5HWXA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and zero ca2+
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
301
structure length
294
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 126
structure length 294
sequence length 301
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hwxA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hwxA02
5JDHA 5HXSA 3V5SA 5JDMA 5HWXA 5JDFA 5HXCA 5HXHA 5HWYA 5JDGA 3V5UA 5JDNA 5JDQA 5HXRA 5JDLA 5HXEA 5HYAA
chains in the Genus database with same CATH superfamily
4YFSA 3ZSSA 5DJQC 4TV9E 3AEDA 5AQNB 2IUBA 4DV1T 5LJMA 4O8SA 4DV6T 5LMNT 4DR5T 4JI3T 2X9YA 3KBTA 3A8YC 4P1NA 4ILCA 1XMOT 1XNQT 4NXMT 3Q9DA 4CN1A 3CPZA 2DWGA 2W66A 3UQ7A 4EOZB 2BKPA 5L4HA 2ACZA 3P50A 3PUXF 2KSRA 3TLUA 3FZMB 2XAJB 2LSKA 1CUNA 1QUUA 1UK5A 4AQYT 4E7SA 5ABFB 1B7TA 5AQVB 4JI7T 2XQ3A 2YK0A 2BKNA 2OLTA 5JRCB 5CJ5A 5IHYA 2VVNA 1T98A 2CPTA 2V6YA 2WZHA 3WSCA 4LFBT 2N9DA 4UIGA 4TV8E 2R6GF 4KHZF 5AQKB 3GN5A 1US7B 3GA8A 4UXNB 1OWAA 3AE4A 4FJOA 2BDEA 2D0UA 5AQLB 4JI8T 3PUSA 4U33A 3H3AA 4HWFA 3AE6A 4L0RA 5FNVE 4LF7T 3UFEA 1D0ZA 3AEGA 2XHEB 3UQ4A 3V5SA 3X1DA 2DWKA 4MBQA 1G8XA 2LKHA 3PU8A 3RX6A 2LEHA 4I4TE 5FKYA 4QKNA 1U5PA 3QNUA 2CWOA 4CZZB 2NR4A 2VL0A 1Y64B 2M67A 3RH3A 1OEDC 3RLFF 4H9QC 4HWDA 1BR4A 2V7IA 4O4HE 2NTXA 4HEAA 5LCYA 1MIYA 1D1BA 1XMQT 3HKDE 5LG4A 4DV3T 2KMFA 1N34T 5KXJA 4ILAA 4HFVA 4HFCA 1XZYA 2C0SA 1SE7A 1JNRA 4B3RT 4AKIA 1UGOA 1X79A 5C3JA 3U3IA 4HE8A 2NW8A 4YXDA 2JMHA 2XPKA 4JI5T 4CXWA 2J62A 2P9BA 4KHPT 3N9LA 4JI1T 2Q9QC 5AQFB 4IE6A 3NWIA 2VKOA 2XAQB 3AA7B 3ANWA 1WRDA 3ZN1B 3HKEE 4OHFA 4IGUA 3IA3A 3ZMSB 4LMJA 2I6HA 3EVYA 2FBWA 3C50A 3RKOA 3DP7A 3N5LA 4ZS2A 3RIUA 1KEYA 3UUBA 4U7IA 5CA0E 3CX6B 4LMKA 1XDPA 3JC6D 3NKZA 3CIRA 3PUVF 4DV2T 2UXBT 2GK9A 4QHOA 3FZFB 2XQ5A 1OEDE 1BR0A 3AXJB 2CXFA 3ETUA 3N9MA 3ZN0B 4NXNT 3NBXX 3ZCIA 1XWMA 2A72A 3RYHE 4TUYE 4HWCA 1NEKA 4X20E 5AQIB 5HXSA 4W8PA 4PJLA 4JI6T 1UX5A 3LDQB 3Q2MA 4ZI3D 1FMWA 4GOUA 3AT7A 5LG3A 3PU3A 3CK6A 4WBNE 4ZI2C 2ODVA 2CHOA 4QH4A 4TX5A 2XZEA 3O1HA 4ZOLE 3ZPOA 3FZHB 3EAMA 3QUJA 3NRXA 2YU2A 4YSXA 4DUZT 4YSZA 2MBGA 2WZIA 1YKEB 2V5DA 3RRWA 1HR0T 3AVRA 4UV8B 3DTOA 5FXXA 2X0YA 3MJXA 2KT9A 2XQYA 4C90A 3PDYA 1E2AA 1O3XA 3UU3A 3VR8A 2DNXA 1IZNB 2E9XB 3FB2A 5HXEA 5GONE 2ZLYA 5FXZA 1XDOA 2C5IT 4XAXB 2LRKA 4AXPA 3ZMUB 3ESLA 3KV6A 2CEAA 3FZLB 3MZKB 4ZZCA 2ZM8A 3M3ZB 3UU8A 3VRAA 5LA6E 2W0GA 4PJJA 3RKGA 5JDQA 5HAXA 2Y8DA 4L9IA 5ABGA 4EEBA 3JCFA 3C4XA 2IW5B 1L0VA 3TLSA 1VCSA 2UXXB 2V7LA 3SS1A 2ZM6T 3C98B 4UVCB 2CRBA 1X9BA 1OXZA 2X68A 5ETWA 4ONRA 2BG9B 3T8OA 4V1Av 3UULA 4K0KT 3DJBA 4IHJE 3PJAA 5BR8T 4G63A 1ZV4X 3ONLC 4H9OC 3PUWF 1BR1A 4U31A 4JEUB 3ZEFB 2EHOA 5L4EA 2CM0A 5JREA 1S35A 2KLQA 5J1GA 4DBQA 5H6RB 5HXCA 5HXHA 4JV5T 4EV6A 3VRBA 3CVRA 3QK6A 1FJGT 3KDSE 2MPKA 2V7KA 2N2NA 5FXWA 3NVOA 2LJLA 4AQFA 4AKRB 3VKHA 2M6BA 2H7VC 1HS7A 2JQQA 2C5JA 2UUBT 3I9WA 4A5XA 4JEHB 2V6YB 1D1CA 3TKLB 4DR7T 2WU5A 5EK2A 1MIVA 2ES0A 4EB6E 4HKAA 5LNKA 3GN5B 3LJCA 4GK0E 3O9XA 4EEDA 4LMLA 1ZKEA 2XQ8A 3PUYF 2B1EA 4Z91A 4AI6A 5HWXA 3CQXC 2MTQA 4DR4T 4EXTA 4B3ST 1Z0PA 5FXVA 2LSIA 2CHNA 5DQWA 4LF5T 3C4ZA 2HN1A 5L3CB 2K48A 1J5ET 5HYAA 2CLYB 2W63A 5AQMB 1IBKT 4XBFB 4IE7A 5LXTE 4L5GA 1BR2A 2D9DA 2MYSA 4AIUA 1VCTA 2CA5A 4HTEA 2DLRA 3RPUA 4IREA 4H9RC 3UFGA 4GYSA 2H89A 5EZYE 3ZLIA 5CA1E 2HN2A 3SFEA 3KV5A 4J2CA 4F8HA 2QGSA 3B57A 4HWHA 2V8SV 3MK7C 5HEUA 4AKLA 2W67A 2JMKA 1YQ3A 5L3DB 2DHRA 3AE1A 2WMNA 2DL1A 3GMIA 4DV0T 5F8PA 4TN7B 2W62A 1MMGA 4KI0F 3SWHA 4PJNA 4DV5T 4GIWA 5L3EB 1YQ4A 1SJ7A 3U78A 4DNDA 4ZHQE 3ZT5A 3JAEA 5EK4A 5IWAT 3RGLA 5JDFA 2LM2A 1T8BA 2NOXA 5JR9A 1VRBA 2K3WA 3QB5A 2PJQA 4UR9A 2EHOC 5KX5E 4DMVA 3L8RA 3OVUA 4LF4T 4IIJE 5JDLA 3AE3A 4YJ2E 3ZMTB 5LP6E 3DYJA 3EABA 2LT3A 4QX7B 2L3LA 4U2ZA 2UU9T 5C8YE 3R84B 2VASA 4ISSA 4DR3T 2WDRA 3HA4A 5FMNA 3UU6A 3PE0A 5JDHA 2YKSA 5IYZE 1LRZA 3UUXB 3I0OA 4WYVA 3RQUA 4CN6A 5J2TE 2KZ7B 3WURA 3FXEB 2CBJA 4O2AE 3RF1A 2E9XC 5CB4E 3PHF1 3E22E 1XNRT 4IDQA 3E08A 3L09A 4YY3T 2WU2A 2XM2A 3UT5E 4P0AA 5LYJE 2QYWA 5LGNB 3RC3A 3AAIA 5F3JA 2OA5A 4TWDA 3NRYA 2XUEA 2X9WA 5M4YA 4B3MT 4DV4T 1H7CA 1YW0A 1QLBA 4JBWF 2KBBA 5J2UE 4B6XA 2UXDT 4E7ZA 2VKHA 2ACXA 2NW9A 5AQHB 3V5UA 2X0LB 4MALA 3P4SA 3KFWX 2Y48B 5LHIB 1IJ6A 3VHLA 3ZMZB 1KFYA 3Q5WA 2BG9C 3C4WA 3AEEA 3PV0F 2IC9A 2HH7A 3ZC0A 4PK5A 2K5BB 3G06A 