5HWXA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and zero ca2+
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
301
structure length
294
Chain Sequence
b'MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 126
structure length 294
sequence length 301
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hwxA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hwxA02
5HXEA 5HXHA 5JDQA 5HWYA 5HYAA 5JDLA 5HXCA 5JDMA 5HXSA 3V5SA 5HXRA 5HWXA 5JDNA 5JDFA 5JDGA 5JDHA 3V5UA
chains in the Genus database with same CATH superfamily
3SWHA 2XQ9A 3ESLA 5ABGA 2Y8DA 4KHZF 3JC6D 4AKLA 2PTFA 5LHIB 4K0KT 4IGUA 2YN6A 2L9QA 3N9MA 2IW5B 1B7TA 1QSDA 5FVLA 1IZNB 4X1YE 3FBLA 4AQGA 2X9YA 4PK6A 2DNXA 4ZI7E 4YXDA 2E9XD 1UX4A 2VKJA 2A3DA 1HFAA 5L3CB 3OBVE 2YDRA 2WBLA 4DVDA 2A9UA 2CWYA 1W0BA 3Q5XA 2IMLA 4X65T 4QH1A 1Y01A 4JYAT 4JV5T 5BR8T 2ODVA 5CB4E 1AJ3A 3UT5E 4IE4A 2CXFA 5CA1E 2XAQB 4EAHA 1XNQT 2D0UA 2L3LA 2FJEA 2KWIB 3MACA 3GA8A 4AKHA 5KX5E 2X0CA 5HEOA 2K9AA 2KINB 3UQ4A 2MBGA 4U2ZA 4C90A 3T8OA 4AKRB 4WBOA 1X79A 4DNDA 1R8IA 4U31A 4GKJT 2FJDA 5AQJB 1YQ3A 1M7KA 3L39A 2VQET 4ASKA 3PUAA 2DCFA 1VRBA 2CHOA 3GN5B 5ABFA 4ILUA 3N9QA 1XMOT 5AQGB 2V6XA 4IL4A 3P4QA 2V7LA 4GOUA 5DJQC 1BR1A 5LBQB 4YHHT 1D1CA 1V9DA 4ZI3C 3GWHA 1KF6A 3CX6B 1HX1B 5LXTE 3QNUA 4HFDA 4KBMB 3CK6A 4U3CA 4TUYE 4I43B 2JQHA 5HCJA 3P4WA 2WWUA 1HTJF 3RQUA 2J62A 4IREA 4ZOLE 3SOLA 1WR0A 4CI1B 4DUZT 2CXLA 3RGLA 4ZXLA 5HEGA 4IHJE 4H9SE 2XJ7A 4HFCA 2NTYA 3P50A 3C50A 5LG4A 4KI0F 4JI4T 4QH5A 3K3QC 3VJZA 3PJAA 3MZKB 2W62A 1DU2A 2LEHA 4HWHA 2YDSA 5JTGA 4ADZA 4AIUA 4ILAA 1D1AA 2BBHA 4X20E 1L0VA 4IIJE 3UUBA 4HFHA 5J2TE 2YOEA 4JI6T 4CN6A 1XZYA 3L09A 2XM2A 3LK2B 1MNEA 3ONJA 2BS3A 4NUVA 5HYAA 5LHHB 3AEFA 3DTOA 2V7IA 5AFUL 2ES0A 4AISA 2QRXA 4ILBA 3N2OA 3KVBA 4UVCB 3O1IA 3WI3A 4LF4T 3UU8A 1OWAA 2EHOB 2NW7A 5M4YA 3RYFE 3PUYF 2WDVA 4GYRA 5L47A 2WMNA 3LBXA 4WW0A 2UU9T 1N32T 3HA4A 4DUYT 3KVAA 3RX6A 2V6YA 3ZC1A 3UUNA 3NZQA 2QYWA 2CBJA 3CVRA 5JRCA 4PJNA 3SS1A 4GKKT 3L3PA 2V5DA 3W15B 1SHZC 5ETWA 2Y48B 3WSCA 1NENA 2FJAA 3DJBA 5LMUT 3OYZA 4H63H 2N1GA 2JRKA 3G06A 2X66A 2KLQA 2KMFA 4B3RT 3AAIA 4YJ2E 2UXBT 2V5CA 4DO0A 1Z0PA 2NWBA 1S94A 1OEDB 4GIWA 5FL0A 2L10A 3N5LA 1ZEEA 3ANWB 5JDFA 4UF0B 5HXEA 3F31A 4DR4T 1IBMT 2CRBA 5EK4A 2WU5A 4HWDA 2E5LT 3LDQB 4OYJA 4DMWA 5F8PA 1YW0A 2CA5A 2HN2A 4WBNE 3QB5A 2CM0A 3KV9A 4CQIA 5HWXA 2W63A 3AE1A 4MALA 1CUNA 4EXTA 4PJLA 2Q9QA 4UVBB 4DR3T 2CXDA 2BKNA 1IAPA 2B76A 4DR5T 5AQMB 5JDMA 4UIGA 3RRWA 3HKDE 3QUJA 3AA1B 4DV3T 3RKGA 4TV9E 1HS7A 2VL0A 1Z8UA 4U74A 4HKAA 5IYZE 2YK0A 1W09A 1WLXA 4PFOA 2FBWA 5JR9B 2ZM8A 4JI8T 3GMIA 4DR2T 2XZEA 3UUXB 1EZ3A 4TX5A 2IC6A 5HWYA 5LHGB 4HFIA 1ZOYA 3ONLC 4QXBB 4UEMA 4ZEYA 3FZFB 3N9NA 4ANJA 3TLWA 1BR2A 2D5UA 4YTMA 3KV4A 2ZM0A 3P4SA 4ZI3D 1LRZA 4BGOA 3K3OA 2LRLA 4E7ZA 1ZP0A 4H9NC 4COFA 2J4GA 3UFEA 2JPFA 4LMKA 4YSXA 5GONE 3AVRA 3RF1A 5C3JA 4IE7A 4I50E 5LGUB 4H9PC 3ZT6A 3ABVA 4BA9A 3RRCA 3NZPA 2F4VT 2VKHA 2X9WA 4HFVA 2Q9QC 3V5SA 2QGSA 4HWIB 3EUHA 3OYXA 4EV6A 2IHR1 2BS4A 2H88A 4O4IE 3HL6A 1VCSA 2WDRA 5AQIB 4TWFA 1FIOA 3BQKA 3PV0F 2FJBA 2BG9C 4NPPA 4QWNB 3Q5EA 3E08A 2E9XB 3AVSA 3OJAA 4HFEA 3KDSE 3AA6B 3RKOA 4O4HE 4QH4A 4XBFB 4IDZA 4YFSA 5FXZA 3RC8A 4KP3C 2WMOA 3AB3B 4PAGA 3AEAA 3EABA 2WB5A 3N2GE 3CQCB 4QXHB 5AQHB 5F3JA 2HN1A 2V7KA 5HXRA 2LT3A 1N33T 3ZMUB 5LP6E 3MA9A 2VWAA 3SFEA 3B13A 2XPKA 2W2UA 2VKDA 3RIUA 4JI7T 3AEBA 2V6YB 1LVKA 1E2AA 1WYCA 1SJ7A 3BK9A 3JAEA 1OEDE 4HEAA 1MNDA 3CQXC 5EZYE 2ZLYA 4WZXA 3I9WA 4H9RC 4GK0E 3FZHB 5FY1A 2LM9A 4KHPT 4P1NA 3OTOT 3AA0B 4FJOA 2OA5A 2LSGA 2K24A 2LM2A 3O1HA 2VB6A 4DV1T 2WCAA 2XQ8A 2XTLA 1U4QA 2WS3A 3PUGA 4IT4A 4HTEA 3AXJB 2KWHA 4L9IA 1J5ET 2E8IA 3CMLA 2M6IA 5L4HA 3D0TA 3LSVA 5AQFB 1VOMA 5TAOA 4CN1A 4PJJA 2VQFT 3BQIA 1IBLT 2PG8A 1D0YA 2E2AA 3MXZA 3ETVA 1KEYA 4OYKA 3C4ZA 2WDQA 3H3MA 3RLFF 4ZHQE 1J5WA 5LB7B 1JNRA 4X1KE 1XDPA 5CJ5A 3RI5A 4KUMB 3MKDA 4LF5T 1VCTA 4I0UA 1NWMX 3FHNA 3C4WA 4EGWA 4ILCA 2C5IT 4LF8T 4YT0A 1I6ZA 4O8SA 2IC9A 4E7SA 4DR7T 4YTNA 3N9OA 2W67A 2XASB 2ZM2A 1WYBA 4TV8E 5C8YE 5L3EB 3AEDA 2BG9B 3ZYMA 3MJXA 4EEDA 2NP9A 2IAKA 3LK42 4BJNA 5JREA 3VRBA 2CPTA 4NXMT 3B57A 5HXCA 3LFMA 4EIWA 2DL1A 5FMNA 3LJCA 4B6XA 1HR0T 2KBBA 3O1JA 3FB2A 1HNXT 3HR0A 3UFGA 3KV5A 2WZIA 1WRDA 3ETUA 5LBMA 4EEBA 3PDYA 5F5WA 4DV4T 5FXXA 4GYSA 5IWAT 5KDMC 4UV9B 4ZZBA 