3V5SA

Structure of sodium/calcium exchanger from methanococcus jannaschii
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
Knots found
sequence length
301
structure length
289
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Sodium/Calcium Exchanger
publication title Structural insight into the ion-exchange mechanism of the sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 109
structure length 289
sequence length 301
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3v5sA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 3v5sA02
5HWXA 5JDGA 5JDHA 5HYAA 5JDFA 5JDLA 5HXRA 3V5SA 5JDMA 5JDQA 3V5UA 5HXCA 5HXHA 5JDNA 5HWYA 5HXEA 5HXSA
chains in the Genus database with same CATH superfamily
3AAAB 2JJ9A 3QNUA 3FBZA 2Y8DA 4MLKA 4WBNE 4CI2B 4U7YA 3C50A 2XZEA 2E5LT 5C3JA 2PBIA 1HNWT 2V7LA 4PW8A 1GQEA 3O9XA 5H6RB 3CIRA 3UUBA 5KX5E 4NXNT 4JYAT 2XY8B 5LBQB 2QGSA 1J1JA 4GKJT 3LBXA 1WFDA 5AQRB 2IC9A 1W0BA 3A8YC 5AQUB 2WSSV 3PE0A 2QYWA 4P0AA 3C98B 4H9QC 5L4EA 3AB3B 4ILUA 2ES0A 4TNVA 3AAIA 3B13A 4HTEA 5F5WA 4X64T 2DNXA 5L3FB 3NRXA 1NEKA 3N9OA 4CN4A 4W8PA 3AT7A 4GIWA 3IEEA 2K3WA 3C51A 3KBUA 2XQYA 5LGTB 4J2CA 3Q9DA 3KV4A 2WQYA 3ZCIA 5DQVA 3O1IA 2X68A 2BKOA 2CRBA 4JI5T 3C4ZA 3SWHA 2M67A 4UV9B 4PJMA 5JDNA 1IZNB 5L3GB 1FIOA 2MTCA 2L9QA 3IHRA 3IF8B 4ANJA 2XQ5A 1HF8A 5JR9B 3CVRA 2JQKA 5JDQA 2BS3A 4QH4A 4YHJA 1EZ3A 2I59A 4AKHA 1D1CA 5LBMA 2XM1A 3IBPA 2J62A 3ZSTA 3PUWF 3WSCA 2VQET 5CGMA 2XM2A 4AKLA 4XBFB 2IDOB 2ODUA 3AVRA 4KHZF 1J5ET 3HKCE 4CN1A 5ETWA 1YKEB 1UX4A 4UIGA 5FP3A 4ZI3D 1LVKA 5ABFB 2M6BA 1Z0PA 4JEHB 3AE9A 3RQWA 3CK6A 4DR2T 4U74A 4EV6A 4HWDA 4ILAA 5LCYA 3AEEA 3TLTA 4LF7T 2UXDT 2LSGA 2BKNA 2UUBT 5FVLA 2WP9A 4DV4T 3VR8A 3PUAA 3BK9A 1I6ZA 4PNIA 4YLHA 3ZN0B 1YD8G 4DV6T 4XZCA 5AQKB 3QB5A 4HFEA 1QSDA 3NVOA 4G63A 4DV2T 2E8IA 1HNZT 5L3EB 4V1Av 2XAQB 3PU8A 5FY0A 4DR4T 1JNRA 2UXBT 2MTQA 2Y6XA 3AEBA 5HAXA 3MK7C 1KNZA 3Q5XA 3RLFF 5L3DB 5HEUA 4AQYT 3QUJA 1MIVA 2CWOA 2BS4A 3B57A 4YSYA 3ZYLA 4IE6A 4P0BA 4UR9A 5CA0E 4JV5T 5AQSB 4X5TA 2J47A 4PAGA 4I0UA 1YQ4A 3PV0F 2CXFA 3UU5A 4UF0B 3MKDA 2BBHA 2NWBA 5LHGB 1NAFA 4QX7B 3PUQA 1UGOA 3C64A 4MFRA 4HWCA 4F8HA 4PJLA 3GWHA 3FZHB 5L4HA 3DP7A 1Z8UA 1SJ8A 1FMVA 5KDMC 1SHZC 3FHNA 4TN7B 2V1DB 5AQOB 4HFDA 2WWUA 2EHOC 2YDRA 3LBXB 3P4RA 3OYZA 2BG9C 4ISTA 2XUEA 1FMWA 4X62T 3K3OA 4X65T 5AQPB 5HYAA 1WR0A 3Q2MA 3AAEB 4UVBB 3ZN1B 4DUZT 4ZS3A 2KINB 3VKGA 3CKDA 3PUYF 2A2FX 2K5BB 1LRZA 4BAYB 3RF1A 4ZZCA 3N2KE 4TWDA 4L9IA 2LKHA 2MYSA 4KX6A 2VASA 2WAUA 1SUMB 5FXVA 2XQ3A 3DYJA 3PJAA 5AQLB 3PF0A 4LFBT 2XSAA 4IHJE 3RIFA 3M1CA 3VR9A 3UU4A 4COFA 3P4SA 2BKPA 4ADZA 2X67A 2WS3A 5IUXA 2NP9A 4P09A 3FXDB 4NUUA 2CLYC 3T1HT 2XAHB 4MALA 3FZFB 2CXDA 3E0ZA 3A5XA 3UFEA 3MJXA 3ESLA 4IL9A 2FJAA 3FB2A 2QA7A 3KVAA 5FNVE 3UU8A 3WAKA 4IDNA 3RIAA 4GKKT 2Q9QA 2QRXA 2BBJA 3G06A 4IGUA 2C5IT 2LRKA 3AE2A 4CZZB 4CI3B 4YTPA 4GYRA 4PFOA 4GOUA 4EEBA 2HHHT 4TUYE 1SA0E 2HPLA 4DR6T 2I0MA 2XQ4A 3AEFA 1E1HB 3LJCA 1WLXA 5F3JA 1D1BA 4DMWA 4JLEA 4O4HE 2X9XA 3L8RA 2VKJA 2WY2A 4A5XA 4GYSA 4JEUB 3KV9A 1OEDA 2DLRA 4ZI2C 4HE8A 3J9X1 2LJLA 2KSRA 4KHPT 3ONXA 4X1KE 2H88A 2CBIA 3AE6A 1HX8A 5ABEA 3JC6C 3N2GE 4IL4A 5FXXA 1OWAA 2LM9A 3ZCJA 1IBKT 1WR6A 2EHOB 1ZOYA 2H3RA 5AQJB 2BG9B 2V7KA 5HEGA 3EUHA 4HKAA 5IHYA 3ZKRA 3Q5WA 1X79A 4AKRB 2PJQA 4B3RT 2N9DA 2W67A 1NWMX 3PTRB 1KK7A 5KMGP 3P4QA 3VKHA 1T8BA 2V6YA 2KGXA 3E22E 2D0UA 3FXEB 3CQGB 3R6NA 5HWXA 5H6QB 5FZTA 4DR7T 2W66A 2IHR1 4KP3C 1ZV4X 1OEDC 4JI7T 4YSZA 2CE7A 5HCMA 4UVCB 4Z90A 2V26A 3QB5K 3B5MA 2FJEA 4NUVA 2CLYB 3ZEFB 3Q5DA 5LP6E 5EK4A 4U31A 1QLBA 4AKIA 2F4VT 1XDOA 4PK4A 2WZIA 2GK9A 4QKNA 4OX9T 2YKSA 4KI0F 5JREA 4YT0A 3ZYKA 2UUCT 5FL0A 2AXDS 3UULA 4NPPA 1YKHB 2DCFA 2HN1A 4H9OC 2MAWA 3M3ZB 2BS2A 3WURA 5LJNA 3EDVA 5T1DA 3PURA 2H89A 4YTNA 3ZLIA 1BR1A 5JRCA 5FY7A 1UUSA 4ERRA 2NW7A 4U33A 5JVDE 4IDOA 4AXPA 4JI8T 2WZHA 4DMVA 3BQKA 2VKOA 4K0KT 1MNDA 4BGOA 2YOEA 4EXTA 4DNDA 3LSVA 2VURA 3O1HA 2CM0A 5J1GA 4DVDA 2M6IA 3OTOT 4H9NC 2W4XA 1WCRA 4LFAT 5FL1A 3ZT6A 4EGWA 1L0VA 1SJ7A 3RRCA 3AE5A 3RGLA 2FJDA 4ONRA 1BR2A 2JMHA 2KVPA 2CA5A 5GONE 3RKOA 5ABHA 2Q9QB 4AISA 2KWHA 3NZQA 3L39A 2XQ7A 3N9QA 2UXNB 4LF8T 4UV8B 2VVNA 2ZM8A 3RX6A 2A9UA 5LMNT 2RA1A 2BDEA 5FYMA 1XDPA 4AQGA 1M7KA 4TWFA 4H63H 4QXBB 4O8SA 3LK2B 3UQ7A 4ZI2D 4IT4A 3VRAA 1JNZA 1MMAA 2DHRA 3K1SA 2E9XC 2WWVA 3HR0A 2CXLA 4OYJA 