5HWXA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and zero ca2+
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
301
structure length
294
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords sodium,calcium exchanger
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
total genus 126
structure length 294
sequence length 301
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hwxA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hwxA02
5JDGA 5HYAA 3V5UA 5HXCA 5JDHA 5HXEA 5JDLA 3V5SA 5JDNA 5HXRA 5JDMA 5JDQA 5HXSA 5HWYA 5HXHA 5HWXA 5JDFA
chains in the Genus database with same CATH superfamily
1LVKA 3C4XA 2DCFA 4HFHA 3ONXA 3KBUA 1SJ8A 5LNKA 4JBWF 3ZT7A 2A3DA 3AAIA 4ILBA 5FXXA 3PV0F 3LK2B 4X1KE 5AQTB 3LSVA 4DV5T 2V8SV 4ECGA 3A8YC 1UURA 3FXDB 2KGXA 3PE0A 1E2AA 2NW7A 2ZMAA 2BVLA 5AQLB 4PJNA 1MMAA 4DUZT 4O4JE 2UXCT 3QC9A 3WURA 3SRZA 4TN7B 5KDMC 1KNRA 4CI3B 3J7Yq 2LM9A 4I55E 5LBMA 2BG9B 3ZLIA 4ZS2A 3HKEE 5FYMA 4ONRA 1BR0A 2CWOA 4XZCA 4CXYA 3RRWA 1HNXT 3TKLB 4K0KT 3RIFA 5FKYA 4TV8E 4UVAB 3CX8B 3B57A 4MALA 2WWUA 1HX8A 2JMHA 2XQ6A 1XZYA 1Y64B 3HI2A 4H9OC 3QNUA 1WYBA 4ZI7E 3PUYF 3P7IA 2E2AA 3Q5EA 5HAXA 4O4LE 2LOPA 4WNKA 4YLHA 5AQGB 4EB6E 2YN6A 1XNRT 2ODUA 5EK4A 4I50E 4HFIA 4B6XA 4ZI2D 4OYKA 3O9XA 3WI3A 1D0YA 3P4WA 4NXNT 4F7GB 2DI4A 4LF6T 4XAXB 2KINB 5H6QB 3FZMB 2K48A 4JEHB 2BS3A 2X9WA 2PFVA 1S35A 1W9RA 5HCMA 1X79A 4Q25A 1HNWT 3HKCE 1B7TA 2WB5A 2X51A 4TNVA 4YY3T 2BKOA 3WAJA 1IBKT 4YTPA 3UU5A 2V6YB 4ERRA 1D0XA 3ZJ1A 2X9YA 3RPUA 4YHJA 3KVBA 1YKEB 4CXWA 2WMOA 5HEOA 2CWYA 5HYAA 2J4GA 3P4PA 2VB6A 3NZQA 4ZI2C 2NTXA 4GK5E 1E1HB 3FZFB 2A9UA 3H3AA 4P09A 2XZEA 4WZXA 3MACA 1IAPA 5ADXL 2YDSA 2ZM2A 3FBZA 5DJQC 2BBJA 3N9OA 4CN1A 2Q9QD 4JLEA 2WQYA 2VKDA 4OX9T 4O2AE 4HFDA 3QB5A 4NIQA 3RIUC 1FIOA 2B1EA 3IEEA 4AQFA 3AVRA 2C0SA 1XMOT 4YTMA 2MOZA 2LKHA 1T72A 2XSAA 2CPTA 3P4SA 3TLWA 2L8KA 1WYCA 2W63A 4KBMB 2H7VC 2A72A 4LF4T 3M65A 2NTYA 3PU8A 2JIWA 4QWNB 4HFVA 1YW0A 3UUBA 3EVYA 3NRYA 3WAKA 4ZOLE 2OA5A 4HFEA 2Q9QC 3C64A 3CIRA 5AQMB 3LJCA 5HXCA 2D0UA 2WAUA 3C51A 2KXPB 2XM2A 4ZS3A 5HEGA 1FEWA 4BAYB 1FJGT 1IJ5A 4FJOA 4ILAA 5CA1E 2QVAA 4GK0E 5H6RB 1ZOYA 3QB5K 2LSYA 4O8SA 2K5BB 2BVMA 5LG3A 2C5JA 3PJAJ 2WY2A 3K3OA 4B3ST 3AVSA 5AQSB 5JDLA 4DR3T 1XWMA 1YQ4A 3UU8A 1HTJF 3O4XE 4QXCB 5L4HA 5L3BB 3GA8A 2LRLA 4DV2T 2HN1A 4PJMA 3MJXA 4A97A 5AQOB 4QX7B 5LOVE 5HWXA 1Z0PA 2LQUA 3R84B 2Z6EA 3AEAA 4EAHA 3OYZA 5LP6E 5ABGA 3RX6A 5ABEA 3L39A 5AFUL 3AT7A 4UV9B 2RA1A 4NPPA 1HX1B 4PFPA 4HE8A 3UT5E 2YDQA 3JAFA 2ACXA 5IUXA 3AE9A 5ABFA 3LG7A 4CN6A 1KK7A 4DV4T 2YEVC 1WFDA 4ZXLA 3ZC1A 4DIDB 4PK4A 5HXRA 3HR0A 4HWIB 1ZV4X 5J1GA 5JRCB 3R6NA 3AA0B 4IREA 3RYCE 2X9HA 4FI5A 2XPKA 3TLUA 2XAQB 3VKHA 3OBVE 4F6RC 2VK9A 4PJLA 2LHRA 5AQFB 3NKZA 4DR2T 4CZZB 4JI0T 4HN9A 4HTEA 2CMRA 2G0UA 4KMCA 5J0ZA 2XY8B 5AQQB 2F4VT 2Q9QB 2LE8A 3AECA 1MMNA 2BG9C 3RKGA 4IDPA 4I43B 3OYXA 5KX5E 3E08A 1R8IA 5GONE 3EI0A 2BBHA 2CE7A 5L4EA 5LB7B 4IL4A 2Y48B 3OVUA 1KEYA 5JDHA 2NP9A 4X1IE 5EK2A 4AKHA 2E8IA 5C2TA 4BJNA 3UU3A 2EHOA 4QKNA 5JTGA 4U72A 4PFOA 2DLRA 3K3NA 4E7SA 3DP7A 4KHPT 1IZNB 4DMVA 5DQWA 5J2UE 4UVBB 4QXBB 3ZSSA 5L47A 1HFAA 3E22E 2H89A 3BQLA 1I94T 3IHRA 3JCFA 3QK6A 2W66A 4HWDA 4DO0A 2YDRA 3B5MA 3ZN1B 3I9WA 5FL1A 3RI5A 2E9XA 4JI3T 4WW0A 4IL9A 2FBWA 1LKXA 3AEGA 2KVPA 3PUGA 3RRCA 5E0OA 2WZHA 1I6ZA 2MPKA 3ZMSB 2LSJA 1J1JA 2CRBA 2XTLA 1Z8UA 2WMNA 3AE4A 2X0LB 3AEFA 4BGOA 3N9QA 5ETWA 4QH4A 2WSSV 2SPCA 2VASA 3P8CD 1LRZA 4AKGA 3KV9A 2L3LA 5F5WA 3N9PA 2LM2A 3C4ZA 5LBQB 1NENA 3ETUA 2XQ8A 2ES0A 4CQIA 4YT0A 2UUCT 4WYVA 1WRDA 4LF5T 3N2KE 5LHGB 2W67A 4JI6T 4ZZBA 1M62A 3J9X1 2NR4A 2WWVA 4EEBA 4QH1A 3C50A 4PW8A 3RHWA 4CI2B 5LGTB 5LHHB 4A98A 1D1CA 2XM1A 5FZTA 1ZHCA 4OK0A 4O4IE 2WDVA 3F31A 3AA1B 4X1YE 1IJ6A 2PBIA 3I1AA 4OYJA 4C90A 1DU2A 5LA6E 3MZKB 2LSIA 3ZC0A 3CPZA 4X66T 2KMFA 1UCUA 2MYSA 4IIJE 5LHIB 4HWHA 5HEHA 2V1DB 3O1JA 2LKGA 2XQ4A 4P0BA 2V6XA 1IBLT 3CQGB 3I0QA 3N9NA 3EDVA 3N5LA 2J47A 3BQKA 3T8OA 2VL0A 3S4UA 4JI7T 3SOLA 1S94A 1BR1A 2VL8A 4YHHT 4YSZA 3AE6A 4TUYE 3UQ4A 2X0YA 3JAEA 3VJZA 3AY5A 3VHLA 3ZMTB 2E5LT 3LK3B 4DV3T 5L3FB 2JQQA 5EZYE 2PTFA 4V1Av 3A5XA 2V26A 4G63A 2WU5A 5BR8T 5T1DA 3CKDA 4H9RC 4KHZF 3AEEA 3NZPA 4JV5T 4A56A 5C8YE 2JMKA 2OLTA 2NOXA 2UXXB 1XDOA 2K24A 2L9QA 5L2LA 1HG5A 2VQFT 4IDQA 4AQFC 2N2NA 5LGUB 3ZYLA 3UFEA 2Y6XA 4IE5A 5JVDE 2CXDA 