3IBPA 4X64T 4DR6T 2PJQA 4JEUB 4A56A 4EZ4A 1MIWA 1UX5A 4IDOA 3QB5K 2NW9A 4LFAT 3PTRB 3DP7A 4YTPA 2AE9A 4O4JE 2I0MA 2XQ5A 2Q9QD 2ZMAA 3UQ7A 2LHNA 3CWZB 2JJ9A 3Q5DA 4JI5T 4IE6A 1XNRT 3CIRA 3T1YT 4A97A 4JI0T 3QOFA 2WSSV 1T7SA 5FXWA 2XQ3A 2IIUA 1J1JA 4CXWA 2WAUA 2M67A 5HAXA 1UUSA 2Z6EA 2YU2A 3VR9A 1BR4A 2XQ6A 4EB6E 2RA1A 5DQWA 5ABEA 4LMJA 5IHYA 2MTCA 5JDNA 3ZSTA 3JCFA 4XZCA 4LFCT 2VKOA 3AE6A 4X66T 3ZN1B 2RP4A 3PUZF 3ZYKA 5JQGE 4A5XA 3AY5A 3OVUA 4MFRA 2GK9A 4OFZA 2KSRA 3FXEB 3C64A 4WYVA 2YU1A 4DV2T 3ZYLA 3NKZA 3ZLIA 4XAXB 3E22E 2MYSA 1IJ6A 4Z90A 2R6GF 2WY2A 3AAAB 3TLSA 4DMVA 1FEWA 3BQLA 2YKSA 2DI4A 2BS2A 4P0AA 2HPLA 3NBXX 4CN4A 3AE8A 4JUYA 4AQYT 3P7IA 3HI2A 3IA3A 2N2NA 3PUXF 2YEVC 4UR9A 4YY3T 3ZPOA 2K48A 3EI0A 5AQQB 2L8KA 1FMVA 1S35A 5AQNB 3B5MA 2V7JA 1U5PA 2DLRA 4V1Av 4B3MT 3EDUA 2VVSA 2BZBA 2LSYA 5FXVA 2KNDA 2X9HA 1BR0A 5E0OA 4X62T 4UELA 4ZS3A 3AE2A 5HCMA 4O4LE 3S4UA 2YINA 1WCRA 4ONRA 4PW8A 4HWCA 4QX8B 1HX8A 2JQQA 3AEEA 5FYMA 5ABHA 5J2UE 5KMGP 1HG2A 3QC9A 4Q25A 4U7YA 5ABFB 1JNZA 3VR8A 3GN5A 4O2BE 4G63A 5LJNA 3CPZA 1ZHCA 5T1DA 2D2SA 2CMRA 3ZMVB 3P4RA 5BMVE 3O4XE 2LSKA 5AQOB 1IBKT 2D9DA 4TNWA 4ZZCA 2ZM6T 2MOZA 4UXNB 3RC3A 1D1BA 2BKPA 1UGOA 2I59A 3U78A 3ZEFB 3AE3A 3WAKA 2UUAT 2JMHA 5L3DB 2VL8A 2K5BB 3ONXA 3VKHA 3ZJ1A 1YKHB 2LSJA 2V26A 1XDOA 3KBTA 3RYIE 3KFWX 2WWVA 5A1LA 4OX9T 4AKIA 3FBZA 3P8CD 2KZ7B 2V8SV 4YJ3E 1UURA 4CZZB 4C91A 2XAJB 4LF9T 3F57A 2CLYC 2XAFB 2VASA 2KXPB 3AAEB 2OV9A 3UULA 2B1EA 5LJMA 5CA0E 4OK0A 5JDQA 1N34T 4TWHA 2LOPA 3VU7H 2NTXA 1HCIA 4FI5A 1OXZA 4YHJA 3N9PA 5JDLA 3Q9DA 2HPJA 5H6QB 5HEJA 3HKCE 3H37A 2W4XA 4KMCA 4CI3B 4L5GA 3ZT7A 4H9QC 3IHRA 5HEUA 2L7NA 4EZHA 2LRKA 4NXNT 2CHNA 1NEKA 4DV0T 2MPKA 3AECA 5J1GA 1US7B 1SJ8A 2IUBA 5EK3A 1CHUA 2LKGA 4BAYB 3NRYA 2H3RA 2BDEA 3VRAA 4JI1T 4N78D 5L2LA 3NVOA 2EHOA 3RPUA 2BVLA 4YSZA 3AT7A 3LBXB 2WQYA 4Z91A 2X0HA 4IE0A 2LKHA 5LNKA 3ZCJA 4P0BA 2NR4A 5JRCB 2WU2A 3RH3A 4OHFA 1H7CA 2X9XA 4AXPA 3QK6A 1I94T 3ZKRA 2LJLA 4A98A 2BKOA 2X68A 2KVPA 2DWGA 1G8XA 4ISSA 4NIQA 1OEDA 5HXHA 2UXCT 2A72A 3E0ZA 4YSYA 2JIWA 1WR6A 3JAFA 3ANWA 3PJAJ 2JMKA 3UU5A 4AI6A 4UF0A 3K1SA 2OLTA 2V1DB 4JBWF 5HEHA 4B3ST 2QA7A 4J2CA 2ODUA 3WURA 3K3NA 1HF8A 2EHOC 2KT9A 5FL1A 2A2FX 2LQUA 3ZC0A 2J47A 3RIUC 3O9XA 3HKBE 3IF8B 2CE7A 1T98A 3I1AA 5L4EA 2E5VA 5HXSA 1FJGT 4DR1T 3AA7B 2ACZA 2Y6XA 2MTQA 3SFDA 3PUWF 3UU3A 3PU3A 2AXDS 2N9DA 1ZKEA 1QLBA 2Q9QB 2VK9A 4U33A 1KNRA 1YXRA 4ZS2A 3PU8A 3N2KE 2I6HA 5FY7A 2X0LB 3AEGA 2WM9A 4IDPA 2CLYB 3TKLB 4QXCB 5AQVB 2PBIA 5LGTB 3K8PC 2DHRA 4DBRA 5FY0A 1T72A 2UUCT 3FZMB 4CXYA 2DWKA 2CCQA 2W0GA 3Q2MA 4PJMA 5JR9A 4TN7B 1OEDC 2V7MA 4ZI2C 3PUSA 1YKEB 3RIFA 2NW8A 4ERRA 2G0UA 4DBQA 2HHHT 2J1DG 1KNZA 5ADXL 2MAWA 2VVNA 2UXXB 3V5UA 3CX7B 3PE0A 4DV7T 2XQ4A 3PUVF 1SE7A 3A8YC 3DYJA 5AQRB 3AE5A 3KINB 1HNWT 5JVDE 1MIYA 2M6BA 3M65A 3FYQA 4PFPA 1MMNA 5DQVA 2CWOA 2XQ7A 3F2EA 5FVKA 2RPAA 3C98B 4CXXA 2K3WA 4UV8B 1MMDA 1ZV4X 1LVFA 4F7GB 3EHZA 2NOXA 4QHOA 2E9XA 4I55E 4DV6T 5JR9C 1W9RA 5AQTB 3ZCIA 2WP9A 1E1HB 4NUUA 2ACXA 1NAFA 2YDQA 4TNVA 5LGNB 4CI2B 4P09A 1YD8G 3ZMTB 2UXDT 3TLVA 4HFBA 3JADA 4X1IE 3Q5WA 3CX8B 3ZMSB 5LCYA 1SA0E 3I0OA 5JH7E 4B3TT 3RIAA 1WFDA 4EYUA 3P4PA 5LOVE 1KK7A 3OKQA 4UVAB 3FXDB 2KGXA 1SUMB 3JC6C 3EAMA 3FZLB 5FZTA 4MBQA 4F8HA 4F6RC 4JI2T 4JI3T 4Z8XA 4K0UA 5L3GB 4LF6T 5AQLB 2XUEA 4MLKA 5C2TA 4DIDB 3R6NA 1UCUA 1G73A 3AE7A 2X51A 4ISTA 4H63V 5FP3A 3M1CA 1T8BA 3M3ZB 3VKGA 2E9XC 1LKXA 1HG5A 4YLHA 1Y64B 4AQFA 3MK7C 3EDVA 3AXJA 3ZJ2A 2XSBA 3VHLA 3SRZA 2VURA 3TLTA 4QX7B 1XWMA 4EYYR 2UXNB 1UK5A 2W61A 5IUXA 2CBIA 4ECGA 4PK5A 3A7MA 5JDHA 1MMGA 1M62A 5AQKB 5AQUB 3LK3B 4AKGA 5LG3A 4KX6A 5LA6E 4HE8A 1MMAA 2W00A 2EHOD 4IE5A 3ZMZB 2BG9E 2LSIA 5KXJA 4HWFA 4IDNA 4HN9A 3CKDA 2XHEB 1D0ZA 4MHCA 2JQ9A 3HKEE 4O2AE 5JDGA 2P9BA 3UUMA 1MIVA 3J7Yq 1O3XA 2BVMA 2LHRA 2XAGB 2JQKA 3T1HT 5FNVE 4GK5E 4W8PA 2LLYA 2PFVA 3KBUA 5L3FB 4U7IA 2X0YA 3TLUA 1KFYA 3C4XA 3RYHE 2CEAA 1FMWA 3KV6A 2BG9A 3UU4A 4AQFC 2C5KT 4LF7T 1QUUA 1IJ5A 5CFBA 3LG7A 3PURA 4G2AA 4PK4A 1HNZT 4WNKA 3U3IA 4IDQA 3C51A 4H9OC 4ZI2D 3PF0A 5FKYA 4DV5T 5J0ZA 2LOSA 2C5JA 3R84B 3N9LA 5LYJE 4U2YA 3PUQA 5H6RB 1GQEA 2XQYA 2IDOB 5AQPB 5L3BB 3UU6A 5LMNT 4TZ4C 3RQWA 5DABA 1YQ4A 2LE8A 4PNIA 2H89A 4M1PA 4JLEA 1W0AA 2HH7A 3J9X1 1X9BA 4U72A 3NWIA 3WAJA 2X67A 3ZSSA 1XMQT 3EVYA 3I0QA 4HGAA 5CGMA 4TWDA 2QVAA 5AQSB 3X1DA 4L0RA 4I4TE 3A5XA 3OPCA 3IEEA 4JEHB 3I9YA 3ZN0B 2WZHA 3ZT5A 2XQAA 3H3AA 2H7OA 2UUBT 2W66A 3CQGB 3AE4A 2FUPA 3NRXA 1E7PA 3AE9A 3RHWA 1N36T 2XM1A 2XAHB 3UTKA 2BBJA 2SPCA 4QKNA 2D0TA 4LMLA 3RYCE 4LFBT 4IL9A 2C0SA 3L8RA 3PHF1 5EK2A 4BJMA 4X5TA 1D0XA 4EOZB 2XY8B 2H7VC 2XSAA 3FZKB 1KNPA
