 3ANWB 3ZKRA 3ONLC 5AQLB 4X65T 3AE7A 4K0UA 5J1GA 4U3CA 3JC6D 5JDGA 1FEWA 3CK6A 5JR9C 4AXPA 2DL1A 5AQJB 1N34T 2XUEA 3DP7A 3OVUA 4WYVA 1EZ3A 4C90A 3IF8B 4IDPA 3VJZA 2UXBT 2PTFA 1L0VA 2UXXB 3RRCA 3RH3A 4PNIA 3P4RA 4A97A 4QX7B 4WBNE 3BQKA 3FZLB 2CWYA 4UEMA 1DU2A 4JI6T 4MLKA 1B7TA 3RIUA 5EK4A 2LE8A 3K3NA 3B13A 3T1HT 5FL0A 3U3IA 1IBLT 4JI3T 4W8PA 3V5UA 4HFEA 5BMVE 2M6BA 4I0UA 2RPAA 2K9AA 4L5GA 4V1Av 5HEJA 4DR1T 3MA9A 3RKGA 3AA0B 4GYSA 4GK5E 2CRBA 2BBJA 2DLRA 2VVSA 5FY1A 2X9HA 4QKNA 1R8IA 4WZXA 4ZZBA 5LNKA 4LFAT 2A2FX 4M1PA 3SWHA 3UQ7A 5LG4A 2V7MA 3P4SA 3LBXA 4KHZF 4JYAT 3X1DA 5AQFB 1QUUA 4HFDA 3AA1B 1SHZC 1WRDA 5HAXA 3RC8A 1VRBA 1XDOA 1SJ7A 2YEVC 2DNXA 3TKLB 2WBLA 1D0ZA 5JQGE 1MMGA 3NZPA 3ZSTA 4B3RT 2X0YA 3GN5A 2VL0A 2IC6A 3MKDA 3TLVA 5FP3A 1IJ5A 3VR9A 2YDRA 2V7LA 4IREA 5ADXL 3WAJA 1IBMT 5HYAA 4U7YA 3AXJB 4YHJA 2VASA 4QXHB 2AE9A 4HFIA 2W61A 1UCUA 3N9OA 5LOVE 2VQET 4EOZB 1WR6A 2XJ7A 3CKDA 3NVOA 4PW8A 3PUXF 3UUBA 1HR0T 1FMVA 2DHRA 4H9OC 3I0OA 1AJ3A 4CXYA 1I6ZA 2CWOA 1N36T 1IZNB 3EVYA 3M3ZB 2L3LA 3RYHE 4HKAA 3FBLA 4XZCA 2KWIB 3KV6A 1J1JA 1NWMX 4LF5T 5HEGA 3QUJA 3PUAA 1SA0E 2XQ9A 3RQUA 1UX4A 2LRLA 3TLSA 3ETUA 4DMVA 2VK9A 3C4ZA 3C98B 3EAMA 4IDZA 2FUPA 5C2TA 2KGXA 3L09A 1T8BA 2LSKA 4IE6A 3UFGA 5FL1A 4DV5T 3AA7B 2WMNA 2CA5A 4PK6A 2V7KA 3LK42 2IHR1 3ZT6A 3BK9A 3NRXA 2VKOA 2KINB 1CUNA 3F31A 5LA6E 4ILAA 4Z8XA 2A72A 4IDOA 4U2YA 3QNUA 5DQWA 4U2ZA 4TUYE 2CBIA 3ESLA 4AISA 4CN4A 5M4YA 4KMCA 2UXCT 4U72A 5H6QB 3EI0A 1XWMA 3AEFA 3SFDA 2VKHA 4X62T 2XSAA 5L4HA 3FZHB 2KT9A 4DV1T 2H7VC 2PJQA 3E22E 3VRBA 3WAKA 3CPZA 3GN5B 3V5SA 3K3OA 2XPKA 1J5WA 3UU4A 3PUZF 4HFCA 2XQ3A 2KMFA 5FKYA 3RHWA 3Q5XA 1WYBA 2WAUA 3DYJA 1HX1B 4JLEA 2CXDA 3N2KE 5HWYA 2LOPA 2WP9A 2I0MA 3AAIA 2NW9A 1XNQT 3PF0A 1WCRA 1OWAA 4U31A 4G63A 4ANJA 2X51A 2CCQA 1U5PA 3P8CD 2A3DA 2L8KA 2IUBA 5JDHA 3ZJ2A 2WWUA 1YD8G 2B1EA 5LMUT 4KBMB 3ZMTB 2H88A 3NZQA 4DVDA 3HKCE 4FJOA 3UTKA 1S94A 2JJ9A 5L47A 2QRXA 1UUSA 1W9RA 2YINA 3ZN1B 2CPTA 4CI2B 3MJXA 2HHHT 2NTYA 2MOZA 2NP9A 4JUYA 2HPJA 4P1NA 3UFEA 2D0TA 2XSBA 1MNEA 2VKJA 3ZT5A 1MIVA 4LMJA 4GKJT 3Q9DA 4YY3T 2V1DB 4QXBB 4KP3C 4UIGA 4AKLA 1H7CA 4EZ4A 2XASB 3PUQA 3ZYKA 5FXVA 1M7KA 3AE1A 3CQXC 1JNRA 1XMOT 5JDFA 1WYCA 3SOLA 3QC9A 3VKHA 1OXZA 3RC3A 3RKOA 3AA6B 4JI4T 3O1HA 4PK5A 2XHEB 3I0QA 4X1IE 2E9XA 4DV2T 4KHPT 3FZKB 2RA1A 1LRZA 2V5CA 2ODUA 3Q5WA 4IL9A 2JMKA 3U78A 1YQ4A 4YSYA 4LF6T 2H7OA 5CA1E 4OX9T 3ANWA 4PJNA 4COFA 4CXWA 3J7Yq 2L9QA 2FJBA 3ZMVB 3AEEA 4I55E 4ERRA 2IC9A 1YXRA 4NXMT 2MPKA 3VR8A 4DR4T 1GQEA 4HWFA 4AQFA 2QYWA 4E7SA 3LK2B 1WLXA 4TX5A 5LG3A 2BKNA 2MTQA 4ISTA 1BR1A 4DV0T 2IIUA 2XQ5A 2BBHA 4ZXLA 4P0BA 2WU2A 5AQGB 3ZMSB 4LFCT 4F6RC 2LKHA 4GKKT 1LVKA 4CZZB 4C91A 2RP4A 5JR9B 2ACXA 2CEAA 4IGUA 4AKRB 1XZYA 3O4XE 5F5WA 1HNXT 4CXXA 2WWVA 2E8IA 3W15B 4ZHQE 3A7MA 2BS3A 2BS2A 2BS4A 3E08A 3H3MA 3ZYMA 5HXHA 4MALA 3K1SA 5AQKB 1BR0A 2XAJB 3L39A 4OK0A 4P09A 3T1YT 3HKEE 3CX6B 5LJMA 2KSRA 2JPFA 4L9IA 3FHNA 5L3EB 2E5VA 2D0UA 5AQIB 4AQGA 2G0UA 2IDOB 3PV0F 4U74A 4AKIA 3QK6A 3UUMA 1I94T 2V26A 3PJAA 4HGAA 1YKEB 2XY8B 4AKHA 4QH1A 3RX6A 4ZS2A 1VOMA 2GK9A 3HKDE 2CXLA 2CHOA 4UF0B 1X9BA 5ETWA 2DI4A 3M65A 1E2AA 4E7ZA 1MNDA 5L3GB 2ODVA 2IAKA 3HL6A 3RI5A 2OV9A 5L2LA 4F7GB 4IDQA 3S4UA 3UULA 5HWXA 3NKZA 5JDNA 3G06A 3UU3A 4CN6A 2UUAT 3AE3A 4N78D 2UUCT 5FZTA 3CMLA 1KEYA 4X66T 5AFUL 2J1DG 4MFRA 5AQPB 2H89A 3AE9A 3P4QA 4HWIB 2BKOA 2JRKA 4Z91A 1YW0A 2Z6EA 3C51A 4FI5A 3AY5A 3NBXX 2J47A 4TNVA 4HE8A 5KX5E 4P0AA 2DCFA 4YJ3E 3Q5EA 4I4TE 4QHOA 5IYZE 3SRZA 3EDUA 3MZKB 2W2UA 3JCFA 2V7JA 4X64T 3WURA 5EK3A 5CJ5A 2NWBA 3SS1A 1HF8A 5LGNB 4F8HA 5JH7E 2M6IA 1HG2A 3H3AA 3CWZB 4JI2T 1V9DA 2N9DA 4PK4A 2XQ8A 4DUZT 2WZIA 2K3WA 2WU5A 3D0TA 2K5BB 3OBVE 3ZEFB 3FZMB 4ZI2D 5LMNT 5FXXA 3M1CA 4ZI3C 2XAGB 4JBWF 3KV4A 1HG5A 3KDSE 1T98A 4TWFA 2D2SA 3HA4A 4QXCB 2FJEA 4AQFC 4DBQA 2BG9A 2E2AA 2EHOD 4WW0A 3UU5A 5C3JA 5KXJA 1XMQT 4O4HE 4HEAA 4NUVA 5CA0E 2SPCA 3AVRA 1MMNA 3FB2A 1US7B 2ES0A 3KINB 3MXZA 3AAAB 1Y01A 4UV9B 4OHFA 3A5XA 4UVCB 3GMIA 5FVKA 3R6NA 3RIFA 3ZC1A 4ADZA 1D1AA 3PHF1 5LP6E 4HWHA 5HCJA 3AE5A 2W00A 3I9YA 4OFZA 2W4XA 