5FY0A 2LHNA 1I6ZA 3MACA 3OYXA 2L8KA 2Q9QD 1I94T 3MKDA 4HFIA 2W61A 3ZT7A 1IJ5A 3H3MA 1HNZT 3PURA 5LGTB 5FVLA 3PUZF 2KNDA 1EZ3A 1W9RA 4X5TA 2LSJA 2XQAA 1G73A 3NZPA 1T72A 2ZMAA 4ZXLA 2BZBA 1IBMT 2YINA 3AA6B 5J0ZA 1KNZA 5JR9C 1WYBA 2EHOB 3AE8A 1ZOYA 2UXNB 5JDMA 4ERRA 2HPJA 3OJAA 3ZCJA 2WDQA 4CXYA 1FIOA 2RP4A 4YSYA 5HCJA 2OV9A 2L7NA 5FY1A 2BG9E 2AE9A 2IIUA 1WYCA 4K0UA 1D0XA 2FJBA 1Y01A 4UV9B 2W2UA 4I55E 5JTGA 2E5LT 5IUXA 4TWFA 4OYJA 3HL6A 4ZI2D 3L39A 2YDQA 5LBMA 3ZMVB 4I50E 3RYIE 2KXPB 4YLHA 4U7YA 1NENA 4X1YE 4EGWA 3EDVA 5LHHB 2JRKA 4KX6A 3IHRA 4X62T 4IDOA 3CX8B 2CLYC 3P4QA 4IDZA 1HNXT 3AY5A 4KUMB 4AQGA 4BJMA 3S4UA 3O4XE 3IBPA 3BK9A 4LFCT 3RYCE 4ZI7E 2F4VT 2Y6XA 2LKGA 4IL4A 5FZTA 2CBIA 2JJ9A 4IE0A 2E8IA 4X66T 4XZCA 3FHNA 2BBHA 4PK6A 1IBLT 2RPAA 4C91A 2D2SA 2BS2A 3H37A 1N36T 3B13A 5FL0A 4TNVA 2V5CA 2XSAA 2YDRA 2WSSV 4OX9T 4JI2T 3VU7H 4AISA 4X64T 3RYFE 3Q5XA 2M6IA 4YHHT 2CCQA 3I1AA 4DMWA 3ZYKA 3BQKA 2CXLA 3CQCB 2V1DB 3SRZA 4QWNB 3N9PA 4LF9T 4QH5A 5A1LA 3M65A 3CMLA 3J7Yq 1YD8G 3P8CD 4OK0A 2XQ7A 3F2EA 4P0BA 2DI4A 5ADXL 1KNRA 3RIUC 2I59A 2QRXA 2L9QA 3AB3B 3EHZA 2CWYA 1M7KA 2WQYA 3E0ZA 1UCUA 4MFRA 3UUNA 4DR6T 1R8IA 3OBVE 1D1AA 1E1HB 4U72A 5JR9B 3LK42 3UUMA 3HKBE 3KV9A 2KWIB 1CHUA 3Q5DA 4Q25A 2YN6A 4FI5A 2XAGB 4EZ4A 2X0HA 2AXDS 3F57A 2WP9A 2CXDA 1UURA 4ISTA 4UELA 4PAGA 5HCMA 1Z8UA 1MMDA 5JH7E 5LB7B 5CGMA 3N9NA 2W00A 5HEOA 4BGOA 4G2AA 3PUQA 5L3GB 4CI1B 2X0CA 4JI0T 4ILUA 4ZEYA 3A7MA 4CQIA 3AEAA 1QSDA 4NUUA 2IAKA 5JVDE 4EIWA 3LK3B 1MMAA 5FY7A 2XJ7A 2WAUA 4DR1T 5LGUB 4HN9A 1E7PA 1J5WA 1OEDA 2JQ9A 1WR6A 4LF6T 3AE5A 1ZP0A 2WDVA 1DU2A 2VL8A 5TAOA 3ZYLA 5AQOB 4DIDB 4N78D 3TLWA 1HCIA 2Z6EA 4UF0A 4KBMB 2C5KT 3TLTA 2XY8B 2XASB 3KV4A 4GK5E 4ADZA 2IC6A 2H7OA 1UUSA 3T1YT 4QXCB 2PTFA 4GKJT 4YHJA 4PJMA 4CI3B 3RC8A 1IAPA 2Q9QA 3LBXA 4HGAA 2LRLA 3AEBA 5AQJB 3A5XA 5JQGE 3ABVA 3OTOT 3LK2B 2LQUA 2UXCT 4X65T 2WWUA 3EUHA 2XM1A 3N2GE 4AKHA 3RI5A 1WCRA 2MOZA 2X9HA 1SUMB 4QH1A 3UU4A 3HI2A 1WLXA 3SFDA 4X1IE 4JYAT 2YOEA 3ANWB 2XTLA 3BQLA 5FYMA 1HNWT 1NAFA 4QX8B 5LJNA 3D0TA 4YTPA 3ONJA 5LBQB 3AA0B 4BA9A 3MA9A 5AFUL 1HTJF 2WBLA 4JLEA 1MIWA 2RA1A 4I43B 2JQKA 3FZKB 3ZT6A 3W15B 4NUVA 3AE7A 2EHOD 2ZM0A 4H9SE 4Z8XA 4PK4A 4COFA 2BS4A 4LF8T 4A97A 5HEGA 4ANJA 3M1CA 3PUAA 4AQFC 2V7JA 2VK9A 2VKJA 3PTRB 4H9NC 2N1GA 3PF0A 1VOMA 3OPCA 2JIWA 3OKQA 2KGXA 2L10A 3N9OA 3KVAA 4WNKA 2J4GA 4O4IE 4GYRA 2I0MA 5JDGA 2X9XA 2LLYA 2XAFB 4QXHB 3K3OA 2BS3A 5AQRB 4OYKA 1HFAA 4BJNA 4BAYB 2DCFA 3KVBA 4KMCA 1W09A 4YT0A 5ABHA 1N32T 2LOSA 2YU1A 4IE4A 1MNEA 2E9XD 4U74A 3P4WA 3VR9A 2XSBA 5AQTB 3RQWA 4A56A 3B5MA 1LVFA 4U2YA 2FUPA 2X51A 2V26A 2WMOA 2W4XA 4HWIB 3ZYMA 1AJ3A 2A2FX 3I9YA 4O2BE 3C64A 3J9X1 5L2LA 4YJ3E 4JI4T 1ZEEA 3UU5A 2XAHB 4YTMA 2X67A 4HFDA 4EYUA 4IT4A 3O1IA 4IL9A 3PUGA 3CX7B 4KP3C 2LHRA 2J47A 5T1DA 2BBJA 4UVBB 3P4RA 4X1KE 2ODUA 4U3CA 4JUYA 5EK3A 5DQVA 4ASKA 1NWMX 3AVSA 3ZJ2A 5FP3A 4NIQA 1W0BA 2YDSA 2QVAA 4Z90A 3JC6C 4PW8A 1M62A 3KBUA 5ABFA 4GKKT 4YTNA 1N33T 5JRCA 4QXBB 2VURA 3CWZB 4ZS3A 2FJEA 2YEVC 2NWBA 3QOFA 4TNWA 2SPCA 3N2KE 4PNIA 2K24A 3RIFA 3AA1B 2MAWA 1KK7A 4HFBA 3AECA 2JQHA 4LFAT 3JADA 3RRCA 2ZM2A 4P09A 3NZQA 4ZI3C 3N9QA 1LKXA 2XQ9A 1SHZC 2CMRA 1FMVA 1MNDA 3RIAA 2KWHA 3AE9A 4IDNA 4DO0A 2G0UA 3ZSTA 2FJAA 3K1SA 2NTYA 1FEWA 2BVMA 3SOLA 2IMLA 1KF6A 2UUAT 3FYQA 5HEJA 1S94A 5AQGB 2BVLA 2B76A 3FXDB 4DR2T 3P4PA 3PJAJ 2XQ6A 2A9UA 1YXRA 3K3NA 5LHGB 2VB6A 3QB5K 5AQQB 1ZHCA 3WI3A 4OFZA 3ZC1A 5H6QB 4MLKA 1W0AA 4A98A 2VQFT 4ILBA 5CFBA 2WCAA 4WW0A 1T7SA 3P7IA 4TWHA 4IE5A 3N2OA 3BQIA 4WZXA 5AQUB 2LOPA 5HWYA 3HKCE 3IEEA 5FL1A 2WM9A 3CQGB 4ZZBA 4ECGA 2LSYA 3ZKRA 3TLVA 4F6RC 3O1JA 4DVDA 1OEDB 2LE8A 3AE2A 1J1JA 5LOVE 1MMNA 2VQET 2NW7A 3K8PC 1LVKA 4WBOA 3FBLA 4UEMA 4UVAB 5KDMC 1WFDA 4PFOA 3Q5EA 2H88A 5ABEA 5E0OA 3R6NA 4UF0B 1SA0E 2WS3A 2PBIA 3WAKA 4IDPA 1JNZA 1HX8A 3VKGA 1HG2A 3LSVA 3F31A 2MTCA 3JAFA 5HXRA 1U4QA 4CN4A 2VWAA 2Q9QB 2BKOA 3LBXB 4CI2B 3AXJA 4DV7T 4EYYR 3OYZA 5F5WA 2WWVA 1KNPA 2LSGA 4HFEA 2PFVA 4I0UA 5C2TA 3KINB 5DABA 4MHCA 4PFPA 4O4JE 2WB5A 3CKDA 3FBZA 2K9AA 3L3PA 5L47A 2VKDA 2V6XA 4B3TT 4F7GB 3GWHA 2QA7A 5FVKA 3LG7A 5L3BB 4H63V 2VVSA 3MXZA 1HX1B 3AEFA 3QC9A 4EAHA 4AKGA 2XQ4A 3T1HT 2FJDA 4O4LE 4CXXA 3AAEB 2LM9A 2WY2A 5L3FB 5BMVE 2CE7A 5HEHA 4M1PA 4HFHA 2NP9A 3EI0A 2E9XA 3LFMA 3WAJA 2IHR1 3ZJ1A 1SJ8A 1UX4A 4H63H 5LMUT 2A3DA 3VJZA 1YKHB 3RHWA 4EZHA 3UTKA 2X66A 3ONXA 2D5UA 3K3QC 4H9PC 4NPPA 2HHHT 5KMGP 2HPLA 4DBRA 2KINB 2KVPA 1GQEA 3AAAB 5AQSB 3I0QA 2V7MA 2UUCT 2H3RA 3EDUA 2D0TA 4TZ4C 3IF8B 2IDOB 1WR0A 3HR0A 2JPFA 2PG8A 1D0YA 2J1DG 5JDNA 2E5VA 3ETVA 5AQPB 1V9DA 2E2AA 3C51A 1HF8A 2BG9A 4DUYT 1HG5A
