3V5SA

Structure of sodium/calcium exchanger from methanococcus jannaschii
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
Knots found
sequence length
301
structure length
289
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium/Calcium Exchanger
publication title Structural insight into the ion-exchange mechanism of the sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal transport
total genus 109
structure length 289
sequence length 301
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3v5sA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 3v5sA02
5JDNA 5HYAA 3V5UA 5HWYA 5JDHA 5JDLA 5JDFA 5HXSA 5HXEA 5JDMA 5HXRA 3V5SA 5HXHA 5HXCA 5JDGA 5JDQA 5HWXA
chains in the Genus database with same CATH superfamily
2MYSA 4U7YA 3AXJA 3MJXA 1XZYA 3ONLC 2W00A 3UQ7A 3AEEA 4AXPA 1XMQT 4HE8A 3P4RA 1D0YA 3ZC0A 2LSJA 4B3ST 3AAIA 2BBJA 3QB5A 4U3CA 4EZ4A 4HFIA 2LHRA 4AKRB 2MPKA 3AE6A 1OEDE 2IDOB 3ETUA 3OYZA 3AE1A 4LF5T 2BKOA 4XAXB 3FZLB 2AE9A 4ZZBA 4EOZB 3ZKRA 3KVAA 3PF0A 2V6YB 3SRZA 2XQ4A 5FNVE 2ES0A 4DVDA 3QOFA 2V26A 3ZT7A 4HFVA 4U2ZA 2XZEA 3H3MA 3SS1A 2XM1A 3EAMA 5C3JA 2LOSA 4JYAT 3HI2A 4LFCT 4QH5A 1T98A 4KUMB 3TLUA 2WB5A 3ZJ1A 2IC9A 5KX5E 4DIDB 4UR9A 4X1YE 2DHRA 3PU8A 4YSYA 2Y6XA 5LP6E 2L8KA 3PHF1 3CQCB 3FZHB 4UVCB 4HFDA 1XNRT 2D0UA 1HX1B 1HNXT 3AEDA 3HKCE 4V1Av 3VR8A 4IDZA 5JR9B 4DR6T 3T1HT 3A8YC 2CWYA 4XBFB 4JEUB 4IDQA 1WRDA 4PJLA 4YT0A 1YXRA 2JQQA 2PTFA 3LK42 5LB7B 5AQTB 5FXXA 1D0XA 2XQ8A 2YU2A 4ZS2A 2FBWA 5ABEA 3UUNA 4TWFA 1J1JA 2VKDA 5HWYA 3KDSE 2H7VC 3RRCA 2W66A 2X9HA 4HFHA 5LHGB 2NWBA 3C98B 3KV6A 4DV6T 1IJ5A 5ABFA 2BKNA 2NOXA 4TWDA 3RLFF 4WW0A 1DU2A 3RIUC 5HXEA 1W9RA 4OK0A 4LF9T 1IAPA 2CWOA 4DBQA 2I0MA 1V9DA 2QRXA 2WDRA 3A5XA 3KVBA 5AQKB 4CN1A 4ERRA 5LHHB 2RP4A 5AQFB 2CPTA 5IHYA 4IREA 2X51A 5JR9A 4LF6T 1JNRA 2W4XA 2D5UA 3HR0A 3ZMTB 2XY8B 3UT5E 4KHZF 3RI5A 5HEUA 2NW9A 2N1GA 1SJ7A 2MTCA 1SE7A 3FHNA 4O2BE 4OYKA 1T72A 3UU5A 4DMVA 3MA9A 3N2OA 3P7IA 2JPFA 2K24A 4I50E 4X66T 2CCQA 5LG4A 1NWMX 3AT7A 3HKBE 4ADZA 3ONJA 2WWUA 4CXYA 5JRCB 3O1HA 2LE8A 3RH3A 4KBMB 1IBKT 4HWCA 3AE7A 5L3GB 1SHZC 1HFAA 2LM9A 4FI5A 2X66A 3E22E 4EEBA 1JNZA 3I0QA 3VRBA 3KBTA 3NVOA 2X68A 4IHJE 2A72A 4AKHA 1IJ6A 4N78D 4X65T 3M65A 2LSIA 5CA1E 1X79A 2MBGA 4ZHQE 3OYXA 3T8OA 3ZN0B 2KWHA 4IL9A 2VKHA 4HTEA 2CMRA 3DYJA 2YDRA 1SA0E 4PJNA 5JVDE 2UUCT 4WNKA 1HS7A 2UUAT 2Q9QA 2BDEA 5CGMA 1LRZA 4TWHA 2YK0A 2XQYA 3FBZA 3T1YT 2HPLA 1UUSA 1HNZT 1XNQT 1MIVA 5JRCA 1YKEB 3UU8A 1W0BA 3ZYMA 2DLRA 4Q25A 4MBQA 3MK7C 3ZMUB 5AQRB 3ZLIA 5LJNA 4DR3T 2Y8DA 3PUZF 3P50A 1I6ZA 4U2YA 3L39A 3C50A 4CN6A 3ZSTA 2KZ7B 5ETWA 2ZM0A 2LM2A 1IBLT 3UUXB 5L3CB 3FB2A 3TKLB 5LNKA 2KLQA 3QC9A 3NRYA 3P4QA 4UELA 3OJAA 2V6XA 2CXLA 4WBNE 1Z0PA 1N34T 4YTPA 3Q5DA 4TNVA 2G0UA 4HGAA 5LA6E 4DMWA 2VKJA 3FZMB 1ZHCA 4A97A 1NENA 2JQHA 2K5BB 2W67A 4MFRA 3WSCA 3IEEA 3RYHE 3LDQB 4MHCA 2VB6A 2WMNA 3RIFA 2VKOA 2D0TA 2ZM8A 3FXDB 4BA9A 2CBIA 4G2AA 4PFPA 3AE2A 2IW5B 2LSYA 3F57A 3HL6A 4DO0A 4IIJE 2CBJA 3SOLA 2VQET 4B3RT 2QGSA 5DQWA 1YQ3A 5J2TE 5ABGA 5TAOA 3G06A 1XDOA 4DBRA 1HX8A 2WM9A 4O4IE 1E1HB 2KMFA 2JIWA 3NWIA 4EEDA 2XAQB 3WAJA 1XMOT 5IUXA 4PK5A 4OX9T 4BJNA 5F3JA 4AIUA 4CXWA 2CEAA 1HR0T 4JI8T 2ZMAA 1Y01A 5CA0E 2BS2A 2CM0A 5T1DA 1WCRA 3V5UA 4COFA 4JI3T 3UULA 1MIWA 5AQNB 2D2SA 4KI0F 3CKDA 2CRBA 4QXCB 3RQWA 1VCSA 1MMDA 3ANWB 4PFOA 3O9XA 2FJBA 4P0BA 1HG5A 3GA8A 1O3XA 5HEHA 3RQUA 2WU5A 5L3BB 2OLTA 4LFAT 3AEAA 3HKEE 2JQKA 2WBLA 3EI0A 4JEHB 3TLVA 4HFCA 1KEYA 4L5GA 3QNUA 2M6IA 3LG7A 5J0ZA 2YN6A 3RGLA 3B5MA 4UV9B 1LKXA 2FJEA 4KMCA 1G8XA 4BJMA 2IUBA 4EZHA 2M6BA 4EAHA 3UFEA 3ABVA 1MNEA 4UIGA 1B7TA 4GIWA 3GMIA 2BG9E 2UXNB 3NZPA 3L09A 3AB3B 2CHNA 4TX5A 1WYBA 1KK7A 2BG9B 3ZJ2A 5BR8T 2LOPA 1OEDB 4MALA 5JDQA 4AISA 2IHR1 5AQMB 4FJOA 5HCMA 3A7MA 4ILCA 5JDNA 3P4WA 5H6RB 4ILAA 3VR9A 1YKHB 2LHNA 4DV2T 4IE0A 2YDSA 4GK0E 3UQ4A 3EUHA 5FY0A 4F7GB 4PJMA 4QH1A 2KNDA 4TN7B 3PJAJ 3C4WA 2A2FX 5DABA 3LFMA 3PUVF 3ONXA 4JI5T 2JQ9A 4QH4A 1WFDA 2F4VT 2XJ7A 3Q5EA 5AQSB 2WP9A 1ZOYA 5JTGA 1NEKA 3AA7B 1HTJF 4O4LE 2BG9C 4L9IA 5DJQC 4EYYR 2BZBA 1OEDC 1US7B 2XASB 4I43B 5DQVA 3AE8A 2JJ9A 4ILUA 1CUNA 5HWXA 2XQ3A 5FL1A 3CK6A 4JI1T 4H9OC 2YKSA 4ISSA 3K3QC 1OEDA 2VVSA 2V6YA 4UF0B 4YXDA 1WR6A 3N9MA 2XAFB 4CI3B 2ACZA 4QXBB 4X20E 3AVRA 1H7CA 2CA5A 2VURA 3OKQA 5LOVE 4ZI7E 2LQUA 4PW8A 4BGOA 5JDGA 2I59A 2E9XB 1HG2A 4I0UA 