3RQWA 3UU6A 4EEDA 3EHZA 3AA6B 3NBXX 4AQGA 3FYQA 4UVCB 2M6BA 5LJNA 3UUMA 4H63V 2OV9A 3RC8A 2FJDA 4U7IA 3B13A 3MKDA 5HWYA 4ZEYA 2LSGA 3IA3A 1OEDA 2LSKA 1YXRA 1NWMX 3VR9A 1UK5A 3N2OA 2BG9E 3L3PA 2V7MA 1W0AA 2WCAA 4DR6T 1J5WA 3VRBA 2GK9A 2IC9A 1N34T 3T1YT 4HGAA 2W2UA 3QOFA 4LMLA 2BDEA 3ZMVB 2LT3A 4J2CA 2JQHA 2FJAA 4I0UA 2I0MA 1J5ET 3P4QA 3ETVA 2UU9T 2VVSA 5IWAT 5L3EB 2KWIB 3AB3B 3ONLC 2H7OA 4DUYT 5AQPB 2J1DG 2XHEB 5FMNA 3GN5A 3M1CA 2X68A 2XSBA 2E5VA 2KBBA 5M4YA 2V7KA 1MIVA 2PG8A 3ZYMA 2WP9A 4JEUB 5HEJA 1MIWA 3AAAB 2P9BA 4LFAT 4LF7T 1D1AA 5IHYA 1MNDA 4WBNE 3ZSTA 4JI4T 2IIUA 3FZLB 2WS3A 4IE4A 3RYHE 1UX5A 2JQKA 2X0CA 2VVNA 3KV6A 3LBXA 3T1HT 4HWCA 3PJAA 1YD8G 2RP4A 5AQRB 4AXPA 1SA0E 3OPCA 4Z8XA 3AE3A 1L0VA 4O4HE 4X64T 2IC6A 3PUZF 3UUNA 4IT4A 3AEDA 4TWHA 3JC6D 5DABA 4LMKA 4PAGA 2AXDS 5LCYA 2CLYC 2ZM6T 2UUAT 2H88A 2EHOD 2HH7A 1IBMT 5LG4A 2BKPA 1VCSA 4O2BE 2D2SA 4PNIA 4LFBT 4TZ4C 2VQET 4DR7T 2XQAA 1MNEA 4KP3C 4YJ3E 5FVLA 5JDGA 4X5TA 4IGUA 3G06A 1N33T 4UEMA 4C91A 2BS4A 4B3TT 4DNDA 2JRKA 2ACZA 1T98A 4MLKA 1X9BA 1QUUA 1SJ7A 2KNDA 3X1DA 5JH7E 5JR9A 2RPAA 3ZYKA 2E9XD 3JC6C 4OHFA 5JDMA 5L3CB 3JADA 5AQJB 5C3JA 4X65T 4HFCA 2D9DA 4UV8B 4EGWA 2I6HA 2EHOC 3M3ZB 3LBXB 4B3MT 5HXHA 4EZ4A 2WZIA 2XAGB 2LEHA 2ZM8A 4H9QC 1HF8A 2W0GA 4JYAT 3PU3A 3WSCA 4NXMT 4ZI3D 3AXJA 1MMDA 3OJAA 3PUSA 4UF0A 2MBGA 3AE2A 3GWHA 2CXFA 1SHZC 3ONJA 2DNXA 4Z90A 2IMLA 3CVRA 1KFYA 2YU1A 4LF8T 3FHNA 3CMLA 4H9PC 5TAOA 4H63H 1NEKA 3IF8B 4ZZCA 4EXTA 5AQKB 1UUSA 2E9XC 3NWIA 4CXXA 2XQYA 2PJQA 4PJJA 1JNRA 4JI8T 4YSXA 4HWFA 1FMWA 3ZMUB 1QSDA 5ABFB 2W4XA 5AQVB 4QH5A 3MA9A 4P1NA 3TLTA 3ZCJA 1LVFA 3ZMZB 3CWZB 2XUEA 3IBPA 1Y01A 1JNZA 2LLYA 4P0AA 2LJLA 3I0OA 2XASB 3RKOA 4ZI3C 3KBTA 5JDNA 4M1PA 5JR9B 2CLYB 1HG2A 4IE7A 5CGMA 3N2GE 5LGNB 3ZN0B 2H3RA 2DHRA 1G8XA 3AE7A 1E7PA 5FY7A 2FJEA 4NUUA 3O1HA 4YFSA 3C4WA 4ISSA 3L8RA 3N9LA 1KNZA 5LMNT 3PTRB 1M7KA 1EZ3A 2YU2A 3AXJB 4OFZA 4B3RT 5AQHB 4W8PA 4EYUA 5FY1A 5JREA 5HCJA 3VKGA 1YKHB 5FP3A 4AIUA 1BR2A 4GOUA 1KNPA 3NRXA 2EHOB 4TWDA 4CN4A 2FUPA 2MAWA 1W09A 5CJ5A 4QX8B 2MTQA 4YTNA 2LHNA 3L09A 1WR6A 1D0ZA 2CHOA 2HN2A 5JDQA 4LF9T 3FBLA 4EYYR 4JI1T 3SFDA 3RYIE 1XDPA 2V6YA 2E9XB 3CX6B 3KDSE 3PUVF 1SUMB 2WBLA 2MTCA 3RH3A 5F8PA 4UELA 2IDOB 5HXSA 3ZCIA 2N1GA 1GQEA 3KV5A 3ZJ2A 3FZHB 3DJBA 5FXVA 5LMUT 3KVAA 4DR4T 4YJ2E 3ZEFB 3UQ7A 3DTOA 4DBRA 2W00A 1T7SA 3CK6A 4IDZA 3HKBE 4DR5T 5DQVA 3RLFF 1FMVA 4ILUA 5LYJE 4DV1T 2XAFB 3NVOA 1QLBA 2C5KT 1HS7A 2JJ9A 3W15B 3AE1A 2R6GF 5FL0A 4I4TE 4U31A 4NUVA 4YSYA 1OEDC 3RF1A 5CFBA 4DBQA 4CI1B 2IUBA 2L10A 3Q5WA 5JQGE 4JI2T 4ASKA 1VOMA 5LXTE 3TLSA 1BR4A 3PURA 3SS1A 2CBIA 2WM9A 4X62T 3RGLA 4EZHA 1N36T 3RYFE 2QA7A 2Y8DA 1CHUA 1KF6A 3AA7B 2HPLA 3AE5A 3BQIA 2YOEA 2BKNA 3MK7C 4EIWA 3KINB 2C5IT 3A7MA 3PHF1 2XQ9A 4PK6A 5AQIB 1MMGA 5BMVE 3BK9A 5FXZA 1N32T 5CA0E 4JI5T 2UUBT 1CUNA 3CQXC 4GYSA 3TLVA 3P50A 1MIYA 3VU7H 1XMQT 3OKQA 3K1SA 4U74A 4U2ZA 2CCQA 3HA4A 2KLQA 4X20E 5ABHA 2NW8A 4GYRA 1XNQT 1YQ3A 4A5XA 3U3IA 1UX4A 3UULA 2LRKA 2QGSA 2V7IA 4IHJE 2BZBA 4LMJA 1V9DA 1WR0A 3ESLA 2KSRA 3DYJA 2QRXA 2L7NA 4JUYA 2B76A 4E7ZA 4N78D 4AI6A 2FJBA 4EOZB 1NAFA 4HKAA 4L5GA 4TWFA 3V5UA 3RC3A 3RIUA 1ZKEA 2WDQA 5FVKA 2VKJA 5JRCA 2X67A 4IDOA 3U78A 2KWHA 2X0HA 4DV6T 2VKOA 4UIGA 2IHR1 4ISTA 1HNZT 4HEAA 3H3MA 4DR1T 3VRAA 4AQYT 2KZ7B 3MXZA 2X9XA 2AE9A 4COFA 2LOSA 5FY0A 2ZM0A 1OEDB 3E0ZA 3K3QC 4AKIA 2CXLA 5EK3A 4KI0F 5KXJA 4KX6A 2NWBA 4AKRB 2D5UA 4PK5A 3I9YA 4DMWA 4GIWA 2CEAA 3EABA 3ZT6A 1OWAA 1U5PA 5CB4E 2Q9QA 3UU4A 1W0BA 3ABVA 3Q9DA 3SWHA 1ZP0A 2V7JA 5JR9C 3Q2MA 3PUAA 2ODVA 1WLXA 3F2EA 2YINA 1H7CA 4U33A 2V5DA 3FZKB 4GKKT 2HPJA 3P4RA 3FXEB 4DVDA 1U4QA 4QHOA 2M67A 1HCIA 2UXNB 2XAHB 4MBQA 3UFGA 3CX7B 4MFRA 4TV9E 4ADZA 1O3XA 1D1BA 3AEBA 4WBOA 2JPFA 4ANJA 5F3JA 2M6IA 2V5CA 4UXNB 3GN5B 3VR8A 3CQCB 3PUWF 3AE8A 4L0RA 4MHCA 2CHNA 2XQ7A 3Q5DA 2W61A 2XJ7A 1AJ3A 4F8HA 3C98B 3HKDE 1OXZA 2N9DA 5KMGP 3PUQA 2D0TA 2QYWA 2XQ5A 1WCRA 3PUXF 4H9NC 5AQNB 2DWKA 1US7B 3ZT5A 1T8BA 3N9MA 3ZPOA 2VKHA 2JQ9A 3H37A 2WDRA 1UGOA 4XBFB 1HR0T 3HL6A 5HXEA 4G2AA 4IE6A 5LJMA 3PDYA 2VWAA 2YKSA 3EUHA 3ANWA 2DWGA 4DV7T 4DV0T 5J2TE 4HFBA 5HEUA 4BA9A 3FB2A 2I59A 3LK42 2A2FX 2YK0A 1VCTA 2UXDT 5AQUB 3Q5XA 4KUMB 4ILCA 5JDFA 3GMIA 2IW5B 3QUJA 4EV6A 2HHHT 3AAEB 1OEDE 4L9IA 3UTKA 1SE7A 4U3CA 3O1IA 3UUXB 2BS2A 2CBJA 4QXHB 2NW9A 2V7LA 2DL1A 1VRBA 2WU2A 4YXDA 4ZHQE 3RQUA 5A1LA 1ZEEA 3EDUA 2IAKA 2KT9A 5L3GB 4U7YA 3KFWX 4IE0A 5FNVE 2BG9A 4UR9A 3F57A 3SFEA 3V5SA 4IDNA 2VURA 4Z91A 3KV4A 4BJMA 5IYZE 2K9AA 4U2YA 4AISA 1G73A 2J62A 3LFMA 3OTOT 2XQ3A 5FXWA 2CA5A 4TX5A 5L3DB 3EAMA 4AKLA 4LFCT 4K0UA 2ZLYA 4UF0B 2K3WA 4TNWA 4H9SE 3K8PC 4GKJT 3LDQB 3ANWB 3RIAA 3ZKRA 3D0TA 2X66A 2XAJB 2CM0A 2UXBT 2W62A 3PF0A
