5HWYA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 10 mm na+ and zero ca2+
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
Knots found
sequence length
300
structure length
300
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEENNDKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
molecule keywords Uncharacterized membrane protein MJ0091
total genus 133
structure length 300
sequence length 300
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hwyA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hwyA02
5HXCA 5JDFA 5JDHA 5HXRA 5HXEA 5HWYA 3V5SA 5JDGA 5JDMA 5HWXA 5HXHA 5JDQA 5JDNA 5HYAA 5HXSA 3V5UA 5JDLA
chains in the Genus database with same CATH superfamily
3UTKA 1YKHB 2M6BA 5EK4A 2FBWA 3PUZF 4HWIB 3PU8A 3VHLA 3FXDB 5C3JA 4A5XA 1ZEEA 4ZS2A 4QXHB 3H3MA 4UEMA 2LT3A 4AIUA 3TLUA 4PJMA 4EV6A 3OYZA 5L47A 4M1PA 3T1HT 4JI4T 3T1YT 4B3RT 4MALA 1WCRA 2VK9A 2CRBA 2ZMAA 1GQEA 2A9UA 2JIWA 4O4HE 5AQRB 3WSCA 4U31A 4L0RA 2I59A 2X0HA 3P4WA 4HN9A 2CMRA 1FEWA 1XDOA 2CA5A 4UVAB 3ZC0A 1XMQT 1UX4A 5FZTA 4YHHT 2Y48B 3AA6B 5LXTE 1YW0A 3C98B 5FL0A 1VCTA 5EK3A 4PNIA 3U78A 3J9X1 4HFBA 1XDPA 4QH5A 4DMWA 3ZT5A 5L3DB 3ZMVB 2X9HA 2M67A 3Q5WA 4H63V 4ZS3A 4CN1A 3SFDA 1W0BA 2W66A 1ZKEA 2DCFA 1IJ6A 1FMWA 1KK7A 4AQGA 2B1EA 1NENA 2UXDT 4EB6E 2BVLA 4UXNB 2NW7A 2WCAA 4IDNA 4U33A 4YHJA 2V5DA 4EYUA 2NTXA 3K1SA 1DU2A 3CWZB 4U7IA 2X0LB 2RPAA 1IAPA 4GYRA 2JJ9A 4XAXB 5AQNB 4TV8E 1S94A 5JDFA 4WYVA 2VKDA 3EDUA 1LKXA 4IHJE 3BQLA 3ZT7A 1HNZT 5LJMA 5BMVE 2JQQA 4ISTA 1XWMA 5C2TA 5CA0E 4DNDA 2VWAA 4GK5E 1OWAA 5FY0A 2YOEA 3TLVA 3UULA 4GKKT 2WY2A 3AVRA 2PJQA 3L8RA 2HH7A 2LE8A 3WI3A 5JDNA 5L3EB 2XSBA 4ZHQE 4HFIA 3IEEA 3K3OA 3A7MA 5CFBA 3HKCE 2NW9A 5AQFB 4P0AA 4O4IE 2ZM0A 2J4GA 2CXLA 4UELA 4W8PA 3FXEB 2V7JA 4YY3T 2V7LA 5AQKB 4PK4A 1D0ZA 1HX1B 3FZFB 4NIQA 4L9IA 3VR8A 3AE3A 4A56A 3CX7B 3RH3A 3EVYA 3P4RA 4N78D 4DV4T 3I0OA 1S35A 2FJDA 2JMKA 1US7B 4UVBB 4X1IE 2XAFB 5H6RB 4DV5T 3DP7A 4XZCA 2VURA 2VKHA 5DJQC 3UU5A 4CXYA 3P50A 1VOMA 3AA0B 4O4JE 4ZZCA 4DUYT 3RGLA 4I0UA 3QOFA 5FY1A 2VVSA 2BG9B 4OFZA 2W0GA 5AQLB 4GKJT 5HXRA 5ABHA 1Y64B 2IIUA 5FY7A 4DR7T 2M6IA 2D2SA 2XPKA 1WRDA 4LF6T 3RIFA 4U2YA 2KWIB 4DR4T 2D0TA 2ODVA 3JAFA 4AKRB 4XBFB 2JRKA 5HYAA 5IUXA 4ZI7E 2LSJA 2V1DB 2H7VC 4I43B 5AQUB 1WLXA 5F3JA 1WR0A 1T8BA 2A3DA 3CQGB 3ZJ1A 4CI3B 4DIDB 4F6RC 4P1NA 5JH7E 1N36T 1SJ7A 4H9RC 5AQGB 3R84B 1JNRA 3RYHE 2KVPA 4UVCB 2ZLYA 3GWHA 2E9XA 1MMAA 2K9AA 1HS7A 2BKNA 2VKJA 3AAAB 5AQMB 1D0YA 3RIUA 4BGOA 3LBXA 4HTEA 4ZI3D 5GONE 2YU2A 4QX7B 4KP3C 3PURA 2KBBA 4U72A 2X68A 5JRCB 1E1HB 2LM2A 4P0BA 4LFBT 4YXDA 5HEGA 3IF8B 3WAKA 2K5BB 2WM9A 1QLBA 1IBKT 2YDQA 3ZEFB 5FXWA 2BDEA 3M65A 4JI5T 4IGUA 2CLYC 3NRXA 3WURA 2WP9A 4ECGA 3PUSA 3KFWX 3PTRB 4QXCB 5LGNB 3UT5E 2L10A 2MTCA 2IC6A 4QH1A 4HWFA 2XAHB 1WFDA 3KVAA 2KMFA 1LVKA 3OBVE 3RKOA 4AKLA 3CK6A 2KNDA 3AEEA 1ZOYA 3CQCB 4IE5A 5L4HA 2Q9QD 3E08A 3RLFF 5CA1E 5JDQA 4DV6T 4ZI2C 5J2UE 2HN1A 3AE6A 1LVFA 4PFOA 4X5TA 2CWOA 2YN6A 2DL1A 2DI4A 1KF6A 2UUAT 5JTGA 2VL8A 2FUPA 2YDSA 1R8IA 4UR9A 2N9DA 3HKBE 4F8HA 5JDHA 1H7CA 3E22E 1OXZA 2V7KA 5HWYA 3UUBA 2E9XB 4LF7T 3HKDE 2HN2A 1UX5A 2WZHA 2QA7A 4ILBA 4TWDA 1UURA 2CLYB 2IDOB 1NWMX 4HFCA 2F4VT 2I0MA 3RF1A 2V6YB 3AAEB 2H3RA 5H6QB 4C90A 5J0ZA 4YLHA 4K0KT 3TLSA 2KGXA 2YINA 5JR9A 4PW8A 1HTJF 3SFEA 4ERRA 4ZEYA 5JQGE 5L3FB 2J62A 3PUYF 2I6HA 3CIRA 4LF9T 2CBJA 2IHR1 3TLWA 4YSYA 2NWBA 5IYZE 3RRWA 4HKAA 1VRBA 2L9QA 5LYJE 4PJJA 5LCYA 2D9DA 5M4YA 3A5XA 4FJOA 4JI8T 3M3ZB 4NXNT 3ANWA 3N9NA 4AXPA 3E0ZA 3FYQA 2X0CA 3F31A 2LHRA 3AEDA 3N2OA 2WB5A 3NBXX 3ONLC 3PUAA 4NPPA 4PJNA 5EZYE 5CJ5A 4IDZA 4ADZA 1BR0A 4HWDA 1HNWT 5DQWA 3ZC1A 3UUNA 2XQ9A 3OVUA 5LMNT 2PBIA 4CI1B 2AXDS 5AFUL 3EAMA 2LOSA 3KBTA 1YQ3A 2LRLA 1UCUA 