3JC6D 3LFMA 4GK0E 1T72A 4IDZA 3AE1A 1HR0T 5JDGA 2PG8A 3N2OA 1OEDB 4U2YA 3ZMZB 2LE8A 2Q9QD 2H7VC 4HWFA 2W63A 4QX8B 4DIDB 3ETUA 4HFVA 1HX1B 4H63V 2A3DA 2W62A 3UT5E 4MBQA 2WB5A 5FKYA 3TLSA 4L0RA 3LG7A 3R84B 3NZPA 3P8CD 4QH1A 2ZM0A 5F8PA 5J0ZA 3JADA 2NW9A 3RQUA 5EK3A 2EHOA 3EI0A 2LQUA 3I0QA 2NTXA 3TLWA 1HS7A 4LF5T 3EABA 2D9DA 2BG9A 4IE4A 5LOVE 4CXWA 3PHF1 4CN6A 3CX6B 4OK0A 2V6YB 3BQIA 1D0YA 1WYCA 1VOMA 4ISSA 2JQ9A 5BR8T 4TNWA 2WDVA 2XQ6A 1MMNA 4DV3T 1FEWA 3HKDE 1HCIA 4IREA 3WI3A 2E2AA 2LOSA 1MMGA 3ONLC 4ECGA 3RI5A 5FXZA 3AEGA 3VHLA 4ILCA 5HEOA 5LGNB 4A98A 2Z6EA 3RHWA 2NW8A 2KLQA 1HNXT 5HEJA 4F7GB 4JBWF 2ZM2A 2A72A 5HXSA 2JQQA 5LNKA 2VL0A 2YDSA 1KFYA 2YN6A 3PUGA 3RYIE 3ZJ1A 4JUYA 3TKLB 2YK0A 4AQFC 3NKZA 4F6RC 2UXXB 2IC6A 2DL1A 1QUUA 5FXWA 5HXHA 2CPTA 4I43B 4A56A 1S35A 3FZKB 1Y64B 4WBOA 1S94A 2VK9A 3TLUA 1OXZA 5JRCB 3FZMB 3HL6A 4UEMA 3M65A 2JRKA 3HI2A 1MIWA 3DJBA 4EZHA 3F2EA 1V9DA 1BR0A 3GA8A 2E9XB 4H9RC 2X51A 1LVFA 2UU9T 3ZMTB 3AA6B 2ODVA 2FJBA 2XTLA 3AEDA 3P4WA 1U5PA 1HFAA 5LMUT 4H9PC 5M4YA 4OFZA 3ONJA 5AFUL 1ZKEA 2FUPA 2LT3A 4YY3T 5DQWA 1XZYA 2BVMA 1W9RA 3PJAJ 1J5WA 5FY1A 1IBMT 2L8KA 4X1IE 2E9XD 5HXRA 2Y48B 3UUXB 2L7NA 2ZMAA 3SS1A 4DBQA 4UXNB 4EB6E 4E7ZA 2XAFB 2IW5B 2X0LB 5C8YE 5HXCA 3AE7A 2LKGA 3SRZA 3CQXC 4MHCA 3ZC1A 2VQFT 2R6GF 2J1DG 2XAGB 3T8OA 4TV8E 2VB6A 1O3XA 4HWIB 5AQQB 3TLVA 1G73A 3SFDA 4P1NA 2D2SA 4KBMB 3ZMVB 5AQFB 2WM9A 2WBLA 1M62A 5ABGA 4A97A 3AECA 4LMKA 3HKEE 4HFBA 2YINA 4TV9E 1I94T 3P7IA 5EZYE 4U7IA 5AQMB 4YJ2E 3N9PA 4LMLA 2XSBA 1UK5A 2UXCT 2VKDA 3OVUA 4LF4T 3S4UA 2BZBA 4HFIA 2CBJA 2I6HA 4X1YE 4ZI3C 4U72A 1E7PA 3RYCE 1UCUA 1AJ3A 1YQ3A 2YDQA 2KWIB 3OYXA 5JR9C 1U4QA 3CPZA 4QXHB 4JI4T 1HTJF 3RC8A 4ZZBA 4AKGA 2X0YA 3F31A 3UU3A 1DU2A 3NBXX 2VL8A 4X20E 4ZOLE 4DR5T 1D1AA 3A7MA 3F57A 4Z91A 5AQHB 2V5DA 5JQGE 3PU3A 4JI6T 3VU7H 4IDPA 3BQLA 2EHOD 2E5VA 4ZXLA 5HWYA 1IAPA 4QWNB 2CEAA 5JDLA 2IMLA 3RPUA 4LF6T 3H3AA 2H7OA 2LRLA 4ZI7E 1WYBA 4JI0T 2V6XA 1NENA 3U78A 3NWIA 4JI2T 3EVYA 5IWAT 4WW0A 2HH7A 4IDQA 3ZMSB 3AEAA 2W00A 2KXPB 4CI1B 1WRDA 2QVAA 4NIQA 2FBWA 3GN5A 2K9AA 5FMNA 4TX5A 2HPJA 2LSJA 4ASKA 2PTFA 2KNDA 5AQIB 2G0UA 1VRBA 2XQ9A 2LHNA 3AA0B 3KBTA 5AQGB 2ACXA 4ZEYA 3AXJA 2B76A 2E9XA 2WDQA 5EK2A 1N32T 5CJ5A 4Q25A 4YFSA 2V5CA 1ZEEA 2BG9E 3MA9A 2K48A 4DV0T 4X66T 4PJNA 2C0SA 4O2BE 4CQIA 4N78D 5LA6E 3OBVE 3MXZA 2XJ7A 1R8IA 2VKHA 4Z8XA 4U2ZA 3E08A 3FZLB 3QC9A 1XNRT 5L3BB 4C91A 1FJGT 2V7JA 2XASB 2YU2A 2IIUA 1G8XA 3ZT7A 4WNKA 3AE4A 4UVAB 4YHHT 1H7CA 5LYJE 3N9LA 3KFWX 1VCSA 2LM2A 5CA1E 4LFCT 3P50A 1ZHCA 5BMVE 1KEYA 1CUNA 1N34T 3AA7B 4QH5A 3FBLA 5LGUB 3AY5A 3KV6A 3H37A 2N1GA 1XMOT 3EDUA 5LG4A 2MPKA 2X9YA 3N5LA 5CFBA 1W0AA 4IE0A 4KMCA 2RPAA 4EYYR 4FI5A 3JAEA 3L3PA 3J7Yq 4GK5E 2MBGA 4EIWA 3RYFE 3ANWA 2OV9A 4I50E 3CMLA 4E7SA 2X9HA 4C90A 4B3MT 5JDMA 4O4IE 5LB7B 2JPFA 4WZXA 4U3CA 3UQ4A 4EZ4A 5LHIB 5JH7E 5HCJA 3H3MA 3CX7B 1X9BA 5E0OA 1B7TA 1BR4A 5AQNB 4IIJE 2WMOA 1IJ6A 4XAXB 4O4JE 3KINB 2HN2A 4PFPA 3LDQB 2CCQA 3ZJ2A 5C2TA 4AI6A 3RC3A 3P4PA 4PK5A 5KXJA 3ZC0A 2KZ7B 3RKGA 5AQTB 1D0XA 3MZKB 2ACZA 4AQFA 4BJNA 1N36T 2LOPA 5AQVB 4EEDA 4BA9A 4I55E 3UFGA 3D0TA 4B3TT 3ZSSA 3AE8A 2NTYA 2IUBA 3PUSA 2YEVC 2V7IA 2NOXA 2N2NA 1SE7A 3C4WA 3KV5A 2X9WA 4ZHQE 3C4XA 3SFEA 3AA1B 4NXMT 2KBBA 2MOZA 2V8SV 3UTKA 4G2AA 3UUMA 5JDFA 2D0TA 2WDRA 3RRWA 3HKBE 3MACA 3PUXF 1HG5A 3ZMUB 5DABA 4DV5T 1UURA 4I4TE 2CMRA 5ADXL 3ETVA 3VRBA 3SOLA 1KNRA 1YXRA 3I9YA 4YSXA 5JTGA 1VCTA 3I1AA 4LF9T 4TZ4C 3K3NA 4BJMA 4DV7T 3L09A 2VWAA 5HEHA 1US7B 3GN5B 2W2UA 4OYKA 4YXDA 1OEDE 4CXXA 1LKXA 5TAOA 2CHNA 3KVBA 3EAMA 2OLTA 1UX5A 1T7SA 4L5GA 2LEHA 5LXTE 2C5KT 4DR3T 1XNQT 3K8PC 4IE5A 2OA5A 2DI4A 3AXJB 4YTMA 4TWHA 4OHFA 2AE9A 4DV1T 2B1EA 3W15B 2SPCA 3RH3A 3I9WA 3KDSE 5L3CB 2X66A 2CHOA 5JDHA 2WCAA 2IAKA 3K3QC 4M1PA 4HFCA 3N9NA 2UUAT 2D5UA 3WAJA 4JI1T 2ZM6T 3EHZA 4B6XA 1IJ5A 4EOZB 1MMDA 2XQAA 5CB4E 5IYZE 2J4GA 4KUMB 3VJZA 4YJ3E 2JMKA 3I0OA 4H9SE 3JAFA 2XHEB 3RIUA 1W09A 3DTOA 3ABVA 5FVKA 2RP4A 1XMQT 4JI3T 3X1DA 4O4LE 5L2LA 3GMIA 4DUYT 5LJMA 2W61A 3LK3B 1YW0A 1IBLT 5JR9A 4B3ST 1Y01A 3OPCA 3UU6A 3T1YT 3AVSA 3N9MA 4QHOA 4DBRA 4ILBA 2VVSA 3HA4A 2YU1A 2BVLA 1MNEA 3V5UA 2LSYA 3PUZF 4EAHA 4FJOA 4DO0A 3Q5EA 3ANWB 4HEAA 1E2AA 4UELA 3PUVF 4O2AE 2DWGA 3CX8B 4QXCB 1XWMA 2LSKA 3IA3A 1N33T 5A1LA 2K24A 3U3IA 5ABFA 2KMFA 3OJAA 4PK6A 3JCFA 2DWKA 2XPKA 4HFHA 4PJJA 2LLYA 5HXEA 4HN9A 3RYHE 3QK6A 2C5JA 5LHHB 3RIUC 4HGAA 5J2TE 2CWYA 4CXYA 4AIUA 5DJQC 2NR4A 4ZS2A 3UUNA 2X0HA 1MIYA 2JQHA 1HG2A 3CQCB 2V7MA 3NRYA 5L47A 1KF6A 2LSIA 3CWZB 2W0GA 2ZLYA 2Q9QC 2WU2A 2JIWA 3AE3A 3OKQA 2X0CA 3O4XE 2P9BA 2L10A 4IE7A 3FYQA 3V5SA 1D0ZA 1T98A 4K0UA 1CHUA 3ZT5A 2LHRA 3ZPOA 4LMJA 2L3LA 3PDYA 3ZYMA 2XAJB 4WYVA 4EYUA 3LK42 2WMNA 1KNPA 2PFVA 3O1JA 2WU5A 5J2UE 4DR1T 4HWHA 2KT9A 3QOFA 5LG3A 2XQ8A 4UF0A 1ZP0A