chains in the Genus database with same CATH topology
4YFSA 2YU1A 4IE4A 3ZEFB 1MNEA 2EHOA 4K0UA 4TV9E 2E9XD 1D0XA 4U74A 5DJQC 4UV9B 5LJMA 2CM0A 5JREA 4O8SA 1S35A 4I55E 2KLQA 5J1GA 4DBQA 5H6RB 4A56A 1LVFA 5HXCA 2X9YA 3KBTA 5HXHA 4OYJA 3HL6A 4ZI2D 3CVRA 2X51A 3QK6A 2V26A 5LBMA 3ZMVB 3KDSE 2WMOA 4I50E 3RYIE 2KXPB 4YLHA 3ZYMA 2V7KA 1AJ3A 2A2FX 2N2NA 3I9YA 5FXWA 4O2BE 3C64A 2LJLA 4AQFA 3Q9DA 4AKRB 3VKHA 4X1YE 3J9X1 3CPZA 5L2LA 4YJ3E 3EDVA 2DWGA 2H7VC 4EOZB 5LHHB 1ZEEA 2JRKA 2XAHB 3IHRA 1HS7A 2JQQA 2C5JA 3CX8B 2CLYC 2X67A 3I9WA 4IDZA 4JEHB 4EYUA 1D1CA 3TKLB 3O1IA 2XAJB 2LSKA 1CUNA 1QUUA 3PUGA 5EK2A 1MIVA 3CX7B 4KUMB 4AQGA 4BJMA 3S4UA 3O4XE 4KP3C 2LHRA 4E7SA 2ES0A 4EB6E 4HKAA 5T1DA 5LNKA 1B7TA 4UVBB 2YK0A 4X1KE 3GN5B 3IBPA 2ODUA 3LJCA 5JRCB 5IHYA 3BK9A 4JUYA 4GK0E 3RYCE 3O9XA 5EK3A 1T98A 4ZI7E 2Y6XA 5DQVA 4ASKA 1NWMX 1ZKEA 3AVSA 3ZJ2A 3WSCA 2JJ9A 4IE0A 2N9DA 4UIGA 5FP3A 2E8IA 4XZCA 2B1EA 3FHNA 4PK6A 4TV8E 4AI6A 5HWXA 3CQXC 4C91A 3JC6C 4PW8A 2MTQA 4EXTA 3KBUA 1Z0PA 5FXVA 2D2SA 2LSIA 3GN5A 5JRCA 4QXBB 3H37A 5DQWA 3B13A 3CWZB 4ZS3A 1US7B 3GA8A 4UXNB 1OWAA 3C4ZA 4FJOA 2YEVC 2NWBA 5L3CB 2SPCA 2WSSV 2BDEA 3N2KE 2K48A 2D0UA 4PNIA 2K24A 3VU7H 3AA1B 2CLYB 3RYFE 1KK7A 5HYAA 2W63A 3Q5XA 3PUSA 3H3AA 2CCQA 4XBFB 3I1AA 3RRCA 4IE7A 2ZM2A 4DMWA 5LXTE 4L5GA 4L0RA 4P09A 3ZYKA 3NZQA 5FNVE 3BQKA 3UFEA 1BR2A 1D0ZA 2CXLA 4ZI3C 3N9QA 2MYSA 3CQCB 2CA5A 2XHEB 4HTEA 2V1DB 2DLRA 3V5SA 1LKXA 4QWNB 3SRZA 3RPUA 4H9RC 3N9PA 4GYSA 5EZYE 1SHZC 5A1LA 2DWKA 3M65A 3ZLIA 3CMLA 3J7Yq 2CMRA 5CA1E 1FMVA 1YD8G 3P8CD 1MNDA 3KV5A 4J2CA 4MBQA 1G8XA 2KWHA 4OK0A 2QGSA 3PU8A 3RX6A 3B57A 2LEHA 3F2EA 4DO0A 3MK7C 4I4TE 4P0BA 2DI4A 2G0UA 5ADXL 4AKLA 2JMKA 4QKNA 1U5PA 2NTYA 1FEWA 5L3DB 2BVMA 2I59A 3SOLA 2DHRA 2L9QA 2CWOA 3AB3B 2CWYA 2WMNA 3GMIA 4CZZB 3E0ZA 1UCUA 4MFRA 3UUNA 5F8PA 1Y64B 2M67A 3RH3A 4TN7B 2W62A 1MMGA 4H9QC 3SWHA 4PJNA 3OBVE 1D1AA 1BR4A 4GIWA 1E1HB 1S94A 2V7IA 4U72A 2BVLA 4O4HE 5JR9B 2NTXA 3LK42 3UUMA 4HEAA 5L3EB 3HKBE 3KV9A 5LCYA 1MIYA 1D1BA 3FXDB 2KWIB 3HKDE 5LG4A 3U78A 2KMFA 4DNDA 4ZHQE 4FI5A 3K3NA 2XAGB 4EZ4A 5LHGB 2VB6A 4HFVA 3F57A 2C0SA 2CXDA 5EK4A 1ZHCA 3WI3A 4AKIA 4OFZA 3ZC1A 5H6QB 4MLKA 4ISTA 5JDFA 2NOXA 4UELA 1VRBA 1X79A 4PAGA 5JR9A 3U3IA 1MMDA 4HE8A 2NW8A 4WW0A 2JMHA 5JH7E 2PJQA 4CXWA 3P7IA 2P9BA 2EHOC 3N9NA 3N9LA 4IE5A 5KX5E 3N2OA 3BQIA 4DMVA 2W00A 4BGOA 2Q9QC 4G2AA 2LOPA 3PUQA 4CI1B 5HWYA 5L3GB 3HKCE 3IEEA 4IE6A 4IIJE 5JDLA 2WM9A 2VKOA 3CQGB 4ECGA 4YJ2E 4ILUA 2LSYA 3ZMTB 5LP6E 2XAQB 4CQIA 3O1JA 4DVDA 4F6RC 3AA7B 1QSDA 3ANWA 4NUUA 1WRDA 2IAKA 3ZN1B 2LE8A 3HKEE 4OHFA 4IGUA 3ZMSB 2LT3A 5LOVE 1MMNA 4QX7B 5JVDE 2NW7A 2L3LA 3EVYA 3K8PC 4EIWA 1LVKA 3C50A 5C8YE 4WBOA 3RKOA 3FBLA 4UEMA 4UVAB 5KDMC 3DP7A 3LK3B 3N5LA 1MMAA 4ZS2A 5FY7A 4PFOA 3R84B 5CA0E 3CX6B 2VASA 3JC6D 5E0OA 4ISSA 2GK9A 2WAUA 3R6NA 4QHOA 4UF0B 3HA4A 5FMNA 5LGUB 4HN9A 1SA0E 2PBIA 3WAKA 3PE0A 1BR0A 1WR6A 5JDHA 1HX8A 5IYZE 3VKGA 2CXFA 3ETUA 3N9MA 3ZN0B 1HG2A 1LRZA 3UUXB 3I0OA 2VL8A 3NBXX 5TAOA 3ZCIA 3F31A 2A72A 3ZYLA 3RYHE 5J2TE 4TUYE 2MTCA 2KZ7B 3WURA 3FXEB 5HXRA 4N78D 1U4QA 1HCIA 4O2AE 2Z6EA 4UF0A 4X20E 2VWAA 4KBMB 5HXSA 2C5KT 2E9XC 2Q9QB 5CB4E 2XASB 3LBXB 4PJLA 1UX5A 3Q2MA 4CI2B 3KV4A 3PHF1 3E22E 4ZI3D 1FMWA 4GK5E 4GOUA 4EYYR 3OYZA 4ADZA 2IC6A 3E08A 3AT7A 3L09A 2LSGA 3UT5E 4P0AA 5LYJE 2H7OA 3PU3A 4WBNE 5LGNB 2PFVA 3RC3A 3AAIA 4ZI2C 2ODVA 5F3JA 4QXCB 2OA5A 4TX5A 4YHJA 4PJMA 4CI3B 3NRYA 1IAPA 3KINB 5DABA 3RC8A 4MHCA 3O1HA 2Q9QA 4PFPA 2XUEA 4ZOLE 3ZPOA 3LBXA 2X9WA 5M4YA 4O4JE 4HGAA 1H7CA 3QUJA 3A5XA 5JQGE 3CKDA 3NRXA 2YU2A 3LK2B 1YW0A 3FBZA 2K9AA 2LQUA 3L3PA 2MBGA 1YKEB 3RRWA 2WWUA 3EUHA 3AVRA 4UV8B 5J2UE 4B6XA 2VKDA 4E7ZA 2VKHA 3DTOA 2ACXA 5FXXA 2NW9A 3N2GE 4AKHA 3V5UA 2X0LB 3MJXA 2MOZA 2X9HA 4MALA 3GWHA 2KT9A 2QA7A 3KFWX 3LG7A 2Y48B 2XQYA 3HI2A 4C90A 4H63V 3PDYA 1WLXA 1IJ6A 5L3BB 4X1IE 5LHIB 3VHLA 3ZMZB 3MXZA 3Q5WA 1O3XA 3ANWB 2DNXA 1IZNB 2E9XB 3FB2A 2XTLA 5HXEA 3BQLA 3C4WA 5FYMA 3QC9A 5GONE 4EAHA 1NAFA 2ZLYA 4QX8B 5FXZA 2C5IT 5LJNA 4AKGA 3D0TA 4XAXB 5LBQB 