4ILCA 4JLEA 2QRXA 2BKOA 1QSDA 5DABA 3RHWA 3RRCA 3RX6A 3AB3B 3OPCA 4IE0A 4O2BE 3RI5A 2BBJA 3BK9A 4LMJA 3UQ4A 1E7PA 4E7SA 5HXHA 2LM9A 1MMGA 1SUMB 3NWIA 5LGUB 4BA9A 2BS2A 3AXJB 5FVLA 3FZHB 3LBXB 1IBLT 3ZPOA 4AKHA 3C50A 4JEHB 4TV9E 1KFYA 4LFAT 4KHPT 3AE1A 2VVNA 2XHEB 3CKDA 1NAFA 5KMGP 3VRAA 3LJCA 4I4TE 3UU6A 2WWVA 5BR8T 2XZEA 1I6ZA 3AE4A 4IE7A 2V8SV 3N9LA 4X1YE 3AE7A 5IHYA 3T8OA 4MFRA 4EEBA 5HWXA 2E9XC 4H9SE 3ZMSB 2PFVA 3AE9A 3AE5A 2DWKA 2KXPB 5HEUA 3RIUC 3MXZA 2XQ6A 2VKOA 4L5GA 5E0OA 1W09A 3RYCE 4B3ST 3A8YC 3UU4A 3FB2A 5CB4E 3FZKB 3HR0A 1MIVA 2K24A 4YFSA 5LNKA 4HFVA 3VRBA 2KINB 2NTYA 3O9XA 3RYIE 4HWHA 2OLTA 3C64A 1J1JA 1SHZC 4I55E 2X67A 3F57A 5AQOB 3P4QA 5JREA 2GK9A 1KEYA 4Z90A 3OJAA 2CXDA 3AEAA 4UV9B 4V1Av 3UFEA 2K48A 1HR0T 4LFCT 4AKGA 5JR9B 5LJNA 4GYSA 4Z8XA 3DTOA 3G06A 3JCFA 2XAQB 4H9QC 1ZV4X 4J2CA 1HFAA 3NRYA 1E2AA 3IBPA 2HPLA 5HEOA 5FL1A 2RA1A 4QXBB 2EHOB 3NVOA 3MJXA 2QYWA 3ZYKA 4LF5T 2DWGA 2YDRA 1MNDA 2C5KT 3SS1A 3L39A 3ONXA 3KV9A 1OEDA 4HEAA 4C91A 1HNXT 3VKGA 1UUSA 1CHUA 2EHOC 2P9BA 2UXNB 1T7SA 3PDYA 5L3BB 4DV7T 4IREA 4E7ZA 5ADXL 2X51A 5T1DA 2L7NA 2ACXA 1N32T 4NXMT 4GOUA 4P09A 1VCSA 1YD8G 2BG9C 2V5CA 3PUVF 3ZMUB 2MTQA 5L4EA 4DBQA 2UXXB 3JC6D 2L3LA 5HCMA 3OYXA 1UK5A 5HXEA 1XNQT 1FIOA 3X1DA 4COFA 4BJMA 4CXXA 2XSAA 4PJLA 5FXXA 3TLTA 1O3XA 2YKSA 3V5UA 2KLQA 3PJAA 4AQYT 4IL4A 2WU2A 4NUUA 4AKIA 4YJ2E 3RQWA 2Y6XA 2FJAA 2WBLA 2LRKA 3PUXF 1MMDA 2WWUA 4X20E 4YT0A 3AEGA 3I0QA 3WAJA 2XQ5A 2LSYA 2EHOD 5HAXA 3NKZA 3RQUA 4DBRA 4JI6T 2IC9A 5LGTB 4TNWA 2BZBA 3PF0A 2CCQA 2JQHA 3CPZA 4O2AE 4B3MT 4YTMA 5ABFB 5LB7B 4DR2T 4Q25A 4PK5A 4PFPA 4TUYE 1J5ET 3KV4A 2W67A 3I9WA 4PK6A 3B13A 3KBUA 3KDSE 4ONRA 3VJZA 5AQIB 2XAGB 3KV6A 3EABA 3QC9A 4AQFC 4JI7T 2E8IA 2J1DG 1YKEB 1W0AA 3NZPA 1QUUA 4X66T 2E5LT 2JMHA 3AEFA 3PE0A 3KV5A 3B57A 3KVBA 3N2GE 2MOZA 5IWAT 4EZ4A 4DV1T 3DJBA 2V26A 3D0TA 2LOPA 3W15B 5HXSA 4YJ3E 1OEDB 3GMIA 1N34T 4HGAA 4I50E 5FP3A 1OEDE 4UIGA 3C51A 4DV0T 2E5VA 4X1KE 3ZT6A 2ACZA 2D5UA 2LKHA 2SPCA 5EK2A 1WYCA 3LDQB 3LG7A 4KX6A 1IJ5A 5HXCA 2W4XA 4AISA 2LQUA 3C4WA 3LSVA 4BJNA 2CEAA 2WSSV 4B3TT 2FJBA 1BR1A 3P7IA 4IT4A 3MK7C 2XQYA 4WBNE 4UF0B 5AQVB 2E9XD 2MAWA 2C0SA 3JADA 1LRZA 1UGOA 5TAOA 2IAKA 3P4SA 5L2LA 2R6GF 4O8SA 4IDQA 3GN5B 1J5WA 3ETUA 2WMNA 2PTFA 4KBMB 1KNPA 3FHNA 3UQ7A 3AAIA 1HCIA 4H9OC 2CXFA 4TZ4C 3P8CD 4QHOA 2UUCT 4ZI3C 3KINB 4EAHA 4EZHA 3LK42 2XQAA 3UFGA 4JUYA 2NP9A 1IZNB 3Q5DA 2D0UA 4WW0A 3Q5XA 4G63A 4LF8T 4TN7B 5LG4A 2HHHT 1KNZA 1OEDC 2G0UA 1X9BA 3CX6B 2BS4A 3N9QA 3RPUA 5A1LA 1HG2A 5AQPB 3SRZA 4ILAA 1CUNA 1YXRA 2BVMA 2XM2A 3AVSA 3PU3A 4H63H 3EUHA 2BG9A 3LK3B 1MIYA 2KT9A 5F8PA 3ZMTB 4MLKA 1MIWA 1WR6A 2N2NA 1XNRT 5CGMA 2VB6A 5KXJA 1W9RA 5JR9C 2ZM8A 3QB5K 2VQFT 2C5IT 2KSRA 4X65T 2V7IA 4KHZF 2IUBA 4PAGA 2X9YA 1FJGT 3K3QC 4B6XA 3P4PA 5J1GA 2W00A 2W63A 4TWFA 1D0XA 4UF0A 2XUEA 3UUMA 2WMOA 4YTNA 3AA7B 1N33T 4IL9A 4NUVA 3N9OA 2XQ8A 1IBMT 3Q5EA 3PV0F 5HCJA 2BG9E 5DQVA 1V9DA 5FNVE 3ZCJA 4U7YA 3UU8A 3ANWB 3S4UA 2H89A 3ESLA 4IDOA 3B5MA 2KZ7B 2NOXA 3HI2A 2WU5A 4YSXA 2X9XA 3AE2A 3ZSSA 4JI1T 3AT7A 2Q9QA 2LHNA 2WDQA 2V7MA 3LK2B 2ZM6T 5LBQB 4BAYB 2MYSA 3ETVA 1U4QA 4U2ZA 4DV2T 2UUBT 3PHF1 4OYKA 3QK6A 2Y8DA 2W62A 3AY5A 1WYBA 3DYJA 4OK0A 4EEDA 2XQ4A 4WZXA 3V5SA 4A98A 4AQFA 1ZP0A 4Z91A 4ZI2D 2L8KA 2K3WA 3N2KE 2QGSA 2DNXA 4EXTA 3SOLA 3J7Yq 1SJ8A 2LSIA 5HEJA 3HL6A 3IA3A 3L3PA 2DLRA 4OYJA 2CE7A 1Y01A 4JV5T 3OKQA 1XZYA 1G73A 4JBWF 5LHIB 4DR3T 1Z0PA 1Z8UA 3R6NA 1XMOT 3PUQA 2A2FX 1SA0E 2NW8A 3JC6C 1X79A 3RC3A 2XY8B 4K0UA 4HFEA 4EOZB 3CVRA 2LSKA 2CHNA 5HEHA 5FYMA 3VR9A 5J2TE 3JAEA 3QNUA 2ES0A 4CI2B 3AE8A 4LF4T 5C8YE 5AQTB 2YK0A 1M7KA 2Z6EA 3N5LA 3CX8B 4JI2T 3VKHA 1AJ3A 1U5PA 4O4LE 4YTPA 5AQSB 2WDRA 2WDVA 3PUWF 2E2AA 5FXZA 5AQJB 3C4ZA 2MBGA 