4HFBA 2C5KT 5JRCA 1QSDA 2MYSA 4U33A 4QX8B 4H63H 1HCIA 1KF6A 2CHNA 5IUXA 3LK3B 1OEDA 4TNWA 2X0HA 4GOUA 4JV5T 1HNWT 2R6GF 1KNPA 5FY7A 5LBQB 2IMLA 4ZEYA 4KX6A 5KMGP 4X5TA 1SE7A 2Q9QC 4BA9A 4ZZCA 4DR5T 2CM0A 2OA5A 5HEUA 1KFYA 1NAFA 2YOEA 4DR7T 2WMOA 2HH7A 2LSJA 3C50A 4PFOA 3ZN0B 2PBIA 2P9BA 3CX8B 4H9RC 2Q9QB 1UGOA 5DQVA 4HWCA 1W0AA 1S35A 5TAOA 2WB5A 3ZPOA 5KDMC 4EEBA 3VHLA 2V6YA 3LG7A 3PUWF 3E0ZA 2PG8A 3HKBE 4ZI2C 1XDPA 3L3PA 1ZKEA 3P7IA 4ZI7E 3PE0A 1ZP0A 3FYQA 2LHRA 2XAFB 2XQ7A 5AQMB 3ZMUB 3AE2A 4JEHB 4X1YE 3UUXB 1UX5A 5AQOB 5HXEA 2WDVA 4QH4A 3NWIA 2EHOC 5ABHA 3PUGA 1OEDB 2UXDT 2LLYA 3UU8A 2F4VT 2L7NA 1HTJF 5DABA 2D9DA 4MBQA 2BDEA 2V7IA 4O4LE 2ZLYA 2XQYA 2EHOB 2YDSA 4U7IA 2JQKA 4HWDA 1XNRT 4XBFB 3RLFF 1CHUA 3GA8A 5E0OA 2FJAA 3VKGA 1ZHCA 4BGOA 3FBZA 1MMAA 3IEEA 2K24A 2VL8A 2KZ7B 1Z0PA 4UXNB 5HEOA 3RF1A 5JDQA 2I59A 3BQIA 3O1IA 1UURA 2HN1A 3K3QC 2Y48B 3EDVA 3Q5DA 4HTEA 4KUMB 4CQIA 2C5IT 5ABFA 4O8SA 5T1DA 4NPPA 5L3CB 3LJCA 1T72A 4X20E 2UUBT 2VB6A 1ZEEA 2XAQB 3GWHA 2WDRA 3PUYF 3AXJA 3F2EA 3PUVF 1MMDA 2XQAA 4CI3B 2X9YA 5JDLA 4ASKA 4IHJE 3RIUC 1IBKT 4LF8T 3OJAA 5AQVB 2N1GA 5GONE 5HXSA 3AEGA 4YT0A 5JREA 2JQQA 5HEHA 3FZFB 3AAEB 2NW7A 2B76A 3CQGB 3F57A 2W62A 5EZYE 5AQQB 1ZV4X 5JR9A 2XQ6A 4MHCA 4QH5A 3TLWA 2BZBA 3ZCIA 3WSCA 4BJMA 3JADA 4IL4A 1LVFA 2M67A 2YKSA 2XAHB 5L3BB 1HX8A 3ZT7A 3AEAA 3ETVA 5LHHB 2HPLA 4EB6E 5AQTB 4IE7A 4EV6A 1JNZA 5LB7B 4GIWA 4DMWA 3P4PA 4ONRA 3C4WA 2JQ9A 3IA3A 2CBJA 2KBBA 3L8RA 2QA7A 3C4XA 4TWDA 4YTMA 3ZCJA 1SUMB 2CMRA 5A1LA 5ABEA 2ZM2A 4NXNT 3UQ4A 2Q9QA 2X66A 3KV5A 3RYFE 4A56A 2LM2A 4JI1T 4PJLA 2YK0A 4JI5T 3O9XA 2E5LT 3EABA 1D0XA 4UF0A 1BR4A 4DV3T 5CFBA 2E9XD 3RYCE 3LFMA 4G2AA 3AEBA 3N9QA 2EHOA 3UUNA 3Q2MA 1UK5A 2VURA 4WNKA 3SFEA 5FXWA 2MTCA 3AT7A 5LHIB 5HCMA 4JI8T 3AE8A 4H9NC 3RYIE 3JC6C 2BVMA 3IBPA 2LT3A 2ZM8A 3OKQA 5LYJE 1G73A 3PURA 2JMHA 1MIWA 4NUUA 5F8PA 4B3TT 2DWGA 3DTOA 4DV4T 4EZHA 5L4EA 2X0LB 3LBXB 2E9XB 4UR9A 4DUYT 2LSYA 2V6XA 5DJQC 1VCTA 3UT5E 3LSVA 3PUSA 4YSZA 4YFSA 4EIWA 4HN9A 1WR0A 4DR6T 5AQHB 5H6RB 4DBRA 3KBUA 4H9SE 1HFAA 2JQHA 2Y6XA 4YTNA 5AQUB 3A8YC 2KLQA 2YU1A 4IT4A 3N5LA 1W09A 3O1JA 2YN6A 5AQRB 1E1HB 3ZYLA 1VCSA 4YXDA 3N9MA 4DR2T 2FJDA 2N2NA 1YQ3A 2CXFA 4LMKA 2JIWA 4H9PC 3HI2A 3CVRA 5FXZA 4X1KE 3KVAA 2C5JA 2X9WA 5JRCB 4TN7B 3VU7H 3OTOT 1W0BA 4J2CA 4BAYB 3KVBA 4LF4T 3N2GE 2X0CA 1D1CA 4GK0E 2LSIA 1N33T 4JI0T 2J62A 4OYJA 3AVSA 2LHNA 3NRYA 1X79A 2NOXA 3DJBA 2MBGA 2K48A 2Q9QD 3N9LA 3ONJA 3TLTA 2X68A 2BG9E 4CN1A 4I43B 2WSSV 1IJ6A 4YLHA 5FMNA 1E7PA 3TLUA 3VRAA 1NEKA 1U4QA 3H37A 3OPCA 3FXEB 5AQNB 2QVAA 3KV9A 3JAEA 2BG9C 2XM1A 5LCYA 3I9WA 2D5UA 1O3XA 3QB5A 5BR8T 4DV6T 3CX7B 1Z8UA 4HFVA 5HXRA 3ZMZB 3ZC0A 1D0YA 2H3RA 4DNDA 2NW8A 4WBOA 3T8OA 2CLYB 2LRKA 2LKGA 1D1BA 2I6HA 1NENA 1N32T 2BKPA 2CE7A 2C0SA 2QGSA 3CQCB 3HR0A 1IAPA 3PU3A 3P50A 4B3ST 2CLYC 2LSGA 4Z90A 3ONXA 4EAHA 1OEDE 3OYXA 1WFDA 2WS3A 2V5DA 2XM2A 1KNRA 1FMWA 2WQYA 3CIRA 4QWNB 3QOFA 3ZJ1A 4LMLA 4ZI3D 3B57A 2KNDA 3RPUA 2X67A 3ABVA 5J0ZA
chains in the Genus database with same CATH topology
1KK7A 2ZM0A 5F3JA 5FNVE 1KNZA 4IE4A 3N9PA 4O4IE 2E9XC 4I50E 1LKXA 3KFWX 4H63V 3R84B 3WI3A 3C64A 3ZLIA 4CI1B 4UV8B 2LQUA 1FIOA 5LBMA 3PTRB 4O2AE 4GYRA 2LOSA 3MACA 3I1AA 3MK7C 5FYMA 4EYUA 4AKGA 3OYZA 4IE0A 4PJMA 1YKHB 3PU8A 2Y8DA 3IHRA 4UELA 3AB3B 3K8PC 5HXCA 3EUHA 5C8YE 4IE5A 5L3FB 5LGTB 4YJ2E 2W63A 4ZS3A 3N9NA 2WM9A 4JEUB 5JVDE 4ILUA 4BJNA 5LXTE 1G8XA 2LEHA 1Y64B 4DO0A 4IIJE 4PJJA 4ECGA 1HS7A 5FY0A 2KWHA 4EXTA 4ZOLE 4L0RA 4TV9E 4XAXB 2DWKA 4UVBB 2IW5B 2UXNB 5J2UE 5IHYA 5EK2A 2YU2A 4PAGA 4UVAB 5LJNA 5CB4E 3J9X1 5J2TE 2BVLA 2NTXA 1BR2A 4OYKA 2ZMAA 3N2OA 4ISSA 5JDMA 5LGUB 3BQLA 3RRWA 4O4JE 2VWAA 2LJLA 3KBTA 4H9QC 2XTLA 5L3DB 4B6XA 2PFVA 2KXPB 4O2BE 5LHGB 2W0GA 4EYYR 2LM9A 3FXDB 2VKDA 3PDYA 4PFPA 4TV8E 4TZ4C 2X9XA 1MIYA 3ANWB 4K0UA 5J1GA 3JC6D 5JDGA 1FEWA 4AXPA 2XUEA 3DP7A 3VJZA 1EZ3A 4C90A 3IF8B 2UXXB 3RRCA 3RH3A 4PNIA 4QX7B 4WBNE 3BQKA 2CWYA 4UEMA 4MLKA 1B7TA 5EK4A 2LE8A 3K3NA 3B13A 3U3IA 3V5UA 5BMVE 2K9AA 4L5GA 4V1Av 3MA9A 3AA0B 4GYSA 4GK5E 5LNKA 2DLRA 5FY1A 2X9HA 4QKNA 2A2FX 