2IIUA 4DR2T 5J1GA 2UXDT 3PDYA 3AE9A 3AA0B 3MZKB 3UTKA 2RPAA 1LVKA 2E8IA 1D1BA 2HN2A 2V5DA 4H9NC 3I9YA 3ZMVB 3RIUA 4OHFA 4H9PC 1FJGT 3SFDA 5JREA 1UGOA 5LBMA 2V8SV 4QX7B 2L10A 2DNXA 4EGWA 4DV1T 2ZLYA 4UF0A 4QX8B 3DTOA 4ISTA 4AKLA 5JDLA 2LT3A 2B76A 5C8YE 2XQAA 1BR0A 4EYUA 3OPCA 3O1JA 4PNIA 2E9XC 3GWHA 5CJ5A 2PG8A 2IAKA 3JC6C 4U74A 5FZTA 3BK9A 3JC6D 1MMNA 3ZEFB 5GONE 3VU7H 1N36T 3RX6A 4AQGA 1ZKEA 1MMGA 3JAEA 4ZI3C 2LSKA 2YU1A 3Q5WA 1KNZA 4ZI3D 3L3PA 3ZT5A 3H37A 5HXCA 2N9DA 3RYCE 4QWNB 2XPKA 2L7NA 4DNDA 5LCYA 4WZXA 4C90A 4UXNB 4JUYA 4QXHB 3ZT6A 1KNRA 1HF8A 2KSRA 4LF8T 3WI3A 4Z90A 3S4UA 2V7LA 1W0AA 4XZCA 2UXXB 4NUVA 4LF7T 3RIAA 2LLYA 2X0CA 3O4XE 2QA7A 2N2NA 2V7MA 2YDQA 4GKKT 4TUYE 4IDOA 4F8HA 3DJBA 3ESLA 3TLSA 4GYSA 4DR7T 3PURA 3I1AA 3PUWF 4AQFC 2A9UA 3N9QA 5F8PA 4KHPT 5LHIB 1LVFA 2EHOB 3CQGB 5FXZA 4E7ZA 2XQ7A 4JI6T 2UXBT 1MIYA 1WLXA 2WCAA 4DV7T 2H89A 3N9OA 3P4PA 4DV5T 4JI0T 4AKIA 2Y48B 2V7IA 1KFYA 3ZCJA 5FL0A 4JI7T 5ABHA 4YHHT 5L47A 3EHZA 2BS3A 4H63H 3DP7A 5KDMC 2KXPB 4P1NA 2NW8A 4NIQA 2IMLA 4P0AA 2XTLA 3UU4A 3AE3A 2C5IT 3UU6A 5AQPB 1UURA 3JADA 3VKGA 3QUJA 1XWMA 3OTOT 4DR5T 2EHOC 2C0SA 5JDMA 2EHOD 2W2UA 5L4EA 4NUUA 2OV9A 3F2EA 4KX6A 3AAAB 5M4YA 5JQGE 3N5LA 3MKDA 2UXCT 4GOUA 2V7JA 2NTYA 4IE6A 1J5WA 3OVUA 2W62A 3CPZA 4NXNT 1OWAA 5LGUB 2X0YA 5AQVB 3N9NA 4X1KE 1QSDA 3PV0F 2VL8A 5AQUB 2CXDA 3J9X1 5AQHB 2XQ5A 2CLYB 3CX8B 4A56A 3NZQA 4ZS3A 3IA3A 3QB5K 2AXDS 2BVMA 1L0VA 2YOEA 2QYWA 1ZP0A 5AQJB 4LMLA 2NW7A 4X64T 3RC3A 2XSAA 3C51A 5FVKA 3RKGA 5HXSA 2B1EA 4HEAA 2WQYA 3U78A 4HWIB 2WZIA 1UX5A 4WBOA 3TLWA 3I0OA 1FIOA 4DR4T 2LJLA 2X9WA 2CLYC 4X1IE 5CFBA 1XDPA 2W0GA 3ZMSB 2V7KA 2J62A 5E0OA 5FXVA 4ZI2C 1W09A 4ZI2D 4GK5E 4NPPA 4H9SE 3NBXX 3PUXF 3AVSA 3ZMZB 3RPUA 4U33A 1UK5A 5LJMA 3EDVA 3PU3A 2ZM2A 4CI1B 5L2LA 1CHUA 1G73A 2KT9A 1KF6A 2FJAA 2OA5A 3I9WA 2K9AA 3AEFA 3UUMA 5HXRA 1J5ET 2ODVA 1KNPA 5LGNB 4NXMT 2VVNA 3AE4A 2WSSV 3ZYKA 2MTQA 3AA1B 4JLEA 3C4XA 4PK4A 5IYZE 5JH7E 3QK6A 3EABA 4YLHA 4MLKA 1HCIA 3M3ZB 3RF1A 3VKHA 3JCFA 3RYFE 5HYAA 5AQIB 2C5JA 4TV8E 3OBVE 3IBPA 4U72A 3CX7B 2XQ6A 5LBQB 3UUBA 5L3EB 3PUSA 2BBHA 4J2CA 4DUZT 3CX6B 3ANWA 4HFBA 4HN9A 3FYQA 4CQIA 1VCTA 3K3OA 2X67A 2X9YA 4K0UA 1U5PA 1I94T 2QVAA 4JI4T 4H9RC 2H3RA 2BS4A 5LMNT 2KWIB 2UU9T 4OYJA 3AE5A 2MOZA 4YTNA 3AAEB 5HCJA 2VL0A 2ZM6T 5C2TA 3UFGA 2FJDA 4YTMA 4HWHA 4C91A 4YFSA 1NAFA 5L3FB 3N9LA 2DWGA 3LJCA 2E2AA 5LXTE 3WURA 3LK2B 3ZPOA 4H9QC 1BR4A 4DR1T 1N32T 3V5SA 4JV5T 2YINA 3AEGA 5AFUL 2CE7A 2VWAA 3KV4A 2WS3A 5FY1A 3CWZB 3PUYF 2E5VA 4UV8B 5ABFB 2V5CA 3FZFB 5LYJE 4EV6A 3Q2MA 2XUEA 4LF4T 1BR1A 5A1LA 3FXEB 5HEJA 1IBMT 1MNDA 3O1IA 2W61A 4EIWA 4A5XA 3GN5B 4YY3T 4YJ2E 4IGUA 4EB6E 4O4JE 1IZNB 2BG9A 3MXZA 5CB4E 1YW0A 1VRBA 5FY7A 4QHOA 2K3WA 1YQ4A 3IF8B 5LMUT 5FKYA 4YSXA 3NRXA 4ZOLE 2GK9A 1VOMA 5HEOA 4AKGA 3E0ZA 4UVAB 2PBIA 4PJJA 2SPCA 3PUGA 4I4TE 3CQXC 2LKGA 4F6RC 1T8BA 2WWVA 1UCUA 4X5TA 2CHOA 5HAXA 5EK2A 1FMWA 3KV5A 3VRAA 4ZXLA 4X62T 5FMNA 2A3DA 4BAYB 2WAUA 1FMVA 4B6XA 2D9DA 5KMGP 3FBLA 5JR9C 2FUPA 4IE4A 3GN5A 4B3TT 1M62A 2C5KT 3ZCIA 5L3DB 2XQ9A 2I6HA 1M7KA 4HWDA 3LK3B 3RC8A 1SUMB 1R8IA 4UEMA 3KV9A 3SFEA 2E9XD 4IT4A 2JRKA 5H6QB 3BQLA 4LFBT 1N33T 1X9BA 3AA6B 2LKHA 4ILBA 2XSBA 3C4ZA 3R84B 3F31A 2E9XA 2Q9QB 4PAGA 4O2AE 2K48A 4KP3C 3X1DA 5EK3A 3ZC1A 2WDVA 2E5LT 2VASA 4UVBB 3UU3A 4IE7A 4AQYT 4HWFA 3PJAA 4Z91A 3VJZA 5AQLB 2LSGA 2V1DB 4I55E 3BQIA 5LGTB 5IWAT 2NR4A 4IDPA 3HKDE 3PUQA 4YJ3E 4GYRA 5LG3A 4L0RA 2L3LA 2IC6A 1D1CA 1D1AA 3L8RA 2J47A 1MMAA 2ODUA 3J7Yq 3LBXB 4M1PA 3CVRA 2HHHT 4O8SA 4W8PA 2H7OA 3SWHA 3HA4A 2WDQA 4HKAA 2KVPA 2LRLA 4U7IA 4ASKA 3U3IA 3AEBA 5JDFA 3D0TA 3VHLA 2Q9QC 3E08A 2Q9QD 3CMLA 3Q5XA 3LSVA 1D0ZA 5EK4A 4DV4T 4ZEYA 5FVLA 3M1CA 1E7PA 2WU2A 2KBBA 4QKNA 4P09A 1GQEA 1BR2A 1YD8G 2KINB 4CN4A 3RYIE 2WY2A 2UUBT 4AQFA 1SJ8A 3ETVA 3ZN1B 2NTXA 2BVLA 1QLBA 1WYCA 2M67A 2YEVC 2X0LB 3B57A 3TLTA 3WAKA 2P9BA 1E2AA 5EZYE 2J1DG 3MACA 2X9XA 4DV0T 2JMHA 4GKJT 1T7SA 4ECGA 4OFZA 3P8CD 3FZKB 2XAGB 3LBXA 4YSZA 4O4HE 4H63V 2X0HA 2WMOA 5L4HA 4ZZCA 2LEHA 2CXFA 4K0KT 3N2GE 1HNWT 3RHWA 4DV3T 2BKPA 3K1SA 4CXXA 1OXZA 2ACXA 2EHOA 4B3MT 2PJQA 2DL1A 2XHEB 4Z8XA 5AQOB 2HN1A 2JMKA 2XM2A 2J4GA 1EZ3A 5F5WA 3N2KE 2XAHB 5AQQB 1S35A 3EVYA 4TZ4C 5J2UE 1S94A 3AY5A 4DUYT 2DWKA 2DI4A 4YHJA 3EDUA 2MAWA 1AJ3A 2VK9A 2L9QA 3ZYLA 3PTRB 5AQGB 1ZEEA 2NP9A 3ZSSA 3R6NA 2XAJB 3RKOA 4U31A 4HFEA 5JDHA 3K8PC 2HPJA 4TNWA 4E7SA 2VQFT 4IL4A 4IDNA 4IE5A 3AXJB 1Y64B 3KBUA 4G63A 5HXHA 4TV9E 2R6GF 2W63A 3AECA 3N9PA 3Q9DA 1QUUA 3JAFA 2WZHA 3H3AA 5KXJA 2Z6EA 3C64A 4EXTA 4WYVA 4CZZB 4JI2T 3KFWX 1U4QA 5ADXL 4JBWF 1Z8UA 5FXWA 2PFVA 3IHRA 5HEGA 1ZV4X 2HH7A 3PE0A 2DCFA 5BMVE 2H88A 4LMKA 3B13A 1WR0A 1UX4A 5FP3A 3CIRA 3NKZA 4ONRA 3PUAA 1FEWA 4A98A 4LMJA 4ANJA 2KGXA 3K3NA 4CI2B 3RRWA 3P4SA 2LRKA 4PK6A 3KINB 5FYMA 3W15B 2RA1A 3BQKA 4AI6A
chains in the Genus database with same CATH topology
2MYSA 2N9DA 3IF8B 3RYHE 4MHCA 3RYCE 4QWNB 4DNDA 2VB6A 3NRXA 4ZOLE 5LCYA 2WMNA 4C90A 2VKOA 2D0TA 4JUYA 2ZM8A 4QXHB 4UXNB 2GK9A 1HF8A 3MJXA 3FXDB 1VOMA 3WI3A 4BA9A 2W00A 4AKGA 3S4UA 4G2AA 2V7LA 4AXPA 4PFPA 3E0ZA 4HE8A 2IW5B 2LSYA 4XZCA 3F57A 2UXXB 3HL6A 4DO0A 4NUVA 4UVAB 4IIJE 1D0YA 3ZC0A 2PBIA 4PJJA 2SPCA 2LSJA 3SOLA 3O4XE 2QA7A 2QGSA 3AAIA 5DQWA 3PUGA 2N2NA 4I4TE 5J2TE 2V7MA 5TAOA 3CQXC 4EZ4A 4DBRA 1HX8A 2WM9A 4O4IE 4TUYE 1E1HB 2LHRA 2KMFA 4F6RC 3DJBA 4AKRB 3ESLA 2XAQB 4GYSA 3WAJA 1UCUA 3PURA 3I1AA 5HAXA 4AQFC 3ETUA 3N9QA 5F8PA 5EK2A 5LHIB 1FMWA 4PK5A 3OYZA 3KV5A 1LVFA 4BJNA 2EHOB 4XAXB 3CQGB 5FXZA 4E7ZA 5F3JA 5FMNA 2A3DA 4BAYB 2WAUA 1FMVA 4B6XA 4EOZB 5KMGP 3FBLA 5JR9C 3KVAA 4CXWA 4IE4A 3PF0A 1MIYA 1WLXA 2CEAA 3GN5A 3SRZA 2ZMAA 3N9OA 2C5KT 3ZCIA 5CA0E 5FNVE 5L3DB 2CM0A 5T1DA 4AKIA 2ES0A 4DVDA 2Y48B 2V7IA 2V26A 3ZCJA 4HFVA 3V5UA 3LK3B 3SS1A 3RC8A 2LOSA 3HI2A 3UULA 1MIWA 2D2SA 4H63H 3DP7A 5KDMC 3CKDA 1T98A 2KXPB 4KUMB 4UEMA 4QXCB 2NW8A 3KV9A 2E9XD 1MMDA 2JRKA 3ANWB 5H6QB 4P0AA 4PFOA 3ZJ1A 3O9XA 2XTLA 4P0BA 3BQLA 1HG5A 3GA8A 3AA6B 2IC9A 1O3XA 5KX5E 2C5IT 4X1YE 3C4ZA 2DHRA 3PU8A 2Y6XA 3R84B 3VKGA 3QUJA 3F31A 5L3BB 5LP6E 2L8KA 2E9XA 2EHOC 2Q9QB 2C0SA 4PAGA 5JDMA 4O2AE 2EHOD 3PHF1 3CQCB 2K48A 4KP3C 4UVCB 3HKEE 2WBLA 4JEHB 4NUUA 5EK3A 3ZC1A 3F2EA 2D0UA 2VASA 3AAAB 4UVBB 5M4YA 5JQGE 4IE7A 3HKCE 3N5LA 3MKDA 4L5GA 4V1Av 3VJZA 2LSGA 4GOUA 2V1DB 2V7JA 4I55E 3LG7A 2NTYA 3BQIA 4IE6A 5LGTB 2W62A 4IDZA 3HKDE 3PUQA 4YJ3E 5JR9B 4GYRA 3CPZA 4L0RA 1OWAA 5LGUB 2L3LA 2IC6A 1D1CA 3N9NA 4UV9B 1LKXA 1D1AA 1QSDA 4X1KE 2VL8A 2CWYA 2CXDA 3J9X1 4XBFB 4JEUB 4PJLA 1WRDA 1MMAA 4KMCA 2CLYB 2ODUA 3CX8B 1G8XA 3J7Yq 3LK42 2JQQA 3CVRA 3LBXB 3NZQA 4M1PA 4A56A 4BJMA 4O8SA 5FXXA 4ZS3A 1D0XA 4EZHA 2YU2A 4ZS2A 2H7OA 3SWHA 3HA4A 4EAHA 3UUNA 4HKAA 2VKDA 5HWYA 2BVMA 3UFEA 4ASKA 3KDSE 3U3IA 1MNEA 2NW7A 4UIGA 5JDFA 2H7VC 1B7TA 3RRCA 3D0TA 3RC3A 4GIWA 3GMIA 3C51A 2X9HA 3VHLA 5HXSA 2Q9QC 2B1EA 4HEAA 5LHGB 3E08A 2Q9QD 2NWBA 2UXNB 3NZPA 3U78A 3C98B 3KV6A 3CMLA 1IJ5A 3L09A 3Q5XA 3AB3B 1D0ZA 2NOXA 4TX5A 5EK4A 3M1CA 1WYBA 1KK7A 3ZJ2A 4QKNA 4WW0A 1UX5A 5HXEA 4P09A 4WBOA 1BR2A 2LOPA 4OK0A 1YD8G 2KINB 4MALA 5JDQA 3RYIE 1IAPA 3I0OA 2CWOA 1FIOA 4AQFA 4FJOA 4DBQA 1V9DA 3A5XA 2LJLA 3ETVA 2X9WA 2NTXA 3KVBA 3ZN1B 2BVLA 2CLYC 4X1IE 4ERRA 1WYCA 5JDNA 2M67A 2W0GA 2YEVC 2RP4A 3ZMSB 5LHHB 2X0LB 3B57A 2V7KA 5IHYA 5H6RB 3WAKA 2P9BA 2X51A 5JR9A 5EZYE 2J1DG 3MACA 5E0OA 2D5UA 3HR0A 3ZMTB 1YKHB 5FXVA 4ZI2C 2LHNA 2X9XA 3UT5E 4ZI2D 2JMHA 4GK5E 4IE0A 4GK0E 2NW9A 4H9SE 4ECGA 3NBXX 4OFZA 3EUHA 5FY0A 3AVSA 3P8CD 4PJMA 3ZMZB 2KNDA 3RPUA 2XAGB 4TN7B 3LBXA 4O4HE 2N1GA 5LJMA 3C4WA 2MTCA 3EDVA 4H63V 2A2FX 5DABA 3LFMA 3PU3A 3FHNA 3ONXA 4O2BE 4OYKA 2ZM2A 4CI1B 5L2LA 2WMOA 1G73A 4DMVA 3MA9A 2KT9A 2LEHA 3N2OA 3P7IA 2CXFA 2JPFA 3N2GE 3AA7B 2K24A 1HTJF 4O4LE 2OA5A 3I9WA 2K9AA 4I50E 3UUMA 5HXRA 2CCQA 5LG4A 1NWMX 2ODVA 4L9IA 5DJQC 2BZBA 3HKBE 4EYYR 3AT7A 4ADZA 1US7B 5LGNB 2WWUA 2XASB 4CXYA 5JRCB 4CXXA 3O1HA 4I43B 2LE8A 5DQVA 3RH3A 4KBMB 1OXZA 2ACXA 2JJ9A 4ILUA 2WSSV 2EHOA 3ZYKA 2MTQA 1CUNA 2PJQA 3AA1B 4JLEA 5HWXA 2XHEB 3C4XA 4Z8XA 2JMKA 4H9OC 4PK4A 5IYZE 5L3GB 1SHZC 4ISSA 1HFAA 2LM9A 4FI5A 1EZ3A 3K3QC 5JH7E 3QK6A 2X66A 3E22E 3N2KE 4UF0B 4YLHA 2XAHB 3I0QA 1WR6A 3N9MA 4MLKA 1S35A 1HCIA 3EVYA 3VKHA 4TZ4C 2XAFB 4CI3B 3RYFE 3KBTA 5J2UE 5HYAA 1S94A 2X68A 2DWKA 2C5JA 4QXBB 4IHJE 4TV8E 4X20E 2DI4A 3OBVE 3IBPA 4U72A 4YHJA 3CX7B 3EDUA 2A72A 1AJ3A 4AKHA 2VK9A 2L9QA 3ZYLA 1IJ6A 5LBQB 4N78D 3AVRA 3M65A 2LSIA 5L3EB 5CA1E 1H7CA 2CA5A 3PUSA 1X79A 2MBGA 4ZHQE 3PTRB 4J2CA 3OYXA 1ZEEA 3OKQA 3T8OA 3ZN0B 5LOVE 3CX6B 4ZI7E 2NP9A 3ANWA 2LQUA 2KWHA 3R6NA 4PW8A 2VKHA 4HTEA 4BGOA 4HN9A 5JDGA 4CQIA 3K3OA 2XAJB 3RKOA 2I59A 2E9XB 2X67A 5JDHA 2CMRA 2X9YA 1HG2A 3K8PC 1SA0E 4PJNA 4K0UA 5JVDE 1U5PA 4H9RC 4WNKA 1HS7A 2H3RA 