chains in the Genus database with same CATH topology
2C5IT 3AAAB 3KV6A 2KLQA 2JJ9A 3H37A 2N1GA 3FBZA 2Y8DA 3EDUA 5LG4A 4CZZB 4CI3B 4MLKA 4WBNE 2X9YA 4CI2B 4GYRA 4PFOA 4GOUA 3C50A 2ZM2A 4TUYE 2A72A 5HXSA 3N5LA 2JQQA 5LNKA 2PBIA 1SA0E 2HPLA 2V7LA 4IE0A 4KMCA 4EYYR 4PW8A 4FI5A 1E1HB 3LJCA 1WLXA 5F3JA 3PUGA 3L3PA 3O9XA 3J7Yq 3RYIE 3ZJ1A 4GK5E 2MBGA 1D1BA 5H6RB 4EIWA 3RYFE 3ANWA 4JUYA 4I50E 3CMLA 4E7SA 3TKLB 2YK0A 5KX5E 2X9HA 4DMWA 4C90A 5LBQB 4JLEA 2QGSA 4O4IE 4AQFC 4O4HE 4F6RC 5JDMA 2UXXB 2JPFA 2X9XA 5LHIB 4EZ4A 2IC6A 3LBXA 2IC9A 2VKJA 5JH7E 1QUUA 4GYSA 4JEUB 5FXWA 5HXHA 2WSSV 3CX7B 3PE0A 4P0AA 3C98B 4I43B 3KV9A 1B7TA 5E0OA 4H9QC 4A56A 1S35A 1BR4A 3AB3B 2ES0A 4ILUA 1Y64B 4WBOA 4IIJE 2WMOA 1IJ6A 1S94A 2DLRA 2VK9A 4XAXB 4ZI2C 4HE8A 4O4JE 3J9X1 1OXZA 2LJLA 3AAIA 3KINB 5JRCB 3B13A 4HTEA 3HL6A 3ONXA 4UEMA 3M65A 2DNXA 2JRKA 4X1KE 5L3FB 4PFPA 3HI2A 2CCQA 1MIWA 3DJBA 3ZJ2A 1HX8A 4EZHA 3JC6C 3NRXA 3F2EA 4AI6A 3RC3A 3N2GE 1V9DA 4PK5A 3N9OA 3ZC0A 1BR0A 5FXXA 3AT7A 3GA8A 4GIWA 2E9XB 3IEEA 3C51A 2KZ7B 3KBUA 4H9RC 2XQYA 1OWAA 5LGTB 1D0XA 3MZKB 2X51A 2LM9A 1LVFA 4J2CA 1WR6A 2EHOB 3Q9DA 2H3RA 3ZCJA 4AQFA 4BJNA 3ZMTB 2LOPA 4BA9A 4I55E 3AA6B 2ODVA 3KV4A 2V7KA 2XTLA 3D0TA 3EUHA 4HKAA 3ZCIA 5IHYA 5DQVA 3Q5WA 1X79A 2NTYA 1U5PA 3O1IA 1HFAA 4AKRB 2PJQA 2N9DA 1NWMX 2X68A 3PTRB 1KK7A 4H9PC 3C4ZA 3PUSA 5M4YA 2YEVC 2V7IA 5KMGP 3SWHA 4OFZA 2M67A 2NOXA 5AFUL 1ZKEA 4UV9B 2N2NA 3VKHA 3C4WA 4PJMA 5JDNA 1IZNB 3KV5A 5L3GB 1FIOA 2MTCA 3E22E 2D0UA 2X9WA 2L9QA 2LT3A 3C4XA 3FXEB 4ZHQE 3AA1B 3IF8B 3IHRA 4ANJA 5DQWA 2BVMA 3CQGB 1HF8A 3R6NA 5HWXA 5H6QB 2MOZA 5JR9B 5FY1A 3CVRA 3UTKA 4G2AA 2L8KA 4X1IE 3UUMA 5JDFA 2D0TA 2E9XD 5HXRA 2Y48B 5JDQA 3UUXB 2ZMAA 3RRWA 3HKBE 3SS1A 3MACA 4KP3C 1ZV4X 4YHJA 1EZ3A 2I59A 1HG5A 3ZMUB 4DBQA 5DABA 4UXNB 4AKHA 1D1CA 5LBMA 4EB6E 2CE7A 3IBPA 4E7ZA 4I4TE 2CMRA 2XAFB 2IW5B 4UVCB 5ADXL 2X0LB 3ETVA 5C8YE 3SOLA 5HXCA 2V26A 3WSCA 3I9YA 3I1AA 4NUVA 2CLYB 3ZEFB 4TZ4C 3K3NA 3SRZA 4BJMA 4AKLA 4XBFB 2ODUA 3AVRA 3L09A 5LP6E 3CQXC 5EK4A 3HKCE 4MHCA 3ZC1A 2J1DG 4AKIA 5ETWA 1YKEB 2VWAA 1UX4A 2XAGB 4UIGA 4TV8E 3T8OA 2VB6A 1O3XA 5FP3A 4ZI3D 4QKNA 1G73A 1US7B 2GK9A 1LVKA 4PK4A 3GN5B 4OYKA 5JREA 2D2SA 4KBMB 3ZYKA 4CXXA 3ZMVB 1LKXA 2WM9A 2WBLA 5TAOA 3UULA 1Z0PA 4JEHB 3KVBA 1YKHB 3HKEE 2YINA 1UX5A 4TV9E 4U74A 2DCFA 4H9OC 4L5GA 3P7IA 5EZYE 2LEHA 5LXTE 3WURA 4YJ2E 5LJNA 3N9PA 2C5KT 5LCYA 3EDVA 5T1DA 3PURA 2LSGA 3K8PC 3ZLIA 1BR1A 4IE5A 2VKDA 2OA5A 2DI4A 5JRCA 5FY7A 3S4UA 4OHFA 2BZBA 2B1EA 3W15B 2SPCA 4ERRA 2NW7A 4X1YE 3PUAA 3RH3A 3BK9A 4ZI3C 3I9WA 3KDSE 4U72A 3RYCE 1UCUA 5L3CB 4PNIA 4YLHA 2X66A 1YD8G 5JVDE 3ZN0B 4AXPA 1AJ3A 4XZCA 5JDHA 4DMVA 2IAKA 3K3QC 3BQKA 4M1PA 2KWIB 2VKOA 3OYXA 5JR9C 1QSDA 3N9NA 1U4QA 3CPZA 2D5UA 4G63A 3WAJA 1MNDA 2E8IA 5L3EB 4BGOA 4V1Av 2XAQB 4B6XA 1IJ5A 4EOZB 4EXTA 3PU8A 4DNDA 1MMDA 5FY0A 4QXHB 5CB4E 1HTJF 3RC8A 2MTQA 2Y6XA 5IYZE 3O1HA 2CM0A 5HAXA 5J1GA 3MK7C 4DVDA 4AKGA 1KNZA 4KUMB 3F31A 4H9NC 3Q5XA 3VJZA 4YJ3E 5L3DB 2JMKA 3NBXX 2VL8A 4X20E 3I0OA 1MIVA 2CWOA 3QUJA 1D1AA 4H9SE 4ZOLE 3B57A 2XHEB 3RRCA 3F57A 3DTOA 3ZYLA 4IE6A 2RP4A 4P0BA 5JQGE 5L2LA 4O4LE 3GMIA 4ONRA 5CA0E 1BR2A 5LJMA 2W61A 3LK3B 2JMHA 1YW0A 3PU3A 2CA5A 3VU7H 5GONE 3BQLA 3RKOA 2EHOD 5HWYA 2Q9QB 5JR9A 1IAPA 4QWNB 2CEAA 4PAGA 2KWHA 3NZQA 5JDLA 2CXFA 3RPUA 4UF0B 3MKDA 3N9QA 2NWBA 2UXNB 3AVSA 3H3AA 2H7OA 4UV8B 4ZI7E 1WYBA 5LHGB 1NAFA 2ZM8A 3N9MA 4QX7B 3PUQA 3RX6A 3C64A 4MFRA 4QHOA 2RA1A 4DBRA 2BDEA 3U78A 5FYMA 4AQGA 3HA4A 2YU1A 2BVLA 3EVYA 1MNEA 4PJLA 4H63H 4QXBB 3GWHA 3V5UA 4O8SA 3LK2B 2LSYA 3DP7A 4WW0A 4EAHA 4FJOA 4ZI2D 1FMVA 1MMAA 4DO0A 5KDMC 2DHRA 1SHZC 3ANWB 4HEAA 2HH7A 3ZMSB 3FHNA 2E9XC 4TN7B 2V1DB 4UELA 3HR0A 4O2AE 2WWUA 2CXLA 4OYJA 2DWGA 3JC6D 3LFMA 4GK0E 2EHOC 3CX8B 3LBXB 4IDZA 2LSKA 2W00A 2KXPB 4QXCB 4CI1B 1WRDA 5A1LA 2K24A 3U3IA 3OYZA 5JDGA 4ISTA 3GN5A 2K9AA 5FMNA 2PG8A 2XUEA 2KMFA 1FMWA 4TX5A 3N2OA 3OJAA 