4M1PA 3SWHA 5LG4A 2V7MA 3LBXA 1QUUA 3AA1B 1SHZC 1WRDA 5HAXA 3RC8A 1VRBA 2YEVC 2DNXA 3TKLB 2WBLA 1D0ZA 5JQGE 1MMGA 3NZPA 3GN5A 3MKDA 2IC6A 5ADXL 5FP3A 1IJ5A 2V7LA 3WAJA 5HYAA 4YHJA 2VASA 4QXHB 2W61A 1UCUA 3N9OA 5LOVE 4EOZB 1WR6A 3CKDA 4PW8A 1FMVA 2DHRA 4H9OC 3I0OA 1AJ3A 4CXYA 2CWOA 1IZNB 3EVYA 3RYHE 2L3LA 4HKAA 3FBLA 4XZCA 2KWIB 3KV6A 1NWMX 3QUJA 3PUAA 1SA0E 1UX4A 4DMVA 4EB6E 3ETUA 5JDHA 2VK9A 3C4ZA 3C98B 4IDZA 3L09A 4IE6A 2LSKA 3AA7B 2WMNA 2CA5A 4PK6A 2V7KA 3LK42 3BK9A 3NRXA 2VKOA 2KINB 1CUNA 3F31A 5LA6E 4Z8XA 2A72A 5DQWA 4TUYE 3ESLA 5M4YA 4KMCA 4U72A 5H6QB 2VKHA 2KT9A 2H7VC 2PJQA 3E22E 3WAKA 3CPZA 3GN5B 3V5SA 3K3OA 2KMFA 3Q5XA 1WYBA 2WAUA 4JLEA 2CXDA 3N2KE 5HWYA 2LOPA 2NW9A 3AAIA 3PF0A 1OWAA 4G63A 4ANJA 2X51A 2CCQA 1U5PA 3P8CD 2A3DA 2L8KA 3ZJ2A 2WWUA 1YD8G 2B1EA 4KBMB 3ZMTB 3NZQA 4DVDA 3HKCE 4FJOA 3UTKA 1S94A 2JJ9A 2YINA 4CI2B 3ZN1B 3MJXA 2NTYA 2MOZA 2NP9A 4JUYA 2HPJA 3UFEA 2D0TA 1MNEA 2VKJA 1MIVA 3Q9DA 4AI6A 2V1DB 4QXBB 4KP3C 4UIGA 4AKLA 1H7CA 4EZ4A 2XASB 3PUQA 3ZYKA 5FXVA 3CQXC 5JDFA 1WYCA 3SOLA 3QC9A 3VKHA 1OXZA 3RC3A 3RKOA 3AA6B 3O1HA 4PK5A 2XHEB 3I0QA 4X1IE 2E9XA 2RA1A 1LRZA 3U78A 2ODUA 3Q5WA 2JMKA 2H7OA 5CA1E 3ANWA 4PJNA 3J7Yq 4CXWA 2L9QA 3ZMVB 4I55E 4ERRA 2IC9A 4AQFA 4E7SA 3LK2B 1WLXA 4TX5A 2MTQA 4ISTA 1BR1A 4P0BA 3ZMSB 4F6RC 1LVKA 4CZZB 4C91A 2RP4A 5JR9B 2ACXA 2CEAA 4IGUA 4AKRB 3O4XE 4CXXA 2E8IA 3W15B 4ZHQE 3E08A 3ZYMA 5HXHA 4MALA 1BR0A 2XAJB 4OK0A 4P09A 3HKEE 3CX6B 5LJMA 2JPFA 4L9IA 3FHNA 5L3EB 2D0UA 4AQGA 2G0UA 4U74A 4AKIA 3QK6A 3UUMA 2V26A 4HGAA 1YKEB 4AKHA 3RX6A 4ZS2A 1VOMA 2GK9A 3HKDE 2CXLA 4UF0B 5ETWA 2DI4A 3M65A 4E7ZA 1MNDA 5L3GB 2ODVA 2IAKA 3HL6A 5L2LA 3S4UA 3UULA 5HWXA 5JDNA 4N78D 3CMLA 5AFUL 2J1DG 4MFRA 2JRKA 1YW0A 2Z6EA 3C51A 4FI5A 3NBXX 5KX5E 4P0AA 4HE8A 2DCFA 4YJ3E 4QHOA 4I4TE 5IYZE 3SRZA 3EDUA 3MZKB 2V7JA 3WURA 5EK3A 2NWBA 3SS1A 1HF8A 5LGNB 5JH7E 1HG2A 3H3AA 3CWZB 1V9DA 2N9DA 4PK4A 3D0TA 2K5BB 3OBVE 3ZEFB 4ZI2D 3M1CA 5FXXA 4ZI3C 2XAGB 3KV4A 1HG5A 3KDSE 1T98A 2D2SA 3HA4A 4QXCB 4AQFC 4DBQA 2EHOD 4WW0A 4O4HE 4HEAA 4NUVA 5CA0E 2SPCA 3AVRA 1MMNA 3FB2A 1US7B 2ES0A 3KINB 3MXZA 3AAAB 4UV9B 4OHFA 3A5XA 4UVCB 3GMIA 3R6NA 3ZC1A 4ADZA 1D1AA 3PHF1 5LP6E 2W00A 3I9YA 4OFZA 2C5KT 5JRCA 1QSDA 2MYSA 4QX8B 4H63H 1HCIA 3LK3B 4GOUA 5LBQB 5FY7A 5KMGP 2Q9QC 4BA9A 2CM0A 2OA5A 1NAFA 2WMOA 2HH7A 2LSJA 3C50A 4PFOA 3ZN0B 2PBIA 2P9BA 3CX8B 4H9RC 2Q9QB 5DQVA 1S35A 5TAOA 3ZPOA 5KDMC 3VHLA 3LG7A 3E0ZA 2PG8A 3HKBE 4ZI2C 3L3PA 3P7IA 1ZKEA 4ZI7E 3PE0A 2LHRA 2XAFB 3ZMUB 4JEHB 4X1YE 3UUXB 1UX5A 5HXEA 2EHOC 3PUGA 1HTJF 5DABA 4MBQA 2BDEA 2V7IA 4O4LE 2ZLYA 2XQYA 2EHOB 4XBFB 3VKGA 5E0OA 3GA8A 4BGOA 1ZHCA 3FBZA 1MMAA 3IEEA 2K24A 2VL8A 2KZ7B 1Z0PA 4UXNB 5JDQA 2I59A 3BQIA 3O1IA 3K3QC 4KUMB 2Y48B 3EDVA 4HTEA 4CQIA 2C5IT 5T1DA 4O8SA 5L3CB 3LJCA 4X20E 2VB6A 1ZEEA 2XAQB 3GWHA 3F2EA 4CI3B 1MMDA 5JDLA 2X9YA 4ASKA 4IHJE 3OJAA 5GONE 2N1GA 5HXSA 5JREA 2JQQA 3AAEB 2NW7A 3CQGB 3F57A 2W62A 5EZYE 5JR9A 1ZV4X 3WSCA 4MHCA 2BZBA 3ZCIA 4BJMA 1LVFA 2M67A 2XAHB 5L3BB 1HX8A 3ETVA 5LHHB 2HPLA 4IE7A 4GIWA 4DMWA 4ONRA 2QA7A 3C4XA 3ZCJA 5A1LA 2CMRA 2ZM2A 2Q9QA 2X66A 3KV5A 3RYFE 4A56A 4PJLA 2YK0A 3O9XA 1D0XA 4UF0A 1BR4A 2E9XD 3RYCE 3LFMA 4G2AA 3N9QA 2EHOA 3UUNA 3Q2MA 4WNKA 2MTCA 5FXWA 3AT7A 5LHIB 4H9NC 3RYIE 3JC6C 2BVMA 3IBPA 2LT3A 2ZM8A 3OKQA 5LYJE 1G73A 3PURA 2JMHA 1MIWA 4NUUA 5F8PA 2DWGA 3DTOA 4EZHA 2X0LB 3LBXB 2E9XB 2LSYA 5DJQC 3UT5E 3PUSA 4YFSA 4EIWA 4HN9A 5H6RB 4DBRA 3KBUA 4H9SE 1HFAA 2Y6XA 2KLQA 2YU1A 3N5LA 3O1JA 3ZYLA 1E1HB 3N9MA 2N2NA 2CXFA 4H9PC 3HI2A 3CVRA 5FXZA 4X1KE 3KVAA 2C5JA 2X9WA 5JRCB 4TN7B 3VU7H 4J2CA 4BAYB 3KVBA 3N2GE 1D1CA 4GK0E 2LSIA 4OYJA 3AVSA 2LHNA 3NRYA 1X79A 2NOXA 3DJBA 2MBGA 2K48A 2Q9QD 3N9LA 5JR9C 2X68A 4I43B 2WSSV 1IJ6A 4YLHA 5FMNA 1U4QA 3H37A 3FXEB 3KV9A 5LCYA 3I9WA 2D5UA 1O3XA 3CX7B 4HFVA 5HXRA 3ZMZB 3ZC0A 1D0YA 2H3RA 4DNDA 2NW8A 4WBOA 3T8OA 2CLYB 1D1BA 3CQCB 2CE7A 2C0SA 2QGSA 3HR0A 1IAPA 3PU3A 2CLYC 2LSGA 4EAHA 3ONXA 3OYXA 3ZJ1A 4QWNB 1FMWA 4ZI3D 3B57A 2KNDA 3RPUA 2X67A 3C4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5S A;  5HWX A;  5JDN A;  3V5U A;  5JDL A;  5HYA A;  5HXH A;  5JDG A;  5JDF A;  5JDQ A;  5HXE A;  5JDH A;  5JDM A;  5HXS A;  5HWY A;  5HXR A;  5HXC A; 