2HPJA 5J1GA 4E7SA 3PDYA 2KWIB 2Q9QA 4OYJA 3AA0B 3MZKB 3UTKA 2BDEA 2MOZA 1LRZA 1LVKA 3AAEB 2YK0A 2E8IA 2XQYA 3FBZA 1D1BA 2HPLA 4IE5A 4H9NC 1Y64B 4C91A 1MIVA 3KBUA 3I9YA 3ZMVB 5JRCA 4YFSA 4G63A 1YKEB 1NAFA 3ZYMA 5L3FB 5HXHA 2DLRA 3N9LA 2DWGA 4TV9E 4OHFA 4H9PC 3LJCA 2W63A 3N9PA 3Q9DA 4MBQA 3MK7C 1QUUA 3ZMUB 5JREA 5LXTE 3H3AA 3WURA 3ZLIA 5LBMA 5LJNA 4QX7B 2Z6EA 3LK2B 2Y8DA 3ZPOA 3C64A 4EXTA 4H9QC 2DNXA 2ZLYA 1BR4A 3C50A 4UF0A 4CZZB 3KFWX 3V5SA 4QX8B 1U4QA 5ADXL 3DTOA 2KZ7B 5ETWA 4ISTA 4AKLA 2YINA 5FXWA 5JDLA 2PFVA 2LT3A 3IHRA 5AFUL 2ZM0A 5C8YE 1BR0A 1ZV4X 2HH7A 3PE0A 4EYUA 2CE7A 3O1JA 2VWAA 3KV4A 4PNIA 2DCFA 2E9XC 3UUXB 5L3CB 3GWHA 3FB2A 2PG8A 3TKLB 2IAKA 3JC6C 5BMVE 5LNKA 2KLQA 5FY1A 3CWZB 4U74A 3QC9A 3NRYA 3BK9A 3JC6D 1MMNA 4UELA 3ZEFB 3OJAA 4UV8B 3B13A 5GONE 3VU7H 3RX6A 2CXLA 4WBNE 1UX4A 4AQGA 5LYJE 1Z0PA 5FP3A 1ZKEA 1MMGA 2G0UA 3Q2MA 4ONRA 2XUEA 3PUAA 1FEWA 4HGAA 1BR1A 5A1LA 3FXEB 5LA6E 4DMWA 4ANJA 1MNDA 2VKJA 3O1IA 2W61A 3K3NA 4CI2B 4EIWA 1ZHCA 3GN5B 3RRWA 4YJ2E 4IGUA 4EB6E 4ZI3C 4O4JE 1IZNB 4PK6A 2LSKA 2YU1A 3KINB 2K5BB 3MXZA 3Q5WA 1KNZA 5FYMA 3L3PA 5CB4E 3W15B 4ZI3D 2RA1A 3H37A 4MFRA 3BQKA 3WSCA 1YW0A 4AI6A 1VRBA 5FY7A 4QHOA 5HXCA 3IEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDN A;  5HYA A;  3V5U A;  5HWY A;  5JDH A;  5JDL A;  5JDF A;  5HXS A;  5HXE A;  5JDM A;  5HXR A;  3V5S A;  5HXH A;  5HXC A;  5JDG A;  5JDQ A;  5HWX A; 
#chains in the Genus database with same CATH topology
 2MYS A;  4U7Y A;  3AXJ A;  3MJX A;  1XZY A;  3ONL C;  2W00 A;  3UQ7 A;  3AEE A;  4AXP A;  1XMQ T;  4HE8 A;  3P4R A;  1D0Y A;  3ZC0 A;  2LSJ A;  4B3S T;  3AAI A;  2BBJ A;  3QB5 A;  4U3C A;  4EZ4 A;  4HFI A;  2LHR A;  4AKR B;  2MPK A;  3AE6 A;  1OED E;  2IDO B;  3ETU A;  3OYZ A;  3AE1 A;  4LF5 T;  2BKO A;  4XAX B;  3FZL B;  2AE9 A;  4ZZB A;  4EOZ B;  3ZKR A;  3KVA A;  3PF0 A;  2V6Y B;  3SRZ A;  2XQ4 A;  5FNV E;  2ES0 A;  4DVD A;  3QOF A;  2V26 A;  3ZT7 A;  4HFV A;  4U2Z A;  2XZE A;  3H3M A;  3SS1 A;  2XM1 A;  3EAM A;  5C3J A;  2LOS A;  4JYA T;  3HI2 A;  4LFC T;  4QH5 A;  1T98 A;  4KUM B;  3TLU A;  2WB5 A;  3ZJ1 A;  2IC9 A;  5KX5 E;  4DID B;  4UR9 A;  4X1Y E;  2DHR A;  3PU8 A;  4YSY A;  2Y6X A;  5LP6 E;  2L8K A;  3PHF 1;  3CQC B;  3FZH B;  4UVC B;  4HFD A;  1XNR T;  2D0U A;  1HX1 B;  1HNX T;  3AED A;  3HKC E;  4V1A v;  3VR8 A;  4IDZ A;  5JR9 B;  4DR6 T;  3T1H T;  3A8Y C;  2CWY A;  4XBF B;  4JEU B;  4IDQ A;  1WRD A;  4PJL A;  4YT0 A;  1YXR A;  2JQQ A;  2PTF A;  3LK4 2;  5LB7 B;  5AQT B;  5FXX A;  1D0X A;  2XQ8 A;  2YU2 A;  4ZS2 A;  2FBW A;  5ABE A;  3UUN A;  4TWF A;  1J1J A;  2VKD A;  5HWY A;  3KDS E;  2H7V C;  3RRC A;  2W66 A;  2X9H A;  4HFH A;  5LHG B;  2NWB A;  3C98 B;  3KV6 A;  4DV6 T;  1IJ5 A;  5ABF A;  2BKN A;  2NOX A;  4TWD A;  3RLF F;  4WW0 A;  1DU2 A;  3RIU C;  5HXE A;  1W9R A;  4OK0 A;  4LF9 T;  1IAP A;  2CWO A;  4DBQ A;  2I0M A;  1V9D A;  2QRX A;  2WDR A;  3A5X A;  3KVB A;  5AQK B;  4CN1 A;  4ERR A;  5LHH B;  2RP4 A;  5AQF B;  2CPT A;  5IHY A;  4IRE A;  2X51 A;  5JR9 A;  4LF6 T;  1JNR A;  2W4X A;  2D5U A;  3HR0 A;  3ZMT B;  2XY8 B;  3UT5 E;  4KHZ F;  3RI5 A;  5HEU A;  2NW9 A;  2N1G A;  1SJ7 A;  2MTC A;  1SE7 A;  3FHN A;  4O2B E;  4OYK A;  1T72 A;  3UU5 A;  4DMV A;  3MA9 A;  3N2O A;  3P7I A;  2JPF A;  2K24 A;  4I50 E;  4X66 T;  2CCQ A;  5LG4 A;  1NWM X;  3AT7 A;  3HKB E;  4ADZ A;  3ONJ A;  2WWU A;  4CXY A;  5JRC B;  3O1H A;  2LE8 A;  3RH3 A;  4KBM B;  1IBK T;  4HWC A;  3AE7 A;  5L3G B;  1SHZ C;  1HFA A;  2LM9 A;  4FI5 A;  2X66 A;  3E22 E;  4EEB A;  1JNZ A;  3I0Q A;  3VRB A;  3KBT A;  3NVO A;  2X68 A;  4IHJ E;  2A72 A;  4AKH A;  1IJ6 A;  4N78 D;  4X65 T;  3M65 A;  2LSI A;  5CA1 E;  1X79 A;  2MBG A;  4ZHQ E;  3OYX A;  3T8O A;  3ZN0 B;  2KWH A;  4IL9 A;  2VKH A;  4HTE A;  2CMR A;  3DYJ A;  2YDR A;  1SA0 E;  4PJN A;  5JVD E;  2UUC T;  4WNK A;  1HS7 A;  2UUA T;  2Q9Q A;  2BDE A;  5CGM A;  1LRZ A;  4TWH A;  2YK0 A;  2XQY A;  3FBZ A;  3T1Y T;  2HPL A;  1UUS A;  1HNZ T;  1XNQ T;  1MIV A;  5JRC A;  1YKE B;  3UU8 A;  1W0B A;  3ZYM A;  2DLR A;  4Q25 A;  4MBQ A;  3MK7 C;  3ZMU B;  5AQR B;  3ZLI A;  5LJN A;  4DR3 T;  2Y8D A;  3PUZ F;  3P50 A;  1I6Z A;  4U2Y A;  3L39 A;  3C50 A;  4CN6 A;  3ZST A;  2KZ7 B;  5ETW A;  2ZM0 A;  2LM2 A;  1IBL T;  3UUX B;  5L3C B;  3FB2 A;  3TKL B;  5LNK A;  2KLQ A;  3QC9 