4PK6A 2DWKA 2HPJA 4PJJA 3ZMZB 2LE8A 2Q9QD 2H7VC 2LSJA 3K3OA 5HXEA 2W63A 4QX8B 4ASKA 5HYAA 4HN9A 3ETUA 2KNDA 4HFVA 3QK6A 3RYHE 2G0UA 3AAEB 1VRBA 3Q2MA 4H63V 4UVBB 2A3DA 3ZN1B 2C5JA 2LHNA 2W62A 4ZS3A 3AA0B 3UT5E 2KINB 5LHHB 4MBQA 3KBTA 4HGAA 5J2TE 3VKGA 3CKDA 2CWYA 4CXYA 4L0RA 3LG7A 3R84B 2A2FX 2ACXA 2K5BB 3NZPA 3P8CD 5DJQC 1LRZA 4BAYB 4ZS2A 2ZM0A 5F8PA 2E9XA 3UUNA 3N2KE 5EK2A 2NW9A 4YFSA 4L9IA 5EK3A 1ZEEA 2EHOA 2MYSA 3MA9A 2LQUA 2VASA 3I0QA 1MIYA 2K48A 1HG2A 2NTXA 2WAUA 3CQCB 5FXVA 2V7MA 3NRYA 1HS7A 2LSIA 3PF0A 3CWZB 4PJNA 2W0GA 2ZLYA 4IE4A 4IHJE 2Q9QC 5LOVE 2C0SA 4O2BE 3M1CA 4CQIA 3OKQA 3O4XE 4CXWA 4N78D 3PHF1 5LA6E 4ADZA 2P9BA 2X67A 3OBVE 4IE7A 3MXZA 3V5SA 2VKHA 1D0ZA 1T98A 4K0UA 2NP9A 4P09A 4Z8XA 3CX6B 4OK0A 3BQIA 3E08A 1D0YA 3FXDB 3QC9A 1WYCA 1VOMA 4ISSA 4NUUA 2CLYC 2XAHB 4C91A 5L3BB 4MALA 2V7JA 2XASB 2CXDA 1MMNA 2YU2A 3E0ZA 3A5XA 3UFEA 3MJXA 3ESLA 1G8XA 1FEWA 2LHRA 4WNKA 3ZPOA 3FB2A 2L3LA 3HKDE 1HCIA 3WI3A 4UVAB 3PDYA 1H7CA 2LOSA 2QA7A 3ZYMA 5LYJE 3N9LA 1MMGA 2XAJB 3KFWX 5CA1E 4ECGA 1ZHCA 3KVAA 3LK42 2WMNA 5FNVE 5FXZA 3WAKA 4EYUA 5BMVE 3VHLA 2PFVA 5LGNB 1CUNA 3O1JA 5J2UE 2Q9QA 2Z6EA 3AA7B 2NW8A 2KT9A 3FBLA 5LGUB 4UF0A 4IGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWX A;  5JDG A;  5JDH A;  5HYA A;  5JDF A;  5JDL A;  5HXR A;  3V5S A;  5JDM A;  5JDQ A;  3V5U A;  5HXC A;  5HXH A;  5JDN A;  5HWY A;  5HXE A;  5HXS A; 
#chains in the Genus database with same CATH topology
 3AAA B;  2JJ9 A;  3QNU A;  3FBZ A;  2Y8D A;  4MLK A;  4WBN E;  4CI2 B;  4U7Y A;  3C50 A;  2XZE A;  2E5L T;  5C3J A;  2PBI A;  1HNW T;  2V7L A;  4PW8 A;  1GQE A;  3O9X A;  5H6R B;  3CIR A;  3UUB A;  5KX5 E;  4NXN T;  4JYA T;  2XY8 B;  5LBQ B;  2QGS A;  1J1J A;  4GKJ T;  3LBX A;  1WFD A;  5AQR B;  2IC9 A;  1W0B A;  3A8Y C;  5AQU B;  2WSS V;  3PE0 A;  2QYW A;  4P0A A;  3C98 B;  4H9Q C;  5L4E A;  3AB3 B;  4ILU A;  2ES0 A;  4TNV A;  3AAI A;  3B13 A;  4HTE A;  5F5W A;  4X64 T;  2DNX A;  5L3F B;  3NRX A;  1NEK A;  3N9O A;  4CN4 A;  4W8P A;  3AT7 A;  4GIW A;  3IEE A;  2K3W A;  3C51 A;  3KBU A;  2XQY A;  5LGT B;  4J2C A;  3Q9D A;  3KV4 A;  2WQY A;  3ZCI A;  5DQV A;  3O1I A;  2X68 A;  2BKO A;  2CRB A;  4JI5 T;  3C4Z A;  3SWH A;  2M67 A;  4UV9 B;  4PJM A;  5JDN A;  1IZN B;  5L3G B;  1FIO A;  2MTC A;  2L9Q A;  3IHR A;  3IF8 B;  4ANJ A;  2XQ5 A;  1HF8 A;  5JR9 B;  3CVR A;  2JQK A;  5JDQ A;  2BS3 A;  4QH4 A;  4YHJ A;  1EZ3 A;  2I59 A;  4AKH A;  1D1C A;  5LBM A;  2XM1 A;  3IBP A;  2J62 A;  3ZST A;  3PUW F;  3WSC A;  2VQE T;  5CGM A;  2XM2 A;  4AKL A;  4XBF B;  2IDO B;  2ODU A;  3AVR A;  4KHZ F;  1J5E T;  3HKC E;  4CN1 A;  5ETW A;  1YKE B;  1UX4 A;  4UIG A;  5FP3 A;  4ZI3 D;  1LVK A;  5ABF B;  2M6B A;  1Z0P A;  4JEH B;  3AE9 A;  3RQW A;  3CK6 A;  4DR2 T;  4U74 A;  4EV6 A;  4HWD A;  4ILA A;  5LCY A;  3AEE A;  3TLT A;  4LF7 T;  2UXD T;  2LSG A;  2BKN A;  2UUB T;  5FVL A;  2WP9 A;  4DV4 T;  3VR8 A;  3PUA A;  3BK9 A;  1I6Z A;  4PNI A;  4YLH A;  3ZN0 B;  1YD8 G;  4DV6 T;  4XZC A;  5AQK B;  3QB5 A;  4HFE A;  1QSD A;  3NVO A;  4G63 A;  4DV2 T;  2E8I A;  1HNZ T;  5L3E B;  4V1A v;  2XAQ B;  3PU8 A;  5FY0 A;  4DR4 T;  1JNR A;  2UXB T;  2MTQ A;  2Y6X A;  3AEB A;  5HAX A;  3MK7 C;  1KNZ A;  3Q5X A;  3RLF F;  5L3D B;  5HEU A;  4AQY T;  3QUJ A;  1MIV A;  2CWO A;  2BS4 A;  3B57 A;  4YSY A;  3ZYL A;  4IE6 A;  4P0B A;  4UR9 A;  5CA0 E;  4JV5 T;  5AQS B;  4X5T A;  2J47 A;  4PAG A;  4I0U A;  1YQ4 A;  3PV0 F;  2CXF A;  3UU5 A;  4UF0 B;  3MKD A;  2BBH A;  2NWB A;  5LHG B;  1NAF A;  4QX7 B;  3PUQ A;  1UGO A;  3C64 A;  4MFR A;  4HWC A;  4F8H A;  4PJL A;  3GWH A;  3FZH B;  5L4H A;  3DP7 A;  1Z8U A;  1SJ8 A;  1FMV A;  5KDM C;  1SHZ C;  3FHN A;  4TN7 B;  2V1D B;  5AQO B;  4HFD A;  2WWU A;  2EHO C;  2YDR A;  3LBX B;  3P4R A;  3OYZ A;  2BG9 C;  4IST A;  2XUE A;  1FMW A;  4X62 T;  3K3O A;  4X65 T;  5AQP B;  5HYA A;  1WR0 A;  3Q2M A;  3AAE B;  4UVB B;  3ZN1 B;  4DUZ T;  4ZS3 A;  2KIN B;  3VKG A;  3CKD A;  3PUY F;  2A2F X;  2K5B B;  1LRZ A;  4BAY B;  3RF1 A;  4ZZC A;  3N2K E;  4TWD A;  4L9I A;  2LKH A;  2MYS A;  4KX6 A;  2VAS A;  2WAU A;  1SUM B;  5FXV A;  2XQ3 A;  3DYJ A;  3PJA A;  5AQL B;  3PF0 A;  4LFB T;  2XSA A;  4IHJ E;  3RIF A;  3M1C A;  3VR9 A;  3UU4 A;  4COF A;  3P4S A;  2BKP A;  4ADZ A;  2X67 A;  2WS3 A;  5IUX A;  2NP9 A;  4P09 A;  3FXD