#chains in the Genus database with same CATH topology
 1KK7 A;  1QLB A;  2ZM0 A;  3QB5 K;  4K0K T;  2XQ4 A;  4DID B;  5FNV E;  4KI0 F;  5F3J A;  4IE4 A;  3N9P A;  4O4I E;  1KNZ A;  2E9X C;  2WY2 A;  3AEC A;  4I50 E;  4JI7 T;  1LKX A;  3KFW X;  4AI6 A;  4H63 V;  3LDQ B;  4Q25 A;  2V6Y B;  3R84 B;  3WI3 A;  3C64 A;  3ZLI A;  4CI1 B;  4UV8 B;  2LQU A;  2L10 A;  1FIO A;  2A9U A;  5LBM A;  2WCA A;  3PTR B;  4O2A E;  4GYR A;  2KVP A;  2LOS A;  3MAC A;  3I1A A;  3MK7 C;  1T7S A;  4ILB A;  5FYM A;  3OYZ A;  4IE0 A;  4EYU A;  4AKG A;  4PJM A;  2ACZ A;  1YKH B;  3PU8 A;  2Y8D A;  3AE6 A;  3IHR A;  4UEL A;  1HNZ T;  4NIQ A;  3AB3 B;  3K8P C;  5HXC A;  3EUH A;  5C8Y E;  4IE5 A;  5L3F B;  2ZM6 T;  5LGT B;  4YJ2 E;  2W63 A;  2MAW A;  4ZS3 A;  3N9N A;  2WM9 A;  4JEU B;  4HFH A;  3AE4 A;  5JVD E;  4ILU A;  4BJN A;  5LXT E;  1G8X A;  2LEH A;  4A5X A;  2V8S V;  1OED C;  1Y64 B;  3ZSS A;  4IIJ E;  2FBW A;  2HN2 A;  4PJJ A;  4DO0 A;  4ECG A;  5CGM A;  1HS7 A;  3P4W A;  4YSX A;  5FY0 A;  3RQW A;  5IWA T;  4LFB T;  2KWH A;  3EHZ A;  4EXT A;  1SJ8 A;  4ZOL E;  4L0R A;  4TV9 E;  4XAX B;  4AIU A;  2DWK A;  4UVB B;  2YDQ A;  2UXN B;  5AQS B;  2IW5 B;  5IHY A;  4A98 A;  5J2U E;  4AQY T;  2AXD S;  4DR3 T;  5EK2 A;  2YU2 A;  4PAG A;  3AED A;  4UVA B;  3RGL A;  5CB4 E;  3J9X 1;  5LJN A;  2BVL A;  5J2T E;  1FJG T;  2NTX A;  1BR2 A;  4OYK A;  2ZMA A;  3N2O A;  4ISS A;  4TWH A;  5FVL A;  4EED A;  3UU6 A;  4YTP A;  5JDM A;  4ILC A;  2WZH A;  3BQL A;  2BG9 B;  5LGU B;  3RRW A;  4O4J E;  1ZOY A;  2VWA A;  2LJL A;  2WDQ A;  3KBT A;  5ABG A;  1M62 A;  5ABF B;  3JAF A;  3PJA J;  2XTL A;  4H9Q C;  3B5M A;  2VVN A;  2NR4 A;  5L3D B;  4B6X A;  2XZE A;  4DV7 T;  2VQF T;  2OLT A;  5JTG A;  4LF7 T;  2PFV A;  3RIA A;  4YHH T;  2KXP B;  4LF9 T;  4O2B E;  5LHG B;  2W0G A;  4EYY R;  2LM9 A;  4IDN A;  3FXD B;  2VKD A;  2J4G A;  2W66 A;  3PDY A;  4PFP A;  4TV8 E;  4TZ4 C;  1J5E T;  2UU9 T;  2X9X A;  2W67 A;  1MIY A;  4B3M T;  4EGW A;  3ANW B;  3ZKR A;  3ONL C;  5AQL B;  4X65 T;  3AE7 A;  4K0U A;  5J1G A;  4U3C A;  3JC6 D;  5JDG A;  1FEW A;  3CK6 A;  5JR9 C;  4AXP A;  2DL1 A;  5AQJ B;  1N34 T;  2XUE A;  3DP7 A;  3OVU A;  4WYV A;  1EZ3 A;  4C90 A;  3IF8 B;  4IDP A;  3VJZ A;  2UXB T;  2PTF A;  1L0V A;  2UXX B;  3RRC A;  3RH3 A;  4PNI A;  3P4R A;  4A97 A;  4QX7 B;  4WBN E;  3BQK A;  3FZL B;  2CWY A;  4UEM A;  1DU2 A;  4JI6 T;  4MLK A;  1B7T A;  3RIU A;  5EK4 A;  2LE8 A;  3K3N A;  3B13 A;  3T1H T;  5FL0 A;  3U3I A;  1IBL T;  4JI3 T;  4W8P A;  3V5U A;  4HFE A;  5BMV E;  2M6B A;  4I0U A;  2RPA A;  2K9A A;  4L5G A;  4V1A v;  5HEJ A;  4DR1 T;  3MA9 A;  3RKG A;  3AA0 B;  4GYS A;  4GK5 E;  2CRB A;  2BBJ A;  2DLR A;  2VVS A;  5FY1 A;  2X9H A;  4QKN A;  1R8I A;  4WZX A;  4ZZB A;  5LNK A;  4LFA T;  2A2F X;  4M1P A;  3SWH A;  3UQ7 A;  5LG4 A;  2V7M A;  3P4S A;  3LBX A;  4KHZ F;  4JYA T;  3X1D A;  5AQF B;  1QUU A;  4HFD A;  3AA1 B;  1SHZ C;  1WRD A;  5HAX A;  3RC8 A;  1VRB A;  1XDO A;  1SJ7 A;  2YEV C;  2DNX A;  3TKL B;  2WBL A;  1D0Z A;  5JQG E;  1MMG A;  3NZP A;  3ZST A;  4B3R T;  2X0Y A;  3GN5 A;  2VL0 A;  2IC6 A;  3MKD A;  3TLV A;  5FP3 A;  1IJ5 A;  3VR9 A;  2YDR A;  2V7L A;  4IRE A;  5ADX L;  3WAJ A;  1IBM T;  5HYA A;  4U7Y A;  3AXJ B;  4YHJ A;  2VAS A;  4QXH B;  2AE9 A;  4HFI A;  2W61 A;  1UCU A;  3N9O A;  5LOV E;  2VQE T;  4EOZ B;  1WR6 A;  2XJ7 A;  3CKD A;  3NVO A;  4PW8 A;  3PUX F;  3UUB A;  1HR0 T;  1FMV A;  2DHR A;  4H9O C;  3I0O A;  1AJ3 A;  4CXY A;  1I6Z A;  2CWO A;  1N36 T;  1IZN B;  3EVY A;  3M3Z B;  2L3L A;  3RYH E;  4HKA A;  3FBL A;  4XZC A;  2KWI B;  3KV6 A;  1J1J A;  1NWM X;  4LF5 T;  5HEG A;  3QUJ A;  3PUA A;  1SA0 E;  2XQ9 A;  3RQU A;  1UX4 A;  2LRL A;  3TLS A;  3ETU A;  4DMV A;  2VK9 A;  3C4Z A;  3C98 B;  3EAM A;  4IDZ A;  2FUP A;  5C2T A;  2KGX A;  3L09 A;  1T8B A;  2LSK A;  4IE6 A;  3UFG A;  5FL1 A;  4DV5 T;  3AA7 B;  2WMN A;  2CA5 A;  4PK6 A;  2V7K A;  