A;  3NRY A;  3P4Q A;  4UEL A;  3OJA A;  2V6X A;  2CXL A;  4WBN E;  1Z0P A;  1N34 T;  4YTP A;  3Q5D A;  4TNV A;  2G0U A;  4HGA A;  5LA6 E;  4DMW A;  2VKJ A;  3FZM B;  1ZHC A;  4A97 A;  1NEN A;  2JQH A;  2K5B B;  2W67 A;  4MFR A;  3WSC A;  3IEE A;  3RYH E;  3LDQ B;  4MHC A;  2VB6 A;  2WMN A;  3RIF A;  2VKO A;  2D0T A;  2ZM8 A;  3FXD B;  4BA9 A;  2CBI A;  4G2A A;  4PFP A;  3AE2 A;  2IW5 B;  2LSY A;  3F57 A;  3HL6 A;  4DO0 A;  4IIJ E;  2CBJ A;  3SOL A;  2VQE T;  4B3R T;  2QGS A;  5DQW A;  1YQ3 A;  5J2T E;  5ABG A;  5TAO A;  3G06 A;  1XDO A;  4DBR A;  1HX8 A;  2WM9 A;  4O4I E;  1E1H B;  2KMF A;  2JIW A;  3NWI A;  4EED A;  2XAQ B;  3WAJ A;  1XMO T;  5IUX A;  4PK5 A;  4OX9 T;  4BJN A;  5F3J A;  4AIU A;  4CXW A;  2CEA A;  1HR0 T;  4JI8 T;  2ZMA A;  1Y01 A;  5CA0 E;  2BS2 A;  2CM0 A;  5T1D A;  1WCR A;  3V5U A;  4COF A;  4JI3 T;  3UUL A;  1MIW A;  5AQN B;  2D2S A;  4KI0 F;  3CKD A;  2CRB A;  4QXC B;  3RQW A;  1VCS A;  1MMD A;  3ANW B;  4PFO A;  3O9X A;  2FJB A;  4P0B A;  1HG5 A;  3GA8 A;  1O3X A;  5HEH A;  3RQU A;  2WU5 A;  5L3B B;  2OLT A;  4LFA T;  3AEA A;  3HKE E;  2JQK A;  2WBL A;  3EI0 A;  4JEH B;  3TLV A;  4HFC A;  1KEY A;  4L5G A;  3QNU A;  2M6I A;  3LG7 A;  5J0Z A;  2YN6 A;  3RGL A;  3B5M A;  4UV9 B;  1LKX A;  2FJE A;  4KMC A;  1G8X A;  4BJM A;  2IUB A;  4EZH A;  2M6B A;  4EAH A;  3UFE A;  3ABV A;  1MNE A;  4UIG A;  1B7T A;  4GIW A;  3GMI A;  2BG9 E;  2UXN B;  3NZP A;  3L09 A;  3AB3 B;  2CHN A;  4TX5 A;  1WYB A;  1KK7 A;  2BG9 B;  3ZJ2 A;  5BR8 T;  2LOP A;  1OED B;  4MAL A;  5JDQ A;  4AIS A;  2IHR 1;  5AQM B;  4FJO A;  5HCM A;  3A7M A;  4ILC A;  5JDN A;  3P4W A;  5H6R B;  4ILA A;  3VR9 A;  1YKH B;  2LHN A;  4DV2 T;  4IE0 A;  2YDS A;  4GK0 E;  3UQ4 A;  3EUH A;  5FY0 A;  4F7G B;  4PJM A;  4QH1 A;  2KND A;  4TN7 B;  3PJA J;  3C4W A;  2A2F X;  5DAB A;  3LFM A;  3PUV F;  3ONX A;  4JI5 T;  2JQ9 A;  4QH4 A;  1WFD A;  2F4V T;  2XJ7 A;  3Q5E A;  5AQS B;  2WP9 A;  1ZOY A;  5JTG A;  1NEK A;  3AA7 B;  1HTJ F;  4O4L E;  2BG9 C;  4L9I A;  5DJQ C;  4EYY R;  2BZB A;  1OED C;  1US7 B;  2XAS B;  4I43 B;  5DQV A;  3AE8 A;  2JJ9 A;  4ILU A;  1CUN A;  5HWX A;  2XQ3 A;  5FL1 A;  3CK6 A;  4JI1 T;  4H9O C;  2YKS A;  4ISS A;  3K3Q C;  1OED A;  2VVS A;  2V6Y A;  4UF0 B;  4YXD A;  1WR6 A;  3N9M A;  2XAF B;  4CI3 B;  2ACZ A;  4QXB B;  4X20 E;  3AVR A;  1H7C A;  2CA5 A;  2VUR A;  3OKQ A;  5LOV E;  4ZI7 E;  2LQU A;  4PW8 A;  4BGO A;  5JDG A;  2I59 A;  2E9X B;  1HG2 A;  4I0U A;  2IIU A;  4DR2 T;  5J1G A;  2UXD T;  3PDY A;  3AE9 A;  3AA0 B;  3MZK B;  3UTK A;  2RPA A;  1LVK A;  2E8I A;  1D1B A;  2HN2 A;  2V5D A;  4H9N C;  3I9Y A;  3ZMV B;  3RIU A;  4OHF A;  4H9P C;  1FJG T;  3SFD A;  5JRE A;  1UGO A;  5LBM A;  2V8S V;  4QX7 B;  2L10 A;  2DNX A;  4EGW A;  4DV1 T;  2ZLY A;  4UF0 A;  4QX8 B;  3DTO A;  4IST A;  4AKL A;  5JDL A;  2LT3 A;  2B76 A;  5C8Y E;  2XQA A;  1BR0 A;  4EYU A;  3OPC A;  3O1J A;  4PNI A;  2E9X C;  3GWH A;  5CJ5 A;  2PG8 A;  2IAK A;  3JC6 C;  4U74 A;  5FZT A;  3BK9 A;  3JC6 D;  1MMN A;  3ZEF B;  5GON E;  3VU7 H;  1N36 T;  3RX6 A;  4AQG A;  1ZKE A;  1MMG A;  3JAE A;  4ZI3 C;  2LSK A;  2YU1 A;  3Q5W A;  1KNZ A;  4ZI3 D;  3L3P A;  3ZT5 A;  3H37 A;  5HXC A;  2N9D A;  3RYC E;  4QWN B;  2XPK A;  2L7N A;  4DND A;  5LCY A;  4WZX A;  4C90 A;  4UXN B;  4JUY A;  4QXH B;  3ZT6 A;  1KNR A;  1HF8 A;  2KSR A;  4LF8 T;  3WI3 A;  4Z90 A;  3S4U A;  2V7L A;  1W0A A;  4XZC A;  2UXX B;  4NUV A;  4LF7 T;  3RIA A;  2LLY A;  2X0C A;  3O4X E;  2QA7 A;  2N2N A;  2V7M A;  2YDQ A;  4GKK T;  4TUY E;  4IDO A;  4F8H A;  3DJB A;  3ESL A;  3TLS A;  4GYS A;  4DR7 T;  3PUR A;  3I1A A;  3PUW F;  4AQF C;  2A9U A;  3N9Q A;  5F8P A;  4KHP T;  5LHI B;  1LVF A;  2EHO B;  3CQG B;  5FXZ A;  4E7Z A;  2XQ7 A;  4JI6 T;  2UXB T;  1MIY A;  1WLX A;  2WCA A;  4DV7 T;  2H89 A;  3N9O A;  3P4P A;  4DV5 T;  4JI0 T;  4AKI A;  2Y48 B;  2V7I A;  1KFY A;  3ZCJ A;  5FL0 A;  4JI7 T;  5ABH A;  4YHH T;  5L47 A;  3EHZ A;  2BS3 A;  4H63 H;  3DP7 A;  5KDM C;  2KXP B;  4P1N A;  2NW8 A;  4NIQ A;  2IML A;  4P0A A;  2XTL A;  3UU4 A;  3AE3 A;  2C5I T;  3UU6 A;  5AQP B;  1UUR A;  3JAD A;  3VKG A;  3QUJ A;  1XWM A;  3OTO T;  4DR5 T;  2EHO C;  2C0S A;  5JDM A;  2EHO D;  2W2U A;  5L4E A;  4NUU A;  2OV9 A;  3F2E A;  4KX6 A;  3AAA B;  5M4Y A;  5JQG E;  3N5L A;  3MKD A;  