chains in the Genus database with same CATH topology
3Q5WA 1LVKA 5JQGE 4ASKA 1VOMA 1D1AA 3C4XA 1BR4A 2DCFA 3PURA 4HN9A 1MNDA 3ONXA 3KBUA 4HTEA 2CMRA 3SS1A 4WBNE 2G0UA 5LNKA 4KMCA 2A3DA 2WM9A 3AAIA 2Q9QB 2LE8A 5FXXA 1MMNA 4IE4A 3RYHE 3LK2B 4X1KE 1UX5A 4EZHA 4I43B 2QA7A 3RYFE 2Y8DA 3KV6A 3LBXA 4ECGA 3OYXA 5KX5E 3AA7B 3E08A 3FXDB 2HPLA 3BQIA 3PE0A 5GONE 3MK7C 2NW7A 1YD8G 2RP4A 2ZMAA 2BVLA 4AXPA 1SA0E 4EIWA 3KINB 4Z8XA 2CE7A 2C5IT 4O4HE 4PJNA 1MMAA 3PHF1 4O4JE 2Y48B 4PK6A 3QC9A 3WURA 1MMGA 2IC6A 3SRZA 3BK9A 5FXZA 5BMVE 5JDHA 5CA0E 4TN7B 5KDMC 2NP9A 4X1IE 4CI3B 3UUNA 5EK2A 3J7Yq 2LM9A 4I55E 5LBMA 4AKHA 3JC6D 3ZLIA 4ZS2A 3HKEE 5DABA 5FYMA 2E8IA 1CUNA 3CQXC 4GYSA 4BJNA 4ONRA 2EHOA 1MIYA 3VU7H 4QKNA 1BR0A 2CWOA 4U72A 4XZCA 4CXYA 4PFOA 4PAGA 3RRWA 3TKLB 2DLRA 3OKQA 3K3NA 4E7SA 3DP7A 4TV8E 4U74A 5LCYA 2CLYC 4UVAB 1IZNB 2CCQA 3CX8B 3B57A 2EHOD 2HH7A 4MALA 3HA4A 5LG4A 2KLQA 4DMVA 5DQWA 4X20E 5J2UE 2NW8A 4GYRA 4UVBB 4O2BE 2WWUA 4QXBB 2D2SA 4PNIA 4TZ4C 1HX8A 1HFAA 3E22E 3U3IA 2JMHA 1UX4A 1MNEA 4KP3C 4YJ3E 3UULA 3BQLA 5JDGA 3IHRA 1Y64B 3HI2A 3QK6A 4H9OC 4IGUA 4UEMA 4C91A 1WYBA 4ZI7E 2QGSA 4DO0A 2V7IA 4DNDA 2JRKA 3ZN1B 3I9WA 3P7IA 1T98A 2E9XA 4IHJE 4MLKA 2BZBA 1QUUA 1V9DA 5HAXA 3ESLA 4O4LE 4WW0A 2LOPA 4WNKA 2KNDA 4YLHA 5JH7E 1LKXA 4EB6E 5JR9A 2ODUA 5EK4A 4I50E 3PUGA 4B6XA 4ZI2D 3RRCA 4OYKA 3ZYKA 2E9XD 3O9XA 3JC6C 4OHFA 5JDMA 5L3CB 4JUYA 3WI3A 4E7ZA 5E0OA 4N78D 4AI6A 1D0YA 3ZMSB 1NAFA 4EOZB 4HKAA 2LSJA 2XTLA 4L5GA 2DI4A 4XAXB 3V5UA 2WMNA 2X0LB 4BGOA 3RC3A 2KINB 3N9QA 5ETWA 5H6QB 1ZKEA 2K48A 4JEHB 4UV8B 2WSSV 2EHOC 3LBXB 2VKJA 2X9WA 2PFVA 1S35A 5HXHA 2SPCA 5JRCA 2VASA 2X67A 4EZ4A 3P8CD 1LRZA 2XAGB 3U78A 4AKGA 2KWHA 3KV9A 2LEHA 2ZM8A 4H9QC 1HF8A 2VKOA 2W0GA 4UIGA 1X79A 2L3LA 3PU3A 4ISTA 3N9PA 3WSCA 3C4ZA 4HEAA 4ZI3D 5LBQB 3ETUA 1MMDA 3OJAA 2KZ7B 2ES0A 3HKCE 3MXZA 2X9XA 4CQIA 1B7TA 3PUSA 4UF0A 2LOSA 2MBGA 2X51A 5FY0A 3GWHA 2CXFA 2ZM0A 1SHZC 3E0ZA 2DNXA 3K3QC 1WRDA 3WAJA 3N2KE 5LHGB 3CVRA 2YU1A 4AKIA 3J9X1 3FHNA 2CXLA 3CMLA 4H9PC 5TAOA 5EK3A 4ERRA 1D0XA 4H63H 3ZJ1A 2X9YA 3RPUA 2NWBA 3KVBA 4YHJA 3IF8B 4AKRB 2D5UA 1YKEB 4CXWA 4PK5A 3C50A 4EXTA 2WMOA 3I9YA 2CWYA 4PW8A 5HYAA 4DMWA 2VB6A 4CI2B 3NZQA 4ZI2C 5LGTB 2E9XC 2NTXA 4GIWA 5LHHB 2CEAA 4CXXA 4GK5E 1E1HB 2XQYA 1D1CA 1OWAA 1U5PA 5CB4E 2Q9QA 3H3AA 4P09A 3SWHA 1ZHCA 3Q9DA 2PJQA 2V7JA 4PJJA 5JR9C 4OK0A 4O4IE 1FMWA 3MACA 3PUAA 2ODVA 1QSDA 3Q2MA 3ZMUB 1IAPA 1WLXA 3F31A 3F2EA 2YINA 5ADXL 2ZM2A 3AA1B 3MA9A 4X1YE 1H7CA 3FBZA 5DJQC 3N9OA 1IJ6A 2PBIA 3I1AA 4OYJA 4C90A 5LA6E 3MZKB 2LSIA 2HPJA 2Q9QD 4JLEA 3ZC0A 3ZCJA 3CPZA 1LVFA 2KMFA 3ZMZB 2VKDA 3FXEB 3CWZB 1UCUA 2MYSA 4DVDA 4IIJE 4O2AE 1U4QA 5LHIB 2XUEA 3IBPA 4QHOA 2M67A 1HCIA 2UXNB 2XAHB 4MBQA 4P0AA 2LJLA 3CX7B 3I0OA 4MFRA 1FIOA 4TV9E 2B1EA 2XASB 4ADZA 2V1DB 4ZI3C 3RKOA 3KBTA 1O3XA 3IEEA 1D1BA 4AQFA 3AVRA 4WBOA 3O1JA 5JDNA 4P0BA 2C0SA 4M1PA 2JPFA 4ANJA 5JR9B 5F3JA 2MOZA 3CQGB 4UXNB 2CLYB 3GN5B 3I0QA 3N9NA 3CQCB 3EDVA 3N5LA 3BQKA 4L0RA 4MHCA 1HG2A 2L8KA 3T8OA 1WYCA 4IE7A 3N2GE 5LGNB 3S4UA 2W63A 3ZN0B 3SOLA 2W61A 1S94A 2H3RA 2DHRA 1AJ3A 1BR1A 1G8XA 2VL8A 3C98B 4KBMB 2H7VC 2A72A 5FY7A 4NUUA 3O1HA 4TUYE 3VJZA 4YFSA 3M65A 3HKDE 3C4WA 1OXZA 2NTYA 3PU8A 3VHLA 2N9DA 4ISSA 4QWNB 3ZMTB 3PUQA 2D0TA 3LK3B 5KMGP 4HFVA 1YW0A 5L3FB 3N9LA 2JQQA 5EZYE 1KNZA 4V1Av 3A5XA 3EVYA 3NRYA 3PTRB 2V26A 4H9NC 4G63A 2DWKA 3WAKA 1EZ3A 1US7B 2YU2A 4ZOLE 2OA5A 3N9MA 4OFZA 3ZPOA 2VKHA 5LXTE 3H37A 2Q9QC 3C64A 5T1DA 4XBFB 4EYUA 3CKDA 4H9RC 5FY1A 5JREA 3HL6A 3NZPA 3LJCA 3VKGA 5HXCA 5HXEA 1YKHB 4G2AA 5FP3A 2D0UA 2WAUA 4IE6A 5LJMA 3PDYA 4A56A 1BR2A 5C8YE 3C51A 2JMKA 2KXPB 2NOXA 2UXXB 4ZS3A 1FEWA 4GOUA 2VWAA 2K24A 2L9QA 3EUHA 5L2LA 4BAYB 1HG5A 3ANWA 1IJ5A 3NRXA 2DWGA 5J2TE 2EHOB 4FJOA 4AQFC 2N2NA 4BA9A 3FB2A 5CA1E 5LGUB 2I59A 3LK42 4GK0E 5H6RB 3UFEA 3ZYLA 2A2FX 2LSYA 2Y6XA 4IE5A 5JVDE 4O8SA 2K5BB 2YK0A 2BVMA 2C5JA 5IHYA 2CXDA 3K3OA 3Q5XA 4KUMB 3AA6B 3NBXX 5JDFA 4AQGA 4QX8B 3GMIA 4UVCB 2IW5B 