3LK4 2;  2IHR 1;  3ZT6 A;  3BK9 A;  3NRX A;  2VKO A;  2KIN B;  1CUN A;  3F31 A;  5LA6 E;  4ILA A;  4Z8X A;  2A72 A;  4IDO A;  4U2Y A;  3QNU A;  5DQW A;  4U2Z A;  4TUY E;  2CBI A;  3ESL A;  4AIS A;  4CN4 A;  5M4Y A;  4KMC A;  2UXC T;  4U72 A;  5H6Q B;  3EI0 A;  1XWM A;  3AEF A;  3SFD A;  2VKH A;  4X62 T;  2XSA A;  5L4H A;  3FZH B;  2KT9 A;  4DV1 T;  2H7V C;  2PJQ A;  3E22 E;  3VRB A;  3WAK A;  3CPZ A;  3GN5 B;  3V5S A;  3K3O A;  2XPK A;  1J5W A;  3UU4 A;  3PUZ F;  4HFC A;  2XQ3 A;  2KMF A;  5FKY A;  3RHW A;  3Q5X A;  1WYB A;  2WAU A;  3DYJ A;  1HX1 B;  4JLE A;  2CXD A;  3N2K E;  5HWY A;  2LOP A;  2WP9 A;  2I0M A;  3AAI A;  2NW9 A;  1XNQ T;  3PF0 A;  1WCR A;  1OWA A;  4U31 A;  4G63 A;  4ANJ A;  2X51 A;  2CCQ A;  1U5P A;  3P8C D;  2A3D A;  2L8K A;  2IUB A;  5JDH A;  3ZJ2 A;  2WWU A;  1YD8 G;  2B1E A;  5LMU T;  4KBM B;  3ZMT B;  2H88 A;  3NZQ A;  4DVD A;  3HKC E;  4FJO A;  3UTK A;  1S94 A;  2JJ9 A;  5L47 A;  2QRX A;  1UUS A;  1W9R A;  2YIN A;  3ZN1 B;  2CPT A;  4CI2 B;  3MJX A;  2HHH T;  2NTY A;  2MOZ A;  2NP9 A;  4JUY A;  2HPJ A;  4P1N A;  3UFE A;  2D0T A;  2XSB A;  1MNE A;  2VKJ A;  3ZT5 A;  1MIV A;  4LMJ A;  4GKJ T;  3Q9D A;  4YY3 T;  2V1D B;  4QXB B;  4KP3 C;  4UIG A;  4AKL A;  1H7C A;  4EZ4 A;  2XAS B;  3PUQ A;  3ZYK A;  5FXV A;  1M7K A;  3AE1 A;  3CQX C;  1JNR A;  1XMO T;  5JDF A;  1WYC A;  3SOL A;  3QC9 A;  3VKH A;  1OXZ A;  3RC3 A;  3RKO A;  3AA6 B;  4JI4 T;  3O1H A;  4PK5 A;  2XHE B;  3I0Q A;  4X1I E;  2E9X A;  4DV2 T;  4KHP T;  3FZK B;  2RA1 A;  1LRZ A;  2V5C A;  2ODU A;  3Q5W A;  4IL9 A;  2JMK A;  3U78 A;  1YQ4 A;  4YSY A;  4LF6 T;  2H7O A;  5CA1 E;  4OX9 T;  3ANW A;  4PJN A;  4COF A;  4CXW A;  3J7Y q;  2L9Q A;  2FJB A;  3ZMV B;  3AEE A;  4I55 E;  4ERR A;  2IC9 A;  1YXR A;  4NXM T;  2MPK A;  3VR8 A;  4DR4 T;  1GQE A;  4HWF A;  4AQF A;  2QYW A;  4E7S A;  3LK2 B;  1WLX A;  4TX5 A;  5LG3 A;  2BKN A;  2MTQ A;  4IST A;  1BR1 A;  4DV0 T;  2IIU A;  2XQ5 A;  2BBH A;  4ZXL A;  4P0B A;  2WU2 A;  5AQG B;  3ZMS B;  4LFC T;  4F6R C;  2LKH A;  4GKK T;  1LVK A;  4CZZ B;  4C91 A;  2RP4 A;  5JR9 B;  2ACX A;  2CEA A;  4IGU A;  4AKR B;  1XZY A;  3O4X E;  5F5W A;  1HNX T;  4CXX A;  2WWV A;  2E8I A;  3W15 B;  4ZHQ E;  3A7M A;  2BS3 A;  2BS2 A;  2BS4 A;  3E08 A;  3H3M A;  3ZYM A;  5HXH A;  4MAL A;  3K1S A;  5AQK B;  1BR0 A;  2XAJ B;  3L39 A;  4OK0 A;  4P09 A;  3T1Y T;  3HKE E;  3CX6 B;  5LJM A;  2KSR A;  2JPF A;  4L9I A;  3FHN A;  5L3E B;  2E5V A;  2D0U A;  5AQI B;  4AQG A;  2G0U A;  2IDO B;  3PV0 F;  4U74 A;  4AKI A;  3QK6 A;  3UUM A;  1I94 T;  2V26 A;  3PJA A;  4HGA A;  1YKE B;  2XY8 B;  4AKH A;  4QH1 A;  3RX6 A;  4ZS2 A;  1VOM A;  2GK9 A;  3HKD E;  2CXL A;  2CHO A;  4UF0 B;  1X9B A;  5ETW A;  2DI4 A;  3M65 A;  1E2A A;  4E7Z A;  1MND A;  5L3G B;  2ODV A;  2IAK A;  3HL6 A;  3RI5 A;  2OV9 A;  5L2L A;  4F7G B;  4IDQ A;  3S4U A;  3UUL A;  5HWX A;  3NKZ A;  5JDN A;  3G06 A;  3UU3 A;  4CN6 A;  2UUA T;  3AE3 A;  4N78 D;  2UUC T;  5FZT A;  3CML A;  1KEY A;  4X66 T;  5AFU L;  2J1D G;  4MFR A;  5AQP B;  2H89 A;  3AE9 A;  3P4Q A;  4HWI B;  2BKO A;  2JRK A;  4Z91 A;  1YW0 A;  2Z6E A;  3C51 A;  4FI5 A;  3AY5 A;  3NBX X;  2J47 A;  4TNV A;  4HE8 A;  5KX5 E;  4P0A A;  2DCF A;  4YJ3 E;  3Q5E A;  4I4T E;  4QHO A;  5IYZ E;  3SRZ A;  3EDU A;  3MZK B;  2W2U A;  3JCF A;  2V7J A;  4X64 T;  3WUR A;  5EK3 A;  5CJ5 A;  2NWB A;  3SS1 A;  1HF8 A;  5LGN B;  4F8H A;  5JH7 E;  2M6I A;  1HG2 A;  3H3A A;  3CWZ B;  4JI2 T;  1V9D A;  2N9D A;  4PK4 A;  2XQ8 A;  4DUZ T;  2WZI A;  2K3W A;  2WU5 A;  3D0T A;  2K5B B;  3OBV E;  3ZEF B;  3FZM B;  4ZI2 D;  5LMN T;  5FXX A;  3M1C A;  4ZI3 C;  2XAG B;  4JBW F;  3KV4 A;  1HG5 A;  3KDS E;  1T98 A;  4TWF A;  2D2S A;  3HA4 A;  4QXC B;  2FJE A;  4AQF C;  4DBQ A;  2BG9 A;  2E2A A;  2EHO D;  4WW0 A;  3UU5 A;  5C3J A;  5KXJ A;  1XMQ T;  4O4H E;  4HEA A;  4NUV A;  5CA0 E;  2SPC A;  3AVR A;  1MMN A;  3FB2 A;  1US7 B;  2ES0 A;  3KIN B;  3MXZ A;  3AAA B;  1Y01 A;  4UV9 B;  4OHF A;  3A5X A;  4UVC B;  3GMI A;  5FVK A;  3R6N A;  3RIF A;  3ZC1 A;  4ADZ A;  