B;  4NUU A;  2CLY C;  3T1H T;  2XAH B;  4MAL A;  3FZF B;  2CXD A;  3E0Z A;  3A5X A;  3UFE A;  3MJX A;  3ESL A;  4IL9 A;  2FJA A;  3FB2 A;  2QA7 A;  3KVA A;  5FNV E;  3UU8 A;  3WAK A;  4IDN A;  3RIA A;  4GKK T;  2Q9Q A;  2QRX A;  2BBJ A;  3G06 A;  4IGU A;  2C5I T;  2LRK A;  3AE2 A;  4CZZ B;  4CI3 B;  4YTP A;  4GYR A;  4PFO A;  4GOU A;  4EEB A;  2HHH T;  4TUY E;  1SA0 E;  2HPL A;  4DR6 T;  2I0M A;  2XQ4 A;  3AEF A;  1E1H B;  3LJC A;  1WLX A;  5F3J A;  1D1B A;  4DMW A;  4JLE A;  4O4H E;  2X9X A;  3L8R A;  2VKJ A;  2WY2 A;  4A5X A;  4GYS A;  4JEU B;  3KV9 A;  1OED A;  2DLR A;  4ZI2 C;  4HE8 A;  3J9X 1;  2LJL A;  2KSR A;  4KHP T;  3ONX A;  4X1K E;  2H88 A;  2CBI A;  3AE6 A;  1HX8 A;  5ABE A;  3JC6 C;  3N2G E;  4IL4 A;  5FXX A;  1OWA A;  2LM9 A;  3ZCJ A;  1IBK T;  1WR6 A;  2EHO B;  1ZOY A;  2H3R A;  5AQJ B;  2BG9 B;  2V7K A;  5HEG A;  3EUH A;  4HKA A;  5IHY A;  3ZKR A;  3Q5W A;  1X79 A;  4AKR B;  2PJQ A;  4B3R T;  2N9D A;  2W67 A;  1NWM X;  3PTR B;  1KK7 A;  5KMG P;  3P4Q A;  3VKH A;  1T8B A;  2V6Y A;  2KGX A;  3E22 E;  2D0U A;  3FXE B;  3CQG B;  3R6N A;  5HWX A;  5H6Q B;  5FZT A;  4DR7 T;  2W66 A;  2IHR 1;  4KP3 C;  1ZV4 X;  1OED C;  4JI7 T;  4YSZ A;  2CE7 A;  5HCM A;  4UVC B;  4Z90 A;  2V26 A;  3QB5 K;  3B5M A;  2FJE A;  4NUV A;  2CLY B;  3ZEF B;  3Q5D A;  5LP6 E;  5EK4 A;  4U31 A;  1QLB A;  4AKI A;  2F4V T;  1XDO A;  4PK4 A;  2WZI A;  2GK9 A;  4QKN A;  4OX9 T;  2YKS A;  4KI0 F;  5JRE A;  4YT0 A;  3ZYK A;  2UUC T;  5FL0 A;  2AXD S;  3UUL A;  4NPP A;  1YKH B;  2DCF A;  2HN1 A;  4H9O C;  2MAW A;  3M3Z B;  2BS2 A;  3WUR A;  5LJN A;  3EDV A;  5T1D A;  3PUR A;  2H89 A;  4YTN A;  3ZLI A;  1BR1 A;  5JRC A;  5FY7 A;  1UUS A;  4ERR A;  2NW7 A;  4U33 A;  5JVD E;  4IDO A;  4AXP A;  4JI8 T;  2WZH A;  4DMV A;  3BQK A;  2VKO A;  4K0K T;  1MND A;  4BGO A;  2YOE A;  4EXT A;  4DND A;  3LSV A;  2VUR A;  3O1H A;  2CM0 A;  5J1G A;  4DVD A;  2M6I A;  3OTO T;  4H9N C;  2W4X A;  1WCR A;  4LFA T;  5FL1 A;  3ZT6 A;  4EGW A;  1L0V A;  1SJ7 A;  3RRC A;  3AE5 A;  3RGL A;  2FJD A;  4ONR A;  1BR2 A;  2JMH A;  2KVP A;  2CA5 A;  5GON E;  3RKO A;  5ABH A;  2Q9Q B;  4AIS A;  2KWH A;  3NZQ A;  3L39 A;  2XQ7 A;  3N9Q A;  2UXN B;  4LF8 T;  4UV8 B;  2VVN A;  2ZM8 A;  3RX6 A;  2A9U A;  5LMN T;  2RA1 A;  2BDE A;  5FYM A;  1XDP A;  4AQG A;  1M7K A;  4TWF A;  4H63 H;  4QXB B;  4O8S A;  3LK2 B;  3UQ7 A;  4ZI2 D;  4IT4 A;  3VRA A;  1JNZ A;  1MMA A;  2DHR A;  3K1S A;  2E9X C;  2WWV A;  3HR0 A;  2CXL A;  4OYJ A;  3JC6 D;  3LFM A;  4GK0 E;  1T72 A;  4IDZ A;  3AE1 A;  1HR0 T;  5JDG A;  2PG8 A;  3N2O A;  1OED B;  4U2Y A;  3ZMZ B;  2LE8 A;  2Q9Q D;  2H7V C;  4HWF A;  2W63 A;  4QX8 B;  4DID B;  3ETU A;  4HFV A;  1HX1 B;  4H63 V;  2A3D A;  2W62 A;  3UT5 E;  4MBQ A;  2WB5 A;  5FKY A;  3TLS A;  4L0R A;  3LG7 A;  3R84 B;  3NZP A;  3P8C D;  4QH1 A;  2ZM0 A;  5F8P A;  5J0Z A;  3JAD A;  2NW9 A;  3RQU A;  5EK3 A;  2EHO A;  3EI0 A;  2LQU A;  3I0Q A;  2NTX A;  3TLW A;  1HS7 A;  4LF5 T;  3EAB A;  2D9D A;  2BG9 A;  4IE4 A;  5LOV E;  4CXW A;  3PHF 1;  4CN6 A;  3CX6 B;  4OK0 A;  2V6Y B;  3BQI A;  1D0Y A;  1WYC A;  1VOM A;  4ISS A;  2JQ9 A;  5BR8 T;  4TNW A;  2WDV A;  2XQ6 A;  1MMN A;  4DV3 T;  1FEW A;  3HKD E;  1HCI A;  4IRE A;  3WI3 A;  2E2A A;  2LOS A;  1MMG A;  3ONL C;  4ECG A;  3RI5 A;  5FXZ A;  3AEG A;  3VHL A;  4ILC A;  5HEO A;  5LGN B;  4A98 A;  2Z6E A;  3RHW A;  2NW8 A;  2KLQ A;  1HNX T;  5HEJ A;  4F7G B;  4JBW F;  2ZM2 A;  2A72 A;  5HXS A;  2JQQ A;  5LNK A;  2VL0 A;  2YDS A;  1KFY A;  2YN6 A;  3PUG A;  3RYI E;  3ZJ1 A;  4JUY A;  3TKL B;  2YK0 A;  4AQF C;  3NKZ A;  4F6R C;  2UXX B;  2IC6 A;  2DL1 A;  1QUU A;  5FXW A;  5HXH A;  2CPT A;  4I43 B;  4A56 A;  1S35 A;  3FZK B;  1Y64 B;  4WBO A;  1S94 A;  2VK9 A;  3TLU A;  1OXZ A;  5JRC B;  3FZM B;  3HL6 A;  4UEM A;  3M65 A;  2JRK A;  3HI2 A;  1MIW A;  3DJB A;  4EZH A;  3F2E A;  1V9D A;  1BR0 A;  3GA8 A;  2E9X B;  4H9R C;  2X51 A;  1LVF A;  2UU9 T;  3ZMT B;  3AA6 B;  2ODV A;  2FJB A;  2XTL A;  3AED A;  3P4W A;  1U5P A;  1HFA A;  5LMU T;  4H9P C;  5M4Y A;  4OFZ A;  3ONJ A;  5AFU L;  1ZKE A;  2FUP A;  2LT3 A;  4YY3 T;  5DQW A;  1XZY A;  2BVM A;  1W9R A;  3PJA J;  1J5W A;  5FY1 A;  1IBM T;  2L8K A;  4X1I E;  2E9X D;  5HXR A;  2Y48 B;  3UUX B;  2L7N A;  2ZMA A;  3SS1 A;  4DBQ A;  4UXN B;  4EB6 E;  