3AVSA 2MTQA 3QUJA 3AAEB 4L9IA 3UTKA 3UUMA 5LJNA 4H63V 3O1IA 5JDLA 3RC8A 3UUXB 3B13A 3MKDA 5HWYA 2LHNA 1HTJF 3O4XE 4QXCB 3L09A 5L3BB 4QXHB 1WR6A 2NW9A 3GA8A 1D0ZA 2LSGA 2V7LA 2LSKA 5JDQA 3FBLA 4PJMA 1NWMX 3MJXA 1VRBA 4EYYR 4QX7B 5LOVE 5HWXA 1Z0PA 3N2OA 4ZHQE 3L3PA 3RYIE 2LQUA 2V7MA 5A1LA 1ZEEA 2E9XB 3EDUA 3CX6B 2IAKA 3R84B 2KT9A 2Z6EA 3KDSE 4EAHA 5L3GB 3OYZA 5LP6E 2GK9A 2IC9A 3RX6A 2WBLA 3KFWX 2MTCA 3RH3A 4IE0A 5FNVE 4HGAA 5AFUL 3AT7A 4UV9B 2RA1A 5F8PA 3F57A 4UELA 5HXSA 4PFPA 3ZCIA 2N1GA 4HE8A 3KV5A 3ZJ2A 3UT5E 3V5SA 2ACXA 3DJBA 5FXVA 2BDEA 3LG7A 3ZMVB 3KV4A 1KK7A 2LT3A 4BJMA 4J2CA 3KVAA 2YEVC 5IYZE 2K9AA 4YJ2E 3ZEFB 3ZC1A 1G73A 4PK4A 3DTOA 5HXRA 3ETVA 3HR0A 3LFMA 4DBRA 2W00A 1ZV4X 5J1GA 4IDZA 5JRCB 3R6NA 3HKBE 5DQVA 3AA0B 1FMVA 5FXWA 4ILUA 2CA5A 4TX5A 5LYJE 5L3EB 2KWIB 2XAFB 3AB3B 2H7OA 3RYCE 2J1DG 2X9HA 5L3DB 4FI5A 2C5KT 1HS7A 4AKLA 2JJ9A 2XHEB 3W15B 2XAQB 4CZZB 5FMNA 3GN5A 3M1CA 4K0UA 2ZLYA 4UF0B 2X68A 4H9SE 3K8PC 5M4YA 3VKHA 2V7KA 3OBVE 3ANWB 4I4TE 3D0TA 1MIVA 2PG8A 3ZYMA 4F6RC 4JEUB 1MIWA 4NUVA 2VK9A 4PJLA 3AAAB 2X66A 2P9BA 2XAJB 2LHRA 2CM0A 4DBQA 4CI1B 2W62A 3PF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDG A;  5HYA A;  3V5U A;  5HXC A;  5JDH A;  5HXE A;  5JDL A;  3V5S A;  5JDN A;  5HXR A;  5JDM A;  5JDQ A;  5HXS A;  5HWY A;  5HXH A;  5HWX A;  5JDF A; 
#chains in the Genus database with same CATH topology
 1LVK A;  3C4X A;  2DCF A;  4HFH A;  3ONX A;  3KBU A;  1SJ8 A;  5LNK A;  4JBW F;  3ZT7 A;  2A3D A;  3AAI A;  4ILB A;  5FXX A;  3PV0 F;  3LK2 B;  4X1K E;  5AQT B;  3LSV A;  4DV5 T;  2V8S V;  4ECG A;  3A8Y C;  1UUR A;  3FXD B;  2KGX A;  3PE0 A;  1E2A A;  2NW7 A;  2ZMA A;  2BVL A;  5AQL B;  4PJN A;  1MMA A;  4DUZ T;  4O4J E;  2UXC T;  3QC9 A;  3WUR A;  3SRZ A;  4TN7 B;  5KDM C;  1KNR A;  4CI3 B;  3J7Y q;  2LM9 A;  4I55 E;  5LBM A;  2BG9 B;  3ZLI A;  4ZS2 A;  3HKE E;  5FYM A;  4ONR A;  1BR0 A;  2CWO A;  4XZC A;  4CXY A;  3RRW A;  1HNX T;  3TKL B;  4K0K T;  3RIF A;  5FKY A;  4TV8 E;  4UVA B;  3CX8 B;  3B57 A;  4MAL A;  2WWU A;  1HX8 A;  2JMH A;  2XQ6 A;  1XZY A;  1Y64 B;  3HI2 A;  4H9O C;  3QNU A;  1WYB A;  4ZI7 E;  3PUY F;  3P7I A;  2E2A A;  3Q5E A;  5HAX A;  4O4L E;  2LOP A;  4WNK A;  4YLH A;  5AQG B;  4EB6 E;  2YN6 A;  1XNR T;  2ODU A;  5EK4 A;  4I50 E;  4HFI A;  4B6X A;  4ZI2 D;  4OYK A;  3O9X A;  3WI3 A;  1D0Y A;  3P4W A;  4NXN T;  4F7G B;  2DI4 A;  4LF6 T;  4XAX B;  2KIN B;  5H6Q B;  3FZM B;  2K48 A;  4JEH B;  2BS3 A;  2X9W A;  2PFV A;  1S35 A;  1W9R A;  5HCM A;  1X79 A;  4Q25 A;  1HNW T;  3HKC E;  1B7T A;  2WB5 A;  2X51 A;  4TNV A;  4YY3 T;  2BKO A;  3WAJ A;  1IBK T;  4YTP A;  3UU5 A;  2V6Y B;  4ERR A;  1D0X A;  3ZJ1 A;  2X9Y A;  3RPU A;  4YHJ A;  3KVB A;  1YKE B;  4CXW A;  2WMO A;  5HEO A;  2CWY A;  5HYA A;  2J4G A;  3P4P A;  2VB6 A;  3NZQ A;  4ZI2 C;  2NTX A;  4GK5 E;  1E1H B;  3FZF B;  2A9U A;  3H3A A;  4P09 A;  2XZE A;  4WZX A;  3MAC A;  1IAP A;  5ADX L;  2YDS A;  2ZM2 A;  3FBZ A;  5DJQ C;  2BBJ A;  3N9O A;  4CN1 A;  2Q9Q D;  4JLE A;  2WQY A;  2VKD A;  4OX9 T;  4O2A E;  4HFD A;  3QB5 A;  4NIQ A;  3RIU C;  1FIO A;  2B1E A;  3IEE A;  4AQF A;  3AVR A;  2C0S A;  1XMO T;  4YTM A;  2MOZ A;  2LKH A;  1T72 A;  2XSA A;  2CPT A;  3P4S A;  3TLW A;  2L8K A;  1WYC A;  2W63 A;  4KBM B;  2H7V C;  2A72 A;  4LF4 T;  3M65 A;  2NTY A;  3PU8 A;  2JIW A;  4QWN B;  4HFV A;  1YW0 A;  3UUB A;  3EVY A;  3NRY A;  3WAK A;  4ZOL E;  2OA5 A;  4HFE A;  2Q9Q C;  3C64 A;  3CIR A;  5AQM B;  3LJC A;  5HXC A;  2D0U A;  2WAU A;  3C51 A;  2KXP B;  2XM2 A;  4ZS3 A;  5HEG A;  1FEW A;  4BAY B;  1FJG T;  1IJ5 A;  4FJO A;  4ILA A;  5CA1 E;  2QVA A;  4GK0 E;  5H6R B;  1ZOY A;  3QB5 K;  2LSY A;  4O8S A;  2K5B B;  2BVM A;  5LG3 A;  2C5J A;  3PJA J;  2WY2 A;  3K3O A;  4B3S T;  3AVS A;  5AQS B;  5JDL A;  4DR3 T;  1XWM A;  1YQ4 A;  3UU8 A;  1HTJ F;  3O4X E;  4QXC B;  5L4H A;  5L3B B;  3GA8 A;  2LRL A;  4DV2 T;  2HN1 A;  4PJM A;  3MJX A;  4A97 A;  5AQO B;  4QX7 B;  5LOV E;  5HWX A;  1Z0P A;  2LQU A;  3R84 B;  2Z6E A;  3AEA A;  4EAH A;  3OYZ A;  5LP6 E;  5ABG A;  3RX6 A;  5ABE A;  3L39 A;  5AFU L;  3AT7 A;  4UV9 B;  2RA1 A;  4NPP A;  1HX1 B;  4PFP A;  4HE8 A;  3UT5 E;  2YDQ A;  3JAF A;  2ACX A;  5IUX A;  3AE9 A;  5ABF A;  3LG7 A;  4CN6 A;  1KK7 A;  4DV4 T;  2YEV C;  1WFD A;  4ZXL A;  3ZC1 