chains in the Genus database with same CATH topology
3SWHA 3PUSA 3UUXB 5JQGE 1YKEB 3ESLA 1EZ3A 4TX5A 2IC6A 5HWYA 5LHGB 2Y8DA 4MFRA 2GK9A 3JC6D 4OFZA 4QXBB 2NW8A 4UEMA 4AKLA 4ERRA 3FXEB 3C64A 2G0UA 3N9NA 2YU1A 4ANJA 1BR2A 4DBQA 5LHIB 2D5UA 2J1DG 4IGUA 1KNZA 3KV4A 2ZM0A 4ZI3D 5ADXL 1LRZA 3ZYLA 3K3OA 4BGOA 2L9QA 3ZLIA 2UXXB 4XAXB 3E22E 3CX7B 2MYSA 3PE0A 3V5UA 4E7ZA 1IJ6A 3N9MA 4H9NC 2IW5B 3AAAB 1B7TA 3UFEA 2JPFA 4DMVA 1FEWA 1QSDA 5GONE 3AVRA 3BQLA 2DI4A 3KINB 4IE7A 4P0AA 2HPLA 5JVDE 3NBXX 4I50E 1MIYA 5LGUB 1IZNB 4X1YE 3FBLA 3M65A 4H9PC 2X9YA 4JUYA 4AQGA 4PK6A 3P7IA 2DNXA 4ZI7E 3HI2A 4PFPA 1MMNA 5DQVA 4BA9A 3RRCA 3NZPA 2CWOA 2E9XD 1UX4A 2VKJA 2A3DA 1HFAA 2VKHA 2X9WA 4HFVA 2Q9QC 5L3CB 3OBVE 3F2EA 3V5SA 2QGSA 3EUHA 3OYXA 2N2NA 2WBLA 4DVDA 2YEVC 3C98B 3ZPOA 2K48A 4O4IE 2CWYA 3Q5XA 3HL6A 2L8KA 4CXXA 1FMVA 1S35A 2ODVA 5CB4E 4UV8B 3UT5E 1AJ3A 1FIOA 3BQKA 1MMDA 1ZV4X 1LVFA 4IE4A 2V7JA 2CXFA 5CA1E 2XAQB 1U5PA 2NOXA 2DLRA 4QWNB 4QHOA 4EAHA 2D0UA 4V1Av 3E08A 2E9XB 3AVSA 2L3LA 2E9XA 4I55E 3OJAA 2KWIB 3EDUA 3KDSE 3AA6B 3RKOA 4O4HE 5JR9C 3MACA 4XBFB 2BZBA 3GA8A 4IDZA 4AKHA 5KX5E 2LSYA 3ZCIA 4YFSA 5FXZA 5FXVA 2KNDA 2X9HA 3RC8A 4KP3C 1BR0A 5E0OA 2K9AA 1E1HB 2KINB 4NUUA 4UELA 2ACXA 4ZS3A 2WMOA 2MBGA 1NAFA 4O4LE 3S4UA 3AB3B 4C90A 3T8OA 5LGNB 4PAGA 4AKRB 4CI2B 4P09A 2YINA 1YD8G 4WBOA 3ZMTB 4ONRA 4PW8A 1X79A 4DNDA 4QX8B 1HX8A 4X1IE 2JQQA 3N2GE 3CQCB 4QXHB 5F3JA 3Q5WA 3CX8B 3ZMSB 5LCYA 1SA0E 3I0OA 5FYMA 5JH7E 5J2UE 4ASKA 5KMGP 1HG2A 3PUAA 2DCFA 3QC9A 1VRBA 4EYUA 2V7KA 3GN5B 2LT3A 5HXRA 3GN5A 4ILUA 3ZMUB 5LP6E 5LOVE 3MA9A 3N9QA 4O2BE 2VWAA 4G63A 5LJNA 3B13A 1KK7A 2V7LA 3CPZA 3OKQA 4UVAB 4GOUA 3FXDB 1ZHCA 2VKDA 3JC6C 5DJQC 5T1DA 2D2SA 2CMRA 4MBQA 1BR1A 1LVKA 5LBQB 4F6RC 3ZMVB 1D1CA 1V9DA 4ZI3C 1WYCA 5BMVE 3O4XE 2LSKA 3GWHA 4Z8XA 3BK9A 4K0UA 5L3GB 4HEAA 1MNDA 3CQXC 2XUEA 5EZYE 2ZLYA 4MLKA 3CX6B 3I9WA 2MOZA 4H9RC 4UXNB 4GK0E 3R6NA 5LXTE 3RC3A 5FY1A 1UCUA 2LM9A 1D1BA 1G73A 3AA0B 4FJOA 2I59A 2OA5A 2X51A 2LSGA 4ISTA 4H63V 3U78A 5FP3A 3M1CA 3ZEFB 4KBMB 2K24A 3VKGA 4TUYE 3O1HA 3WAKA 2VB6A 4I43B 2E9XC 2JMHA 1LKXA 5L3DB 2VL8A 2K5BB 3ONXA 3VKHA 2WWUA 3ZJ1A 1HTJF 1YKHB 2XTLA 1HG5A 1U4QA 2LSJA 4YLHA 4ZOLE 2V26A 1Y64B 3PUGA 3SOLA 4CI1B 3KBTA 4HTEA 3RYIE 2CXLA 4AQFA 3KFWX 2KWHA 3MK7C 3EDVA 5A1LA 3ZJ2A 3VHLA 3SRZA 4IHJE 4AKIA 3FBZA 3P8CD 4QX7B 4L9IA 2KZ7B 4H9SE 4YJ3E 4CZZB 4C91A 4EYYR 2NTYA 2UXNB 2E8IA 2XAJB 3CMLA 3C50A 5LG4A 3F57A 2W61A 3D0TA 2CLYC 2XAFB 2VASA 1VOMA 2KXPB 3AAEB 3K3QC 3UULA 3VJZA 4ECGA 5TAOA 4PK5A 3MZKB 2B1EA 5JDHA 5CA0E 5LJMA 4PJJA 2W62A 2LEHA 1MMGA 4OK0A 5JDQA 2LOPA 3BQIA 3VU7H 4ADZA 2NTXA 3LK3B 1HCIA 1D1AA 2PG8A 4FI5A 4AKGA 1OXZA 4X20E 4YHJA 3N9PA 1D0YA 5JDLA 3Q9DA 2HPJA 5H6QB 3MXZA 5LA6E 3ETVA 4IIJE 3HKCE 4OYKA 3H37A 3C4ZA 4KMCA 4HE8A 4CI3B 5J2TE 1MMAA 4L5GA 2W00A 2EHOD 4IE5A 3ZMZB 4ZHQE 4H9QC 3L09A 3IHRA 2LSIA 4X1KE 4EZHA 4HN9A 3LK2B 4KUMB 3CKDA 1MNEA 2XHEB 3MKDA 1D0ZA 4MHCA 4NUVA 5J1GA 1US7B 1NWMX 5HYAA 3FHNA 5EK3A 3HKEE 4BAYB 3C4WA 4ZI2C 3DTOA 4O2AE 5JDGA 5LHHB 3NRYA 2V7IA 2H3RA 2P9BA 2BDEA 5AFUL 2ES0A 2C5IT 3UUMA 1MIVA 3N2OA 3J7Yq 1O3XA 2BVMA 3KVBA 4UVCB 3O1IA 2LHRA 2XAGB 4O8SA 2IC9A 4N78D 5L2LA 5FNVE 3WI3A 4E7SA 4GK5E 1OWAA 2EHOB 3N9OA 2PFVA 2EHOA 2NW7A 2XASB 2ZM2A 3RPUA 3RYFE 1WYBA 2BVLA 3KBUA 5L3FB 4TV8E 4GYRA 3AT7A 5C8YE 5L3EB 3C4XA 3LBXB 3RYHE 2WMNA 3LBXA 4WW0A 4IE0A 2CEAA 3HA4A 1FMWA 3KV6A 3KVAA 3RX6A 5LNKA 4AQFC 3ZYMA 3ZC1A 2C5KT 3MJXA 3UUNA 3NZQA 2NP9A 2IAKA 3LK42 4BJNA 5JREA 3ZCJA 1QUUA 1IJ5A 4P0BA 3LG7A 3CVRA 5JRCB 3PURA 5JRCA 3B57A 4PJNA 3RH3A 3SS1A 3L3PA 4OHFA 5HXCA 4G2AA 3W15B 3LFMA 4PK4A 1SHZC 5ETWA 4EIWA 4WNKA 1H7CA 3U3IA 2Y48B 5FMNA 2X9XA 3C51A 3WSCA 4H9OC 4ZI2D 3LJCA 4B6XA 4AXPA 3PF0A 3DJBA 3O1JA 3FB2A 3OYZA 3HR0A 4H63H 2LOSA 2N1GA 3KV5A 2C5JA 3R84B 1WRDA 3QK6A 2JRKA 2X66A 3ETUA 2KLQA 5LBMA 2KMFA 3PDYA 3N9LA 3AAIA 4YJ2E 5FXXA 2LJLA 4DO0A 5LYJE 4GYSA 3PUQA 1Z0PA 5KDMC 4UV9B 2X68A 5H6RB 2XQYA 2NWBA 3IBPA 2DWGA 1G8XA 5L3BB 1S94A 4ISSA 4GIWA 5HXHA 2PJQA 4JEUB 4A56A 4EZ4A 