4E7Z A;  2XAF B;  2IW5 B;  2X0L B;  5C8Y E;  5HXC A;  3AE7 A;  2LKG A;  3SRZ A;  3CQX C;  4MHC A;  3ZC1 A;  2VQF T;  2R6G F;  2J1D G;  2XAG B;  3T8O A;  4TV8 E;  2VB6 A;  1O3X A;  4HWI B;  5AQQ B;  3TLV A;  1G73 A;  3SFD A;  4P1N A;  2D2S A;  4KBM B;  3ZMV B;  5AQF B;  2WM9 A;  2WBL A;  1M62 A;  5ABG A;  4A97 A;  3AEC A;  4LMK A;  3HKE E;  4HFB A;  2YIN A;  4TV9 E;  1I94 T;  3P7I A;  5EZY E;  4U7I A;  5AQM B;  4YJ2 E;  3N9P A;  4LML A;  2XSB A;  1UK5 A;  2UXC T;  2VKD A;  3OVU A;  4LF4 T;  3S4U A;  2BZB A;  4HFI A;  2CBJ A;  2I6H A;  4X1Y E;  4ZI3 C;  4U72 A;  1E7P A;  3RYC E;  1UCU A;  1AJ3 A;  1YQ3 A;  2YDQ A;  2KWI B;  3OYX A;  5JR9 C;  1U4Q A;  3CPZ A;  4QXH B;  4JI4 T;  1HTJ F;  3RC8 A;  4ZZB A;  4AKG A;  2X0Y A;  3F31 A;  3UU3 A;  1DU2 A;  3NBX X;  2VL8 A;  4X20 E;  4ZOL E;  4DR5 T;  1D1A A;  3A7M A;  3F57 A;  4Z91 A;  5AQH B;  2V5D A;  5JQG E;  3PU3 A;  4JI6 T;  3VU7 H;  4IDP A;  3BQL A;  2EHO D;  2E5V A;  4ZXL A;  5HWY A;  1IAP A;  4QWN B;  2CEA A;  5JDL A;  2IML A;  3RPU A;  4LF6 T;  3H3A A;  2H7O A;  2LRL A;  4ZI7 E;  1WYB A;  4JI0 T;  2V6X A;  1NEN A;  3U78 A;  3NWI A;  4JI2 T;  3EVY A;  5IWA T;  4WW0 A;  2HH7 A;  4IDQ A;  3ZMS B;  3AEA A;  2W00 A;  2KXP B;  4CI1 B;  1WRD A;  2QVA A;  4NIQ A;  2FBW A;  3GN5 A;  2K9A A;  5FMN A;  4TX5 A;  2HPJ A;  2LSJ A;  4ASK A;  2PTF A;  2KND A;  5AQI B;  2G0U A;  1VRB A;  2XQ9 A;  2LHN A;  3AA0 B;  3KBT A;  5AQG B;  2ACX A;  4ZEY A;  3AXJ A;  2B76 A;  2E9X A;  2WDQ A;  5EK2 A;  1N32 T;  5CJ5 A;  4Q25 A;  4YFS A;  2V5C A;  1ZEE A;  2BG9 E;  3MA9 A;  2K48 A;  4DV0 T;  4X66 T;  4PJN A;  2C0S A;  4O2B E;  4CQI A;  4N78 D;  5LA6 E;  3OBV E;  3MXZ A;  2XJ7 A;  1R8I A;  2VKH A;  4Z8X A;  4U2Z A;  3E08 A;  3FZL B;  3QC9 A;  1XNR T;  5L3B B;  4C91 A;  1FJG T;  2V7J A;  2XAS B;  2YU2 A;  2IIU A;  1G8X A;  3ZT7 A;  4WNK A;  3AE4 A;  4UVA B;  4YHH T;  1H7C A;  5LYJ E;  3N9L A;  3KFW X;  1VCS A;  2LM2 A;  5CA1 E;  4LFC T;  3P50 A;  1ZHC A;  5BMV E;  1KEY A;  1CUN A;  1N34 T;  3AA7 B;  4QH5 A;  3FBL A;  5LGU B;  3AY5 A;  3KV6 A;  3H37 A;  2N1G A;  1XMO T;  3EDU A;  5LG4 A;  2MPK A;  2X9Y A;  3N5L A;  5CFB A;  1W0A A;  4IE0 A;  4KMC A;  2RPA A;  4EYY R;  4FI5 A;  3JAE A;  3L3P A;  3J7Y q;  4GK5 E;  2MBG A;  4EIW A;  3RYF E;  3ANW A;  2OV9 A;  4I50 E;  3CML A;  4E7S A;  2X9H A;  4C90 A;  4B3M T;  5JDM A;  4O4I E;  5LB7 B;  2JPF A;  4WZX A;  4U3C A;  3UQ4 A;  4EZ4 A;  5LHI B;  5JH7 E;  5HCJ A;  3H3M A;  3CX7 B;  1X9B A;  5E0O A;  1B7T A;  1BR4 A;  5AQN B;  4IIJ E;  2WMO A;  1IJ6 A;  4XAX B;  4O4J E;  3KIN B;  2HN2 A;  4PFP A;  3LDQ B;  2CCQ A;  3ZJ2 A;  5C2T A;  4AI6 A;  3RC3 A;  3P4P A;  4PK5 A;  5KXJ A;  3ZC0 A;  2KZ7 B;  3RKG A;  5AQT B;  1D0X A;  3MZK B;  2ACZ A;  4AQF A;  4BJN A;  1N36 T;  2LOP A;  5AQV B;  4EED A;  4BA9 A;  4I55 E;  3UFG A;  3D0T A;  4B3T T;  3ZSS A;  3AE8 A;  2NTY A;  2IUB A;  3PUS A;  2YEV C;  2V7I A;  2NOX A;  2N2N A;  1SE7 A;  3C4W A;  3KV5 A;  2X9W A;  4ZHQ E;  3C4X A;  3SFE A;  3AA1 B;  4NXM T;  2KBB A;  2MOZ A;  2V8S V;  3UTK A;  4G2A A;  3UUM A;  5JDF A;  2D0T A;  2WDR A;  3RRW A;  3HKB E;  3MAC A;  3PUX F;  1HG5 A;  3ZMU B;  5DAB A;  4DV5 T;  1UUR A;  4I4T E;  2CMR A;  5ADX L;  3ETV A;  3VRB A;  3SOL A;  1KNR A;  1YXR A;  3I9Y A;  4YSX A;  5JTG A;  1VCT A;  3I1A A;  4LF9 T;  4TZ4 C;  3K3N A;  4BJM A;  4DV7 T;  3L09 A;  2VWA A;  5HEH A;  1US7 B;  3GN5 B;  2W2U A;  4OYK A;  4YXD A;  1OED E;  4CXX A;  1LKX A;  5TAO A;  2CHN A;  3KVB A;  3EAM A;  2OLT A;  1UX5 A;  1T7S A;  4L5G A;  2LEH A;  5LXT E;  2C5K T;  4DR3 T;  1XNQ T;  3K8P C;  4IE5 A;  2OA5 A;  2DI4 A;  3AXJ B;  4YTM A;  4TWH A;  4OHF A;  2AE9 A;  4DV1 T;  2B1E A;  3W15 B;  2SPC A;  3RH3 A;  3I9W A;  3KDS E;  5L3C B;  2X66 A;  2CHO A;  5JDH A;  2WCA A;  2IAK A;  3K3Q C;  4M1P A;  4HFC A;  3N9N A;  2UUA T;  2D5U A;  3WAJ A;  4JI1 T;  2ZM6 T;  3EHZ A;  4B6X A;  1IJ5 A;  4EOZ B;  1MMD A;  2XQA A;  5CB4 E;  5IYZ E;  2J4G A;  4KUM B;  3VJZ A;  4YJ3 E;  2JMK A;  3I0O A;  4H9S E;  3JAF A;  2XHE B;  3RIU A;  1W09 A;  3DTO A;  3ABV A;  5FVK A;  2RP4 A;  1XMQ T;  4JI3 T;  3X1D A;  4O4L E;  5L2L A;  3GMI A;  4DUY T;  5LJM A;  2W61 A;  3LK3 B;  1YW0 A;  1IBL T;  5JR9 A;  4B3S T;  1Y01 A;  3OPC A;  3UU6 A;  3T1Y T;  3AVS A;  3N9M A;  4QHO A;  4DBR A;  4ILB A;  2VVS A;  