3AA0B 4BA9A 4O4LE 4CXXA 2IC9A 4AXPA 3ZMUB 3MA9A 3AAEB 5AFUL 1HTJF 3ESLA 3KV6A 2HH7A 2WBLA 2LM9A 4JLEA 3ZC0A 1MIWA 2RA1A 2CEAA 5L3FB 5BMVE 4I43B 4PK5A 2CE7A 3MZKB 4M1PA 2K5BB 3W15B 4NUVA 2EHOD 2NP9A 2ZM8A 2ZM0A 2E9XA 3LFMA 4H9SE 3WAJA 4Z8XA 5FY0A 2LHNA 4PK4A 3MACA 5LA6E 3ZJ1A 3OYXA 2W0GA 2L8KA 2Q9QD 4PJJA 1UX4A 3MKDA 3PUAA 4ANJA 2W61A 3M1CA 5JDQA 4H63H 1IJ5A 2A3DA 2Y8DA 5HAXA 4L9IA 3VJZA 3PURA 1YKHB 5LGTB 4AQFC 2V7JA 2VK9A 4EZHA 3UTKA 2VKJA 2X66A 3C4XA 3PTRB 2IW5B 4H9NC 2N1GA 3PF0A 3ONXA 2D5UA 2KNDA 3K3QC 1VOMA 1EZ3A 4H9PC 2LSJA 3OKQA 2UXXB 5KMGP 2V7LA 1G73A 3NZPA 2HPLA 4DBRA 2KINB 3SS1A 3N9OA 3C98B 4UVCB 3KVAA 4WNKA 2ZMAA 2BZBA 1OXZA 2X68A 3AAAB 4O4IE 4GYRA 2YINA 3AA6B 5JDGA 5ETWA 2X9XA 4ONRA 2XAFB 3I0QA 1KNZA 2V7MA 2H3RA 3T8OA 5JR9C 4QXHB 4V1Av 3EDUA 2D0TA 3K3OA 4TZ4C 1WYBA 3UULA 2EHOB 3IF8B 2UXNB 3HR0A 3DJBA 2JPFA 5JDMA 2PG8A 4OYKA 1HFAA 4IHJE 1D0YA 4ERRA 2HPJA 3OJAA 3ZCJA 4BJNA 4CXYA 1FIOA 4BAYB 2DCFA 3KVBA 4G63A 2RP4A 2J1DG 4KMCA 1ZV4X 4H9OC 5JDNA 3ETVA 1BR1A 1V9DA 5FY1A 3C51A 1HF8A 4JEUB 2LOSA 1HG5A 1WYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDH A;  5HXS A;  3V5S A;  5JDM A;  5HWX A;  5JDF A;  5HXC A;  5HXH A;  5HWY A;  5JDG A;  3V5U A;  5JDN A;  5JDQ A;  5HXR A;  5JDL A;  5HXE A;  5HYA A; 
#chains in the Genus database with same CATH topology
 4YFS A;  3ZSS A;  5DJQ C;  4TV9 E;  3AED A;  5AQN B;  2IUB A;  4DV1 T;  5LJM A;  4O8S A;  4DV6 T;  5LMN T;  4DR5 T;  4JI3 T;  2X9Y A;  3KBT A;  3A8Y C;  4P1N A;  4ILC A;  1XMO T;  1XNQ T;  4NXM T;  3Q9D A;  4CN1 A;  3CPZ A;  2DWG A;  2W66 A;  3UQ7 A;  4EOZ B;  2BKP A;  5L4H A;  2ACZ A;  3P50 A;  3PUX F;  2KSR A;  3TLU A;  3FZM B;  2XAJ B;  2LSK A;  1CUN A;  1QUU A;  1UK5 A;  4AQY T;  4E7S A;  5ABF B;  1B7T A;  5AQV B;  4JI7 T;  2XQ3 A;  2YK0 A;  2BKN A;  2OLT A;  5JRC B;  5CJ5 A;  5IHY A;  2VVN A;  1T98 A;  2CPT A;  2V6Y A;  2WZH A;  3WSC A;  4LFB T;  2N9D A;  4UIG A;  4TV8 E;  2R6G F;  4KHZ F;  5AQK B;  3GN5 A;  1US7 B;  3GA8 A;  4UXN B;  1OWA A;  3AE4 A;  4FJO A;  2BDE A;  2D0U A;  5AQL B;  4JI8 T;  3PUS A;  4U33 A;  3H3A A;  4HWF A;  3AE6 A;  4L0R A;  5FNV E;  4LF7 T;  3UFE A;  1D0Z A;  3AEG A;  2XHE B;  3UQ4 A;  3V5S A;  3X1D A;  2DWK A;  4MBQ A;  1G8X A;  2LKH A;  3PU8 A;  3RX6 A;  2LEH A;  4I4T E;  5FKY A;  4QKN A;  1U5P A;  3QNU A;  2CWO A;  4CZZ B;  2NR4 A;  2VL0 A;  1Y64 B;  2M67 A;  3RH3 A;  1OED C;  3RLF F;  4H9Q C;  4HWD A;  1BR4 A;  2V7I A;  4O4H E;  2NTX A;  4HEA A;  5LCY A;  1MIY A;  1D1B A;  1XMQ T;  3HKD E;  5LG4 A;  4DV3 T;  2KMF A;  1N34 T;  5KXJ A;  4ILA A;  4HFV A;  4HFC A;  1XZY A;  2C0S A;  1SE7 A;  1JNR A;  4B3R T;  4AKI A;  1UGO A;  1X79 A;  5C3J A;  3U3I A;  4HE8 A;  2NW8 A;  4YXD A;  2JMH A;  2XPK A;  4JI5 T;  4CXW A;  2J62 A;  2P9B A;  4KHP T;  3N9L A;  4JI1 T;  2Q9Q C;  5AQF B;  4IE6 A;  3NWI A;  2VKO A;  2XAQ B;  3AA7 B;  3ANW A;  1WRD A;  3ZN1 B;  3HKE E;  4OHF A;  4IGU A;  3IA3 A;  3ZMS B;  4LMJ A;  2I6H A;  3EVY A;  2FBW A;  3C50 A;  3RKO A;  3DP7 A;  3N5L A;  4ZS2 A;  3RIU A;  1KEY A;  3UUB A;  4U7I A;  5CA0 E;  3CX6 B;  4LMK A;  1XDP A;  3JC6 D;  3NKZ A;  3CIR A;  3PUV F;  4DV2 T;  2UXB T;  2GK9 A;  4QHO A;  3FZF B;  2XQ5 A;  1OED E;  1BR0 A;  3AXJ B;  2CXF A;  3ETU A;  3N9M A;  3ZN0 B;  4NXN T;  3NBX X;  3ZCI A;  1XWM A;  2A72 A;  3RYH E;  4TUY E;  4HWC A;  1NEK A;  4X20 E;  5AQI B;  5HXS A;  4W8P A;  4PJL A;  4JI6 T;  1UX5 A;  3LDQ B;  3Q2M A;  4ZI3 D;  1FMW A;  4GOU A;  3AT7 A;  5LG3 A;  3PU3 A;  3CK6 A;  4WBN E;  4ZI2 C;  2ODV A;  2CHO A;  4QH4 A;  4TX5 A;  2XZE A;  3O1H A;  4ZOL E;  3ZPO A;  3FZH B;  3EAM A;  3QUJ A;  3NRX A;  2YU2 A;  4YSX A;  4DUZ T;  4YSZ A;  2MBG A;  2WZI A;  1YKE B;  2V5D A;  3RRW A;  1HR0 T;  3AVR A;  4UV8 B;  3DTO A;  5FXX A;  2X0Y A;  3MJX A;  2KT9 A;  2XQY A;  4C90 A;  3PDY A;  1E2A A;  1O3X A;  3UU3 A;  3VR8 A;  2DNX A;  1IZN B;  2E9X B;  3FB2 A;  5HXE A;  5GON E;  2ZLY A;  5FXZ A;  1XDO A;  2C5I T;  4XAX B;  2LRK A;  4AXP A;  3ZMU B;  3ESL A;  3KV6 A;  2CEA A;  3FZL B;  3MZK B;  4ZZC A;  2ZM8 A;  3M3Z B;  3UU8 A;  3VRA A;  5LA6 E;  2W0G A;  4PJJ A;  3RKG A;  5JDQ A;  5HAX A;  2Y8D A;  4L9I A;  5ABG A;  4EEB A;  3JCF A;  3C4X A;  2IW5 B;  1L0V A;  3TLS A;  1VCS A;  2UXX B;  2V7L A;  3SS1 A;  2ZM6 T;  3C98 B;  4UVC B;  2CRB A;  