A;  4DID B;  4PK4 A;  5HXR A;  3HR0 A;  4HWI B;  1ZV4 X;  5J1G A;  5JRC B;  3R6N A;  3AA0 B;  4IRE A;  3RYC E;  2X9H A;  4FI5 A;  2XPK A;  3TLU A;  2XAQ B;  3VKH A;  3OBV E;  4F6R C;  2VK9 A;  4PJL A;  2LHR A;  5AQF B;  3NKZ A;  4DR2 T;  4CZZ B;  4JI0 T;  4HN9 A;  4HTE A;  2CMR A;  2G0U A;  4KMC A;  5J0Z A;  2XY8 B;  5AQQ B;  2F4V T;  2Q9Q B;  2LE8 A;  3AEC A;  1MMN A;  2BG9 C;  3RKG A;  4IDP A;  4I43 B;  3OYX A;  5KX5 E;  3E08 A;  1R8I A;  5GON E;  3EI0 A;  2BBH A;  2CE7 A;  5L4E A;  5LB7 B;  4IL4 A;  2Y48 B;  3OVU A;  1KEY A;  5JDH A;  2NP9 A;  4X1I E;  5EK2 A;  4AKH A;  2E8I A;  5C2T A;  4BJN A;  3UU3 A;  2EHO A;  4QKN A;  5JTG A;  4U72 A;  4PFO A;  2DLR A;  3K3N A;  4E7S A;  3DP7 A;  4KHP T;  1IZN B;  4DMV A;  5DQW A;  5J2U E;  4UVB B;  4QXB B;  3ZSS A;  5L47 A;  1HFA A;  3E22 E;  2H89 A;  3BQL A;  1I94 T;  3IHR A;  3JCF A;  3QK6 A;  2W66 A;  4HWD A;  4DO0 A;  2YDR A;  3B5M A;  3ZN1 B;  3I9W A;  5FL1 A;  3RI5 A;  2E9X A;  4JI3 T;  4WW0 A;  4IL9 A;  2FBW A;  1LKX A;  3AEG A;  2KVP A;  3PUG A;  3RRC A;  5E0O A;  2WZH A;  1I6Z A;  2MPK A;  3ZMS B;  2LSJ A;  1J1J A;  2CRB A;  2XTL A;  1Z8U A;  2WMN A;  3AE4 A;  2X0L B;  3AEF A;  4BGO A;  3N9Q A;  5ETW A;  4QH4 A;  2WSS V;  2SPC A;  2VAS A;  3P8C D;  1LRZ A;  4AKG A;  3KV9 A;  2L3L A;  5F5W A;  3N9P A;  2LM2 A;  3C4Z A;  5LBQ B;  1NEN A;  3ETU A;  2XQ8 A;  2ES0 A;  4CQI A;  4YT0 A;  2UUC T;  4WYV A;  1WRD A;  4LF5 T;  3N2K E;  5LHG B;  2W67 A;  4JI6 T;  4ZZB A;  1M62 A;  3J9X 1;  2NR4 A;  2WWV A;  4EEB A;  4QH1 A;  3C50 A;  4PW8 A;  3RHW A;  4CI2 B;  5LGT B;  5LHH B;  4A98 A;  1D1C A;  2XM1 A;  5FZT A;  1ZHC A;  4OK0 A;  4O4I E;  2WDV A;  3F31 A;  3AA1 B;  4X1Y E;  1IJ6 A;  2PBI A;  3I1A A;  4OYJ A;  4C90 A;  1DU2 A;  5LA6 E;  3MZK B;  2LSI A;  3ZC0 A;  3CPZ A;  4X66 T;  2KMF A;  1UCU A;  2MYS A;  4IIJ E;  5LHI B;  4HWH A;  5HEH A;  2V1D B;  3O1J A;  2LKG A;  2XQ4 A;  4P0B A;  2V6X A;  1IBL T;  3CQG B;  3I0Q A;  3N9N A;  3EDV A;  3N5L A;  2J47 A;  3BQK A;  3T8O A;  2VL0 A;  3S4U A;  4JI7 T;  3SOL A;  1S94 A;  1BR1 A;  2VL8 A;  4YHH T;  4YSZ A;  3AE6 A;  4TUY E;  3UQ4 A;  2X0Y A;  3JAE A;  3VJZ A;  3AY5 A;  3VHL A;  3ZMT B;  2E5L T;  3LK3 B;  4DV3 T;  5L3F B;  2JQQ A;  5EZY E;  2PTF A;  4V1A v;  3A5X A;  2V26 A;  4G63 A;  2WU5 A;  5BR8 T;  5T1D A;  3CKD A;  4H9R C;  4KHZ F;  3AEE A;  3NZP A;  4JV5 T;  4A56 A;  5C8Y E;  2JMK A;  2OLT A;  2NOX A;  2UXX B;  1XDO A;  2K24 A;  2L9Q A;  5L2L A;  1HG5 A;  2VQF T;  4IDQ A;  4AQF C;  2N2N A;  5LGU B;  3ZYL A;  3UFE A;  2Y6X A;  4IE5 A;  5JVD E;  2CXD A;  3RQW A;  3UU6 A;  4EED A;  3EHZ A;  3AA6 B;  3NBX X;  4AQG A;  3FYQ A;  4UVC B;  2M6B A;  5LJN A;  3UUM A;  4H63 V;  2OV9 A;  3RC8 A;  2FJD A;  4U7I A;  3B13 A;  3MKD A;  5HWY A;  4ZEY A;  2LSG A;  3IA3 A;  1OED A;  2LSK A;  1YXR A;  1NWM X;  3VR9 A;  1UK5 A;  3N2O A;  2BG9 E;  3L3P A;  2V7M A;  1W0A A;  2WCA A;  4DR6 T;  1J5W A;  3VRB A;  2GK9 A;  2IC9 A;  1N34 T;  3T1Y T;  4HGA A;  2W2U A;  3QOF A;  4LML A;  2BDE A;  3ZMV B;  2LT3 A;  4J2C A;  2JQH A;  2FJA A;  4I0U A;  2I0M A;  1J5E T;  3P4Q A;  3ETV A;  2UU9 T;  2VVS A;  5IWA T;  5L3E B;  2KWI B;  3AB3 B;  3ONL C;  2H7O A;  4DUY T;  5AQP B;  2J1D G;  2XHE B;  5FMN A;  3GN5 A;  3M1C A;  2X68 A;  2XSB A;  2E5V A;  2KBB A;  5M4Y A;  2V7K A;  1MIV A;  2PG8 A;  3ZYM A;  2WP9 A;  4JEU B;  5HEJ A;  1MIW A;  3AAA B;  2P9B A;  4LFA T;  4LF7 T;  1D1A A;  5IHY A;  1MND A;  4WBN E;  3ZST A;  4JI4 T;  2IIU A;  3FZL B;  2WS3 A;  4IE4 A;  3RYH E;  1UX5 A;  2JQK A;  2X0C A;  2VVN A;  3KV6 A;  3LBX A;  3T1H T;  4HWC A;  3PJA A;  1YD8 G;  2RP4 A;  5AQR B;  4AXP A;  1SA0 E;  3OPC A;  4Z8X A;  3AE3 A;  1L0V A;  4O4H E;  4X64 T;  2IC6 A;  3PUZ F;  3UUN A;  4IT4 A;  3AED A;  4TWH A;  3JC6 D;  5DAB A;  4LMK A;  4PAG A;  2AXD S;  5LCY A;  2CLY C;  2ZM6 T;  2UUA T;  2H88 A;  2EHO D;  2HH7 A;  1IBM T;  5LG4 A;  2BKP A;  1VCS A;  4O2B E;  2D2S A;  4PNI A;  4LFB T;  4TZ4 C;  2VQE T;  4DR7 T;  2XQA A;  1MNE A;  4KP3 C;  4YJ3 E;  5FVL A;  5JDG A;  4X5T A;  4IGU A;  3G06 A;  1N33 T;  4UEM A;  4C91 A;  2BS4 A;  4B3T T;  4DND A;  2JRK A;  2ACZ A;  1T98 A;  4MLK A;  1X9B A;  1QUU A;  1SJ7 A;  2KND A;  3X1D A;  5JH7 E;  5JR9 A;  2RPA A;  3ZYK A;  2E9X D;  3JC6 C;  4OHF A;  5JDM A;  5L3C B;  3JAD A;  5AQJ B;  5C3J A;  4X65 T;  4HFC A;  2D9D A;  4UV8 B;  4EGW A;  2I6H A;  2EHO C;  3M3Z B;  3LBX B;  4B3M T;  5HXH A;  4EZ4 A;  2WZI A;  2XAG B;  2LEH A;  2ZM8 A;  4H9Q C;  1HF8 A;  2W0G A;  4JYA T;  3PU3 A;  3WSC A;  4NXM T;  4ZI3 D;  3AXJ A;  1MMD A;  3OJA A;  3PUS A;  4UF0 A;  2MBG A;  3AE2 A;  3GWH A;  2CXF A;  1SHZ C;  3ONJ A;  2DNX A;  4Z90 A;  2IML A;  3CVR A;  1KFY A;  2YU1 A;  4LF8 T;  3FHN A;  3CML A;  4H9P C;  5TAO A;  4H63 H;  1NEK A;  3IF8 B;  4ZZC A;  4EXT A;  5AQK B;  1UUS A;  2E9X C;  3NWI A;  4CXX A;  2XQY A;  2PJQ A;  4PJJ A;  1JNR A;  4JI8 T;  4YSX A;  4HWF A;  1FMW A;  3ZMU B;  1QSD A;  5ABF B;  2W4X A;  5AQV B;  4QH5 A;  3MA9 A;  4P1N A;  3TLT A;  3ZCJ A;  1LVF A;  3ZMZ B;  3CWZ B;  2XUE A;  3IBP A;  1Y01 A;  1JNZ A;  2LLY A;  4P0A A;  2LJL A;  3I0O A;  2XAS B;  3RKO A;  4ZI3 C;  3KBT A;  5JDN A;  4M1P A;  5JR9 B;  2CLY B;  1HG2 A;  4IE7 A;  5CGM A;  3N2G E;  5LGN B;  3ZN0 B;  2H3R A;  2DHR A;  1G8X A;  3AE7 A;  1E7P A;  5FY7 A;  2FJE A;  4NUU A;  3O1H A;  4YFS A;  3C4W A;  4ISS A;  3L8R A;  3N9L A;  1KNZ A;  5LMN T;  3PTR B;  1M7K A;  1EZ3 A;  2YU2 A;  3AXJ B;  4OFZ A;  4B3R T;  5AQH B;  4W8P A;  4EYU A;  5FY1 A;  5JRE A;  5HCJ A;  3VKG A;  1YKH B;  5FP3 A;  4AIU A;  1BR2 A;  4GOU A;  1KNP A;  3NRX A;  2EHO B;  4TWD A;  4CN4 A;  2FUP A;  2MAW A;  1W09 A;  5CJ5 A;  4QX8 B;  2MTQ A;  4YTN A;  2LHN A;  3L09 A;  1WR6 A;  1D0Z A;  2CHO A;  2HN2 A;  5JDQ A;  4LF9 T;  3FBL A;  4EYY R;  4JI1 T;  3SFD A;  3RYI E;  1XDP A;  2V6Y A;  2E9X B;  3CX6 B;  3KDS E;  3PUV F;  1SUM B;  2WBL A;  2MTC A;  3RH3 A;  5F8P A;  4UEL A;  2IDO B;  5HXS A;  3ZCI A;  2N1G A;  1GQE A;  3KV5 A;  3ZJ2 A;  3FZH B;  3DJB A;  5FXV A;  5LMU T;  3KVA A;  4DR4 T;  4YJ2 E;  3ZEF B;  3UQ7 A;  3DTO A;  4DBR A;  2W00 A;  1T7S A;  3CK6 A;  4IDZ A;  3HKB E;  4DR5 T;  5DQV A;  3RLF F;  1FMV A;  4ILU A;  5LYJ E;  4DV1 T;  2XAF B;  3NVO A;  1QLB A;  2C5K T;  1HS7 A;  2JJ9 A;  3W15 B;  3AE1 A;  2R6G F;  5FL0 A;  4I4T E;  4U31 A;  4NUV A;  4YSY A;  1OED C;  3RF1 A;  5CFB A;  4DBQ A;  4CI1 B;  2IUB A;  2L10 A;  3Q5W A;  5JQG E;  4JI2 T;  4ASK A;  1VOM A;  5LXT E;  3TLS A;  1BR4 A;  3PUR A;  3SS1 A;  2CBI A;  2WM9 A;  4X62 T;  3RGL A;  4EZH A;  1N36 T;  3RYF E;  2QA7 A;  2Y8D A;  1CHU A;  1KF6 A;  3AA7 B;  2HPL A;  3AE5 A;  3BQI A;  2YOE A;  2BKN A;  3MK7 C;  4EIW A;  3KIN B;  2C5I T;  3A7M A;  3PHF 1;  2XQ9 A;  4PK6 A;  5AQI B;  1MMG A;  5BMV E;  3BK9 A;  5FXZ A;  1N32 T;  5CA0 E;  4JI5 T;  2UUB T;  1CUN A;  3CQX C;  4GYS A;  3TLV A;  3P50 A;  1MIY A;  3VU7 H;  1XMQ T;  3OKQ A;  3K1S A;  4U74 A;  4U2Z A;  2CCQ A;  3HA4 A;  2KLQ A;  4X20 E;  5ABH A;  2NW8 A;  4GYR A;  1XNQ T;  1YQ3 A;  4A5X A;  3U3I A;  1UX4 A;  3UUL A;  2LRK A;  2QGS A;  2V7I A;  4IHJ E;  2BZB A;  4LMJ A;  1V9D A;  1WR0 A;  3ESL A;  2KSR A;  3DYJ A;  2QRX A;  2L7N A;  4JUY A;  2B76 A;  4E7Z A;  4N78 D;  4AI6 A;  2FJB A;  4EOZ B;  1NAF A;  4HKA A;  4L5G A;  4TWF A;  3V5U A;  3RC3 A;  3RIU A;  1ZKE A;  2WDQ A;  5FVK A;  2VKJ A;  5JRC A;  2X67 A;  4IDO A;  3U78 A;  2KWH A;  2X0H A;  4DV6 T;  2VKO A;  4UIG A;  2IHR 1;  4IST A;  1HNZ T;  4HEA A;  3H3M A;  4DR1 T;  3VRA A;  4AQY T;  2KZ7 B;  3MXZ A;  2X9X A;  2AE9 A;  4COF A;  2LOS A;  5FY0 A;  2ZM0 A;  1OED B;  3E0Z A;  3K3Q C;  4AKI A;  2CXL A;  5EK3 A;  4KI0 F;  5KXJ A;  4KX6 A;  2NWB A;  4AKR B;  2D5U A;  4PK5 A;  3I9Y A;  4DMW A;  4GIW A;  2CEA A;  3EAB A;  3ZT6 A;  1OWA A;  1U5P A;  5CB4 E;  2Q9Q A;  3UU4 A;  1W0B A;  3ABV A;  3Q9D A;  3SWH A;  1ZP0 A;  2V7J A;  5JR9 C;  3Q2M A;  3PUA A;  2ODV A;  1WLX A;  3F2E A;  2YIN A;  1H7C A;  4U33 A;  2V5D A;  3FZK B;  4GKK T;  2HPJ A;  3P4R A;  3FXE B;  4DVD A;  1U4Q A;  4QHO A;  2M67 A;  1HCI A;  2UXN B;  2XAH B;  4MBQ A;  3UFG A;  3CX7 B;  4MFR A;  4TV9 E;  4ADZ A;  1O3X A;  1D1B A;  3AEB A;  4WBO A;  2JPF A;  4ANJ A;  5F3J A;  2M6I A;  2V5C A;  4UXN B;  3GN5 B;  3VR8 A;  3CQC B;  3PUW F;  3AE8 A;  4L0R A;  4MHC A;  2CHN A;  2XQ7 A;  3Q5D A;  2W61 A;  2XJ7 A;  1AJ3 A;  4F8H A;  3C98 B;  3HKD E;  1OXZ A;  2N9D A;  5KMG P;  3PUQ A;  2D0T A;  2QYW A;  2XQ5 A;  1WCR A;  3PUX F;  4H9N C;  5AQN B;  2DWK A;  1US7 B;  3ZT5 A;  1T8B A;  3N9M A;  3ZPO A;  2VKH A;  2JQ9 A;  3H37 A;  2WDR A;  1UGO A;  4XBF B;  1HR0 T;  3HL6 A;  5HXE A;  4G2A A;  4IE6 