3GA8A 1YQ4A 4KMCA 3N9MA 2BS3A 3UUXB 2UXBT 5LBMA 3ZYMA 2FJEA 5ABEA 1B7TA 4TX5A 2CHOA 2DHRA 3BQKA 4IE6A 5LG3A 3K3NA 5ABGA 1EZ3A 3FZLB 5L3CB 4ZOLE 4ZZBA 2XQ7A 3GN5A 3I9YA 1ZHCA 4IIJE 4TWHA 4A97A 4WNKA 4DVDA 2HPJA 4EGWA 4ZXLA 2KWHA 2QVAA 2CM0A 5AQHB 2WQYA 3ZCIA 2WS3A 3IHRA 2OV9A 2X66A 3RKGA 5ETWA 5LHHB 4LMLA 4JEUB 2EHOA 2OA5A 1HX8A 2Q9QC 1L0VA 2YEVC 2WAUA 3F2EA 4X62T 4HE8A 2H7OA 5FMNA 3ONJA 2ODUA 3FBZA 5JDLA 2VQET 3FBLA 2W2UA 1MMNA 1JNZA 3O1HA 4ANJA 3BQIA 5LHGB 2AE9A 5L3GB 1FMVA 1HG5A 1T72A 2W61A 2XQ3A 2MPKA 2JQKA 3HKEE 2IMLA 4U74A 5FKYA 3RIAA 1BR4A 3ZMZB 3QB5A 5KDMC 4DR1T 3EHZA 2XM1A 4JYAT 1NEKA 4X64T 3RYFE 2Q9QB 4WBOA 5FVKA 1D1CA 4HFHA 3MA9A 3O4XE 4ILUA 4CN6A 4DUZT 2C5JA 3AEBA 4JI3T 2X9WA 2J47A 4HWCA 4KUMB 4EYYR 3H37A 4ISSA 4UV8B 2NR4A 2YU1A 3SWHA 4ASKA 3M1CA 4CZZB 3UU3A 3EI0A 3MKDA 3ZJ2A 2WZIA 3Q2MA 5FXVA 2XJ7A 4DO0A 2VL0A 3C4XA 4CN4A 4DR5T 3OTOT 2XAJB 3Q9DA 3HA4A 1KNRA 2BKPA 2X0YA 3FZMB 3MZKB 3O1JA 4GK0E 4KI0F 1MNEA 1SE7A 4OHFA 4MBQA 2CPTA 3O1IA 5LOVE 4IE4A 3ZLIA 4YSZA 3L09A 5JDMA 4DV3T 1I94T 4OX9T 3RC8A 3ZN0B 2XASB 2ZM2A 3LFMA 2N1GA 3ZYLA 3AA1B 2CWYA 4GIWA 4JI0T 2UXCT 1D1AA 3K8PC 5LA6E 5JRCA 4LMKA 2H88A 2LKGA 4DMVA 3EDVA 4H9PC 3ZN1B 2IW5B 3H3AA 1D1BA 5AQQB 1M62A 4TNVA 3ABVA 4FI5A 4QKNA 2JPFA 1HF8A 4MHCA 4QH4A 2A72A 4QWNB 4U3CA 4F7GB 4DR6T 2LEHA 2LJLA 4G2AA 2VASA 4AI6A 3VU7H 3AECA 3U3IA 1BR2A 2BBHA 5ABFA 5KX5E 4QX8B 5LP6E 4H9NC 3TKLB 4HFDA 2JQ9A 3CQXC 4CXWA 3AXJA 4CQIA 1G8XA 1T98A 3PUGA 2LLYA 3N9PA 2CBIA 5JVDE 4EIWA 2UU9T 3PJAJ 3QUJA 5F5WA 3ZKRA 2B76A 3CMLA 3ZSTA 2XTLA 5JDGA 3I1AA 3MACA 4IDPA 2PG8A 2V6YA 2RP4A 2V6XA 5LMUT 2LSGA 3NZQA
chains in the Genus database with same CATH topology
3UTKA 1YKHB 5EK4A 3PU8A 3VHLA 3FXDB 1ZEEA 4ZS2A 4QXHB 4UEMA 2LT3A 4PJMA 3OYZA 4M1PA 4MALA 2VK9A 2ZMAA 3WSCA 4O4HE 4L0RA 2I59A 4HN9A 2CMRA 1FEWA 4UVAB 2CA5A 3ZC0A 1UX4A 2Y48B 3AA6B 5LXTE 1YW0A 3C98B 5EK3A 4PNIA 3U78A 3J9X1 4DMWA 5L3DB 3ZMVB 2X9HA 2M67A 3Q5WA 4H63V 4ZS3A 1ZKEA 2DCFA 1FMWA 1IJ6A 1KK7A 4AQGA 2B1EA 2BVLA 4UXNB 2NW7A 4YHJA 4EYUA 2NTXA 3CWZB 2X0LB 1IAPA 4GYRA 2JJ9A 4XAXB 4TV8E 1S94A 5JDFA 2VKDA 3EDUA 1LKXA 4IHJE 3BQLA 5LJMA 5BMVE 2JQQA 4ISTA 5CA0E 4DNDA 2VWAA 4GK5E 1OWAA 5FY0A 3UULA 3AVRA 2PJQA 3WI3A 2HH7A 2LE8A 5L3EB 5JDNA 4ZHQE 3IEEA 3K3OA 3HKCE 2NW9A 4P0AA 4O4IE 2ZM0A 2CXLA 4UELA 3FXEB 2V7JA 2V7LA 4PK4A 1D0ZA 4A56A 4L9IA 3CX7B 3RH3A 3EVYA 4N78D 3I0OA 1S35A 2JMKA 1US7B 4UVBB 4X1IE 2XAFB 5H6RB 3DP7A 4XZCA 2VKHA 5DJQC 4CXYA 1VOMA 3AA0B 4O4JE 5FY1A 4OFZA 2W0GA 5HXRA 1Y64B 5FY7A 2D2SA 1WRDA 2KWIB 2D0TA 2ODVA 4AKRB 4XBFB 2JRKA 4ZI7E 2LSJA 2H7VC 2V1DB 4I43B 1WLXA 5F3JA 2A3DA 3CQGB 3ZJ1A 4CI3B 5JH7E 4F6RC 4H9RC 3R84B 3RYHE 4UVCB 2ZLYA 3GWHA 2E9XA 1MMAA 2K9AA 1HS7A 2VKJA 3AAAB 4BGOA 1D0YA 3LBXA 4HTEA 4ZI3D 5GONE 2YU2A 4QX7B 4KP3C 3PURA 4U72A 2X68A 1E1HB 4P0BA 3IF8B 3WAKA 2K5BB 2WM9A 3ZEFB 5FXWA 2BDEA 3M65A 4IGUA 2CLYC 3NRXA 3WURA 4ECGA 3PUSA 3KFWX 3PTRB 4QXCB 5LGNB 3UT5E 2MTCA 2IC6A 2XAHB 3RKOA 3KVAA 2KMFA 1LVKA 3OBVE 4AKLA 4DMVA 2KNDA 3CQCB 4IE5A 5CA1E 2Q9QD 3E08A 5JDQA 4ZI2C 5J2UE 1LVFA 4PFOA 2CWOA 2DI4A 2VL8A 2N9DA 3HKBE 5JDHA 1H7CA 3E22E 1OXZA 2V7KA 5HWYA 2E9XB 3HKDE 1UX5A 2QA7A 2CLYB 1NWMX 3AAEB 5H6QB 2H3RA 4C90A 4YLHA 2YINA 5JR9A 4PW8A 1HTJF 4ERRA 5JQGE 5L3FB 5LYJE 2NWBA 5IYZE 3RRWA 4HKAA 1VRBA 2L9QA 4PJJA 5LCYA 5M4YA 3A5XA 4FJOA 3ANWA 3N9NA 4AXPA 3E0ZA 3F31A 2LHRA 3N2OA 3NBXX 4PJNA 3PUAA 5EZYE 1BR0A 4IDZA 4ADZA 5DQWA 3ZC1A 3UUNA 2PBIA 4CI1B 5AFUL 2LOSA 3KBTA 4JLEA 5DABA 1UCUA 3RRCA 1QSDA 3RX6A 3AB3B 4O2BE 4IE0A 4E7SA 3BK9A 5HXHA 2LM9A 1MMGA 5LGUB 4BA9A 4AKHA 3LBXB 3ZPOA 3C50A 4JEHB 4TV9E 2XHEB 3CKDA 1NAFA 5KMGP 3LJCA 4I4TE 4IE7A 4X1YE 3N9LA 5IHYA 3T8OA 4MFRA 5HWXA 2E9XC 4H9SE 3ZMSB 2PFVA 4EB6E 2DWKA 2KXPB 3MXZA 