2UXC T;  4GOU A;  2V7J A;  2NTY A;  4IE6 A;  1J5W A;  3OVU A;  2W62 A;  3CPZ A;  4NXN T;  1OWA A;  5LGU B;  2X0Y A;  5AQV B;  3N9N A;  4X1K E;  1QSD A;  3PV0 F;  2VL8 A;  5AQU B;  2CXD A;  3J9X 1;  5AQH B;  2XQ5 A;  2CLY B;  3CX8 B;  4A56 A;  3NZQ A;  4ZS3 A;  3IA3 A;  3QB5 K;  2AXD S;  2BVM A;  1L0V A;  2YOE A;  2QYW A;  1ZP0 A;  5AQJ B;  4LML A;  2NW7 A;  4X64 T;  3RC3 A;  2XSA A;  3C51 A;  5FVK A;  3RKG A;  5HXS A;  2B1E A;  4HEA A;  2WQY A;  3U78 A;  4HWI B;  2WZI A;  1UX5 A;  4WBO A;  3TLW A;  3I0O A;  1FIO A;  4DR4 T;  2LJL A;  2X9W A;  2CLY C;  4X1I E;  5CFB A;  1XDP A;  2W0G A;  3ZMS B;  2V7K A;  2J62 A;  5E0O A;  5FXV A;  4ZI2 C;  1W09 A;  4ZI2 D;  4GK5 E;  4NPP A;  4H9S E;  3NBX X;  3PUX F;  3AVS A;  3ZMZ B;  3RPU A;  4U33 A;  1UK5 A;  5LJM A;  3EDV A;  3PU3 A;  2ZM2 A;  4CI1 B;  5L2L A;  1CHU A;  1G73 A;  2KT9 A;  1KF6 A;  2FJA A;  2OA5 A;  3I9W A;  2K9A A;  3AEF A;  3UUM A;  5HXR A;  1J5E T;  2ODV A;  1KNP A;  5LGN B;  4NXM T;  2VVN A;  3AE4 A;  2WSS V;  3ZYK A;  2MTQ A;  3AA1 B;  4JLE A;  3C4X A;  4PK4 A;  5IYZ E;  5JH7 E;  3QK6 A;  3EAB A;  4YLH A;  4MLK A;  1HCI A;  3M3Z B;  3RF1 A;  3VKH A;  3JCF A;  3RYF E;  5HYA A;  5AQI B;  2C5J A;  4TV8 E;  3OBV E;  3IBP A;  4U72 A;  3CX7 B;  2XQ6 A;  5LBQ B;  3UUB A;  5L3E B;  3PUS A;  2BBH A;  4J2C A;  4DUZ T;  3CX6 B;  3ANW A;  4HFB A;  4HN9 A;  3FYQ A;  4CQI A;  1VCT A;  3K3O A;  2X67 A;  2X9Y A;  4K0U A;  1U5P A;  1I94 T;  2QVA A;  4JI4 T;  4H9R C;  2H3R A;  2BS4 A;  5LMN T;  2KWI B;  2UU9 T;  4OYJ A;  3AE5 A;  2MOZ A;  4YTN A;  3AAE B;  5HCJ A;  2VL0 A;  2ZM6 T;  5C2T A;  3UFG A;  2FJD A;  4YTM A;  4HWH A;  4C91 A;  4YFS A;  1NAF A;  5L3F B;  3N9L A;  2DWG A;  3LJC A;  2E2A A;  5LXT E;  3WUR A;  3LK2 B;  3ZPO A;  4H9Q C;  1BR4 A;  4DR1 T;  1N32 T;  3V5S A;  4JV5 T;  2YIN A;  3AEG A;  5AFU L;  2CE7 A;  2VWA A;  3KV4 A;  2WS3 A;  5FY1 A;  3CWZ B;  3PUY F;  2E5V A;  4UV8 B;  5ABF B;  2V5C A;  3FZF B;  5LYJ E;  4EV6 A;  3Q2M A;  2XUE A;  4LF4 T;  1BR1 A;  5A1L A;  3FXE B;  5HEJ A;  1IBM T;  1MND A;  3O1I A;  2W61 A;  4EIW A;  4A5X A;  3GN5 B;  4YY3 T;  4YJ2 E;  4IGU A;  4EB6 E;  4O4J E;  1IZN B;  2BG9 A;  3MXZ A;  5CB4 E;  1YW0 A;  1VRB A;  5FY7 A;  4QHO A;  2K3W A;  1YQ4 A;  3IF8 B;  5LMU T;  5FKY A;  4YSX A;  3NRX A;  4ZOL E;  2GK9 A;  1VOM A;  5HEO A;  4AKG A;  3E0Z A;  4UVA B;  2PBI A;  4PJJ A;  2SPC A;  3PUG A;  4I4T E;  3CQX C;  2LKG A;  4F6R C;  1T8B A;  2WWV A;  1UCU A;  4X5T A;  2CHO A;  5HAX A;  5EK2 A;  1FMW A;  3KV5 A;  3VRA A;  4ZXL A;  4X62 T;  5FMN A;  2A3D A;  4BAY B;  2WAU A;  1FMV A;  4B6X A;  2D9D A;  5KMG P;  3FBL A;  5JR9 C;  2FUP A;  4IE4 A;  3GN5 A;  4B3T T;  1M62 A;  2C5K T;  3ZCI A;  5L3D B;  2XQ9 A;  2I6H A;  1M7K A;  4HWD A;  3LK3 B;  3RC8 A;  1SUM B;  1R8I A;  4UEM A;  3KV9 A;  3SFE A;  2E9X D;  4IT4 A;  2JRK A;  5H6Q B;  3BQL A;  4LFB T;  1N33 T;  1X9B A;  3AA6 B;  2LKH A;  4ILB A;  2XSB A;  3C4Z A;  3R84 B;  3F31 A;  2E9X A;  2Q9Q B;  4PAG A;  4O2A E;  2K48 A;  4KP3 C;  3X1D A;  5EK3 A;  3ZC1 A;  2WDV A;  2E5L T;  2VAS A;  4UVB B;  3UU3 A;  4IE7 A;  4AQY T;  4HWF A;  3PJA A;  4Z91 A;  3VJZ A;  5AQL B;  2LSG A;  2V1D B;  4I55 E;  3BQI A;  5LGT B;  5IWA T;  2NR4 A;  4IDP A;  3HKD E;  3PUQ A;  4YJ3 E;  4GYR A;  5LG3 A;  4L0R A;  2L3L A;  2IC6 A;  1D1C A;  1D1A A;  3L8R A;  2J47 A;  1MMA A;  2ODU A;  3J7Y q;  3LBX B;  4M1P A;  3CVR A;  2HHH T;  4O8S A;  4W8P A;  2H7O A;  3SWH A;  3HA4 A;  2WDQ A;  4HKA A;  2KVP A;  2LRL A;  4U7I A;  4ASK A;  3U3I A;  3AEB A;  5JDF A;  3D0T A;  3VHL A;  2Q9Q C;  3E08 A;  2Q9Q D;  3CML A;  3Q5X A;  3LSV A;  1D0Z A;  5EK4 A;  4DV4 T;  4ZEY A;  5FVL A;  3M1C A;  1E7P A;  2WU2 A;  2KBB A;  4QKN A;  4P09 A;  1GQE A;  1BR2 A;  1YD8 G;  2KIN B;  4CN4 A;  3RYI E;  2WY2 A;  2UUB T;  4AQF A;  1SJ8 A;  3ETV A;  3ZN1 B;  2NTX A;  2BVL A;  1QLB A;  1WYC A;  2M67 A;  2YEV C;  2X0L B;  3B57 A;  3TLT A;  3WAK A;  2P9B A;  1E2A A;  5EZY E;  2J1D G;  3MAC A;  2X9X A;  4DV0 T;  2JMH A;  4GKJ T;  1T7S A;  4ECG A;  4OFZ A;  3P8C D;  3FZK B;  2XAG B;  3LBX A;  4YSZ A;  4O4H E;  4H63 V;  2X0H A;  2WMO A;  5L4H A;  4ZZC A;  2LEH A;  2CXF A;  4K0K T;  3N2G E;  1HNW T;  3RHW A;  4DV3 T;  2BKP A;  3K1S A;  4CXX A;  1OXZ A;  2ACX A;  2EHO A;  4B3M T;  2PJQ A;  2DL1 A;  2XHE B;  4Z8X A;  5AQO