A;  5LJM A;  3PDY A;  2VWA A;  2YKS A;  3EUH A;  3ANW A;  2DWG A;  4DV7 T;  4DV0 T;  5J2T E;  4HFB A;  5HEU A;  4BA9 A;  3FB2 A;  2I59 A;  3LK4 2;  2A2F X;  2YK0 A;  1VCT A;  2UXD T;  5AQU B;  3Q5X A;  4KUM B;  4ILC A;  5JDF A;  3GMI A;  2IW5 B;  3QUJ A;  4EV6 A;  2HHH T;  3AAE B;  1OED E;  4L9I A;  3UTK A;  1SE7 A;  4U3C A;  3O1I A;  3UUX B;  2BS2 A;  2CBJ A;  4QXH B;  2NW9 A;  2V7L A;  2DL1 A;  1VRB A;  2WU2 A;  4YXD A;  4ZHQ E;  3RQU A;  5A1L A;  1ZEE A;  3EDU A;  2IAK A;  2KT9 A;  5L3G B;  4U7Y A;  3KFW X;  4IE0 A;  5FNV E;  2BG9 A;  4UR9 A;  3F57 A;  3SFE A;  3V5S A;  4IDN A;  2VUR A;  4Z91 A;  3KV4 A;  4BJM A;  5IYZ E;  2K9A A;  4U2Y A;  4AIS A;  1G73 A;  2J62 A;  3LFM A;  3OTO T;  2XQ3 A;  5FXW A;  2CA5 A;  4TX5 A;  5L3D B;  3EAM A;  4AKL A;  4LFC T;  4K0U A;  2ZLY A;  4UF0 B;  2K3W A;  4TNW A;  4H9S E;  3K8P C;  4GKJ T;  3LDQ B;  3ANW B;  3RIA A;  3ZKR A;  3D0T A;  2X66 A;  2XAJ B;  2CM0 A;  2UXB T;  2W62 A;  3PF0 A; 
#chains in the Genus database with same CATH homology
 3Q5W A;  1LVK A;  5JQG E;  4ASK A;  1VOM A;  1D1A A;  3C4X A;  1BR4 A;  2DCF A;  3PUR A;  4HN9 A;  1MND A;  3ONX A;  3KBU A;  4HTE A;  2CMR A;  3SS1 A;  4WBN E;  2G0U A;  5LNK A;  4KMC A;  2A3D A;  2WM9 A;  3AAI A;  2Q9Q B;  2LE8 A;  5FXX A;  1MMN A;  4IE4 A;  3RYH E;  3LK2 B;  4X1K E;  1UX5 A;  4EZH A;  4I43 B;  2QA7 A;  3RYF E;  2Y8D A;  3KV6 A;  3LBX A;  4ECG A;  3OYX A;  5KX5 E;  3AA7 B;  3E08 A;  3FXD B;  2HPL A;  3BQI A;  3PE0 A;  5GON E;  3MK7 C;  2NW7 A;  1YD8 G;  2RP4 A;  2ZMA A;  2BVL A;  4AXP A;  1SA0 E;  4EIW A;  3KIN B;  4Z8X A;  2CE7 A;  2C5I T;  4O4H E;  4PJN A;  1MMA A;  3PHF 1;  4O4J E;  2Y48 B;  4PK6 A;  3QC9 A;  3WUR A;  1MMG A;  2IC6 A;  3SRZ A;  3BK9 A;  5FXZ A;  5BMV E;  5JDH A;  5CA0 E;  4TN7 B;  5KDM C;  2NP9 A;  4X1I E;  4CI3 B;  3UUN A;  5EK2 A;  3J7Y q;  2LM9 A;  4I55 E;  5LBM A;  4AKH A;  3JC6 D;  3ZLI A;  4ZS2 A;  3HKE E;  5DAB A;  5FYM A;  2E8I A;  1CUN A;  3CQX C;  4GYS A;  4BJN A;  4ONR A;  2EHO A;  1MIY A;  3VU7 H;  4QKN A;  1BR0 A;  2CWO A;  4U72 A;  4XZC A;  4CXY A;  4PFO A;  4PAG A;  3RRW A;  3TKL B;  2DLR A;  3OKQ A;  3K3N A;  4E7S A;  3DP7 A;  4TV8 E;  4U74 A;  5LCY A;  2CLY C;  4UVA B;  1IZN B;  2CCQ A;  3CX8 B;  3B57 A;  2EHO D;  2HH7 A;  4MAL A;  3HA4 A;  5LG4 A;  2KLQ A;  4DMV A;  5DQW A;  4X20 E;  5J2U E;  2NW8 A;  4GYR A;  4UVB B;  4O2B E;  2WWU A;  4QXB B;  2D2S A;  4PNI A;  4TZ4 C;  1HX8 A;  1HFA A;  3E22 E;  3U3I A;  2JMH A;  1UX4 A;  1MNE A;  4KP3 C;  4YJ3 E;  3UUL A;  3BQL A;  5JDG A;  3IHR A;  1Y64 B;  3HI2 A;  3QK6 A;  4H9O C;  4IGU A;  4UEM A;  4C91 A;  1WYB A;  4ZI7 E;  2QGS A;  4DO0 A;  2V7I A;  4DND A;  2JRK A;  3ZN1 B;  3I9W A;  3P7I A;  1T98 A;  2E9X A;  4IHJ E;  4MLK A;  2BZB A;  1QUU A;  1V9D A;  5HAX A;  3ESL A;  4O4L E;  4WW0 A;  2LOP A;  4WNK A;  2KND A;  4YLH A;  5JH7 E;  1LKX A;  4EB6 E;  5JR9 A;  2ODU A;  5EK4 A;  4I50 E;  3PUG A;  4B6X A;  4ZI2 D;  3RRC A;  4OYK A;  3ZYK A;  2E9X D;  3O9X A;  3JC6 C;  4OHF A;  5JDM A;  5L3C B;  4JUY A;  3WI3 A;  4E7Z A;  5E0O A;  4N78 D;  4AI6 A;  1D0Y A;  3ZMS B;  1NAF A;  4EOZ B;  4HKA A;  2LSJ A;  2XTL A;  4L5G A;  2DI4 A;  4XAX B;  3V5U A;  2WMN A;  2X0L B;  4BGO A;  3RC3 A;  2KIN B;  3N9Q A;  5ETW A;  5H6Q B;  1ZKE A;  2K48 A;  4JEH B;  4UV8 B;  2WSS V;  2EHO C;  3LBX B;  2VKJ A;  2X9W A;  2PFV A;  1S35 A;  5HXH A;  2SPC A;  5JRC A;  2VAS A;  2X67 A;  4EZ4 A;  3P8C D;  1LRZ A;  2XAG B;  3U78 A;  4AKG A;  2KWH A;  3KV9 A;  2LEH A;  2ZM8 A;  4H9Q C;  1HF8 A;  2VKO A;  2W0G A;  4UIG A;  1X79 A;  2L3L A;  3PU3 A;  4IST A;  3N9P A;  3WSC A;  3C4Z A;  4HEA A;  4ZI3 D;  5LBQ B;  3ETU A;  1MMD A;  3OJA A;  2KZ7 B;  2ES0 A;  3HKC E;  3MXZ A;  2X9X A;  4CQI A;  1B7T A;  3PUS A;  4UF0 A;  2LOS A;  2MBG A;  2X51 A;  5FY0 A;  3GWH A;  2CXF A;  2ZM0 A;  1SHZ C;  3E0Z A;  2DNX A;  3K3Q C;  1WRD A;  3WAJ A;  3N2K E;  5LHG B;  3CVR A;  2YU1 A;  4AKI A;  3J9X 1;  3FHN A;  2CXL A;  3CML A;  4H9P C;  5TAO A;  5EK3 A;  4ERR A;  1D0X A;  4H63 H;  3ZJ1 A;  2X9Y A;  3RPU A;  2NWB A;  3KVB A;  4YHJ A;  3IF8 B;  4AKR B;  2D5U A;  1YKE B;  4CXW A;  4PK5 A;  3C50 A;  4EXT A;  2WMO A;  3I9Y A;  2CWY A;  4PW8 A;  5HYA A;  4DMW A;  2VB6 A;  4CI2 B;  3NZQ A;  4ZI2 C;  5LGT B;  2E9X C;  2NTX A;  4GIW A;  5LHH B;  2CEA