1X9B A;  1OXZ A;  2X68 A;  5ETW A;  4ONR A;  2BG9 B;  3T8O A;  4V1A v;  3UUL A;  4K0K T;  3DJB A;  4IHJ E;  3PJA A;  5BR8 T;  4G63 A;  1ZV4 X;  3ONL C;  4H9O C;  3PUW F;  1BR1 A;  4U31 A;  4JEU B;  3ZEF B;  2EHO A;  5L4E A;  2CM0 A;  5JRE A;  1S35 A;  2KLQ A;  5J1G A;  4DBQ A;  5H6R B;  5HXC A;  5HXH A;  4JV5 T;  4EV6 A;  3VRB A;  3CVR A;  3QK6 A;  1FJG T;  3KDS E;  2MPK A;  2V7K A;  2N2N A;  5FXW A;  3NVO A;  2LJL A;  4AQF A;  4AKR B;  3VKH A;  2M6B A;  2H7V C;  1HS7 A;  2JQQ A;  2C5J A;  2UUB T;  3I9W A;  4A5X A;  4JEH B;  2V6Y B;  1D1C A;  3TKL B;  4DR7 T;  2WU5 A;  5EK2 A;  1MIV A;  2ES0 A;  4EB6 E;  4HKA A;  5LNK A;  3GN5 B;  3LJC A;  4GK0 E;  3O9X A;  4EED A;  4LML A;  1ZKE A;  2XQ8 A;  3PUY F;  2B1E A;  4Z91 A;  4AI6 A;  5HWX A;  3CQX C;  2MTQ A;  4DR4 T;  4EXT A;  4B3S T;  1Z0P A;  5FXV A;  2LSI A;  2CHN A;  5DQW A;  4LF5 T;  3C4Z A;  2HN1 A;  5L3C B;  2K48 A;  1J5E T;  5HYA A;  2CLY B;  2W63 A;  5AQM B;  1IBK T;  4XBF B;  4IE7 A;  5LXT E;  4L5G A;  1BR2 A;  2D9D A;  2MYS A;  4AIU A;  1VCT A;  2CA5 A;  4HTE A;  2DLR A;  3RPU A;  4IRE A;  4H9R C;  3UFG A;  4GYS A;  2H89 A;  5EZY E;  3ZLI A;  5CA1 E;  2HN2 A;  3SFE A;  3KV5 A;  4J2C A;  4F8H A;  2QGS A;  3B57 A;  4HWH A;  2V8S V;  3MK7 C;  5HEU A;  4AKL A;  2W67 A;  2JMK A;  1YQ3 A;  5L3D B;  2DHR A;  3AE1 A;  2WMN A;  2DL1 A;  3GMI A;  4DV0 T;  5F8P A;  4TN7 B;  2W62 A;  1MMG A;  4KI0 F;  3SWH A;  4PJN A;  4DV5 T;  4GIW A;  5L3E B;  1YQ4 A;  1SJ7 A;  3U78 A;  4DND A;  4ZHQ E;  3ZT5 A;  3JAE A;  5EK4 A;  5IWA T;  3RGL A;  5JDF A;  2LM2 A;  1T8B A;  2NOX A;  5JR9 A;  1VRB A;  2K3W A;  3QB5 A;  2PJQ A;  4UR9 A;  2EHO C;  5KX5 E;  4DMV A;  3L8R A;  3OVU A;  4LF4 T;  4IIJ E;  5JDL A;  3AE3 A;  4YJ2 E;  3ZMT B;  5LP6 E;  3DYJ A;  3EAB A;  2LT3 A;  4QX7 B;  2L3L A;  4U2Z A;  2UU9 T;  5C8Y E;  3R84 B;  2VAS A;  4ISS A;  4DR3 T;  2WDR A;  3HA4 A;  5FMN A;  3UU6 A;  3PE0 A;  5JDH A;  2YKS A;  5IYZ E;  1LRZ A;  3UUX B;  3I0O A;  4WYV A;  3RQU A;  4CN6 A;  5J2T E;  2KZ7 B;  3WUR A;  3FXE B;  2CBJ A;  4O2A E;  3RF1 A;  2E9X C;  5CB4 E;  3PHF 1;  3E22 E;  1XNR T;  4IDQ A;  3E08 A;  3L09 A;  4YY3 T;  2WU2 A;  2XM2 A;  3UT5 E;  4P0A A;  5LYJ E;  2QYW A;  5LGN B;  3RC3 A;  3AAI A;  5F3J A;  2OA5 A;  4TWD A;  3NRY A;  2XUE A;  2X9W A;  5M4Y A;  4B3M T;  4DV4 T;  1H7C A;  1YW0 A;  1QLB A;  4JBW F;  2KBB A;  5J2U E;  4B6X A;  2UXD T;  4E7Z A;  2VKH A;  2ACX A;  2NW9 A;  5AQH B;  3V5U A;  2X0L B;  4MAL A;  3P4S A;  3KFW X;  2Y48 B;  5LHI B;  1IJ6 A;  3VHL A;  3ZMZ B;  1KFY A;  3Q5W A;  2BG9 C;  3C4W A;  3AEE A;  3PV0 F;  2IC9 A;  2HH7 A;  3ZC0 A;  4PK5 A;  2K5B B;  3G06 A;  5FY0 A;  2LHN A;  1I6Z A;  3MAC A;  3OYX A;  2L8K A;  2Q9Q D;  1I94 T;  3MKD A;  4HFI A;  2W61 A;  3ZT7 A;  1IJ5 A;  3H3M A;  1HNZ T;  3PUR A;  5LGT B;  5FVL A;  3PUZ F;  2KND A;  1EZ3 A;  1W9R A;  4X5T A;  2LSJ A;  2XQA A;  1G73 A;  3NZP A;  1T72 A;  2ZMA A;  4ZXL A;  2BZB A;  1IBM T;  2YIN A;  3AA6 B;  5J0Z A;  1KNZ A;  5JR9 C;  1WYB A;  2EHO B;  3AE8 A;  1ZOY A;  2UXN B;  5JDM A;  4ERR A;  2HPJ A;  3OJA A;  3ZCJ A;  2WDQ A;  4CXY A;  1FIO A;  2RP4 A;  4YSY A;  5HCJ A;  2OV9 A;  2L7N A;  5FY1 A;  2BG9 E;  2AE9 A;  2IIU A;  1WYC A;  4K0U A;  1D0X A;  2FJB A;  1Y01 A;  4UV9 B;  2W2U A;  4I55 E;  5JTG A;  2E5L T;  5IUX A;  4TWF A;  4OYJ A;  3HL6 A;  4ZI2 D;  3L39 A;  2YDQ A;  5LBM A;  3ZMV B;  4I50 E;  3RYI E;  2KXP B;  4YLH A;  4U7Y A;  1NEN A;  4X1Y E;  4EGW A;  3EDV A;  5LHH B;  2JRK A;  4KX6 A;  3IHR A;  4X62 T;  4IDO A;  3CX8 B;  2CLY C;  3P4Q A;  4IDZ A;  1HNX T;  3AY5 A;  4KUM B;  4AQG A;  4BJM A;  3S4U A;  3O4X E;  3IBP A;  3BK9 A;  4LFC T;  3RYC E;  4ZI7 E;  2F4V T;  2Y6X A;  2LKG A;  4IL4 A;  5FZT A;  2CBI A;  2JJ9 A;  4IE0 A;  2E8I A;  4X66 T;  4XZC A;  3FHN A;  2BBH A;  4PK6 A;  1IBL T;  2RPA A;  4C91 A;  2D2S A;  2BS2 A;  3H37 A;  1N36 T;  3B13 A;  5FL0 A;  4TNV A;  2V5C A;  2XSA A;  2YDR A;  2WSS V;  4OX9 T;  4JI2 T;  3VU7 H;  4AIS A;  4X64 T;  3RYF E;  3Q5X A;  2M6I A;  4YHH T;  2CCQ A;  3I1A A;  4DMW A;  3ZYK A;  3BQK A;  2CXL A;  3CQC B;  2V1D B;  3SRZ A;  4QWN B;  3N9P A;  4LF9 T;  4QH5 A;  5A1L A;  3M65 A;  3CML A;  3J7Y q;  1YD8 G;  3P8C D;  4OK0 A;  2XQ7 A;  3F2E A;  4P0B A;  2DI4 A;  5ADX L;  1KNR A;  3RIU C;  2I59 A;  2QRX