5E0OA 2VKOA 4L5GA 3RYCE 3FB2A 5CB4E 3HR0A 1MIVA 2K24A 4YFSA 5LNKA 4HFVA 2KINB 2NTYA 3O9XA 3RYIE 3C64A 1SHZC 4I55E 2X67A 3F57A 5JREA 2GK9A 3OJAA 2CXDA 4AKGA 4UV9B 4V1Av 3UFEA 2K48A 5JR9B 5LJNA 4GYSA 4Z8XA 3DTOA 4J2CA 4H9QC 2XAQB 1ZV4X 1HFAA 3NRYA 3IBPA 2HPLA 2RA1A 4QXBB 2EHOB 3MJXA 3ZYKA 2DWGA 3SS1A 1MNDA 2C5KT 3V5SA 3ONXA 4C91A 3KV9A 3VKGA 4HEAA 2EHOC 2P9BA 2UXNB 5L3BB 3PDYA 5T1DA 4E7ZA 5ADXL 2X51A 2ACXA 4GOUA 4P09A 1YD8G 3ZMUB 2MTQA 4DBQA 2UXXB 3JC6D 2L3LA 3OYXA 5HXEA 1FIOA 4BJMA 4CXXA 4PJLA 5FXXA 1O3XA 3V5UA 2KLQA 4NUUA 4AKIA 4YJ2E 2Y6XA 2WBLA 4X20E 1MMDA 2WWUA 3WAJA 3I0QA 2LSYA 2EHOD 5HAXA 4DBRA 2IC9A 5LGTB 2BZBA 3PF0A 2CCQA 3CPZA 4O2AE 4PK5A 4PFPA 4TUYE 3KV4A 3I9WA 4PK6A 3B13A 3KBUA 3KDSE 4ONRA 3VJZA 2XAGB 3KV6A 3QC9A 4AQFC 2E8IA 2J1DG 1YKEB 3NZPA 1QUUA 2JMHA 3PE0A 3KV5A 3B57A 3KVBA 3N2GE 2MOZA 4EZ4A 3DJBA 2V26A 3D0TA 2LOPA 3W15B 5HXSA 4YJ3E 3GMIA 4HGAA 4I50E 5FP3A 4UIGA 3C51A 4X1KE 2D5UA 2SPCA 5EK2A 1WYCA 3LG7A 1IJ5A 5HXCA 2LQUA 3C4WA 4BJNA 2CEAA 2WSSV 1BR1A 3P7IA 3MK7C 2XQYA 4WBNE 4UF0B 2E9XD 5TAOA 2C0SA 1LRZA 2IAKA 5L2LA 4O8SA 3GN5B 3ETUA 2WMNA 4KBMB 3FHNA 3AAIA 1HCIA 4H9OC 2CXFA 4TZ4C 3P8CD 4QHOA 4ZI3C 3KINB 4EAHA 4EZHA 3LK42 4JUYA 2NP9A 1IZNB 4WW0A 2D0UA 5LG4A 3Q5XA 4G63A 4TN7B 1KNZA 2G0UA 3CX6B 3N9QA 3RPUA 5A1LA 1HG2A 3SRZA 1CUNA 3AVSA 2BVMA 3PU3A 4H63H 5HYAA 3EUHA 3LK3B 3ZMTB 1MIYA 2KT9A 5F8PA 5JR9C 4MLKA 1MIWA 1WR6A 2N2NA 2VB6A 2ZM8A 2C5IT 2V7IA 4PAGA 2X9YA 3K3QC 4B6XA 5J1GA 2W00A 2W63A 4UF0A 1D0XA 2XUEA 3UUMA 2WMOA 3AA7B 4NUVA 3N9OA 5FNVE 5DQVA 1V9DA 3ZCJA 3ANWB 3S4UA 3ESLA 3HI2A 2KZ7B 2NOXA 2X9XA 3AT7A 2Q9QA 2LHNA 2V7MA 3LK2B 5LBQB 4BAYB 2MYSA 3ETVA 1U4QA 3PHF1 4OYKA 3QK6A 2Y8DA 2W62A 1WYBA 4OK0A 4AQFA 4ZI2D 2L8KA 3N2KE 2QGSA 2DNXA 4EXTA 3SOLA 3J7Yq 2LSIA 3HL6A 3L3PA 2DLRA 4OYJA 2CE7A 3OKQA 1G73A 5LHIB 1Z0PA 3R6NA 3PUQA 2A2FX 1SA0E 2NW8A 3JC6C 1X79A 3RC3A 4K0UA 4EOZB 3CVRA 2LSKA 5FYMA 5J2TE 2ES0A 4CI2B 5C8YE 2YK0A 2Z6EA 3VKHA 3N5LA 3CX8B 1AJ3A 1U5PA 4O4LE 5FXZA 3C4ZA 2MBGA 3GA8A 4KMCA 3N9MA 3UUXB 5LBMA 3ZYMA 1B7TA 4TX5A 2DHRA 3BQKA 4IE6A 3K3NA 1EZ3A 5L3CB 4ZOLE 3GN5A 3I9YA 1ZHCA 4IIJE 4WNKA 4DVDA 2HPJA 2KWHA 2CM0A 3ZCIA 3IHRA 2X66A 5ETWA 5LHHB 4JEUB 2EHOA 2OA5A 1HX8A 2Q9QC 2YEVC 2WAUA 3F2EA 4HE8A 2H7OA 5FMNA 2ODUA 3FBZA 5JDLA 3FBLA 3O1HA 1MMNA 5LHGB 4ANJA 3BQIA 5L3GB 1FMVA 1HG5A 2W61A 3HKEE 4U74A 3ZMZB 1BR4A 5KDMC 3RYFE 2Q9QB 4WBOA 1D1CA 3MA9A 3O4XE 4ILUA 2C5JA 2X9WA 4KUMB 4EYYR 3H37A 4ISSA 4UV8B 4ASKA 2YU1A 3SWHA 3M1CA 4CZZB 3ZJ2A 3MKDA 3Q2MA 5FXVA 4DO0A 3C4XA 2XAJB 3Q9DA 3HA4A 3MZKB 4GK0E 3O1JA 1MNEA 4OHFA 4MBQA 3O1IA 5LOVE 3ZLIA 4IE4A 3RC8A 5JDMA 3L09A 3ZN0B 2XASB 2ZM2A 3LFMA 2N1GA 3ZYLA 3AA1B 2CWYA 4GIWA 1D1AA 3K8PC 5LA6E 5JRCA 3EDVA 4H9PC 3ZN1B 2IW5B 3H3AA 1D1BA 5JRCB 4FI5A 4QKNA 2JPFA 1HF8A 4MHCA 4QWNB 2A72A 2LEHA 2LJLA 4G2AA 2VASA 4AI6A 3VU7H 3U3IA 1BR2A 5LP6E 5KX5E 4QX8B 4H9NC 3TKLB 3CQXC 4CXWA 4CQIA 1G8XA 1T98A 3PUGA 3N9PA 5JVDE 4EIWA 3QUJA 3CMLA 2XTLA 5JDGA 3I1AA 3MACA 2PG8A 2RP4A 2LSGA 3NZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXC A;  5JDF A;  5JDH A;  5HXR A;  5HXE A;  5HWY A;  3V5S A;  5JDG A;  5JDM A;  5HWX A;  5HXH A;  5JDQ A;  5JDN A;  5HYA A;  5HXS A;  3V5U A;  5JDL A; 
#chains in the Genus database with same CATH topology
 3UTK A;  1YKH B;  2M6B A;  5EK4 A;  2FBW A;  3PUZ F;  4HWI B;  3PU8 A;  3VHL A;  3FXD B;  5C3J A;  4A5X A;  1ZEE A;  4ZS2 A;  4QXH B;  3H3M A;  4UEM A;  2LT3 A;  4AIU A;  3TLU A;  4PJM A;  4EV6 A;  3OYZ A;  5L47 A;  4M1P A;  3T1H T;  4JI4 T;  3T1Y T;  4B3R T;  4MAL A;  1WCR A;  2VK9 A;  2CRB A;  2ZMA A;  1GQE A;  2A9U A;  2JIW A;  4O4H E;  5AQR B;  3WSC A;  4U31 A;  4L0R A;  2I59 A;  2X0H A;  3P4W A;  4HN9 A;  2CMR A;  1FEW A;  1XDO A;  2CA5 A;  4UVA B;  3ZC0 A;  1XMQ T;  1UX4 A;  5FZT A;  4YHH T;  2Y48 B;  3AA6 B;  5LXT E;  1YW0 A;  3C98 B;  5FL0 A;  1VCT A;  5EK3 A;  4PNI A;  3U78 A;  3J9X 1;  4HFB A;  1XDP A;  4QH5 A;  4DMW A;  3ZT5 A;  5L3D B;  3ZMV B;  2X9H A;  2M67 A;  3Q5W A;  4H63 V;  4ZS3 A;  4CN1 A;  3SFD A;  1W0B A;  2W66 A;  1ZKE A;  2DCF A;  1IJ6 A;  1FMW A;  1KK7 A;  4AQG A;  2B1E A;  1NEN A;  2UXD T;  4EB6 E;  2BVL A;  4UXN B;  2NW7 A;  2WCA A;  4IDN A;  4U33 A;  4YHJ A;  2V5D A;  4EYU A;  2NTX A;  3K1S A;  1DU2 A;  3CWZ B;  4U7I A;  2X0L B;  2RPA A;  1IAP A;  4GYR A;  2JJ9 A;  4XAX B;  5AQN B;  4TV8 E;  1S94 A;  5JDF A;  4WYV A;  2VKD A;  3EDU A;  1LKX A;  4IHJ E;  3BQL A;  3ZT7 A;  1HNZ T;  5LJM A;  5BMV E;  2JQQ A;  4IST A;  1XWM A;  5C2T A;  5CA0 E;  4DND A;  2VWA A;  4GK5 E;  1OWA A;  5FY0 A;  2YOE A;  3TLV A;  3UUL A;  4GKK T;  2WY2 A;  3AVR A;  2PJQ A;  3L8R A;  2HH7 A;  2LE8 A;  3WI3 A;  5JDN A;  5L3E B;  2XSB A;  4ZHQ E;  4HFI A;  3IEE A;  3K3O A;  3A7M A;  5CFB A;  3HKC E;  2NW9 A;  5AQF B;  4P0A A;  4O4I E;  2ZM0 A;  2J4G A;  2CXL A;  4UEL A;  4W8P A;  3FXE B;  2V7J A;  4YY3 T;  2V7L A;  5AQK B;  4PK4 A;  1D0Z A;  1HX1 B;  3FZF B;  4NIQ A;  4L9I A;  3VR8 A;  3AE3 A;  4A56 A;  3CX7 B;  3RH3 A;  3EVY A;  3P4R A;  4N78 D;  4DV4 T;  3I0O A;  1S35 A;  2FJD A;  2JMK A;  1US7 B;  4UVB B;  4X1I E;  2XAF B;  5H6R B;  4DV5 T;  3DP7 A;  4XZC A;  2VUR A;  2VKH A;  5DJQ C;  3UU5 A;  4CXY A;  3P50 A;  1VOM A;  3AA0 B;  4O4J E;  4ZZC A;  4DUY T;  3RGL A;  4I0U A;  3QOF A;  5FY1 A;  2VVS A;  2BG9 B;  4OFZ A;  2W0G A;  5AQL B;  4GKJ T;  5HXR A;  5ABH A;  1Y64 B;  2IIU A;  5FY7 A;  4DR7 T;  2M6I A;  2D2S A;  2XPK A;  1WRD A;  4LF6 T;  3RIF A;  4U2Y A;  2KWI B;  4DR4 T;  2D0T A;  2ODV A;  3JAF A;  4AKR B;  4XBF B;  2JRK A;  5HYA A;  5IUX A;  4ZI7 E;  2LSJ A;  2V1D B;  2H7V C;  4I43 B;  5AQU B;  1WLX A;  5F3J A;  1WR0 A;  1T8B A;  2A3D A;  3CQG B;  3ZJ1 A;  4CI3 B;  4DID B;  4F6R C;  4P1N A;  5JH7 E;  1N36 T;  1SJ7 A;  4H9R C;  5AQG B;  3R84 B;  1JNR A;  3RYH E;  2KVP A;  4UVC B;  2ZLY A;  3GWH A;  2E9X A;  1MMA A;  2K9A A;  1HS7 A;  2BKN A;  2VKJ A;  3AAA B;  5AQM B;  1D0Y A;  3RIU A;  4BGO A;  3LBX A;  4HTE A;  4ZI3 D;  5GON E;  2YU2 A;  4QX7 B;  4KP3 C;  3PUR A;  2KBB A;  4U72 A;  2X68 A;  5JRC B;  1E1H B;  2LM2 A;  4P0B A;  4LFB T;  4YXD A;  5HEG A;  3IF8 B;  3WAK A;  2K5B B;  2WM9 A;  1QLB A;  1IBK T;  2YDQ A;  3ZEF B;  5FXW A;  2BDE A;  3M65 A;  4JI5 T;  4IGU A;  2CLY C;  3NRX A;  3WUR A;  2WP9 A;  4ECG A;  3PUS A;  3KFW X;  3PTR B;  4QXC B;  5LGN B;  3UT5 E;  2L10 A;  2MTC A;  2IC6 A;  4QH1 A;  4HWF A;  2XAH B;  1WFD A;  3KVA A;  2KMF A;  1LVK A;  3OBV E;  3RKO A;  4AKL A;  3CK6 A;  2KND A;  3AEE A;  1ZOY A;  3CQC B;  4IE5 A;  5L4H A;  2Q9Q D;  3E08 A;  3RLF F;  5CA1 E;  5JDQ A;  4DV6 T;  4ZI2 C;  5J2U E;  2HN1 A;  3AE6 A;  1LVF A;  4PFO A;  4X5T A;  2CWO A;  2YN6 A;  2DL1 A;  2DI4 A;  1KF6 A;  2UUA T;  5JTG A;  2VL8 A;  2FUP A;  2YDS A;  1R8I A;  4UR9 A;  2N9D A;  3HKB E;  4F8H A;  5JDH A;  1H7C A;  3E22 E;  1OXZ A;  2V7K A;  5HWY A;  3UUB A;  2E9X B;  4LF7 T;  3HKD E;  2HN2 A;  1UX5 A;  2WZH A;  2QA7 A;  4ILB A;  4TWD A;  1UUR A;  2CLY B;  2IDO B;  1NWM X;  4HFC A;  2F4V T;  2I0M A;  3RF1 A;  2V6Y B;  3AAE B;  2H3R A;  5H6Q B;  4C90 A;  5J0Z A;  4YLH A;  4K0K T;  3TLS A;  2KGX A;  2YIN A;  5JR9 A;  4PW8 A;  1HTJ F;  3SFE A;  4ERR A;  4ZEY A;  5JQG E;  5L3F B;  2J62 A;  3PUY F;  2I6H A;  3CIR A;  4LF9 T;  2CBJ A;  2IHR 1;  3TLW A;  4YSY A;  2NWB A;  5IYZ E;  3RRW A;  4HKA A;  1VRB A;  2L9Q A;  5LYJ E;  4PJJ A;  5LCY A;  2D9D A;  5M4Y A;  3A5X A;  4FJO A;  4JI8 T;  3M3Z B;  4NXN T;  3ANW A;  3N9N A;  4AXP A;  3E0Z A;  3FYQ A;  