1D1A A;  3PHF 1;  5LP6 E;  4HWH A;  5HCJ A;  3AE5 A;  2W00 A;  3I9Y A;  4OFZ A;  2W4X A;  4HFB A;  2C5K T;  5JRC A;  1QSD A;  2MYS A;  4U33 A;  4QX8 B;  4H63 H;  1HCI A;  1KF6 A;  2CHN A;  5IUX A;  3LK3 B;  1OED A;  4TNW A;  2X0H A;  4GOU A;  4JV5 T;  1HNW T;  2R6G F;  1KNP A;  5FY7 A;  5LBQ B;  2IML A;  4ZEY A;  4KX6 A;  5KMG P;  4X5T A;  1SE7 A;  2Q9Q C;  4BA9 A;  4ZZC A;  4DR5 T;  2CM0 A;  2OA5 A;  5HEU A;  1KFY A;  1NAF A;  2YOE A;  4DR7 T;  2WMO A;  2HH7 A;  2LSJ A;  3C50 A;  4PFO A;  3ZN0 B;  2PBI A;  2P9B A;  3CX8 B;  4H9R C;  2Q9Q B;  1UGO A;  5DQV A;  4HWC A;  1W0A A;  1S35 A;  5TAO A;  2WB5 A;  3ZPO A;  5KDM C;  4EEB A;  3VHL A;  2V6Y A;  3LG7 A;  3PUW F;  3E0Z A;  2PG8 A;  3HKB E;  4ZI2 C;  1XDP A;  3L3P A;  1ZKE A;  3P7I A;  4ZI7 E;  3PE0 A;  1ZP0 A;  3FYQ A;  2LHR A;  2XAF B;  2XQ7 A;  5AQM B;  3ZMU B;  3AE2 A;  4JEH B;  4X1Y E;  3UUX B;  1UX5 A;  5AQO B;  5HXE A;  2WDV A;  4QH4 A;  3NWI A;  2EHO C;  5ABH A;  3PUG A;  1OED B;  2UXD T;  2LLY A;  3UU8 A;  2F4V T;  2L7N A;  1HTJ F;  5DAB A;  2D9D A;  4MBQ A;  2BDE A;  2V7I A;  4O4L E;  2ZLY A;  2XQY A;  2EHO B;  2YDS A;  4U7I A;  2JQK A;  4HWD A;  1XNR T;  4XBF B;  3RLF F;  1CHU A;  3GA8 A;  5E0O A;  2FJA A;  3VKG A;  1ZHC A;  4BGO A;  3FBZ A;  1MMA A;  3IEE A;  2K24 A;  2VL8 A;  2KZ7 B;  1Z0P A;  4UXN B;  5HEO A;  3RF1 A;  5JDQ A;  2I59 A;  3BQI A;  3O1I A;  1UUR A;  2HN1 A;  3K3Q C;  2Y48 B;  3EDV A;  3Q5D A;  4HTE A;  4KUM B;  4CQI A;  2C5I T;  5ABF A;  4O8S A;  5T1D A;  4NPP A;  5L3C B;  3LJC A;  1T72 A;  4X20 E;  2UUB T;  2VB6 A;  1ZEE A;  2XAQ B;  3GWH A;  2WDR A;  3PUY F;  3AXJ A;  3F2E A;  3PUV F;  1MMD A;  2XQA A;  4CI3 B;  2X9Y A;  5JDL A;  4ASK A;  4IHJ E;  3RIU C;  1IBK T;  4LF8 T;  3OJA A;  5AQV B;  2N1G A;  5GON E;  5HXS A;  3AEG A;  4YT0 A;  5JRE A;  2JQQ A;  5HEH A;  3FZF B;  3AAE B;  2NW7 A;  2B76 A;  3CQG B;  3F57 A;  2W62 A;  5EZY E;  5AQQ B;  1ZV4 X;  5JR9 A;  2XQ6 A;  4MHC A;  4QH5 A;  3TLW A;  2BZB A;  3ZCI A;  3WSC A;  4BJM A;  3JAD A;  4IL4 A;  1LVF A;  2M67 A;  2YKS A;  2XAH B;  5L3B B;  1HX8 A;  3ZT7 A;  3AEA A;  3ETV A;  5LHH B;  2HPL A;  4EB6 E;  5AQT B;  4IE7 A;  4EV6 A;  1JNZ A;  5LB7 B;  4GIW A;  4DMW A;  3P4P A;  4ONR A;  3C4W A;  2JQ9 A;  3IA3 A;  2CBJ A;  2KBB A;  3L8R A;  2QA7 A;  3C4X A;  4TWD A;  4YTM A;  3ZCJ A;  1SUM B;  2CMR A;  5A1L A;  5ABE A;  2ZM2 A;  4NXN T;  3UQ4 A;  2Q9Q A;  2X66 A;  3KV5 A;  3RYF E;  4A56 A;  2LM2 A;  4JI1 T;  4PJL A;  2YK0 A;  4JI5 T;  3O9X A;  2E5L T;  3EAB A;  1D0X A;  4UF0 A;  1BR4 A;  4DV3 T;  5CFB A;  2E9X D;  3RYC E;  3LFM A;  4G2A A;  3AEB A;  3N9Q A;  2EHO A;  3UUN A;  3Q2M A;  1UK5 A;  2VUR A;  4WNK A;  3SFE A;  5FXW A;  2MTC A;  3AT7 A;  5LHI B;  5HCM A;  4JI8 T;  3AE8 A;  4H9N C;  3RYI E;  3JC6 C;  2BVM A;  3IBP A;  2LT3 A;  2ZM8 A;  3OKQ A;  5LYJ E;  1G73 A;  3PUR A;  2JMH A;  1MIW A;  4NUU A;  5F8P A;  4B3T T;  2DWG A;  3DTO A;  4DV4 T;  4EZH A;  5L4E A;  2X0L B;  3LBX B;  2E9X B;  4UR9 A;  4DUY T;  2LSY A;  2V6X A;  5DJQ C;  1VCT A;  3UT5 E;  3LSV A;  3PUS A;  4YSZ A;  4YFS A;  4EIW A;  4HN9 A;  1WR0 A;  4DR6 T;  5AQH B;  5H6R B;  4DBR A;  3KBU A;  4H9S E;  1HFA A;  2JQH A;  2Y6X A;  4YTN A;  5AQU B;  3A8Y C;  2KLQ A;  2YU1 A;  4IT4 A;  3N5L A;  1W09 A;  3O1J A;  2YN6 A;  5AQR B;  1E1H B;  3ZYL A;  1VCS A;  4YXD A;  3N9M A;  4DR2 T;  2FJD A;  2N2N A;  1YQ3 A;  2CXF A;  4LMK A;  2JIW A;  4H9P C;  3HI2 A;  3CVR A;  5FXZ A;  4X1K E;  3KVA A;  2C5J A;  2X9W A;  5JRC B;  4TN7 B;  3VU7 H;  3OTO T;  1W0B A;  4J2C A;  4BAY B;  3KVB A;  4LF4 T;  3N2G E;  2X0C A;  1D1C A;  4GK0 E;  2LSI A;  1N33 T;  4JI0 T;  2J62 A;  4OYJ A;  3AVS A;  2LHN A;  3NRY A;  1X79 A;  2NOX A;  3DJB A;  2MBG A;  2K48 A;  2Q9Q D;  3N9L A;  3ONJ A;  3TLT A;  2X68 A;  2BG9 E;  4CN1 A;  4I43 B;  2WSS V;  1IJ6 A;  4YLH A;  5FMN A;  1E7P A;  3TLU A;  3VRA A;  1NEK A;  1U4Q A;  3H37 A;  3OPC A;  3FXE B;  5AQN B;  2QVA A;  3KV9 A;  3JAE A;  2BG9 C;  2XM1 A;  5LCY A;  3I9W A;  2D5U A;  1O3X A;  3QB5 A;  5BR8 T;  4DV6 T;  3CX7 B;  1Z8U A;  4HFV A;  5HXR A;  3ZMZ B;  3ZC0 A;  1D0Y A;  2H3R A;  4DND A;  2NW8 A;  4WBO A;  3T8O A;  2CLY B;  2LRK A;  2LKG A;  1D1B A;  2I6H A;  1NEN A;  1N32 T;  2BKP A;  2CE7 A;  2C0S A;  2QGS A;  3CQC B;  3HR0 A;  1IAP A;  3PU3 A;  3P50 A;  4B3S T;  2CLY C;  2LSG A;  4Z90 A;  3ONX A;  4EAH A;  1OED E;  3OYX A;  1WFD A;  2WS3 A;  2V5D A;  2XM2 A;  1KNR A;  1FMW A;  2WQY A;  3CIR A;  4QWN B;  3QOF A;  3ZJ1 A;  4LML A;  4ZI3 D;  3B57 A;  2KND A;  3RPU A;  2X67 A;  3ABV A;  5J0Z A; 