3HA4 A;  2YU1 A;  2BVL A;  1MNE A;  3V5U A;  2LSY A;  3PUZ F;  4EAH A;  4FJO A;  4DO0 A;  3Q5E A;  3ANW B;  4HEA A;  1E2A A;  4UEL A;  3PUV F;  4O2A E;  2DWG A;  3CX8 B;  4QXC B;  1XWM A;  2LSK A;  3IA3 A;  1N33 T;  5A1L A;  2K24 A;  3U3I A;  5ABF A;  2KMF A;  3OJA A;  4PK6 A;  3JCF A;  2DWK A;  2XPK A;  4HFH A;  4PJJ A;  2LLY A;  5HXE A;  4HN9 A;  3RYH E;  3QK6 A;  2C5J A;  5LHH B;  3RIU C;  4HGA A;  5J2T E;  2CWY A;  4CXY A;  4AIU A;  5DJQ C;  2NR4 A;  4ZS2 A;  3UUN A;  2X0H A;  1MIY A;  2JQH A;  1HG2 A;  3CQC B;  2V7M A;  3NRY A;  5L47 A;  1KF6 A;  2LSI A;  3CWZ B;  2W0G A;  2ZLY A;  2Q9Q C;  2WU2 A;  2JIW A;  3AE3 A;  3OKQ A;  2X0C A;  3O4X E;  2P9B A;  2L10 A;  4IE7 A;  3FYQ A;  3V5S A;  1D0Z A;  1T98 A;  4K0U A;  1CHU A;  3ZT5 A;  2LHR A;  3ZPO A;  4LMJ A;  2L3L A;  3PDY A;  3ZYM A;  2XAJ B;  4WYV A;  4EYU A;  3LK4 2;  2WMN A;  1KNP A;  2PFV A;  3O1J A;  2WU5 A;  5J2U E;  4DR1 T;  4HWH A;  2KT9 A;  3QOF A;  5LG3 A;  2XQ8 A;  4UF0 A;  1ZP0 A; 
#chains in the Genus database with same CATH homology
 2C5I T;  3AAA B;  3KV6 A;  2KLQ A;  2JJ9 A;  3H37 A;  2N1G A;  3FBZ A;  2Y8D A;  3EDU A;  5LG4 A;  4CZZ B;  4CI3 B;  4MLK A;  4WBN E;  2X9Y A;  4CI2 B;  4GYR A;  4PFO A;  4GOU A;  3C50 A;  2ZM2 A;  4TUY E;  2A72 A;  5HXS A;  3N5L A;  2JQQ A;  5LNK A;  2PBI A;  1SA0 E;  2HPL A;  2V7L A;  4IE0 A;  4KMC A;  4EYY R;  4PW8 A;  4FI5 A;  1E1H B;  3LJC A;  1WLX A;  5F3J A;  3PUG A;  3L3P A;  3O9X A;  3J7Y q;  3RYI E;  3ZJ1 A;  4GK5 E;  2MBG A;  1D1B A;  5H6R B;  4EIW A;  3RYF E;  3ANW A;  4JUY A;  4I50 E;  3CML A;  4E7S A;  3TKL B;  2YK0 A;  5KX5 E;  2X9H A;  4DMW A;  4C90 A;  5LBQ B;  4JLE A;  2QGS A;  4O4I E;  4AQF C;  4O4H E;  4F6R C;  5JDM A;  2UXX B;  2JPF A;  2X9X A;  5LHI B;  4EZ4 A;  2IC6 A;  3LBX A;  2IC9 A;  2VKJ A;  5JH7 E;  1QUU A;  4GYS A;  4JEU B;  5FXW A;  5HXH A;  2WSS V;  3CX7 B;  3PE0 A;  4P0A A;  3C98 B;  4I43 B;  3KV9 A;  1B7T A;  5E0O A;  4H9Q C;  4A56 A;  1S35 A;  1BR4 A;  3AB3 B;  2ES0 A;  4ILU A;  1Y64 B;  4WBO A;  4IIJ E;  2WMO A;  1IJ6 A;  1S94 A;  2DLR A;  2VK9 A;  4XAX B;  4ZI2 C;  4HE8 A;  4O4J E;  3J9X 1;  1OXZ A;  2LJL A;  3AAI A;  3KIN B;  5JRC B;  3B13 A;  4HTE A;  3HL6 A;  3ONX A;  4UEM A;  3M65 A;  2DNX A;  2JRK A;  4X1K E;  5L3F B;  4PFP A;  3HI2 A;  2CCQ A;  1MIW A;  3DJB A;  3ZJ2 A;  1HX8 A;  4EZH A;  3JC6 C;  3NRX A;  3F2E A;  4AI6 A;  3RC3 A;  3N2G E;  1V9D A;  4PK5 A;  3N9O A;  3ZC0 A;  1BR0 A;  5FXX A;  3AT7 A;  3GA8 A;  4GIW A;  2E9X B;  3IEE A;  3C51 A;  2KZ7 B;  3KBU A;  4H9R C;  2XQY A;  1OWA A;  5LGT B;  1D0X A;  3MZK B;  2X51 A;  2LM9 A;  1LVF A;  4J2C A;  1WR6 A;  2EHO B;  3Q9D A;  2H3R A;  3ZCJ A;  4AQF A;  4BJN A;  3ZMT B;  2LOP A;  4BA9 A;  4I55 E;  3AA6 B;  2ODV A;  3KV4 A;  2V7K A;  2XTL A;  3D0T A;  3EUH A;  4HKA A;  3ZCI A;  5IHY A;  5DQV A;  3Q5W A;  1X79 A;  2NTY A;  1U5P A;  3O1I A;  1HFA A;  4AKR B;  2PJQ A;  2N9D A;  1NWM X;  2X68 A;  3PTR B;  1KK7 A;  4H9P C;  3C4Z A;  3PUS A;  5M4Y A;  2YEV C;  2V7I A;  5KMG P;  3SWH A;  4OFZ A;  2M67 A;  2NOX A;  5AFU L;  1ZKE A;  4UV9 B;  2N2N A;  3VKH A;  3C4W A;  4PJM A;  5JDN A;  1IZN B;  3KV5 A;  5L3G B;  1FIO A;  2MTC A;  3E22 E;  2D0U A;  2X9W A;  2L9Q A;  2LT3 A;  3C4X A;  3FXE B;  4ZHQ E;  3AA1 B;  3IF8 B;  3IHR A;  4ANJ A;  5DQW A;  2BVM A;  3CQG B;  1HF8 A;  3R6N A;  5HWX A;  5H6Q B;  2MOZ A;  5JR9 B;  5FY1 A;  3CVR A;  3UTK A;  4G2A A;  2L8K A;  4X1I E;  3UUM A;  5JDF A;  2D0T A;  2E9X D;  5HXR A;  2Y48 B;  5JDQ A;  3UUX B;  2ZMA A;  3RRW A;  3HKB E;  3SS1 A;  3MAC A;  4KP3 C;  1ZV4 X;  4YHJ A;  1EZ3 A;  2I59 A;  1HG5 A;  3ZMU B;  4DBQ A;  5DAB A;  4UXN B;  4AKH A;  1D1C A;  5LBM A;  4EB6 E;  2CE7 A;  3IBP A;  4E7Z A;  4I4T E;  2CMR A;  2XAF B;  2IW5 B;  4UVC B;  5ADX L;  2X0L B;  3ETV A;  5C8Y E;  3SOL A;  5HXC A;  2V26 A;  3WSC A;  3I9Y A;  3I1A A;  4NUV A;  2CLY B;  3ZEF B;  4TZ4 C;  3K3N A;  3SRZ A;  4BJM A;  4AKL A;  4XBF B;  2ODU A;  3AVR A;  3L09 A;  5LP6 E;  3CQX C;  5EK4 A;  3HKC E;  4MHC A;  3ZC1 A;  2J1D G;  4AKI A;  5ETW A;  1YKE B;  2VWA A;  1UX4 A;  2XAG B;  4UIG A;  4TV8 E;  3T8O A;  2VB6 A;  1O3X A;  5FP3 A;  4ZI3 D;  4QKN A;  1G73 A;  1US7 B;  2GK9 A;  1LVK A;  4PK4 A;  3GN5 B;  4OYK A;  5JRE A;  2D2S A;  4KBM B;  3ZYK A;  4CXX A;  3ZMV B;  1LKX A;  2WM9 A;  