2X0C A;  3F31 A;  2LHR A;  3AED A;  3N2O A;  2WB5 A;  3NBX X;  3ONL C;  3PUA A;  4NPP A;  4PJN A;  5EZY E;  5CJ5 A;  4IDZ A;  4ADZ A;  1BR0 A;  4HWD A;  1HNW T;  5DQW A;  3ZC1 A;  3UUN A;  2XQ9 A;  3OVU A;  5LMN T;  2PBI A;  4CI1 B;  2AXD S;  5AFU L;  3EAM A;  2LOS A;  3KBT A;  1YQ3 A;  2LRL A;  1UCU A;  4ILC A;  4JLE A;  2QRX A;  2BKO A;  1QSD A;  5DAB A;  3RHW A;  3RRC A;  3RX6 A;  3AB3 B;  3OPC A;  4IE0 A;  4O2B E;  3RI5 A;  2BBJ A;  3BK9 A;  4LMJ A;  3UQ4 A;  1E7P A;  4E7S A;  5HXH A;  2LM9 A;  1MMG A;  1SUM B;  3NWI A;  5LGU B;  4BA9 A;  2BS2 A;  3AXJ B;  5FVL A;  3FZH B;  3LBX B;  1IBL T;  3ZPO A;  4AKH A;  3C50 A;  4JEH B;  4TV9 E;  1KFY A;  4LFA T;  4KHP T;  3AE1 A;  2VVN A;  2XHE B;  3CKD A;  1NAF A;  5KMG P;  3VRA A;  3LJC A;  4I4T E;  3UU6 A;  2WWV A;  5BR8 T;  2XZE A;  1I6Z A;  3AE4 A;  4IE7 A;  2V8S V;  3N9L A;  4X1Y E;  3AE7 A;  5IHY A;  3T8O A;  4MFR A;  4EEB A;  5HWX A;  2E9X C;  4H9S E;  3ZMS B;  2PFV A;  3AE9 A;  3AE5 A;  2DWK A;  2KXP B;  5HEU A;  3RIU C;  3MXZ A;  2XQ6 A;  2VKO A;  4L5G A;  5E0O A;  1W09 A;  3RYC E;  4B3S T;  3A8Y C;  3UU4 A;  3FB2 A;  5CB4 E;  3FZK B;  3HR0 A;  1MIV A;  2K24 A;  4YFS A;  5LNK A;  4HFV A;  3VRB A;  2KIN B;  2NTY A;  3O9X A;  3RYI E;  4HWH A;  2OLT A;  3C64 A;  1J1J A;  1SHZ C;  4I55 E;  2X67 A;  3F57 A;  5AQO B;  3P4Q A;  5JRE A;  2GK9 A;  1KEY A;  4Z90 A;  3OJA A;  2CXD A;  3AEA A;  4UV9 B;  4V1A v;  3UFE A;  2K48 A;  1HR0 T;  4LFC T;  4AKG A;  5JR9 B;  5LJN A;  4GYS A;  4Z8X A;  3DTO A;  3G06 A;  3JCF A;  2XAQ B;  4H9Q C;  1ZV4 X;  4J2C A;  1HFA A;  3NRY A;  1E2A A;  3IBP A;  2HPL A;  5HEO A;  5FL1 A;  2RA1 A;  4QXB B;  2EHO B;  3NVO A;  3MJX A;  2QYW A;  3ZYK A;  4LF5 T;  2DWG A;  2YDR A;  1MND A;  2C5K T;  3SS1 A;  3L39 A;  3ONX A;  3KV9 A;  1OED A;  4HEA A;  4C91 A;  1HNX T;  3VKG A;  1UUS A;  1CHU A;  2EHO C;  2P9B A;  2UXN B;  1T7S A;  3PDY A;  5L3B B;  4DV7 T;  4IRE A;  4E7Z A;  5ADX L;  2X51 A;  5T1D A;  2L7N A;  2ACX A;  1N32 T;  4NXM T;  4GOU A;  4P09 A;  1VCS A;  1YD8 G;  2BG9 C;  2V5C A;  3PUV F;  3ZMU B;  2MTQ A;  5L4E A;  4DBQ A;  2UXX B;  3JC6 D;  2L3L A;  5HCM A;  3OYX A;  1UK5 A;  5HXE A;  1XNQ T;  1FIO A;  3X1D A;  4COF A;  4BJM A;  4CXX A;  2XSA A;  4PJL A;  5FXX A;  3TLT A;  1O3X A;  2YKS A;  3V5U A;  2KLQ A;  3PJA A;  4AQY T;  4IL4 A;  2WU2 A;  4NUU A;  4AKI A;  4YJ2 E;  3RQW A;  2Y6X A;  2FJA A;  2WBL A;  2LRK A;  3PUX F;  1MMD A;  2WWU A;  4X20 E;  4YT0 A;  3AEG A;  3I0Q A;  3WAJ A;  2XQ5 A;  2LSY A;  2EHO D;  5HAX A;  3NKZ A;  3RQU A;  4DBR A;  4JI6 T;  2IC9 A;  5LGT B;  4TNW A;  2BZB A;  3PF0 A;  2CCQ A;  2JQH A;  3CPZ A;  4O2A E;  4B3M T;  4YTM A;  5ABF B;  5LB7 B;  4DR2 T;  4Q25 A;  4PK5 A;  4PFP A;  4TUY E;  1J5E T;  3KV4 A;  2W67 A;  3I9W A;  4PK6 A;  3B13 A;  3KBU A;  3KDS E;  4ONR A;  3VJZ A;  5AQI B;  2XAG B;  3KV6 A;  3EAB A;  3QC9 A;  4AQF C;  4JI7 T;  2E8I A;  2J1D G;  1YKE B;  1W0A A;  3NZP A;  1QUU A;  4X66 T;  2E5L T;  2JMH A;  3AEF A;  3PE0 A;  3KV5 A;  3B57 A;  3KVB A;  3N2G E;  2MOZ A;  5IWA T;  4EZ4 A;  4DV1 T;  3DJB A;  2V26 A;  3D0T A;  2LOP A;  3W15 B;  5HXS A;  4YJ3 E;  1OED B;  3GMI A;  1N34 T;  4HGA A;  4I50 E;  5FP3 A;  1OED E;  4UIG A;  3C51 A;  4DV0 T;  2E5V A;  4X1K E;  3ZT6 A;  2ACZ A;  2D5U A;  2LKH A;  2SPC A;  5EK2 A;  1WYC A;  3LDQ B;  3LG7 A;  4KX6 A;  1IJ5 A;  5HXC A;  2W4X A;  4AIS A;  2LQU A;  3C4W A;  3LSV A;  4BJN A;  2CEA A;  2WSS V;  4B3T T;  2FJB A;  1BR1 A;  3P7I A;  4IT4 A;  3MK7 C;  2XQY A;  4WBN E;  4UF0 B;  5AQV B;  2E9X D;  2MAW A;  2C0S A;  3JAD A;  1LRZ A;  1UGO A;  5TAO A;  2IAK A;  3P4S A;  5L2L A;  2R6G F;  4O8S A;  4IDQ A;  3GN5 B;  1J5W A;  3ETU A;  2WMN A;  2PTF A;  4KBM B;  