B;  2HN1 A;  2JMK A;  2XM2 A;  2J4G A;  1EZ3 A;  5F5W A;  3N2K E;  2XAH B;  5AQQ B;  1S35 A;  3EVY A;  4TZ4 C;  5J2U E;  1S94 A;  3AY5 A;  4DUY T;  2DWK A;  2DI4 A;  4YHJ A;  3EDU A;  2MAW A;  1AJ3 A;  2VK9 A;  2L9Q A;  3ZYL A;  3PTR B;  5AQG B;  1ZEE A;  2NP9 A;  3ZSS A;  3R6N A;  2XAJ B;  3RKO A;  4U31 A;  4HFE A;  5JDH A;  3K8P C;  2HPJ A;  4TNW A;  4E7S A;  2VQF T;  4IL4 A;  4IDN A;  4IE5 A;  3AXJ B;  1Y64 B;  3KBU A;  4G63 A;  5HXH A;  4TV9 E;  2R6G F;  2W63 A;  3AEC A;  3N9P A;  3Q9D A;  1QUU A;  3JAF A;  2WZH A;  3H3A A;  5KXJ A;  2Z6E A;  3C64 A;  4EXT A;  4WYV A;  4CZZ B;  4JI2 T;  3KFW X;  1U4Q A;  5ADX L;  4JBW F;  1Z8U A;  5FXW A;  2PFV A;  3IHR A;  5HEG A;  1ZV4 X;  2HH7 A;  3PE0 A;  2DCF A;  5BMV E;  2H88 A;  4LMK A;  3B13 A;  1WR0 A;  1UX4 A;  5FP3 A;  3CIR A;  3NKZ A;  4ONR A;  3PUA A;  1FEW A;  4A98 A;  4LMJ A;  4ANJ A;  2KGX A;  3K3N A;  4CI2 B;  3RRW A;  3P4S A;  2LRK A;  4PK6 A;  3KIN B;  5FYM A;  3W15 B;  2RA1 A;  3BQK A;  4AI6 A; 
#chains in the Genus database with same CATH homology
 2MYS A;  2N9D A;  3IF8 B;  3RYH E;  4MHC A;  3RYC E;  4QWN B;  4DND A;  2VB6 A;  3NRX A;  4ZOL E;  5LCY A;  2WMN A;  4C90 A;  2VKO A;  2D0T A;  4JUY A;  2ZM8 A;  4QXH B;  4UXN B;  2GK9 A;  1HF8 A;  3MJX A;  3FXD B;  1VOM A;  3WI3 A;  4BA9 A;  2W00 A;  4AKG A;  3S4U A;  4G2A A;  2V7L A;  4AXP A;  4PFP A;  3E0Z A;  4HE8 A;  2IW5 B;  2LSY A;  4XZC A;  3F57 A;  2UXX B;  3HL6 A;  4DO0 A;  4NUV A;  4UVA B;  4IIJ E;  1D0Y A;  3ZC0 A;  2PBI A;  4PJJ A;  2SPC A;  2LSJ A;  3SOL A;  3O4X E;  2QA7 A;  2QGS A;  3AAI A;  5DQW A;  3PUG A;  2N2N A;  4I4T E;  5J2T E;  2V7M A;  5TAO A;  3CQX C;  4EZ4 A;  4DBR A;  1HX8 A;  2WM9 A;  4O4I E;  4TUY E;  1E1H B;  2LHR A;  2KMF A;  4F6R C;  3DJB A;  4AKR B;  3ESL A;  2XAQ B;  4GYS A;  3WAJ A;  1UCU A;  3PUR A;  3I1A A;  5HAX A;  4AQF C;  3ETU A;  3N9Q A;  5F8P A;  5EK2 A;  5LHI B;  1FMW A;  4PK5 A;  3OYZ A;  3KV5 A;  1LVF A;  4BJN A;  2EHO B;  4XAX B;  3CQG B;  5FXZ A;  4E7Z A;  5F3J A;  5FMN A;  2A3D A;  4BAY B;  2WAU A;  1FMV A;  4B6X A;  4EOZ B;  5KMG P;  3FBL A;  5JR9 C;  3KVA A;  4CXW A;  4IE4 A;  3PF0 A;  1MIY A;  1WLX A;  2CEA A;  3GN5 A;  3SRZ A;  2ZMA A;  3N9O A;  2C5K T;  3ZCI A;  5CA0 E;  5FNV E;  5L3D B;  2CM0 A;  5T1D A;  4AKI A;  2ES0 A;  4DVD A;  2Y48 B;  2V7I A;  2V26 A;  3ZCJ A;  4HFV A;  3V5U A;  3LK3 B;  3SS1 A;  3RC8 A;  2LOS A;  3HI2 A;  3UUL A;  1MIW A;  2D2S A;  4H63 H;  3DP7 A;  5KDM C;  3CKD A;  1T98 A;  2KXP B;  4KUM B;  4UEM A;  4QXC B;  2NW8 A;  3KV9 A;  2E9X D;  1MMD A;  2JRK A;  3ANW B;  5H6Q B;  4P0A A;  4PFO A;  3ZJ1 A;  3O9X A;  2XTL A;  4P0B A;  3BQL A;  1HG5 A;  3GA8 A;  3AA6 B;  2IC9 A;  1O3X A;  5KX5 E;  2C5I T;  4X1Y E;  3C4Z A;  2DHR A;  3PU8 A;  2Y6X A;  3R84 B;  3VKG A;  3QUJ A;  3F31 A;  5L3B B;  5LP6 E;  2L8K A;  2E9X A;  2EHO C;  2Q9Q B;  2C0S A;  4PAG A;  5JDM A;  4O2A E;  2EHO D;  3PHF 1;  3CQC B;  2K48 A;  4KP3 C;  4UVC B;  3HKE E;  2WBL A;  4JEH B;  4NUU A;  5EK3 A;  3ZC1 A;  3F2E A;  2D0U A;  2VAS A;  3AAA B;  4UVB B;  5M4Y A;  5JQG E;  4IE7 A;  3HKC E;  3N5L A;  3MKD A;  4L5G A;  4V1A v;  3VJZ A;  2LSG A;  4GOU A;  2V1D B;  2V7J A;  4I55 E;  3LG7 A;  2NTY A;  3BQI A;  4IE6 A;  5LGT B;  2W62 A;  4IDZ A;  3HKD E;  3PUQ A;  4YJ3 E;  5JR9 B;  4GYR A;  3CPZ A;  4L0R A;  1OWA A;  5LGU B;  2L3L A;  2IC6 A;  1D1C A;  3N9N A;  4UV9 B;  1LKX A;  1D1A A;  1QSD A;  4X1K E;  2VL8 A;  2CWY A;  2CXD A;  3J9X 1;  4XBF B;  4JEU B;  4PJL A;  1WRD A;  1MMA A;  4KMC A;  2CLY B;  2ODU A;  3CX8 B;  1G8X A;  3J7Y q;  3LK4 2;  2JQQ A;  3CVR A;  3LBX B;  3NZQ A;  4M1P A;  4A56 A;  4BJM A;  4O8S A;  5FXX A;  4ZS3 A;  1D0X A;  4EZH A;  2YU2 A;  4ZS2 A;  2H7O A;  3SWH A;  3HA4 A;  4EAH A;  3UUN A;  4HKA A;  2VKD A;  5HWY A;  2BVM A;  3UFE A;  4ASK A;  3KDS E;  3U3I A;  1MNE A;  2NW7 A;  4UIG A;  5JDF A;  2H7V C;  1B7T A;  3RRC A;  3D0T A;  3RC3 A;  4GIW A;  3GMI A;  3C51 A;  2X9H A;  3VHL A;  5HXS A;  2Q9Q C;  2B1E A;  4HEA A;  5LHG B;  3E08 A;  2Q9Q D;  2NWB A;  2UXN B;  3NZP A;  3U78 A;  3C98 B;  3KV6 A;  3CML A;  1IJ5 A;  3L09 A;  3Q5X A;  3AB3 B;  1D0Z A;  2NOX A;  4TX5 A;  5EK4 A;  3M1C A;  1WYB A;  1KK7 A;  3ZJ2 A;  4QKN A;  4WW0 A;  1UX5 A;  5HXE A;  4P09 A;  4WBO A;  1BR2 A;  2LOP A;  4OK0 A;  1YD8 G;  2KIN B;  4MAL A;  