1MIWA 1UX5A 2A72A 3N5LA 3E0ZA 4TZ4C 1ZEEA 3ANWB 1WR6A 5DABA 3ANWA 2LE8A 4PNIA 2JMKA 2NW9A 5JDFA 3PTRB 3DP7A 4UF0B 5HXEA 4AI6A 4O4JE 4UF0A 2V1DB 3F31A 4M1PA 2QA7A 4J2CA 4JLEA 2ODUA 2Q9QD 2ZMAA 5EK4A 2HH7A 2LHNA 3WURA 3J9X1 3CWZB 3K3NA 4OYJA 4DMWA 2JJ9A 5F8PA 1YW0A 2CA5A 1HF8A 2EHOC 4U72A 3WAJA 2KT9A 2X67A 2A2FX 4IE6A 4WBNE 2LQUA 2CM0A 3ZC0A 3KV9A 4CQIA 3O9XA 3EVYA 3HKBE 3IF8B 5HWXA 2W63A 3I0QA 4HGAA 2WSSV 4MALA 2CE7A 1T98A 3I1AA 5HXSA 3AA7B 1CUNA 2Y6XA 4EXTA 2MTQA 5FXWA 4L0RA 4PJLA 3PU3A 4I4TE 2N9DA 1ZKEA 3A5XA 2Q9QB 2Q9QA 2VK9A 4UVBB 4ZS2A 4CXWA 2WAUA 3IEEA 3PU8A 3N2KE 4JEHB 3I9YA 3ZN0B 2M67A 2CXDA 5FY7A 3H3AA 1IAPA 2H7OA 2X0LB 3CQGB 5HAXA 3NRXA 2WM9A 2CLYB 5JDMA 2Z6EA 3TKLB 4UIGA 3RRWA 2YU2A 2XAHB 4QXCB 3UTKA 3HKDE 3QUJA 2PBIA 5LGTB 1BR4A 3AA1B 2SPCA 4QKNA 2D0TA 4EB6E 2RA1A 4TV9E 3K8PC 2DHRA 4DBRA 1HS7A 5DQWA 3RYCE 5FY0A 5IHYA 4U74A 2MTCA 2C0SA 4HKAA 3PHF1 5IYZE 5EK2A 5JDNA 5M4YA 4BJMA 4CXYA 2YK0A 1D0XA 4XZCA 1WLXA 2VKOA 4PFOA 2DWKA 2CCQA 2W0GA 3Q2MA 5JR9B 2ZM8A 4EOZB 4PJMA 5JR9A 4TN7B 3GMIA 3ZN1B 2V7MA 2H7VC 2RP4A 3ZYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXE A;  5HXH A;  5JDQ A;  5HWY A;  5HYA A;  5JDL A;  5HXC A;  5JDM A;  5HXS A;  3V5S A;  5HXR A;  5HWX A;  5JDN A;  5JDF A;  5JDG A;  5JDH A;  3V5U A; 
#chains in the Genus database with same CATH topology
 3SWH A;  2XQ9 A;  3ESL A;  5ABG A;  2Y8D A;  4KHZ F;  3JC6 D;  4AKL A;  2PTF A;  5LHI B;  4K0K T;  4IGU A;  2YN6 A;  2L9Q A;  3N9M A;  2IW5 B;  1B7T A;  1QSD A;  5FVL A;  1IZN B;  4X1Y E;  3FBL A;  4AQG A;  2X9Y A;  4PK6 A;  2DNX A;  4ZI7 E;  4YXD A;  2E9X D;  1UX4 A;  2VKJ A;  2A3D A;  1HFA A;  5L3C B;  3OBV E;  2YDR A;  2WBL A;  4DVD A;  2A9U A;  2CWY A;  1W0B A;  3Q5X A;  2IML A;  4X65 T;  4QH1 A;  1Y01 A;  4JYA T;  4JV5 T;  5BR8 T;  2ODV A;  5CB4 E;  1AJ3 A;  3UT5 E;  4IE4 A;  2CXF A;  5CA1 E;  2XAQ B;  4EAH A;  1XNQ T;  2D0U A;  2L3L A;  2FJE A;  2KWI B;  3MAC A;  3GA8 A;  4AKH A;  5KX5 E;  2X0C A;  5HEO A;  2K9A A;  2KIN B;  3UQ4 A;  2MBG A;  4U2Z A;  4C90 A;  3T8O A;  4AKR B;  4WBO A;  1X79 A;  4DND A;  1R8I A;  4U31 A;  4GKJ T;  2FJD A;  5AQJ B;  1YQ3 A;  1M7K A;  3L39 A;  2VQE T;  4ASK A;  3PUA A;  2DCF A;  1VRB A;  2CHO A;  3GN5 B;  5ABF A;  4ILU A;  3N9Q A;  1XMO T;  5AQG B;  2V6X A;  4IL4 A;  3P4Q A;  2V7L A;  4GOU A;  5DJQ C;  1BR1 A;  5LBQ B;  4YHH T;  1D1C A;  1V9D A;  4ZI3 C;  3GWH A;  1KF6 A;  3CX6 B;  1HX1 B;  5LXT E;  3QNU A;  4HFD A;  4KBM B;  3CK6 A;  4U3C A;  4TUY E;  4I43 B;  2JQH A;  5HCJ A;  3P4W A;  2WWU A;  1HTJ F;  3RQU A;  2J62 A;  4IRE A;  4ZOL E;  3SOL A;  1WR0 A;  4CI1 B;  4DUZ T;  2CXL A;  3RGL A;  4ZXL A;  5HEG A;  4IHJ E;  4H9S E;  2XJ7 A;  4HFC A;  2NTY A;  3P50 A;  3C50 A;  5LG4 A;  4KI0 F;  4JI4 T;  4QH5 A;  3K3Q C;  3VJZ A;  3PJA A;  3MZK B;  2W62 A;  1DU2 A;  2LEH A;  4HWH A;  2YDS A;  5JTG A;  4ADZ A;  4AIU A;  4ILA A;  1D1A A;  2BBH A;  4X20 E;  1L0V A;  4IIJ E;  3UUB A;  4HFH A;  5J2T E;  2YOE A;  4JI6 T;  4CN6 A;  1XZY A;  3L09 A;  2XM2 A;  3LK2 B;  1MNE A;  3ONJ A;  2BS3 A;  4NUV A;  5HYA A;  5LHH B;  3AEF A;  3DTO A;  2V7I A;  5AFU L;  2ES0 A;  4AIS A;  2QRX A;  4ILB A;  3N2O A;  3KVB A;  4UVC B;  3O1I A;  3WI3 A;  4LF4 T;  3UU8 A;  1OWA A;  2EHO B;  2NW7 A;  5M4Y A;  3RYF E;  3PUY F;  2WDV A;  4GYR A;  5L47 A;  2WMN A;  3LBX A;  4WW0 A;  2UU9 T;  1N32 T;  3HA4 A;  4DUY T;  3KVA A;  3RX6 A;  2V6Y A;  3ZC1 A;  3UUN A;  3NZQ A;  2QYW A;  2CBJ A;  3CVR A;  5JRC A;  4PJN A;  3SS1 A;  4GKK T;  3L3P A;  2V5D A;  3W15 B;  1SHZ C;  5ETW A;  2Y48 B;  3WSC A;  1NEN A;  2FJA A;  3DJB A;  5LMU T;  3OYZ A;  4H63 H;  2N1G A;  2JRK A;  3G06 A;  2X66 A;  2KLQ A;  2KMF A;  4B3R T;  3AAI A;  4YJ2 E;  2UXB T;  2V5C A;  4DO0 A;  1Z0P A;  2NWB A;  1S94 A;  1OED B;  4GIW A;  5FL0 A;  2L10 A;  3N5L A;  1ZEE A;  3ANW B;  5JDF A;  4UF0 B;  5HXE A;  3F31 A;  4DR4 T;  1IBM T;  2CRB A;  5EK4 A;  2WU5 A;  4HWD A;  2E5L T;  3LDQ B;  4OYJ A;  4DMW A;  5F8P A;  1YW0 A;  2CA5 A;  2HN2 A;  4WBN E;  3QB5 A;  2CM0 A;  3KV9 A;  4CQI A;  5HWX A;  2W63 A;  3AE1 A;  4MAL A;  1CUN A;  4EXT A;  4PJL A;  2Q9Q A;  4UVB B;  4DR3 T;  2CXD A;  2BKN A;  1IAP A;  2B76 A;  4DR5 T;  5AQM B;  5JDM A;  4UIG A;  3RRW A;  3HKD E;  3QUJ A;  3AA1 B;  4DV3 T;  3RKG A;  4TV9 E;  1HS7 A;  2VL0 A;  