1KNP A;  3FHN A;  3UQ7 A;  3AAI A;  1HCI A;  4H9O C;  2CXF A;  4TZ4 C;  3P8C D;  4QHO A;  2UUC T;  4ZI3 C;  3KIN B;  4EAH A;  4EZH A;  3LK4 2;  2XQA A;  3UFG A;  4JUY A;  2NP9 A;  1IZN B;  3Q5D A;  2D0U A;  4WW0 A;  3Q5X A;  4G63 A;  4LF8 T;  4TN7 B;  5LG4 A;  2HHH T;  1KNZ A;  1OED C;  2G0U A;  1X9B A;  3CX6 B;  2BS4 A;  3N9Q A;  3RPU A;  5A1L A;  1HG2 A;  5AQP B;  3SRZ A;  4ILA A;  1CUN A;  1YXR A;  2BVM A;  2XM2 A;  3AVS A;  3PU3 A;  4H63 H;  3EUH A;  2BG9 A;  3LK3 B;  1MIY A;  2KT9 A;  5F8P A;  3ZMT B;  4MLK A;  1MIW A;  1WR6 A;  2N2N A;  1XNR T;  5CGM A;  2VB6 A;  5KXJ A;  1W9R A;  5JR9 C;  2ZM8 A;  3QB5 K;  2VQF T;  2C5I T;  2KSR A;  4X65 T;  2V7I A;  4KHZ F;  2IUB A;  4PAG A;  2X9Y A;  1FJG T;  3K3Q C;  4B6X A;  3P4P A;  5J1G A;  2W00 A;  2W63 A;  4TWF A;  1D0X A;  4UF0 A;  2XUE A;  3UUM A;  2WMO A;  4YTN A;  3AA7 B;  1N33 T;  4IL9 A;  4NUV A;  3N9O A;  2XQ8 A;  1IBM T;  3Q5E A;  3PV0 F;  5HCJ A;  2BG9 E;  5DQV A;  1V9D A;  5FNV E;  3ZCJ A;  4U7Y A;  3UU8 A;  3ANW B;  3S4U A;  2H89 A;  3ESL A;  4IDO A;  3B5M A;  2KZ7 B;  2NOX A;  3HI2 A;  2WU5 A;  4YSX A;  2X9X A;  3AE2 A;  3ZSS A;  4JI1 T;  3AT7 A;  2Q9Q A;  2LHN A;  2WDQ A;  2V7M A;  3LK2 B;  2ZM6 T;  5LBQ B;  4BAY B;  2MYS A;  3ETV A;  1U4Q A;  4U2Z A;  4DV2 T;  2UUB T;  3PHF 1;  4OYK A;  3QK6 A;  2Y8D A;  2W62 A;  3AY5 A;  1WYB A;  3DYJ A;  4OK0 A;  4EED A;  2XQ4 A;  4WZX A;  3V5S A;  4A98 A;  4AQF A;  1ZP0 A;  4Z91 A;  4ZI2 D;  2L8K A;  2K3W A;  3N2K E;  2QGS A;  2DNX A;  4EXT A;  3SOL A;  3J7Y q;  1SJ8 A;  2LSI A;  5HEJ A;  3HL6 A;  3IA3 A;  3L3P A;  2DLR A;  4OYJ A;  2CE7 A;  1Y01 A;  4JV5 T;  3OKQ A;  1XZY A;  1G73 A;  4JBW F;  5LHI B;  4DR3 T;  1Z0P A;  1Z8U A;  3R6N A;  1XMO T;  3PUQ A;  2A2F X;  1SA0 E;  2NW8 A;  3JC6 C;  1X79 A;  3RC3 A;  2XY8 B;  4K0U A;  4HFE A;  4EOZ B;  3CVR A;  2LSK A;  2CHN A;  5HEH A;  5FYM A;  3VR9 A;  5J2T E;  3JAE A;  3QNU A;  2ES0 A;  4CI2 B;  3AE8 A;  4LF4 T;  5C8Y E;  5AQT B;  2YK0 A;  1M7K A;  2Z6E A;  3N5L A;  3CX8 B;  4JI2 T;  3VKH A;  1AJ3 A;  1U5P A;  4O4L E;  4YTP A;  5AQS B;  2WDR A;  2WDV A;  3PUW F;  2E2A A;  5FXZ A;  5AQJ B;  3C4Z A;  2MBG A;  3GA8 A;  1YQ4 A;  4KMC A;  3N9M A;  2BS3 A;  3UUX B;  2UXB T;  5LBM A;  3ZYM A;  2FJE A;  5ABE A;  1B7T A;  4TX5 A;  2CHO A;  2DHR A;  3BQK A;  4IE6 A;  5LG3 A;  3K3N A;  5ABG A;  1EZ3 A;  3FZL B;  5L3C B;  4ZOL E;  4ZZB A;  2XQ7 A;  3GN5 A;  3I9Y A;  1ZHC A;  4IIJ E;  4TWH A;  4A97 A;  4WNK A;  4DVD A;  2HPJ A;  4EGW A;  4ZXL A;  2KWH A;  2QVA A;  2CM0 A;  5AQH B;  2WQY A;  3ZCI A;  2WS3 A;  3IHR A;  2OV9 A;  2X66 A;  3RKG A;  5ETW A;  5LHH B;  4LML A;  4JEU B;  2EHO A;  2OA5 A;  1HX8 A;  2Q9Q C;  1L0V A;  2YEV C;  2WAU A;  3F2E A;  4X62 T;  4HE8 A;  2H7O A;  5FMN A;  3ONJ A;  2ODU A;  3FBZ A;  5JDL A;  2VQE T;  3FBL A;  2W2U A;  1MMN A;  1JNZ A;  3O1H A;  4ANJ A;  3BQI A;  5LHG B;  2AE9 A;  5L3G B;  1FMV A;  1HG5 A;  1T72 A;  2W61 A;  2XQ3 A;  2MPK A;  2JQK A;  3HKE E;  2IML A;  4U74 A;  5FKY A;  3RIA A;  1BR4 A;  3ZMZ B;  3QB5 A;  5KDM C;  4DR1 T;  3EHZ A;  2XM1 A;  4JYA T;  1NEK A;  4X64 T;  3RYF E;  2Q9Q B;  4WBO A;  5FVK A;  1D1C A;  4HFH A;  3MA9 A;  3O4X E;  4ILU A;  4CN6 A;  4DUZ T;  2C5J A;  3AEB A;  4JI3 T;  2X9W A;  2J47 A;  4HWC A;  4KUM B;  4EYY R;  3H37 A;  4ISS A;  4UV8 B;  2NR4 A;  2YU1 A;  3SWH A;  4ASK A;  3M1C A;  4CZZ B;  3UU3 A;  3EI0 A;  3MKD A;  3ZJ2 A;  2WZI A;  3Q2M A;  5FXV A;  2XJ7 A;  4DO0 A;  2VL0 A;  3C4X A;  4CN4 A;  4DR5 T;  3OTO T;  2XAJ B;  3Q9D A;  3HA4 A;  1KNR A;  2BKP A;  2X0Y A;  3FZM B;  3MZK B;  3O1J A;  4GK0 E;  4KI0 F;  1MNE A;  1SE7 A;  4OHF A;  4MBQ A;  2CPT A;  3O1I A;  5LOV E;  4IE4 A;  3ZLI A;  4YSZ A;  3L09 