2WBL A;  5TAO A;  3UUL A;  1Z0P A;  4JEH B;  3KVB A;  1YKH B;  3HKE E;  2YIN A;  1UX5 A;  4TV9 E;  4U74 A;  2DCF A;  4H9O C;  4L5G A;  3P7I A;  5EZY E;  2LEH A;  5LXT E;  3WUR A;  4YJ2 E;  5LJN A;  3N9P A;  2C5K T;  5LCY A;  3EDV A;  5T1D A;  3PUR A;  2LSG A;  3K8P C;  3ZLI A;  1BR1 A;  4IE5 A;  2VKD A;  2OA5 A;  2DI4 A;  5JRC A;  5FY7 A;  3S4U A;  4OHF A;  2BZB A;  2B1E A;  3W15 B;  2SPC A;  4ERR A;  2NW7 A;  4X1Y E;  3PUA A;  3RH3 A;  3BK9 A;  4ZI3 C;  3I9W A;  3KDS E;  4U72 A;  3RYC E;  1UCU A;  5L3C B;  4PNI A;  4YLH A;  2X66 A;  1YD8 G;  5JVD E;  3ZN0 B;  4AXP A;  1AJ3 A;  4XZC A;  5JDH A;  4DMV A;  2IAK A;  3K3Q C;  3BQK A;  4M1P A;  2KWI B;  2VKO A;  3OYX A;  5JR9 C;  1QSD A;  3N9N A;  1U4Q A;  3CPZ A;  2D5U A;  4G63 A;  3WAJ A;  1MND A;  2E8I A;  5L3E B;  4BGO A;  4V1A v;  2XAQ B;  4B6X A;  1IJ5 A;  4EOZ B;  4EXT A;  3PU8 A;  4DND A;  1MMD A;  5FY0 A;  4QXH B;  5CB4 E;  1HTJ F;  3RC8 A;  2MTQ A;  2Y6X A;  5IYZ E;  3O1H A;  2CM0 A;  5HAX A;  5J1G A;  3MK7 C;  4DVD A;  4AKG A;  1KNZ A;  4KUM B;  3F31 A;  4H9N C;  3Q5X A;  3VJZ A;  4YJ3 E;  5L3D B;  2JMK A;  3NBX X;  2VL8 A;  4X20 E;  3I0O A;  1MIV A;  2CWO A;  3QUJ A;  1D1A A;  4H9S E;  4ZOL E;  3B57 A;  2XHE B;  3RRC A;  3F57 A;  3DTO A;  3ZYL A;  4IE6 A;  2RP4 A;  4P0B A;  5JQG E;  5L2L A;  4O4L E;  3GMI A;  4ONR A;  5CA0 E;  1BR2 A;  5LJM A;  2W61 A;  3LK3 B;  2JMH A;  1YW0 A;  3PU3 A;  2CA5 A;  3VU7 H;  5GON E;  3BQL A;  3RKO A;  2EHO D;  5HWY A;  2Q9Q B;  5JR9 A;  1IAP A;  4QWN B;  2CEA A;  4PAG A;  2KWH A;  3NZQ A;  5JDL A;  2CXF A;  3RPU A;  4UF0 B;  3MKD A;  3N9Q A;  2NWB A;  2UXN B;  3AVS A;  3H3A A;  2H7O A;  4UV8 B;  4ZI7 E;  1WYB A;  5LHG B;  1NAF A;  2ZM8 A;  3N9M A;  4QX7 B;  3PUQ A;  3RX6 A;  3C64 A;  4MFR A;  4QHO A;  2RA1 A;  4DBR A;  2BDE A;  3U78 A;  5FYM A;  4AQG A;  3HA4 A;  2YU1 A;  2BVL A;  3EVY A;  1MNE A;  4PJL A;  4H63 H;  4QXB B;  3GWH A;  3V5U A;  4O8S A;  3LK2 B;  2LSY A;  3DP7 A;  4WW0 A;  4EAH A;  4FJO A;  4ZI2 D;  1FMV A;  1MMA A;  4DO0 A;  5KDM C;  2DHR A;  1SHZ C;  3ANW B;  4HEA A;  2HH7 A;  3ZMS B;  3FHN A;  2E9X C;  4TN7 B;  2V1D B;  4UEL A;  3HR0 A;  4O2A E;  2WWU A;  2CXL A;  4OYJ A;  2DWG A;  3JC6 D;  3LFM A;  4GK0 E;  2EHO C;  3CX8 B;  3LBX B;  4IDZ A;  2LSK A;  2W00 A;  2KXP B;  4QXC B;  4CI1 B;  1WRD A;  5A1L A;  2K24 A;  3U3I A;  3OYZ A;  5JDG A;  4IST A;  3GN5 A;  2K9A A;  5FMN A;  2PG8 A;  2XUE A;  2KMF A;  1FMW A;  4TX5 A;  3N2O A;  3OJA A;  4PK6 A;  2DWK A;  2HPJ A;  4PJJ A;  3ZMZ B;  2LE8 A;  2Q9Q D;  2H7V C;  2LSJ A;  3K3O A;  5HXE A;  2W63 A;  4QX8 B;  4ASK A;  5HYA A;  4HN9 A;  3ETU A;  2KND A;  4HFV A;  3QK6 A;  3RYH E;  2G0U A;  3AAE B;  1VRB A;  3Q2M A;  4H63 V;  4UVB B;  2A3D A;  3ZN1 B;  2C5J A;  2LHN A;  2W62 A;  4ZS3 A;  3AA0 B;  3UT5 E;  2KIN B;  5LHH B;  4MBQ A;  3KBT A;  4HGA A;  5J2T E;  3VKG A;  3CKD A;  2CWY A;  4CXY A;  4L0R A;  3LG7 A;  3R84 B;  2A2F X;  2ACX A;  2K5B B;  3NZP A;  3P8C D;  5DJQ C;  1LRZ A;  4BAY B;  4ZS2 A;  2ZM0 A;  5F8P A;  2E9X A;  3UUN A;  3N2K E;  5EK2 A;  2NW9 A;  4YFS A;  4L9I A;  5EK3 A;  1ZEE A;  2EHO A;  2MYS A;  3MA9 A;  2LQU A;  2VAS A;  3I0Q A;  1MIY A;  2K48 A;  1HG2 A;  2NTX A;  2WAU A;  3CQC B;  5FXV A;  2V7M A;  3NRY A;  1HS7 A;  2LSI A;  3PF0 A;  3CWZ B;  4PJN A;  2W0G A;  2ZLY A;  4IE4 A;  4IHJ E;  2Q9Q C;  5LOV E;  2C0S A;  4O2B E;  3M1C A;  4CQI A;  3OKQ A;  3O4X E;  4CXW A;  4N78 D;  3PHF 1;  5LA6 E;  4ADZ A;  2P9B A;  2X67 A;  3OBV E;  4IE7 A;  3MXZ A;  3V5S A;  2VKH A;  1D0Z A;  1T98 A;  4K0U A;  2NP9 A;  4P09 A;  4Z8X A;  3CX6 B;  4OK0 A;  3BQI A;  3E08 A;  1D0Y A;  3FXD B;  3QC9 A;  1WYC A;  1VOM A;  4ISS A;  4NUU A;  2CLY C;  2XAH B;  4C91 A;  5L3B B;  4MAL A;  2V7J A;  2XAS B;  2CXD A;  1MMN A;  2YU2 A;  3E0Z A;  3A5X A;  3UFE A;  3MJX A;  3ESL A;  1G8X A;  1FEW A;  2LHR A;  4WNK A;  3ZPO A;  3FB2 A;  2L3L A;  3HKD E;  1HCI A;  3WI3 A;  4UVA B;  3PDY A;  1H7C A;  2LOS A;  2QA7 A;  3ZYM A;  5LYJ E;  3N9L A;  1MMG A;  2XAJ B;  3KFW X;  5CA1 E;  4ECG A;  1ZHC A;  3KVA A;  3LK4 2;  2WMN A;  5FNV E;  5FXZ A;  3WAK A;  4EYU A;  5BMV E;  3VHL A;  2PFV A;  5LGN B;  1CUN A;  3O1J A;  5J2U E;  2Q9Q A;  2Z6E A;  3AA7 B;  2NW8 A;  2KT9 A;  3FBL A;  5LGU B;  4UF0 A;  4IGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...