A;  2L9Q A;  3AB3 B;  3EHZ A;  2CWY A;  1M7K A;  2WQY A;  3E0Z A;  1UCU A;  4MFR A;  3UUN A;  4DR6 T;  1R8I A;  3OBV E;  1D1A A;  1E1H B;  4U72 A;  5JR9 B;  3LK4 2;  3UUM A;  3HKB E;  3KV9 A;  2KWI B;  1CHU A;  3Q5D A;  4Q25 A;  2YN6 A;  4FI5 A;  2XAG B;  4EZ4 A;  2X0H A;  2AXD S;  3F57 A;  2WP9 A;  2CXD A;  1UUR A;  4IST A;  4UEL A;  4PAG A;  5HCM A;  1Z8U A;  1MMD A;  5JH7 E;  5LB7 B;  5CGM A;  3N9N A;  2W00 A;  5HEO A;  4BGO A;  4G2A A;  3PUQ A;  5L3G B;  4CI1 B;  2X0C A;  4JI0 T;  4ILU A;  4ZEY A;  3A7M A;  4CQI A;  3AEA A;  1QSD A;  4NUU A;  2IAK A;  5JVD E;  4EIW A;  3LK3 B;  1MMA A;  5FY7 A;  2XJ7 A;  2WAU A;  4DR1 T;  5LGU B;  4HN9 A;  1E7P A;  1J5W A;  1OED A;  2JQ9 A;  1WR6 A;  4LF6 T;  3AE5 A;  1ZP0 A;  2WDV A;  1DU2 A;  2VL8 A;  5TAO A;  3ZYL A;  5AQO B;  4DID B;  4N78 D;  3TLW A;  1HCI A;  2Z6E A;  4UF0 A;  4KBM B;  2C5K T;  3TLT A;  2XY8 B;  2XAS B;  3KV4 A;  4GK5 E;  4ADZ A;  2IC6 A;  2H7O A;  1UUS A;  3T1Y T;  4QXC B;  2PTF A;  4GKJ T;  4YHJ A;  4PJM A;  4CI3 B;  3RC8 A;  1IAP A;  2Q9Q A;  3LBX A;  4HGA A;  2LRL A;  3AEB A;  5AQJ B;  3A5X A;  5JQG E;  3ABV A;  3OTO T;  3LK2 B;  2LQU A;  2UXC T;  4X65 T;  2WWU A;  3EUH A;  2XM1 A;  3N2G E;  4AKH A;  3RI5 A;  1WCR A;  2MOZ A;  2X9H A;  1SUM B;  4QH1 A;  3UU4 A;  3HI2 A;  1WLX A;  3SFD A;  4X1I E;  4JYA T;  2YOE A;  3ANW B;  2XTL A;  3BQL A;  5FYM A;  1HNW T;  1NAF A;  4QX8 B;  5LJN A;  3D0T A;  4YTP A;  3ONJ A;  5LBQ B;  3AA0 B;  4BA9 A;  3MA9 A;  5AFU L;  1HTJ F;  2WBL A;  4JLE A;  1MIW A;  2RA1 A;  4I43 B;  2JQK A;  3FZK B;  3ZT6 A;  3W15 B;  4NUV A;  3AE7 A;  2EHO D;  2ZM0 A;  4H9S E;  4Z8X A;  4PK4 A;  4COF A;  2BS4 A;  4LF8 T;  4A97 A;  5HEG A;  4ANJ A;  3M1C A;  3PUA A;  4AQF C;  2V7J A;  2VK9 A;  2VKJ A;  3PTR B;  4H9N C;  2N1G A;  3PF0 A;  1VOM A;  3OPC A;  2JIW A;  3OKQ A;  2KGX A;  2L10 A;  3N9O A;  3KVA A;  4WNK A;  2J4G A;  4O4I E;  4GYR A;  2I0M A;  5JDG A;  2X9X A;  2LLY A;  2XAF B;  4QXH B;  3K3O A;  2BS3 A;  5AQR B;  4OYK A;  1HFA A;  4BJN A;  4BAY B;  2DCF A;  3KVB A;  4KMC A;  1W09 A;  4YT0 A;  5ABH A;  1N32 T;  2LOS A;  2YU1 A;  4IE4 A;  1MNE A;  2E9X D;  4U74 A;  3P4W A;  3VR9 A;  2XSB A;  5AQT B;  3RQW A;  4A56 A;  3B5M A;  1LVF A;  4U2Y A;  2FUP A;  2X51 A;  2V26 A;  2WMO A;  2W4X A;  4HWI B;  3ZYM A;  1AJ3 A;  2A2F X;  3I9Y A;  4O2B E;  3C64 A;  3J9X 1;  5L2L A;  4YJ3 E;  4JI4 T;  1ZEE A;  3UU5 A;  2XAH B;  4YTM A;  2X67 A;  4HFD A;  4EYU A;  4IT4 A;  3O1I A;  4IL9 A;  3PUG A;  3CX7 B;  4KP3 C;  2LHR A;  2J47 A;  5T1D A;  2BBJ A;  4UVB B;  3P4R A;  4X1K E;  2ODU A;  4U3C A;  4JUY A;  5EK3 A;  5DQV A;  4ASK A;  1NWM X;  3AVS A;  3ZJ2 A;  5FP3 A;  4NIQ A;  1W0B A;  2YDS A;  2QVA A;  4Z90 A;  3JC6 C;  4PW8 A;  1M62 A;  3KBU A;  5ABF A;  4GKK T;  4YTN A;  1N33 T;  5JRC A;  4QXB B;  2VUR A;  3CWZ B;  4ZS3 A;  2FJE A;  2YEV C;  2NWB A;  3QOF A;  4TNW A;  2SPC A;  3N2K E;  4PNI A;  2K24 A;  3RIF A;  3AA1 B;  2MAW A;  1KK7 A;  4HFB A;  3AEC A;  2JQH A;  4LFA T;  3JAD A;  3RRC A;  2ZM2 A;  4P09 A;  3NZQ A;  4ZI3 C;  3N9Q A;  1LKX A;  2XQ9 A;  1SHZ C;  2CMR A;  1FMV A;  1MND A;  3RIA A;  2KWH A;  3AE9 A;  4IDN A;  4DO0 A;  2G0U A;  3ZST A;  2FJA A;  3K1S A;  2NTY A;  1FEW A;  2BVM A;  3SOL A;  2IML A;  1KF6 A;  2UUA T;  3FYQ A;  5HEJ A;  1S94 A;  5AQG B;  2BVL A;  2B76 A;  3FXD B;  4DR2 T;  3P4P A;  3PJA J;  2XQ6 A;  2A9U A;  1YXR A;  3K3N A;  5LHG B;  2VB6 A;  3QB5 K;  5AQQ B;  1ZHC A;  3WI3 A;  4OFZ A;  3ZC1 A;  5H6Q B;  4MLK A;  1W0A A;  4A98 A;  2VQF T;  4ILB A;  5CFB A;  2WCA A;  4WW0 A;  1T7S A;  3P7I A;  4TWH A;  4IE5 A;  3N2O A;  3BQI A;  4WZX A;  5AQU B;  2LOP A;  5HWY A;  3HKC E;  3IEE A;  5FL1 A;  2WM9 A;  3CQG B;  4ZZB A;  4ECG A;  2LSY A;  3ZKR A;  3TLV A;  4F6R C;  3O1J A;  4DVD A;  1OED B;  2LE8 A;  3AE2 A;  1J1J A;  5LOV E;  1MMN A;  2VQE T;  2NW7 A;  3K8P C;  1LVK A;  4WBO A;  3FBL A;  4UEM A;  4UVA B;  5KDM C;  1WFD A;  4PFO A;  3Q5E A;  2H88 A;  5ABE A;  5E0O A;  3R6N A;  4UF0 B;  1SA0 E;  2WS3 A;  2PBI A;  3WAK A;  4IDP A;  1JNZ A;  1HX8 A;  3VKG A;  1HG2 A;  3LSV A;  3F31 A;  2MTC A;  3JAF A;  5HXR A;  1U4Q A;  4CN4 A;  2VWA A;  2Q9Q B;  2BKO A;  3LBX B;  4CI2 B;  3AXJ A;  4DV7 T;  4EYY R;  3OYZ A;  5F5W A;  2WWV A;  1KNP A;  2LSG A;  4HFE A;  2PFV A;  4I0U