1Z8U A;  4U74 A;  4HKA A;  5IYZ E;  2YK0 A;  1W09 A;  1WLX A;  4PFO A;  2FBW A;  5JR9 B;  2ZM8 A;  4JI8 T;  3GMI A;  4DR2 T;  2XZE A;  3UUX B;  1EZ3 A;  4TX5 A;  2IC6 A;  5HWY A;  5LHG B;  4HFI A;  1ZOY A;  3ONL C;  4QXB B;  4UEM A;  4ZEY A;  3FZF B;  3N9N A;  4ANJ A;  3TLW A;  1BR2 A;  2D5U A;  4YTM A;  3KV4 A;  2ZM0 A;  3P4S A;  4ZI3 D;  1LRZ A;  4BGO A;  3K3O A;  2LRL A;  4E7Z A;  1ZP0 A;  4H9N C;  4COF A;  2J4G A;  3UFE A;  2JPF A;  4LMK A;  4YSX A;  5GON E;  3AVR A;  3RF1 A;  5C3J A;  4IE7 A;  4I50 E;  5LGU B;  4H9P C;  3ZT6 A;  3ABV A;  4BA9 A;  3RRC A;  3NZP A;  2F4V T;  2VKH A;  2X9W A;  4HFV A;  2Q9Q C;  3V5S A;  2QGS A;  4HWI B;  3EUH A;  3OYX A;  4EV6 A;  2IHR 1;  2BS4 A;  2H88 A;  4O4I E;  3HL6 A;  1VCS A;  2WDR A;  5AQI B;  4TWF A;  1FIO A;  3BQK A;  3PV0 F;  2FJB A;  2BG9 C;  4NPP A;  4QWN B;  3Q5E A;  3E08 A;  2E9X B;  3AVS A;  3OJA A;  4HFE A;  3KDS E;  3AA6 B;  3RKO A;  4O4H E;  4QH4 A;  4XBF B;  4IDZ A;  4YFS A;  5FXZ A;  3RC8 A;  4KP3 C;  2WMO A;  3AB3 B;  4PAG A;  3AEA A;  3EAB A;  2WB5 A;  3N2G E;  3CQC B;  4QXH B;  5AQH B;  5F3J A;  2HN1 A;  2V7K A;  5HXR A;  2LT3 A;  1N33 T;  3ZMU B;  5LP6 E;  3MA9 A;  2VWA A;  3SFE A;  3B13 A;  2XPK A;  2W2U A;  2VKD A;  3RIU A;  4JI7 T;  3AEB A;  2V6Y B;  1LVK A;  1E2A A;  1WYC A;  1SJ7 A;  3BK9 A;  3JAE A;  1OED E;  4HEA A;  1MND A;  3CQX C;  5EZY E;  2ZLY A;  4WZX A;  3I9W A;  4H9R C;  4GK0 E;  3FZH B;  5FY1 A;  2LM9 A;  4KHP T;  4P1N A;  3OTO T;  3AA0 B;  4FJO A;  2OA5 A;  2LSG A;  2K24 A;  2LM2 A;  3O1H A;  2VB6 A;  4DV1 T;  2WCA A;  2XQ8 A;  2XTL A;  1U4Q A;  2WS3 A;  3PUG A;  4IT4 A;  4HTE A;  3AXJ B;  2KWH A;  4L9I A;  1J5E T;  2E8I A;  3CML A;  2M6I A;  5L4H A;  3D0T A;  3LSV A;  5AQF B;  1VOM A;  5TAO A;  4CN1 A;  4PJJ A;  2VQF T;  3BQI A;  1IBL T;  2PG8 A;  1D0Y A;  2E2A A;  3MXZ A;  3ETV A;  1KEY A;  4OYK A;  3C4Z A;  2WDQ A;  3H3M A;  3RLF F;  4ZHQ E;  1J5W A;  5LB7 B;  1JNR A;  4X1K E;  1XDP A;  5CJ5 A;  3RI5 A;  4KUM B;  3MKD A;  4LF5 T;  1VCT A;  4I0U A;  1NWM X;  3FHN A;  3C4W A;  4EGW A;  4ILC A;  2C5I T;  4LF8 T;  4YT0 A;  1I6Z A;  4O8S A;  2IC9 A;  4E7S A;  4DR7 T;  4YTN A;  3N9O A;  2W67 A;  2XAS B;  2ZM2 A;  1WYB A;  4TV8 E;  5C8Y E;  5L3E B;  3AED A;  2BG9 B;  3ZYM A;  3MJX A;  4EED A;  2NP9 A;  2IAK A;  3LK4 2;  4BJN A;  5JRE A;  3VRB A;  2CPT A;  4NXM T;  3B57 A;  5HXC A;  3LFM A;  4EIW A;  2DL1 A;  5FMN A;  3LJC A;  4B6X A;  1HR0 T;  2KBB A;  3O1J A;  3FB2 A;  1HNX T;  3HR0 A;  3UFG A;  3KV5 A;  2WZI A;  1WRD A;  3ETU A;  5LBM A;  4EEB A;  3PDY A;  5F5W A;  4DV4 T;  5FXX A;  4GYS A;  5IWA T;  5KDM C;  4UV9 B;  4ZZB A;  3IBP A;  4X64 T;  4DR6 T;  2PJQ A;  4JEU B;  4A56 A;  4EZ4 A;  1MIW A;  1UX5 A;  4IDO A;  3QB5 K;  2NW9 A;  4LFA T;  3PTR B;  3DP7 A;  4YTP A;  2AE9 A;  4O4J E;  2I0M A;  2XQ5 A;  2Q9Q D;  2ZMA A;  3UQ7 A;  2LHN A;  3CWZ B;  2JJ9 A;  3Q5D A;  4JI5 T;  4IE6 A;  1XNR T;  3CIR A;  3T1Y T;  4A97 A;  4JI0 T;  3QOF A;  2WSS V;  1T7S A;  5FXW A;  2XQ3 A;  2IIU A;  1J1J A;  4CXW A;  2WAU A;  2M67 A;  5HAX A;  1UUS A;  2Z6E A;  2YU2 A;  3VR9 A;  1BR4 A;  2XQ6 A;  4EB6 E;  2RA1 A;  5DQW A;  5ABE A;  4LMJ A;  5IHY A;  2MTC A;  5JDN A;  3ZST A;  3JCF A;  4XZC A;  4LFC T;  2VKO A;  3AE6 A;  4X66 T;  3ZN1 B;  2RP4 A;  3PUZ F;  3ZYK A;  5JQG E;  4A5X A;  3AY5 A;  3OVU A;  4MFR A;  2GK9 A;  4OFZ A;  2KSR A;  3FXE B;  3C64 A;  4WYV A;  2YU1 A;  4DV2 T;  3ZYL A;  3NKZ A;  3ZLI A;  4XAX B;  3E22 E;  2MYS A;  1IJ6 A;  4Z90 A;  2R6G F;  2WY2 A;  3AAA B;  3TLS A;  4DMV A;  1FEW A;  3BQL A;  2YKS A;  2DI4 A;  2BS2 A;  4P0A A;  2HPL A;  3NBX X;  4CN4 A;  3AE8 A;  4JUY A;  4AQY T;  3P7I A;  3HI2 A;  3IA3 A;  2N2N A;  3PUX F;  2YEV C;  4UR9 A;  4YY3 T;  3ZPO A;  2K48 A;  3EI0 A;  5AQQ B;  2L8K A;  1FMV A;  1S35 A;  5AQN B;  3B5M A;  2V7J A;  1U5P A;  2DLR A;  4V1A v;  4B3M T;  3EDU A;  2VVS A;  2BZB A;  2LSY A;  5FXV A;  2KND A;  2X9H A;  1BR0 A;  5E0O A;  4X62 T;  4UEL A;  4ZS3 A;  3AE2 A;  5HCM A;  4O4L E;  3S4U A;  2YIN A;  1WCR A;  4ONR A;  4PW8 A;  4HWC A;  4QX8 B;  1HX8 A;  2JQQ A;  3AEE A;  5FYM A;  5ABH A;  5J2U E;  5KMG P;  1HG2 A;  3QC9 A;  4Q25 A;  4U7Y A;  5ABF B;  1JNZ A;  3VR8 A;  3GN5 A;  4O2B E;  4G63 A;  5LJN A;  3CPZ A;  1ZHC A;  5T1D A;  2D2S A;  2CMR A;  3ZMV B;  