5JDQ A;  3RYI E;  1IAP A;  3I0O A;  2CWO A;  1FIO A;  4AQF A;  4FJO A;  4DBQ A;  1V9D A;  3A5X A;  2LJL A;  3ETV A;  2X9W A;  2NTX A;  3KVB A;  3ZN1 B;  2BVL A;  2CLY C;  4X1I E;  4ERR A;  1WYC A;  5JDN A;  2M67 A;  2W0G A;  2YEV C;  2RP4 A;  3ZMS B;  5LHH B;  2X0L B;  3B57 A;  2V7K A;  5IHY A;  5H6R B;  3WAK A;  2P9B A;  2X51 A;  5JR9 A;  5EZY E;  2J1D G;  3MAC A;  5E0O A;  2D5U A;  3HR0 A;  3ZMT B;  1YKH B;  5FXV A;  4ZI2 C;  2LHN A;  2X9X A;  3UT5 E;  4ZI2 D;  2JMH A;  4GK5 E;  4IE0 A;  4GK0 E;  2NW9 A;  4H9S E;  4ECG A;  3NBX X;  4OFZ A;  3EUH A;  5FY0 A;  3AVS A;  3P8C D;  4PJM A;  3ZMZ B;  2KND A;  3RPU A;  2XAG B;  4TN7 B;  3LBX A;  4O4H E;  2N1G A;  5LJM A;  3C4W A;  2MTC A;  3EDV A;  4H63 V;  2A2F X;  5DAB A;  3LFM A;  3PU3 A;  3FHN A;  3ONX A;  4O2B E;  4OYK A;  2ZM2 A;  4CI1 B;  5L2L A;  2WMO A;  1G73 A;  4DMV A;  3MA9 A;  2KT9 A;  2LEH A;  3N2O A;  3P7I A;  2CXF A;  2JPF A;  3N2G E;  3AA7 B;  2K24 A;  1HTJ F;  4O4L E;  2OA5 A;  3I9W A;  2K9A A;  4I50 E;  3UUM A;  5HXR A;  2CCQ A;  5LG4 A;  1NWM X;  2ODV A;  4L9I A;  5DJQ C;  2BZB A;  3HKB E;  4EYY R;  3AT7 A;  4ADZ A;  1US7 B;  5LGN B;  2WWU A;  2XAS B;  4CXY A;  5JRC B;  4CXX A;  3O1H A;  4I43 B;  2LE8 A;  5DQV A;  3RH3 A;  4KBM B;  1OXZ A;  2ACX A;  2JJ9 A;  4ILU A;  2WSS V;  2EHO A;  3ZYK A;  2MTQ A;  1CUN A;  2PJQ A;  3AA1 B;  4JLE A;  5HWX A;  2XHE B;  3C4X A;  4Z8X A;  2JMK A;  4H9O C;  4PK4 A;  5IYZ E;  5L3G B;  1SHZ C;  4ISS A;  1HFA A;  2LM9 A;  4FI5 A;  1EZ3 A;  3K3Q C;  5JH7 E;  3QK6 A;  2X66 A;  3E22 E;  3N2K E;  4UF0 B;  4YLH A;  2XAH B;  3I0Q A;  1WR6 A;  3N9M A;  4MLK A;  1S35 A;  1HCI A;  3EVY A;  3VKH A;  4TZ4 C;  2XAF B;  4CI3 B;  3RYF E;  3KBT A;  5J2U E;  5HYA A;  1S94 A;  2X68 A;  2DWK A;  2C5J A;  4QXB B;  4IHJ E;  4TV8 E;  4X20 E;  2DI4 A;  3OBV E;  3IBP A;  4U72 A;  4YHJ A;  3CX7 B;  3EDU A;  2A72 A;  1AJ3 A;  4AKH A;  2VK9 A;  2L9Q A;  3ZYL A;  1IJ6 A;  5LBQ B;  4N78 D;  3AVR A;  3M65 A;  2LSI A;  5L3E B;  5CA1 E;  1H7C A;  2CA5 A;  3PUS A;  1X79 A;  2MBG A;  4ZHQ E;  3PTR B;  4J2C A;  3OYX A;  1ZEE A;  3OKQ A;  3T8O A;  3ZN0 B;  5LOV E;  3CX6 B;  4ZI7 E;  2NP9 A;  3ANW A;  2LQU A;  2KWH A;  3R6N A;  4PW8 A;  2VKH A;  4HTE A;  4BGO A;  4HN9 A;  5JDG A;  4CQI A;  3K3O A;  2XAJ B;  3RKO A;  2I59 A;  2E9X B;  2X67 A;  5JDH A;  2CMR A;  2X9Y A;  1HG2 A;  3K8P C;  1SA0 E;  4PJN A;  4K0U A;  5JVD E;  1U5P A;  4H9R C;  4WNK A;  1HS7 A;  2H3R A;  2HPJ A;  5J1G A;  4E7S A;  3PDY A;  2KWI B;  2Q9Q A;  4OYJ A;  3AA0 B;  3MZK B;  3UTK A;  2BDE A;  2MOZ A;  1LRZ A;  1LVK A;  3AAE B;  2YK0 A;  2E8I A;  2XQY A;  3FBZ A;  1D1B A;  2HPL A;  4IE5 A;  4H9N C;  1Y64 B;  4C91 A;  1MIV A;  3KBU A;  3I9Y A;  3ZMV B;  5JRC A;  4YFS A;  4G63 A;  1YKE B;  1NAF A;  3ZYM A;  5L3F B;  5HXH A;  2DLR A;  3N9L A;  2DWG A;  4TV9 E;  4OHF A;  4H9P C;  3LJC A;  2W63 A;  3N9P A;  3Q9D A;  4MBQ A;  3MK7 C;  1QUU A;  3ZMU B;  5JRE A;  5LXT E;  3H3A A;  3WUR A;  3ZLI A;  5LBM A;  5LJN A;  4QX7 B;  2Z6E A;  3LK2 B;  2Y8D A;  3ZPO A;  3C64 A;  4EXT A;  4H9Q C;  2DNX A;  2ZLY A;  1BR4 A;  3C50 A;  4UF0 A;  4CZZ B;  3KFW X;  3V5S A;  4QX8 B;  1U4Q A;  5ADX L;  3DTO A;  2KZ7 B;  5ETW A;  4IST A;  4AKL A;  2YIN A;  5FXW A;  5JDL A;  2PFV A;  2LT3 A;  3IHR A;  5AFU L;  2ZM0 A;  5C8Y E;  1BR0 A;  1ZV4 X;  2HH7 A;  3PE0 A;  4EYU A;  2CE7 A;  3O1J A;  2VWA A;  3KV4 A;  4PNI A;  2DCF A;  2E9X C;  3UUX B;  5L3C B;  3GWH A;  3FB2 A;  2PG8 A;  3TKL B;  2IAK A;  3JC6 C;  5BMV E;  5LNK A;  2KLQ A;  5FY1 A;  3CWZ B;  4U74 A;  3QC9 A;  3NRY A;  3BK9 A;  3JC6 D;  1MMN A;  4UEL A;  3ZEF B;  3OJA A;  4UV8 B;  3B13 A;  5GON E;  3VU7 H;  3RX6 A;  2CXL A;  4WBN E;  1UX4 A;  4AQG A;  5LYJ E;  1Z0P A;  5FP3 A;  1ZKE A;  1MMG A;  2G0U A;  3Q2M A;  4ONR A;  2XUE A;  3PUA A;  1FEW A;  4HGA A;  1BR1 A;  5A1L A;  3FXE B;  5LA6 E;  4DMW A;  4ANJ A;  1MND A;  2VKJ A;  3O1I A;  2W61 A;  3K3N A;  4CI2 B;  4EIW A;  1ZHC A;  3GN5 B;  3RRW A;  4YJ2 E;  4IGU A;  4EB6 E;  4ZI3 C;  4O4J E;  1IZN B;  4PK6 A;  2LSK A;  2YU1 A;  3KIN B;  2K5B B;  3MXZ A;  3Q5W A;  1KNZ A;  5FYM A;  3L3P A;  5CB4 E;  3W15 B;  4ZI3 D;  2RA1 A;  3H37 A;  4MFR A;  3BQK A;  3WSC A;  1YW0 A;  4AI6 A;  1VRB A;  5FY7 A;  4QHO A;  5HXC A;  3IEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...