#chains in the Genus database with same CATH homology
 1KK7 A;  2ZM0 A;  5F3J A;  5FNV E;  1KNZ A;  4IE4 A;  3N9P A;  4O4I E;  2E9X C;  4I50 E;  1LKX A;  3KFW X;  4H63 V;  3R84 B;  3WI3 A;  3C64 A;  3ZLI A;  4CI1 B;  4UV8 B;  2LQU A;  1FIO A;  5LBM A;  3PTR B;  4O2A E;  4GYR A;  2LOS A;  3MAC A;  3I1A A;  3MK7 C;  5FYM A;  4EYU A;  4AKG A;  3OYZ A;  4IE0 A;  4PJM A;  1YKH B;  3PU8 A;  2Y8D A;  3IHR A;  4UEL A;  3AB3 B;  3K8P C;  5HXC A;  3EUH A;  5C8Y E;  4IE5 A;  5L3F B;  5LGT B;  4YJ2 E;  2W63 A;  4ZS3 A;  3N9N A;  2WM9 A;  4JEU B;  5JVD E;  4ILU A;  4BJN A;  5LXT E;  1G8X A;  2LEH A;  1Y64 B;  4DO0 A;  4IIJ E;  4PJJ A;  4ECG A;  1HS7 A;  5FY0 A;  2KWH A;  4EXT A;  4ZOL E;  4L0R A;  4TV9 E;  4XAX B;  2DWK A;  4UVB B;  2IW5 B;  2UXN B;  5J2U E;  5IHY A;  5EK2 A;  2YU2 A;  4PAG A;  4UVA B;  5LJN A;  5CB4 E;  3J9X 1;  5J2T E;  2BVL A;  2NTX A;  1BR2 A;  4OYK A;  2ZMA A;  3N2O A;  4ISS A;  5JDM A;  5LGU B;  3BQL A;  3RRW A;  4O4J E;  2VWA A;  2LJL A;  3KBT A;  4H9Q C;  2XTL A;  5L3D B;  4B6X A;  2PFV A;  2KXP B;  4O2B E;  5LHG B;  2W0G A;  4EYY R;  2LM9 A;  3FXD B;  2VKD A;  3PDY A;  4PFP A;  4TV8 E;  4TZ4 C;  2X9X A;  1MIY A;  3ANW B;  4K0U A;  5J1G A;  3JC6 D;  5JDG A;  1FEW A;  4AXP A;  2XUE A;  3DP7 A;  3VJZ A;  1EZ3 A;  4C90 A;  3IF8 B;  2UXX B;  3RRC A;  3RH3 A;  4PNI A;  4QX7 B;  4WBN E;  3BQK A;  2CWY A;  4UEM A;  4MLK A;  1B7T A;  5EK4 A;  2LE8 A;  3K3N A;  3B13 A;  3U3I A;  3V5U A;  5BMV E;  2K9A A;  4L5G A;  4V1A v;  3MA9 A;  3AA0 B;  4GYS A;  4GK5 E;  5LNK A;  2DLR A;  5FY1 A;  2X9H A;  4QKN A;  2A2F X;  4M1P A;  3SWH A;  5LG4 A;  2V7M A;  3LBX A;  1QUU A;  3AA1 B;  1SHZ C;  1WRD A;  5HAX A;  3RC8 A;  1VRB A;  2YEV C;  2DNX A;  3TKL B;  2WBL A;  1D0Z A;  5JQG E;  1MMG A;  3NZP A;  3GN5 A;  3MKD A;  2IC6 A;  5ADX L;  5FP3 A;  1IJ5 A;  2V7L A;  3WAJ A;  5HYA A;  4YHJ A;  2VAS A;  4QXH B;  2W61 A;  1UCU A;  3N9O A;  5LOV E;  4EOZ B;  1WR6 A;  3CKD A;  4PW8 A;  1FMV A;  2DHR A;  4H9O C;  3I0O A;  1AJ3 A;  4CXY A;  2CWO A;  1IZN B;  3EVY A;  3RYH E;  2L3L A;  4HKA A;  3FBL A;  4XZC A;  2KWI B;  3KV6 A;  1NWM X;  3QUJ A;  3PUA A;  1SA0 E;  1UX4 A;  4DMV A;  4EB6 E;  3ETU A;  5JDH A;  2VK9 A;  3C4Z A;  3C98 B;  4IDZ A;  3L09 A;  4IE6 A;  2LSK A;  3AA7 B;  2WMN A;  2CA5 A;  4PK6 A;  2V7K A;  3LK4 2;  3BK9 A;  3NRX A;  2VKO A;  2KIN B;  1CUN A;  3F31 A;  5LA6 E;  4Z8X A;  2A72 A;  5DQW A;  4TUY E;  3ESL A;  5M4Y A;  4KMC A;  4U72 A;  5H6Q B;  2VKH A;  2KT9 A;  2H7V C;  2PJQ A;  3E22 E;  3WAK A;  3CPZ A;  3GN5 B;  3V5S A;  3K3O A;  2KMF A;  3Q5X A;  1WYB A;  2WAU A;  4JLE A;  2CXD A;  3N2K E;  5HWY A;  2LOP A;  2NW9 A;  3AAI A;  3PF0 A;  1OWA A;  4G63 A;  4ANJ A;  2X51 A;  2CCQ A;  1U5P A;  3P8C D;  2A3D A;  2L8K A;  3ZJ2 A;  2WWU A;  1YD8 G;  2B1E A;  4KBM B;  3ZMT B;  3NZQ A;  4DVD A;  3HKC E;  4FJO A;  3UTK A;  1S94 A;  2JJ9 A;  2YIN A;  4CI2 B;  3ZN1 B;  3MJX A;  2NTY A;  2MOZ A;  2NP9 A;  4JUY A;  2HPJ A;  3UFE A;  2D0T A;  1MNE A;  2VKJ A;  1MIV A;  3Q9D A;  4AI6 A;  2V1D B;  4QXB B;  4KP3 C;  4UIG A;  4AKL A;  1H7C A;  4EZ4 A;  2XAS B;  3PUQ A;  3ZYK A;  5FXV A;  3CQX C;  5JDF A;  1WYC A;  3SOL A;  3QC9 A;  3VKH A;  1OXZ A;  3RC3 A;  3RKO A;  3AA6 B;  3O1H A;  4PK5 A;  2XHE B;  3I0Q A;  4X1I E;  2E9X A;  2RA1 A;  1LRZ A;  3U78 A;  2ODU A;  3Q5W A;  2JMK A;  2H7O A;  5CA1 E;  3ANW A;  4PJN A;  3J7Y q;  4CXW A;  2L9Q A;  3ZMV B;  4I55 E;  4ERR A;  2IC9 A;  4AQF A;  4E7S A;  3LK2 B;  1WLX A;  4TX5 A;  2MTQ A;  4IST A;  1BR1 A;  4P0B A;  3ZMS B;  4F6R C;  1LVK A;  4CZZ B;  4C91 A;  2RP4 A;  5JR9 B;  2ACX A;  2CEA A;  4IGU A;  4AKR B;  3O4X E;  4CXX A;  2E8I A;  3W15 B;  4ZHQ E;  3E08 A;  3ZYM A;  5HXH A;  4MAL A;  1BR0 A;  2XAJ B;  4OK0 A;  4P09 A;  3HKE E;  3CX6 B;  5LJM A;  2JPF A;  4L9I A;  3FHN A;  5L3E B;  2D0U A;  4AQG A;  2G0U A;  4U74 A;  4AKI A;  3QK6 A;  3UUM A;  2V26 A;  4HGA A;  1YKE B;  4AKH A;  3RX6 A;  4ZS2 A;  1VOM A;  2GK9 A;  3HKD E;  2CXL A;  4UF0 B;  5ETW A;  2DI4 A;  3M65 A;  4E7Z A;  1MND A;  5L3G B;  2ODV A;  2IAK A;  3HL6 A;  5L2L A;  3S4U A;  3UUL A;  5HWX A;  5JDN A;  4N78 D;  3CML A;  5AFU L;  2J1D G;  4MFR A;  2JRK A;  1YW0 A;  2Z6E A;  3C51 A;  4FI5 A;  3NBX X;  5KX5 E;  4P0A A;  4HE8 A;  2DCF A;  4YJ3 E;  4QHO A;  4I4T E;  5IYZ E;  3SRZ A;  3EDU A;  3MZK B;  2V7J A;  3WUR A;  5EK3 A;  2NWB A;  3SS1 A;  1HF8 A;  5LGN B;  5JH7 E;  1HG2 A;  3H3A A;  3CWZ B;  1V9D A;  2N9D A;  4PK4 A;  3D0T A;  2K5B B;  3OBV E;  3ZEF B;  4ZI2 D;  3M1C A;  5FXX A;  4ZI3 C;  2XAG B;  3KV4 A;  1HG5 A;  3KDS E;  1T98 A;  2D2S A;  3HA4 A;  4QXC B;  4AQF C;  4DBQ A;  2EHO D;  4WW0 A;  4O4H E;  4HEA A;  4NUV A;  5CA0 E;  2SPC A;  3AVR A;  1MMN A;  3FB2 A;  1US7 B;  2ES0 A;  3KIN B;  3MXZ A;  3AAA B;  4UV9 B;  4OHF A;  3A5X A;  4UVC B;  3GMI A;  3R6N A;  3ZC1 A;  4ADZ A;  1D1A A;  3PHF 1;  5LP6 E;  2W00 A;  3I9Y A;  4OFZ A;  2C5K T;  5JRC A;  1QSD A;  2MYS A;  4QX8 B;  4H63 H;  1HCI A;  3LK3 B;  4GOU A;  5LBQ B;  5FY7 A;  5KMG P;  2Q9Q C;  4BA9 A;  2CM0 A;  2OA5 A;  1NAF A;  2WMO A;  2HH7 A;  2LSJ A;  3C50 A;  4PFO A;  3ZN0 B;  2PBI A;  2P9B A;  3CX8 B;  4H9R C;  2Q9Q B;  5DQV A;  1S35 A;  5TAO A;  3ZPO A;  5KDM C;  3VHL A;  3LG7 A;  3E0Z A;  2PG8 A;  3HKB E;  4ZI2 C;  3L3P A;  3P7I A;  1ZKE A;  4ZI7 E;  3PE0 A;  2LHR A;  2XAF B;  3ZMU B;  4JEH B;  4X1Y E;  3UUX B;  1UX5 A;  5HXE A;  2EHO C;  3PUG A;  1HTJ F;  5DAB A;  4MBQ A;  2BDE A;  2V7I A;  4O4L E;  2ZLY A;  2XQY A;  2EHO B;  4XBF B;  3VKG A;  5E0O A;  3GA8 A;  4BGO A;  1ZHC A;  3FBZ A;  1MMA A;  3IEE A;  2K24 A;  2VL8 A;  2KZ7 B;  1Z0P A;  4UXN B;  5JDQ A;  2I59 A;  3BQI A;  3O1I A;  3K3Q C;  4KUM B;  2Y48 B;  3EDV A;  4HTE A;  4CQI A;  2C5I T;  5T1D A;  4O8S A;  5L3C B;  3LJC A;  4X20 E;  2VB6 A;  1ZEE A;  2XAQ B;  3GWH A;  3F2E A;  4CI3 B;  1MMD A;  5JDL A;  2X9Y A;  4ASK A;  4IHJ E;  3OJA A;  5GON E;  2N1G A;  5HXS A;  5JRE A;  2JQQ A;  3AAE B;  2NW7 A;  3CQG B;  3F57 A;  2W62 A;  5EZY E;  5JR9 A;  1ZV4 X;  3WSC A;  4MHC A;  2BZB A;  3ZCI A;  4BJM A;  1LVF A;  2M67 A;  2XAH B;  5L3B B;  1HX8 A;  3ETV A;  5LHH B;  2HPL A;  4IE7 A;  4GIW A;  4DMW A;  4ONR A;  2QA7 A;  3C4X A;  3ZCJ A;  5A1L A;  2CMR A;  2ZM2 A;  2Q9Q A;  2X66 A;  3KV5 A;  3RYF E;  4A56 A;  4PJL A;  2YK0 A;  3O9X A;  1D0X A;  4UF0 A;  1BR4 A;  2E9X D;  3RYC E;  3LFM A;  4G2A A;  3N9Q A;  2EHO A;  3UUN A;  3Q2M A;  4WNK A;  2MTC A;  5FXW A;  3AT7 A;  5LHI B;  4H9N C;  3RYI E;  3JC6 C;  2BVM A;  3IBP A;  2LT3 A;  2ZM8 A;  3OKQ A;  5LYJ E;  1G73 A;  3PUR A;  2JMH A;  1MIW A;  4NUU A;  5F8P A;  2DWG A;  3DTO A;  4EZH A;  2X0L B;  3LBX B;  2E9X B;  2LSY A;  5DJQ C;  3UT5 E;  3PUS A;  4YFS A;  4EIW A;  4HN9 A;  5H6R B;  4DBR A;  3KBU A;  4H9S E;  1HFA A;  2Y6X A;  2KLQ A;  2YU1 A;  3N5L A;  3O1J A;  3ZYL A;  1E1H B;  3N9M A;  2N2N A;  2CXF A;  4H9P C;  3HI2 A;  3CVR A;  5FXZ A;  4X1K E;  3KVA A;  2C5J A;  2X9W A;  5JRC B;  4TN7 B;  3VU7 H;  4J2C A;  4BAY B;  3KVB A;  3N2G E;  1D1C A;  4GK0 E;  2LSI A;  4OYJ A;  3AVS A;  2LHN A;  3NRY A;  1X79 A;  2NOX A;  3DJB A;  2MBG A;  2K48 A;  2Q9Q D;  3N9L A;  5JR9 C;  2X68 A;  4I43 B;  2WSS V;  1IJ6 A;  4YLH A;  5FMN A;  1U4Q A;  3H37 A;  3FXE B;  3KV9 A;  5LCY A;  3I9W A;  2D5U A;  1O3X A;  3CX7 B;  4HFV A;  5HXR A;  3ZMZ B;  3ZC0 A;  1D0Y A;  2H3R A;  4DND A;  2NW8 A;  4WBO A;  3T8O A;  2CLY B;  1D1B A;  3CQC B;  2CE7 A;  2C0S A;  2QGS A;  3HR0 A;  1IAP A;  3PU3 A;  2CLY C;  2LSG A;  4EAH A;  3ONX A;  3OYX A;  3ZJ1 A;  4QWN B;  1FMW A;  4ZI3 D;  3B57 A;  2KND A;  3RPU A;  2X67 A;  3C4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...