3P4R A;  5BMV E;  3O4X E;  2LSK A;  5AQO B;  1IBK T;  2D9D A;  4TNW A;  4ZZC A;  2ZM6 T;  2MOZ A;  4UXN B;  3RC3 A;  1D1B A;  2BKP A;  1UGO A;  2I59 A;  3U78 A;  3ZEF B;  3AE3 A;  3WAK A;  2UUA T;  2JMH A;  5L3D B;  2VL8 A;  2K5B B;  3ONX A;  3VKH A;  3ZJ1 A;  1YKH B;  2LSJ A;  2V26 A;  1XDO A;  3KBT A;  3RYI E;  3KFW X;  2WWV A;  5A1L A;  4OX9 T;  4AKI A;  3FBZ A;  3P8C D;  2KZ7 B;  2V8S V;  4YJ3 E;  1UUR A;  4CZZ B;  4C91 A;  2XAJ B;  4LF9 T;  3F57 A;  2CLY C;  2XAF B;  2VAS A;  2KXP B;  3AAE B;  2OV9 A;  3UUL A;  2B1E A;  5LJM A;  5CA0 E;  4OK0 A;  5JDQ A;  1N34 T;  4TWH A;  2LOP A;  3VU7 H;  2NTX A;  1HCI A;  4FI5 A;  1OXZ A;  4YHJ A;  3N9P A;  5JDL A;  3Q9D A;  2HPJ A;  5H6Q B;  5HEJ A;  3HKC E;  3H37 A;  2W4X A;  4KMC A;  4CI3 B;  4L5G A;  3ZT7 A;  4H9Q C;  3IHR A;  5HEU A;  2L7N A;  4EZH A;  2LRK A;  4NXN T;  2CHN A;  1NEK A;  4DV0 T;  2MPK A;  3AEC A;  5J1G A;  1US7 B;  1SJ8 A;  2IUB A;  5EK3 A;  1CHU A;  2LKG A;  4BAY B;  3NRY A;  2H3R A;  2BDE A;  3VRA A;  4JI1 T;  4N78 D;  5L2L A;  3NVO A;  2EHO A;  3RPU A;  2BVL A;  4YSZ A;  3AT7 A;  3LBX B;  2WQY A;  4Z91 A;  2X0H A;  4IE0 A;  2LKH A;  5LNK A;  3ZCJ A;  4P0B A;  2NR4 A;  5JRC B;  2WU2 A;  3RH3 A;  4OHF A;  1H7C A;  2X9X A;  4AXP A;  3QK6 A;  1I94 T;  3ZKR A;  2LJL A;  4A98 A;  2BKO A;  2X68 A;  2KVP A;  2DWG A;  1G8X A;  4ISS A;  4NIQ A;  1OED A;  5HXH A;  2UXC T;  2A72 A;  3E0Z A;  4YSY A;  2JIW A;  1WR6 A;  3JAF A;  3ANW A;  3PJA J;  2JMK A;  3UU5 A;  4AI6 A;  4UF0 A;  3K1S A;  2OLT A;  2V1D B;  4JBW F;  5HEH A;  4B3S T;  2QA7 A;  4J2C A;  2ODU A;  3WUR A;  3K3N A;  1HF8 A;  2EHO C;  2KT9 A;  5FL1 A;  2A2F X;  2LQU A;  3ZC0 A;  2J47 A;  3RIU C;  3O9X A;  3HKB E;  3IF8 B;  2CE7 A;  1T98 A;  3I1A A;  5L4E A;  2E5V A;  5HXS A;  1FJG T;  4DR1 T;  3AA7 B;  2ACZ A;  2Y6X A;  2MTQ A;  3SFD A;  3PUW F;  3UU3 A;  3PU3 A;  2AXD S;  2N9D A;  1ZKE A;  1QLB A;  2Q9Q B;  2VK9 A;  4U33 A;  1KNR A;  1YXR A;  4ZS2 A;  3PU8 A;  3N2K E;  2I6H A;  5FY7 A;  2X0L B;  3AEG A;  2WM9 A;  4IDP A;  2CLY B;  3TKL B;  4QXC B;  5AQV B;  2PBI A;  5LGT B;  3K8P C;  2DHR A;  4DBR A;  5FY0 A;  1T72 A;  2UUC T;  3FZM B;  4CXY A;  2DWK A;  2CCQ A;  2W0G A;  3Q2M A;  4PJM A;  5JR9 A;  4TN7 B;  1OED C;  2V7M A;  4ZI2 C;  3PUS A;  1YKE B;  3RIF A;  2NW8 A;  4ERR A;  2G0U A;  4DBQ A;  2HHH T;  2J1D G;  1KNZ A;  5ADX L;  2MAW A;  2VVN A;  2UXX B;  3V5U A;  3CX7 B;  3PE0 A;  4DV7 T;  2XQ4 A;  3PUV F;  1SE7 A;  3A8Y C;  3DYJ A;  5AQR B;  3AE5 A;  3KIN B;  1HNW T;  5JVD E;  1MIY A;  2M6B A;  3M65 A;  3FYQ A;  4PFP A;  1MMN A;  5DQV A;  2CWO A;  2XQ7 A;  3F2E A;  5FVK A;  2RPA A;  3C98 B;  4CXX A;  2K3W A;  4UV8 B;  1MMD A;  1ZV4 X;  1LVF A;  4F7G B;  3EHZ A;  2NOX A;  4QHO A;  2E9X A;  4I55 E;  4DV6 T;  5JR9 C;  1W9R A;  5AQT B;  3ZCI A;  2WP9 A;  1E1H B;  4NUU A;  2ACX A;  1NAF A;  2YDQ A;  4TNV A;  5LGN B;  4CI2 B;  4P09 A;  1YD8 G;  3ZMT B;  2UXD T;  3TLV A;  4HFB A;  3JAD A;  4X1I E;  3Q5W A;  3CX8 B;  3ZMS B;  5LCY A;  1SA0 E;  3I0O A;  5JH7 E;  4B3T T;  3RIA A;  1WFD A;  4EYU A;  3P4P A;  5LOV E;  1KK7 A;  3OKQ A;  4UVA B;  3FXD B;  2KGX A;  1SUM B;  3JC6 C;  3EAM A;  3FZL B;  5FZT A;  4MBQ A;  4F8H A;  4F6R C;  4JI2 T;  4JI3 T;  4Z8X A;  4K0U A;  5L3G B;  4LF6 T;  5AQL B;  2XUE A;  4MLK A;  5C2T A;  4DID B;  3R6N A;  1UCU A;  1G73 A;  3AE7 A;  2X51 A;  4IST A;  4H63 V;  5FP3 A;  3M1C A;  1T8B A;  3M3Z B;  3VKG A;  2E9X C;  1LKX A;  1HG5 A;  4YLH A;  1Y64 B;  4AQF A;  3MK7 C;  3EDV A;  3AXJ A;  3ZJ2 A;  2XSB A;  3VHL A;  3SRZ A;  2VUR A;  3TLT A;  4QX7 B;  1XWM A;  4EYY R;  2UXN B;  1UK5 A;  2W61 A;  5IUX A;  2CBI A;  4ECG A;  4PK5 A;  3A7M A;  5JDH A;  1MMG A;  1M62 A;  5AQK B;  5AQU B;  3LK3 B;  4AKG A;  5LG3 A;  4KX6 A;  5LA6 E;  4HE8 A;  1MMA A;  2W00 A;  2EHO D;  4IE5 A;  3ZMZ B;  2BG9 E;  2LSI A;  5KXJ A;  4HWF A;  4IDN A;  4HN9 A;  3CKD A;  2XHE B;  1D0Z A;  4MHC A;  2JQ9 A;  3HKE E;  4O2A E;  5JDG A;  2P9B A;  3UUM A;  1MIV A;  3J7Y q;  1O3X A;  2BVM A;  2LHR A;  2XAG B;  2JQK A;  3T1H T;  5FNV E;  4GK5 E;  4W8P A;  2LLY A;  2PFV A;  3KBU A;  5L3F B;  4U7I A;  2X0Y A;  3TLU A;  1KFY A;  3C4X A;  3RYH E;  2CEA A;  1FMW A;  3KV6 A;  2BG9 A;  3UU4 A;  4AQF C;  2C5K T;  4LF7 T;  1QUU A;  1IJ5 A;  5CFB A;  3LG7 A;  3PUR A;  