A;  5C2T A;  3KIN B;  5DAB A;  4MHC A;  4PFP A;  4O4J E;  2WB5 A;  3CKD A;  3FBZ A;  2K9A A;  3L3P A;  5L47 A;  2VKD A;  2V6X A;  4B3T T;  4F7G B;  3GWH A;  2QA7 A;  5FVK A;  3LG7 A;  5L3B B;  4H63 V;  2VVS A;  3MXZ A;  1HX1 B;  3AEF A;  3QC9 A;  4EAH A;  4AKG A;  2XQ4 A;  3T1H T;  2FJD A;  4O4L E;  4CXX A;  3AAE B;  2LM9 A;  2WY2 A;  5L3F B;  5BMV E;  2CE7 A;  5HEH A;  4M1P A;  4HFH A;  2NP9 A;  3EI0 A;  2E9X A;  3LFM A;  3WAJ A;  2IHR 1;  3ZJ1 A;  1SJ8 A;  1UX4 A;  4H63 H;  5LMU T;  2A3D A;  3VJZ A;  1YKH B;  3RHW A;  4EZH A;  3UTK A;  2X66 A;  3ONX A;  2D5U A;  3K3Q C;  4H9P C;  4NPP A;  2HHH T;  5KMG P;  2HPL A;  4DBR A;  2KIN B;  2KVP A;  1GQE A;  3AAA B;  5AQS B;  3I0Q A;  2V7M A;  2UUC T;  2H3R A;  3EDU A;  2D0T A;  4TZ4 C;  3IF8 B;  2IDO B;  1WR0 A;  3HR0 A;  2JPF A;  2PG8 A;  1D0Y A;  2J1D G;  5JDN A;  2E5V A;  3ETV A;  5AQP B;  1V9D A;  2E2A A;  3C51 A;  1HF8 A;  2BG9 A;  4DUY T;  1HG5 A; 
#chains in the Genus database with same CATH homology
 4YFS A;  2YU1 A;  4IE4 A;  3ZEF B;  1MNE A;  2EHO A;  4K0U A;  4TV9 E;  2E9X D;  1D0X A;  4U74 A;  5DJQ C;  4UV9 B;  5LJM A;  2CM0 A;  5JRE A;  4O8S A;  1S35 A;  4I55 E;  2KLQ A;  5J1G A;  4DBQ A;  5H6R B;  4A56 A;  1LVF A;  5HXC A;  2X9Y A;  3KBT A;  5HXH A;  4OYJ A;  3HL6 A;  4ZI2 D;  3CVR A;  2X51 A;  3QK6 A;  2V26 A;  5LBM A;  3ZMV B;  3KDS E;  2WMO A;  4I50 E;  3RYI E;  2KXP B;  4YLH A;  3ZYM A;  2V7K A;  1AJ3 A;  2A2F X;  2N2N A;  3I9Y A;  5FXW A;  4O2B E;  3C64 A;  2LJL A;  4AQF A;  3Q9D A;  4AKR B;  3VKH A;  4X1Y E;  3J9X 1;  3CPZ A;  5L2L A;  4YJ3 E;  3EDV A;  2DWG A;  2H7V C;  4EOZ B;  5LHH B;  1ZEE A;  2JRK A;  2XAH B;  3IHR A;  1HS7 A;  2JQQ A;  2C5J A;  3CX8 B;  2CLY C;  2X67 A;  3I9W A;  4IDZ A;  4JEH B;  4EYU A;  1D1C A;  3TKL B;  3O1I A;  2XAJ B;  2LSK A;  1CUN A;  1QUU A;  3PUG A;  5EK2 A;  1MIV A;  3CX7 B;  4KUM B;  4AQG A;  4BJM A;  3S4U A;  3O4X E;  4KP3 C;  2LHR A;  4E7S A;  2ES0 A;  4EB6 E;  4HKA A;  5T1D A;  5LNK A;  1B7T A;  4UVB B;  2YK0 A;  4X1K E;  3GN5 B;  3IBP A;  2ODU A;  3LJC A;  5JRC B;  5IHY A;  3BK9 A;  4JUY A;  4GK0 E;  3RYC E;  3O9X A;  5EK3 A;  1T98 A;  4ZI7 E;  2Y6X A;  5DQV A;  4ASK A;  1NWM X;  1ZKE A;  3AVS A;  3ZJ2 A;  3WSC A;  2JJ9 A;  4IE0 A;  2N9D A;  4UIG A;  5FP3 A;  2E8I A;  4XZC A;  2B1E A;  3FHN A;  4PK6 A;  4TV8 E;  4AI6 A;  5HWX A;  3CQX C;  4C91 A;  3JC6 C;  4PW8 A;  2MTQ A;  4EXT A;  3KBU A;  1Z0P A;  5FXV A;  2D2S A;  2LSI A;  3GN5 A;  5JRC A;  4QXB B;  3H37 A;  5DQW A;  3B13 A;  3CWZ B;  4ZS3 A;  1US7 B;  3GA8 A;  4UXN B;  1OWA A;  3C4Z A;  4FJO A;  2YEV C;  2NWB A;  5L3C B;  2SPC A;  2WSS V;  2BDE A;  3N2K E;  2K48 A;  2D0U A;  4PNI A;  2K24 A;  3VU7 H;  3AA1 B;  2CLY B;  3RYF E;  1KK7 A;  5HYA A;  2W63 A;  3Q5X A;  3PUS A;  3H3A A;  2CCQ A;  4XBF B;  3I1A A;  3RRC A;  4IE7 A;  2ZM2 A;  4DMW A;  5LXT E;  4L5G A;  4L0R A;  4P09 A;  3ZYK A;  3NZQ A;  5FNV E;  3BQK A;  3UFE A;  1BR2 A;  1D0Z A;  2CXL A;  4ZI3 C;  3N9Q A;  2MYS A;  3CQC B;  2CA5 A;  2XHE B;  4HTE A;  2V1D B;  2DLR A;  3V5S A;  1LKX A;  4QWN B;  3SRZ A;  3RPU A;  4H9R C;  3N9P A;  4GYS A;  5EZY E;  1SHZ C;  5A1L A;  2DWK A;  3M65 A;  3ZLI A;  3CML A;  3J7Y q;  2CMR A;  5CA1 E;  1FMV A;  1YD8 G;  3P8C D;  1MND A;  3KV5 A;  4J2C A;  4MBQ A;  1G8X A;  2KWH A;  4OK0 A;  2QGS A;  3PU8 A;  3RX6 A;  3B57 A;  2LEH A;  3F2E A;  4DO0 A;  3MK7 C;  4I4T E;  4P0B A;  2DI4 A;  2G0U A;  5ADX L;  4AKL A;  2JMK A;  4QKN A;  1U5P A;  2NTY A;  1FEW A;  5L3D B;  2BVM A;  2I59 A;  3SOL A;  2DHR A;  2L9Q A;  2CWO A;  3AB3 B;  2CWY A;  2WMN A;  3GMI A;  4CZZ B;  3E0Z A;  1UCU A;  4MFR A;  3UUN A;  5F8P A;  1Y64 B;  2M67 A;  3RH3 A;  4TN7 B;  2W62 A;  1MMG A;  4H9Q C;  3SWH A;  4PJN A;  3OBV E;  1D1A A;  1BR4 A;  4GIW A;  1E1H B;  1S94 A;  2V7I A;  4U72 A;  2BVL A;  4O4H E;  5JR9 B;  2NTX A;  3LK4 2;  3UUM A;  4HEA A;  5L3E B;  3HKB E;  3KV9 A;  5LCY A;  1MIY A;  1D1B A;  3FXD B;  2KWI B;  3HKD E;  5LG4 A;  3U78 A;  2KMF A;  4DND A;  4ZHQ E;  4FI5 A;  3K3N A;  2XAG B;  4EZ4 A;  5LHG B;  2VB6 A;  4HFV A;  3F57 A;  2C0S A;  2CXD A;  5EK4 A;  1ZHC A;  3WI3 A;  4AKI A;  4OFZ A;  3ZC1 A;  5H6Q B;  4MLK A;  4IST A;  5JDF A;  2NOX A;  4UEL A;  1VRB A;  1X79 A;  4PAG A;  5JR9 A;  3U3I A;  1MMD A;  4HE8 A;  2NW8 A;  