A;  4CXX A;  4GK5 E;  1E1H B;  2XQY A;  1D1C A;  1OWA A;  1U5P A;  5CB4 E;  2Q9Q A;  3H3A A;  4P09 A;  3SWH A;  1ZHC A;  3Q9D A;  2PJQ A;  2V7J A;  4PJJ A;  5JR9 C;  4OK0 A;  4O4I E;  1FMW A;  3MAC A;  3PUA A;  2ODV A;  1QSD A;  3Q2M A;  3ZMU B;  1IAP A;  1WLX A;  3F31 A;  3F2E A;  2YIN A;  5ADX L;  2ZM2 A;  3AA1 B;  3MA9 A;  4X1Y E;  1H7C A;  3FBZ A;  5DJQ C;  3N9O A;  1IJ6 A;  2PBI A;  3I1A A;  4OYJ A;  4C90 A;  5LA6 E;  3MZK B;  2LSI A;  2HPJ A;  2Q9Q D;  4JLE A;  3ZC0 A;  3ZCJ A;  3CPZ A;  1LVF A;  2KMF A;  3ZMZ B;  2VKD A;  3FXE B;  3CWZ B;  1UCU A;  2MYS A;  4DVD A;  4IIJ E;  4O2A E;  1U4Q A;  5LHI B;  2XUE A;  3IBP A;  4QHO A;  2M67 A;  1HCI A;  2UXN B;  2XAH B;  4MBQ A;  4P0A A;  2LJL A;  3CX7 B;  3I0O A;  4MFR A;  1FIO A;  4TV9 E;  2B1E A;  2XAS B;  4ADZ A;  2V1D B;  4ZI3 C;  3RKO A;  3KBT A;  1O3X A;  3IEE A;  1D1B A;  4AQF A;  3AVR A;  4WBO A;  3O1J A;  5JDN A;  4P0B A;  2C0S A;  4M1P A;  2JPF A;  4ANJ A;  5JR9 B;  5F3J A;  2MOZ A;  3CQG B;  4UXN B;  2CLY B;  3GN5 B;  3I0Q A;  3N9N A;  3CQC B;  3EDV A;  3N5L A;  3BQK A;  4L0R A;  4MHC A;  1HG2 A;  2L8K A;  3T8O A;  1WYC A;  4IE7 A;  3N2G E;  5LGN B;  3S4U A;  2W63 A;  3ZN0 B;  3SOL A;  2W61 A;  1S94 A;  2H3R A;  2DHR A;  1AJ3 A;  1BR1 A;  1G8X A;  2VL8 A;  3C98 B;  4KBM B;  2H7V C;  2A72 A;  5FY7 A;  4NUU A;  3O1H A;  4TUY E;  3VJZ A;  4YFS A;  3M65 A;  3HKD E;  3C4W A;  1OXZ A;  2NTY A;  3PU8 A;  3VHL A;  2N9D A;  4ISS A;  4QWN B;  3ZMT B;  3PUQ A;  2D0T A;  3LK3 B;  5KMG P;  4HFV A;  1YW0 A;  5L3F B;  3N9L A;  2JQQ A;  5EZY E;  1KNZ A;  4V1A v;  3A5X A;  3EVY A;  3NRY A;  3PTR B;  2V26 A;  4H9N C;  4G63 A;  2DWK A;  3WAK A;  1EZ3 A;  1US7 B;  2YU2 A;  4ZOL E;  2OA5 A;  3N9M A;  4OFZ A;  3ZPO A;  2VKH A;  5LXT E;  3H37 A;  2Q9Q C;  3C64 A;  5T1D A;  4XBF B;  4EYU A;  3CKD A;  4H9R C;  5FY1 A;  5JRE A;  3HL6 A;  3NZP A;  3LJC A;  3VKG A;  5HXC A;  5HXE A;  1YKH B;  4G2A A;  5FP3 A;  2D0U A;  2WAU A;  4IE6 A;  5LJM A;  3PDY A;  4A56 A;  1BR2 A;  5C8Y E;  3C51 A;  2JMK A;  2KXP B;  2NOX A;  2UXX B;  4ZS3 A;  1FEW A;  4GOU A;  2VWA A;  2K24 A;  2L9Q A;  3EUH A;  5L2L A;  4BAY B;  1HG5 A;  3ANW A;  1IJ5 A;  3NRX A;  2DWG A;  5J2T E;  2EHO B;  4FJO A;  4AQF C;  2N2N A;  4BA9 A;  3FB2 A;  5CA1 E;  5LGU B;  2I59 A;  3LK4 2;  4GK0 E;  5H6R B;  3UFE A;  3ZYL A;  2A2F X;  2LSY A;  2Y6X A;  4IE5 A;  5JVD E;  4O8S A;  2K5B B;  2YK0 A;  2BVM A;  2C5J A;  5IHY A;  2CXD A;  3K3O A;  3Q5X A;  4KUM B;  3AA6 B;  3NBX X;  5JDF A;  4AQG A;  4QX8 B;  3GMI A;  4UVC B;  2IW5 B;  3AVS A;  2MTQ A;  3QUJ A;  3AAE B;  4L9I A;  3UTK A;  3UUM A;  5LJN A;  4H63 V;  3O1I A;  5JDL A;  3RC8 A;  3UUX B;  3B13 A;  3MKD A;  5HWY A;  2LHN A;  1HTJ F;  3O4X E;  4QXC B;  3L09 A;  5L3B B;  4QXH B;  1WR6 A;  2NW9 A;  3GA8 A;  1D0Z A;  2LSG A;  2V7L A;  2LSK A;  5JDQ A;  3FBL A;  4PJM A;  1NWM X;  3MJX A;  1VRB A;  4EYY R;  4QX7 B;  5LOV E;  5HWX A;  1Z0P A;  3N2O A;  4ZHQ E;  3L3P A;  3RYI E;  2LQU A;  2V7M A;  5A1L A;  1ZEE A;  2E9X B;  3EDU A;  3CX6 B;  2IAK A;  3R84 B;  2KT9 A;  2Z6E A;  3KDS E;  4EAH A;  5L3G B;  3OYZ A;  5LP6 E;  2GK9 A;  2IC9 A;  3RX6 A;  2WBL A;  3KFW X;  2MTC A;  3RH3 A;  4IE0 A;  5FNV E;  4HGA A;  5AFU L;  3AT7 A;  4UV9 B;  2RA1 A;  5F8P A;  3F57 A;  4UEL A;  5HXS A;  4PFP A;  3ZCI A;  2N1G A;  4HE8 A;  3KV5 A;  3ZJ2 A;  3UT5 E;  3V5S A;  2ACX A;  3DJB A;  5FXV A;  2BDE A;  3LG7 A;  3ZMV B;  3KV4 A;  1KK7 A;  2LT3 A;  4BJM A;  4J2C A;  3KVA A;  2YEV C;  5IYZ E;  2K9A A;  4YJ2 E;  3ZEF B;  3ZC1 A;  1G73 A;  4PK4 A;  3DTO A;  5HXR A;  3ETV A;  3HR0 A;  3LFM A;  4DBR A;  2W00 A;  1ZV4 X;  5J1G A;  4IDZ A;  5JRC B;  3R6N A;  3HKB E;  5DQV A;  3AA0 B;  1FMV A;  5FXW A;  4ILU A;  2CA5 A;  4TX5 A;  5LYJ E;  5L3E B;  2KWI B;  2XAF B;  3AB3 B;  2H7O A;  3RYC E;  2J1D G;  2X9H A;  5L3D B;  4FI5 A;  2C5K T;  1HS7 A;  4AKL A;  2JJ9 A;  2XHE B;  3W15 B;  2XAQ B;  4CZZ B;  5FMN A;  3GN5 A;  3M1C A;  4K0U A;  2ZLY A;  4UF0 B;  2X68 A;  4H9S E;  3K8P C;  5M4Y A;  3VKH A;  2V7K A;  3OBV E;  3ANW B;  4I4T E;  3D0T A;  1MIV A;  2PG8 A;  3ZYM A;  4F6R C;  4JEU B;  1MIW A;  4NUV A;  2VK9 A;  4PJL A;  3AAA B;  2X66 A;  2P9B A;  2XAJ B;  2LHR A;  2CM0 A;  4DBQ A;  4CI1 B;  2W62 A;  3PF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...