4G2A A;  4PK4 A;  1HNZ T;  4WNK A;  3U3I A;  4IDQ A;  3C51 A;  4H9O C;  4ZI2 D;  3PF0 A;  5FKY A;  4DV5 T;  5J0Z A;  2LOS A;  2C5J A;  3R84 B;  3N9L A;  5LYJ E;  4U2Y A;  3PUQ A;  5H6R B;  1GQE A;  2XQY A;  2IDO B;  5AQP B;  5L3B B;  3UU6 A;  5LMN T;  4TZ4 C;  3RQW A;  5DAB A;  1YQ4 A;  2LE8 A;  4PNI A;  2H89 A;  4M1P A;  4JLE A;  1W0A A;  2HH7 A;  3J9X 1;  1X9B A;  4U72 A;  3NWI A;  3WAJ A;  2X67 A;  3ZSS A;  1XMQ T;  3EVY A;  3I0Q A;  4HGA A;  5CGM A;  4TWD A;  2QVA A;  5AQS B;  3X1D A;  4L0R A;  4I4T E;  3A5X A;  3OPC A;  3IEE A;  4JEH B;  3I9Y A;  3ZN0 B;  2WZH A;  3ZT5 A;  2XQA A;  3H3A A;  2H7O A;  2UUB T;  2W66 A;  3CQG B;  3AE4 A;  2FUP A;  3NRX A;  1E7P A;  3AE9 A;  3RHW A;  1N36 T;  2XM1 A;  2XAH B;  3UTK A;  2BBJ A;  2SPC A;  4QKN A;  2D0T A;  4LML A;  3RYC E;  4LFB T;  4IL9 A;  2C0S A;  3L8R A;  3PHF 1;  5EK2 A;  4BJM A;  4X5T A;  1D0X A;  4EOZ B;  2XY8 B;  2H7V C;  2XSA A;  3FZK B;  1KNP A; 
#chains in the Genus database with same CATH homology
 3SWH A;  3PUS A;  3UUX B;  5JQG E;  1YKE B;  3ESL A;  1EZ3 A;  4TX5 A;  2IC6 A;  5HWY A;  5LHG B;  2Y8D A;  4MFR A;  2GK9 A;  3JC6 D;  4OFZ A;  4QXB B;  2NW8 A;  4UEM A;  4AKL A;  4ERR A;  3FXE B;  3C64 A;  2G0U A;  3N9N A;  2YU1 A;  4ANJ A;  1BR2 A;  4DBQ A;  5LHI B;  2D5U A;  2J1D G;  4IGU A;  1KNZ A;  3KV4 A;  2ZM0 A;  4ZI3 D;  5ADX L;  1LRZ A;  3ZYL A;  3K3O A;  4BGO A;  2L9Q A;  3ZLI A;  2UXX B;  4XAX B;  3E22 E;  3CX7 B;  2MYS A;  3PE0 A;  3V5U A;  4E7Z A;  1IJ6 A;  3N9M A;  4H9N C;  2IW5 B;  3AAA B;  1B7T A;  3UFE A;  2JPF A;  4DMV A;  1FEW A;  1QSD A;  5GON E;  3AVR A;  3BQL A;  2DI4 A;  3KIN B;  4IE7 A;  4P0A A;  2HPL A;  5JVD E;  3NBX X;  4I50 E;  1MIY A;  5LGU B;  1IZN B;  4X1Y E;  3FBL A;  3M65 A;  4H9P C;  2X9Y A;  4JUY A;  4AQG A;  4PK6 A;  3P7I A;  2DNX A;  4ZI7 E;  3HI2 A;  4PFP A;  1MMN A;  5DQV A;  4BA9 A;  3RRC A;  3NZP A;  2CWO A;  2E9X D;  1UX4 A;  2VKJ A;  2A3D A;  1HFA A;  2VKH A;  2X9W A;  4HFV A;  2Q9Q C;  5L3C B;  3OBV E;  3F2E A;  3V5S A;  2QGS A;  3EUH A;  3OYX A;  2N2N A;  2WBL A;  4DVD A;  2YEV C;  3C98 B;  3ZPO A;  2K48 A;  4O4I E;  2CWY A;  3Q5X A;  3HL6 A;  2L8K A;  4CXX A;  1FMV A;  1S35 A;  2ODV A;  5CB4 E;  4UV8 B;  3UT5 E;  1AJ3 A;  1FIO A;  3BQK A;  1MMD A;  1ZV4 X;  1LVF A;  4IE4 A;  2V7J A;  2CXF A;  5CA1 E;  2XAQ B;  1U5P A;  2NOX A;  2DLR A;  4QWN B;  4QHO A;  4EAH A;  2D0U A;  4V1A v;  3E08 A;  2E9X B;  3AVS A;  2L3L A;  2E9X A;  4I55 E;  3OJA A;  2KWI B;  3EDU A;  3KDS E;  3AA6 B;  3RKO A;  4O4H E;  5JR9 C;  3MAC A;  4XBF B;  2BZB A;  3GA8 A;  4IDZ A;  4AKH A;  5KX5 E;  2LSY A;  3ZCI A;  4YFS A;  5FXZ A;  5FXV A;  2KND A;  2X9H A;  3RC8 A;  4KP3 C;  1BR0 A;  5E0O A;  2K9A A;  1E1H B;  2KIN B;  4NUU A;  4UEL A;  2ACX A;  4ZS3 A;  2WMO A;  2MBG A;  1NAF A;  4O4L E;  3S4U A;  3AB3 B;  4C90 A;  3T8O A;  5LGN B;  4PAG A;  4AKR B;  4CI2 B;  4P09 A;  2YIN A;  1YD8 G;  4WBO A;  3ZMT B;  4ONR A;  4PW8 A;  1X79 A;  4DND A;  4QX8 B;  1HX8 A;  4X1I E;  2JQQ A;  3N2G E;  3CQC B;  4QXH B;  5F3J A;  3Q5W A;  3CX8 B;  3ZMS B;  5LCY A;  1SA0 E;  3I0O A;  5FYM A;  5JH7 E;  5J2U E;  4ASK A;  5KMG P;  1HG2 A;  3PUA A;  2DCF A;  3QC9 A;  1VRB A;  4EYU A;  2V7K A;  3GN5 B;  2LT3 A;  5HXR A;  3GN5 A;  4ILU A;  3ZMU B;  5LP6 E;  5LOV E;  3MA9 A;  3N9Q A;  4O2B E;  2VWA A;  4G63 A;  5LJN A;  3B13 A;  1KK7 A;  2V7L A;  3CPZ A;  3OKQ A;  4UVA B;  4GOU A;  3FXD B;  1ZHC A;  2VKD A;  3JC6 C;  5DJQ C;  5T1D A;  2D2S A;  2CMR A;  4MBQ A;  1BR1 A;  1LVK A;  5LBQ B;  4F6R C;  3ZMV B;  1D1C A;  1V9D A;  4ZI3 C;  1WYC A;  5BMV E;  3O4X E;  2LSK A;  3GWH A;  4Z8X A;  3BK9 A;  4K0U A;  5L3G B;  4HEA A;  1MND A;  3CQX C;  2XUE A;  5EZY E;  2ZLY A;  4MLK A;  3CX6 B;  3I9W A;  2MOZ A;  4H9R C;  4UXN B;  4GK0 E;  3R6N A;  5LXT E;  3RC3 A;  5FY1 A;  1UCU A;  2LM9 A;  1D1B A;  1G73 A;  3AA0 B;  4FJO A;  2I59 A;  2OA5 A;  2X51 A;  2LSG A;  4IST A;  4H63 V;  3U78 A;  5FP3 A;  3M1C A;  3ZEF B;  4KBM B;  2K24 A;  3VKG A;  4TUY E;  3O1H A;  3WAK A;  2VB6 A;  4I43 B;  2E9X C;  2JMH A;  1LKX A;  5L3D B;  2VL8 A;  2K5B B;  3ONX A;  3VKH A;  2WWU A;  3ZJ1 A;  1HTJ F;  1YKH B;  2XTL A;  1HG5 A;  1U4Q A;  2LSJ A;  4YLH A;  4ZOL E;  2V26 A;  1Y64 B;  3PUG A;  3SOL A;  4CI1 B;  3KBT A;  4HTE A;  3RYI E;  2CXL