4WW0 A;  2JMH A;  5JH7 E;  2PJQ A;  4CXW A;  3P7I A;  2P9B A;  2EHO C;  3N9N A;  3N9L A;  4IE5 A;  5KX5 E;  3N2O A;  3BQI A;  4DMV A;  2W00 A;  4BGO A;  2Q9Q C;  4G2A A;  2LOP A;  3PUQ A;  4CI1 B;  5HWY A;  5L3G B;  3HKC E;  3IEE A;  4IE6 A;  4IIJ E;  5JDL A;  2WM9 A;  2VKO A;  3CQG B;  4ECG A;  4YJ2 E;  4ILU A;  2LSY A;  3ZMT B;  5LP6 E;  2XAQ B;  4CQI A;  3O1J A;  4DVD A;  4F6R C;  3AA7 B;  1QSD A;  3ANW A;  4NUU A;  1WRD A;  2IAK A;  3ZN1 B;  2LE8 A;  3HKE E;  4OHF A;  4IGU A;  3ZMS B;  2LT3 A;  5LOV E;  1MMN A;  4QX7 B;  5JVD E;  2NW7 A;  2L3L A;  3EVY A;  3K8P C;  4EIW A;  1LVK A;  3C50 A;  5C8Y E;  4WBO A;  3RKO A;  3FBL A;  4UEM A;  4UVA B;  5KDM C;  3DP7 A;  3LK3 B;  3N5L A;  1MMA A;  4ZS2 A;  5FY7 A;  4PFO A;  3R84 B;  5CA0 E;  3CX6 B;  2VAS A;  3JC6 D;  5E0O A;  4ISS A;  2GK9 A;  2WAU A;  3R6N A;  4QHO A;  4UF0 B;  3HA4 A;  5FMN A;  5LGU B;  4HN9 A;  1SA0 E;  2PBI A;  3WAK A;  3PE0 A;  1BR0 A;  1WR6 A;  5JDH A;  1HX8 A;  5IYZ E;  3VKG A;  2CXF A;  3ETU A;  3N9M A;  3ZN0 B;  1HG2 A;  1LRZ A;  3UUX B;  3I0O A;  2VL8 A;  3NBX X;  5TAO A;  3ZCI A;  3F31 A;  2A72 A;  3ZYL A;  3RYH E;  5J2T E;  4TUY E;  2MTC A;  2KZ7 B;  3WUR A;  3FXE B;  5HXR A;  4N78 D;  1U4Q A;  1HCI A;  4O2A E;  2Z6E A;  4UF0 A;  4X20 E;  2VWA A;  4KBM B;  5HXS A;  2C5K T;  2E9X C;  2Q9Q B;  5CB4 E;  2XAS B;  3LBX B;  4PJL A;  1UX5 A;  3Q2M A;  4CI2 B;  3KV4 A;  3PHF 1;  3E22 E;  4ZI3 D;  1FMW A;  4GK5 E;  4GOU A;  4EYY R;  3OYZ A;  4ADZ A;  2IC6 A;  3E08 A;  3AT7 A;  3L09 A;  2LSG A;  3UT5 E;  4P0A A;  5LYJ E;  2H7O A;  3PU3 A;  4WBN E;  5LGN B;  2PFV A;  3RC3 A;  3AAI A;  4ZI2 C;  2ODV A;  5F3J A;  4QXC B;  2OA5 A;  4TX5 A;  4YHJ A;  4PJM A;  4CI3 B;  3NRY A;  1IAP A;  3KIN B;  5DAB A;  3RC8 A;  4MHC A;  3O1H A;  2Q9Q A;  4PFP A;  2XUE A;  4ZOL E;  3ZPO A;  3LBX A;  2X9W A;  5M4Y A;  4O4J E;  4HGA A;  1H7C A;  3QUJ A;  3A5X A;  5JQG E;  3CKD A;  3NRX A;  2YU2 A;  3LK2 B;  1YW0 A;  3FBZ A;  2K9A A;  2LQU A;  3L3P A;  2MBG A;  1YKE B;  3RRW A;  2WWU A;  3EUH A;  3AVR A;  4UV8 B;  5J2U E;  4B6X A;  2VKD A;  4E7Z A;  2VKH A;  3DTO A;  2ACX A;  5FXX A;  2NW9 A;  3N2G E;  4AKH A;  3V5U A;  2X0L B;  3MJX A;  2MOZ A;  2X9H A;  4MAL A;  3GWH A;  2KT9 A;  2QA7 A;  3KFW X;  3LG7 A;  2Y48 B;  2XQY A;  3HI2 A;  4C90 A;  4H63 V;  3PDY A;  1WLX A;  1IJ6 A;  5L3B B;  4X1I E;  5LHI B;  3VHL A;  3ZMZ B;  3MXZ A;  3Q5W A;  1O3X A;  3ANW B;  2DNX A;  1IZN B;  2E9X B;  3FB2 A;  2XTL A;  5HXE A;  3BQL A;  3C4W A;  5FYM A;  3QC9 A;  5GON E;  4EAH A;  1NAF A;  2ZLY A;  4QX8 B;  5FXZ A;  2C5I T;  5LJN A;  4AKG A;  3D0T A;  4XAX B;  5LBQ B;  3AA0 B;  4BA9 A;  4O4L E;  4CXX A;  2IC9 A;  4AXP A;  3ZMU B;  3MA9 A;  3AAE B;  5AFU L;  1HTJ F;  3ESL A;  3KV6 A;  2HH7 A;  2WBL A;  2LM9 A;  4JLE A;  3ZC0 A;  1MIW A;  2RA1 A;  2CEA A;  5L3F B;  5BMV E;  4I43 B;  4PK5 A;  2CE7 A;  3MZK B;  4M1P A;  2K5B B;  3W15 B;  4NUV A;  2EHO D;  2NP9 A;  2ZM8 A;  2ZM0 A;  2E9X A;  3LFM A;  4H9S E;  3WAJ A;  4Z8X A;  5FY0 A;  2LHN A;  4PK4 A;  3MAC A;  5LA6 E;  3ZJ1 A;  3OYX A;  2W0G A;  2L8K A;  2Q9Q D;  4PJJ A;  1UX4 A;  3MKD A;  3PUA A;  4ANJ A;  2W61 A;  3M1C A;  5JDQ A;  4H63 H;  1IJ5 A;  2A3D A;  2Y8D A;  5HAX A;  4L9I A;  3VJZ A;  3PUR A;  1YKH B;  5LGT B;  4AQF C;  2V7J A;  2VK9 A;  4EZH A;  3UTK A;  2VKJ A;  2X66 A;  3C4X A;  3PTR B;  2IW5 B;  4H9N C;  2N1G A;  3PF0 A;  3ONX A;  2D5U A;  2KND A;  3K3Q C;  1VOM A;  1EZ3 A;  4H9P C;  2LSJ A;  3OKQ A;  2UXX B;  5KMG P;  2V7L A;  1G73 A;  3NZP A;  2HPL A;  4DBR A;  2KIN B;  3SS1 A;  3N9O A;  3C98 B;  4UVC B;  3KVA A;  4WNK A;  2ZMA A;  2BZB A;  1OXZ A;  2X68 A;  3AAA B;  4O4I E;  4GYR A;  2YIN A;  3AA6 B;  5JDG A;  5ETW A;  2X9X A;  4ONR A;  2XAF B;  3I0Q A;  1KNZ A;  2V7M A;  2H3R A;  3T8O A;  5JR9 C;  4QXH B;  4V1A v;  3EDU A;  2D0T A;  3K3O A;  4TZ4 C;  1WYB A;  3UUL A;  2EHO B;  3IF8 B;  2UXN B;  3HR0 A;  3DJB A;  2JPF A;  5JDM A;  2PG8 A;  4OYK A;  1HFA A;  4IHJ E;  1D0Y A;  4ERR A;  2HPJ A;  3OJA A;  3ZCJ A;  4BJN A;  4CXY A;  1FIO A;  4BAY B;  2DCF A;  3KVB A;  4G63 A;  2RP4 A;  2J1D G;  4KMC A;  1ZV4 X;  4H9O C;  5JDN A;  3ETV A;  1BR1 A;  1V9D A;  5FY1 A;  3C51 A;  1HF8 A;  4JEU B;  2LOS A;  1HG5 A;  1WYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...