A;  4AQF A;  3KFW X;  2KWH A;  3MK7 C;  3EDV A;  5A1L A;  3ZJ2 A;  3VHL A;  3SRZ A;  4IHJ E;  4AKI A;  3FBZ A;  3P8C D;  4QX7 B;  4L9I A;  2KZ7 B;  4H9S E;  4YJ3 E;  4CZZ B;  4C91 A;  4EYY R;  2NTY A;  2UXN B;  2E8I A;  2XAJ B;  3CML A;  3C50 A;  5LG4 A;  3F57 A;  2W61 A;  3D0T A;  2CLY C;  2XAF B;  2VAS A;  1VOM A;  2KXP B;  3AAE B;  3K3Q C;  3UUL A;  3VJZ A;  4ECG A;  5TAO A;  4PK5 A;  3MZK B;  2B1E A;  5JDH A;  5CA0 E;  5LJM A;  4PJJ A;  2W62 A;  2LEH A;  1MMG A;  4OK0 A;  5JDQ A;  2LOP A;  3BQI A;  3VU7 H;  4ADZ A;  2NTX A;  3LK3 B;  1HCI A;  1D1A A;  2PG8 A;  4FI5 A;  4AKG A;  1OXZ A;  4X20 E;  4YHJ A;  3N9P A;  1D0Y A;  5JDL A;  3Q9D A;  2HPJ A;  5H6Q B;  3MXZ A;  5LA6 E;  3ETV A;  4IIJ E;  3HKC E;  4OYK A;  3H37 A;  3C4Z A;  4KMC A;  4HE8 A;  4CI3 B;  5J2T E;  1MMA A;  4L5G A;  2W00 A;  2EHO D;  4IE5 A;  3ZMZ B;  4ZHQ E;  4H9Q C;  3L09 A;  3IHR A;  2LSI A;  4X1K E;  4EZH A;  4HN9 A;  3LK2 B;  4KUM B;  3CKD A;  1MNE A;  2XHE B;  3MKD A;  1D0Z A;  4MHC A;  4NUV A;  5J1G A;  1US7 B;  1NWM X;  5HYA A;  3FHN A;  5EK3 A;  3HKE E;  4BAY B;  3C4W A;  4ZI2 C;  3DTO A;  4O2A E;  5JDG A;  5LHH B;  3NRY A;  2V7I A;  2H3R A;  2P9B A;  2BDE A;  5AFU L;  2ES0 A;  2C5I T;  3UUM A;  1MIV A;  3N2O A;  3J7Y q;  1O3X A;  2BVM A;  3KVB A;  4UVC B;  3O1I A;  2LHR A;  2XAG B;  4O8S A;  2IC9 A;  4N78 D;  5L2L A;  5FNV E;  3WI3 A;  4E7S A;  4GK5 E;  1OWA A;  2EHO B;  3N9O A;  2PFV A;  2EHO A;  2NW7 A;  2XAS B;  2ZM2 A;  3RPU A;  3RYF E;  1WYB A;  2BVL A;  3KBU A;  5L3F B;  4TV8 E;  4GYR A;  3AT7 A;  5C8Y E;  5L3E B;  3C4X A;  3LBX B;  3RYH E;  2WMN A;  3LBX A;  4WW0 A;  4IE0 A;  2CEA A;  3HA4 A;  1FMW A;  3KV6 A;  3KVA A;  3RX6 A;  5LNK A;  4AQF C;  3ZYM A;  3ZC1 A;  2C5K T;  3MJX A;  3UUN A;  3NZQ A;  2NP9 A;  2IAK A;  3LK4 2;  4BJN A;  5JRE A;  3ZCJ A;  1QUU A;  1IJ5 A;  4P0B A;  3LG7 A;  3CVR A;  5JRC B;  3PUR A;  5JRC A;  3B57 A;  4PJN A;  3RH3 A;  3SS1 A;  3L3P A;  4OHF A;  5HXC A;  4G2A A;  3W15 B;  3LFM A;  4PK4 A;  1SHZ C;  5ETW A;  4EIW A;  4WNK A;  1H7C A;  3U3I A;  2Y48 B;  5FMN A;  2X9X A;  3C51 A;  3WSC A;  4H9O C;  4ZI2 D;  3LJC A;  4B6X A;  4AXP A;  3PF0 A;  3DJB A;  3O1J A;  3FB2 A;  3OYZ A;  3HR0 A;  4H63 H;  2LOS A;  2N1G A;  3KV5 A;  2C5J A;  3R84 B;  1WRD A;  3QK6 A;  2JRK A;  2X66 A;  3ETU A;  2KLQ A;  5LBM A;  2KMF A;  3PDY A;  3N9L A;  3AAI A;  4YJ2 E;  5FXX A;  2LJL A;  4DO0 A;  5LYJ E;  4GYS A;  3PUQ A;  1Z0P A;  5KDM C;  4UV9 B;  2X68 A;  5H6R B;  2XQY A;  2NWB A;  3IBP A;  2DWG A;  1G8X A;  5L3B B;  1S94 A;  4ISS A;  4GIW A;  5HXH A;  2PJQ A;  4JEU B;  4A56 A;  4EZ4 A;  1MIW A;  1UX5 A;  2A72 A;  3N5L A;  3E0Z A;  4TZ4 C;  1ZEE A;  3ANW B;  1WR6 A;  5DAB A;  3ANW A;  2LE8 A;  4PNI A;  2JMK A;  2NW9 A;  5JDF A;  3PTR B;  3DP7 A;  4UF0 B;  5HXE A;  4AI6 A;  4O4J E;  4UF0 A;  2V1D B;  3F31 A;  4M1P A;  2QA7 A;  4J2C A;  4JLE A;  2ODU A;  2Q9Q D;  2ZMA A;  5EK4 A;  2HH7 A;  2LHN A;  3WUR A;  3J9X 1;  3CWZ B;  3K3N A;  4OYJ A;  4DMW A;  2JJ9 A;  5F8P A;  1YW0 A;  2CA5 A;  1HF8 A;  2EHO C;  4U72 A;  3WAJ A;  2KT9 A;  2X67 A;  2A2F X;  4IE6 A;  4WBN E;  2LQU A;  2CM0 A;  3ZC0 A;  3KV9 A;  4CQI A;  3O9X A;  3EVY A;  3HKB E;  3IF8 B;  5HWX A;  2W63 A;  3I0Q A;  4HGA A;  2WSS V;  4MAL A;  2CE7 A;  1T98 A;  3I1A A;  5HXS A;  3AA7 B;  1CUN A;  2Y6X A;  4EXT A;  2MTQ A;  5FXW A;  4L0R A;  4PJL A;  3PU3 A;  4I4T E;  2N9D A;  1ZKE A;  3A5X A;  2Q9Q B;  2Q9Q A;  2VK9 A;  4UVB B;  4ZS2 A;  4CXW A;  2WAU A;  3IEE A;  3PU8 A;  3N2K E;  4JEH B;  3I9Y A;  3ZN0 B;  2M67 A;  2CXD A;  5FY7 A;  3H3A A;  1IAP A;  2H7O A;  2X0L B;  3CQG B;  5HAX A;  3NRX A;  2WM9 A;  2CLY B;  5JDM A;  2Z6E A;  3TKL B;  4UIG A;  3RRW A;  2YU2 A;  2XAH B;  4QXC B;  3UTK A;  3HKD E;  3QUJ A;  2PBI A;  5LGT B;  1BR4 A;  3AA1 B;  2SPC A;  4QKN A;  2D0T A;  4EB6 E;  2RA1 A;  4TV9 E;  3K8P C;  2DHR A;  4DBR A;  1HS7 A;  5DQW A;  3RYC E;  5FY0 A;  5IHY A;  4U74 A;  2MTC A;  2C0S A;  4HKA A;  3PHF 1;  5IYZ E;  5EK2 A;  5JDN A;  5M4Y A;  4BJM A;  4CXY A;  2YK0 A;  1D0X A;  4XZC A;  1WLX A;  2VKO A;  4PFO A;  2DWK A;  2CCQ A;  2W0G A;  3Q2M A;  5JR9 B;  2ZM8 A;  4EOZ B;  4PJM A;  5JR9 A;  4TN7 B;  3GMI A;  3ZN1 B;  2V7M A;  2H7V C;  2RP4 A;  3ZYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...