A;  5JDM A;  4DV3 T;  1I94 T;  4OX9 T;  3RC8 A;  3ZN0 B;  2XAS B;  2ZM2 A;  3LFM A;  2N1G A;  3ZYL A;  3AA1 B;  2CWY A;  4GIW A;  4JI0 T;  2UXC T;  1D1A A;  3K8P C;  5LA6 E;  5JRC A;  4LMK A;  2H88 A;  2LKG A;  4DMV A;  3EDV A;  4H9P C;  3ZN1 B;  2IW5 B;  3H3A A;  1D1B A;  5AQQ B;  1M62 A;  4TNV A;  3ABV A;  4FI5 A;  4QKN A;  2JPF A;  1HF8 A;  4MHC A;  4QH4 A;  2A72 A;  4QWN B;  4U3C A;  4F7G B;  4DR6 T;  2LEH A;  2LJL A;  4G2A A;  2VAS A;  4AI6 A;  3VU7 H;  3AEC A;  3U3I A;  1BR2 A;  2BBH A;  5ABF A;  5KX5 E;  4QX8 B;  5LP6 E;  4H9N C;  3TKL B;  4HFD A;  2JQ9 A;  3CQX C;  4CXW A;  3AXJ A;  4CQI A;  1G8X A;  1T98 A;  3PUG A;  2LLY A;  3N9P A;  2CBI A;  5JVD E;  4EIW A;  2UU9 T;  3PJA J;  3QUJ A;  5F5W A;  3ZKR A;  2B76 A;  3CML A;  3ZST A;  2XTL A;  5JDG A;  3I1A A;  3MAC A;  4IDP A;  2PG8 A;  2V6Y A;  2RP4 A;  2V6X A;  5LMU T;  2LSG A;  3NZQ A; 
#chains in the Genus database with same CATH homology
 3UTK A;  1YKH B;  5EK4 A;  3PU8 A;  3VHL A;  3FXD B;  1ZEE A;  4ZS2 A;  4QXH B;  4UEM A;  2LT3 A;  4PJM A;  3OYZ A;  4M1P A;  4MAL A;  2VK9 A;  2ZMA A;  3WSC A;  4O4H E;  4L0R A;  2I59 A;  4HN9 A;  2CMR A;  1FEW A;  4UVA B;  2CA5 A;  3ZC0 A;  1UX4 A;  2Y48 B;  3AA6 B;  5LXT E;  1YW0 A;  3C98 B;  5EK3 A;  4PNI A;  3U78 A;  3J9X 1;  4DMW A;  5L3D B;  3ZMV B;  2X9H A;  2M67 A;  3Q5W A;  4H63 V;  4ZS3 A;  1ZKE A;  2DCF A;  1FMW A;  1IJ6 A;  1KK7 A;  4AQG A;  2B1E A;  2BVL A;  4UXN B;  2NW7 A;  4YHJ A;  4EYU A;  2NTX A;  3CWZ B;  2X0L B;  1IAP A;  4GYR A;  2JJ9 A;  4XAX B;  4TV8 E;  1S94 A;  5JDF A;  2VKD A;  3EDU A;  1LKX A;  4IHJ E;  3BQL A;  5LJM A;  5BMV E;  2JQQ A;  4IST A;  5CA0 E;  4DND A;  2VWA A;  4GK5 E;  1OWA A;  5FY0 A;  3UUL A;  3AVR A;  2PJQ A;  3WI3 A;  2HH7 A;  2LE8 A;  5L3E B;  5JDN A;  4ZHQ E;  3IEE A;  3K3O A;  3HKC E;  2NW9 A;  4P0A A;  4O4I E;  2ZM0 A;  2CXL A;  4UEL A;  3FXE B;  2V7J A;  2V7L A;  4PK4 A;  1D0Z A;  4A56 A;  4L9I A;  3CX7 B;  3RH3 A;  3EVY A;  4N78 D;  3I0O A;  1S35 A;  2JMK A;  1US7 B;  4UVB B;  4X1I E;  2XAF B;  5H6R B;  3DP7 A;  4XZC A;  2VKH A;  5DJQ C;  4CXY A;  1VOM A;  3AA0 B;  4O4J E;  5FY1 A;  4OFZ A;  2W0G A;  5HXR A;  1Y64 B;  5FY7 A;  2D2S A;  1WRD A;  2KWI B;  2D0T A;  2ODV A;  4AKR B;  4XBF B;  2JRK A;  4ZI7 E;  2LSJ A;  2H7V C;  2V1D B;  4I43 B;  1WLX A;  5F3J A;  2A3D A;  3CQG B;  3ZJ1 A;  4CI3 B;  5JH7 E;  4F6R C;  4H9R C;  3R84 B;  3RYH E;  4UVC B;  2ZLY A;  3GWH A;  2E9X A;  1MMA A;  2K9A A;  1HS7 A;  2VKJ A;  3AAA B;  4BGO A;  1D0Y A;  3LBX A;  4HTE A;  4ZI3 D;  5GON E;  2YU2 A;  4QX7 B;  4KP3 C;  3PUR A;  4U72 A;  2X68 A;  1E1H B;  4P0B A;  3IF8 B;  3WAK A;  2K5B B;  2WM9 A;  3ZEF B;  5FXW A;  2BDE A;  3M65 A;  4IGU A;  2CLY C;  3NRX A;  3WUR A;  4ECG A;  3PUS A;  3KFW X;  3PTR B;  4QXC B;  5LGN B;  3UT5 E;  2MTC A;  2IC6 A;  2XAH B;  3RKO A;  3KVA A;  2KMF A;  1LVK A;  3OBV E;  4AKL A;  4DMV A;  2KND A;  3CQC B;  4IE5 A;  5CA1 E;  2Q9Q D;  3E08 A;  5JDQ A;  4ZI2 C;  5J2U E;  1LVF A;  4PFO A;  2CWO A;  2DI4 A;  2VL8 A;  2N9D A;  3HKB E;  5JDH A;  1H7C A;  3E22 E;  1OXZ A;  2V7K A;  5HWY A;  2E9X B;  3HKD E;  1UX5 A;  2QA7 A;  2CLY B;  1NWM X;  3AAE B;  5H6Q B;  2H3R A;  4C90 A;  4YLH A;  2YIN A;  5JR9 A;  4PW8 A;  1HTJ F;  4ERR A;  5JQG E;  5L3F B;  5LYJ E;  2NWB A;  5IYZ E;  3RRW A;  4HKA A;  1VRB A;  2L9Q A;  4PJJ A;  5LCY A;  5M4Y A;  3A5X A;  4FJO A;  3ANW A;  3N9N A;  4AXP A;  3E0Z A;  3F31 A;  2LHR A;  3N2O A;  3NBX X;  4PJN A;  3PUA A;  5EZY E;  1BR0 A;  4IDZ A;  4ADZ A;  5DQW A;  3ZC1 A;  3UUN A;  2PBI A;  4CI1 B;  5AFU L;  2LOS A;  3KBT A;  4JLE A;  5DAB A;  1UCU A;  3RRC A;  1QSD A;  3RX6 A;  3AB3 B;  4O2B E;  4IE0 A;  4E7S A;  3BK9 A;  5HXH A;  2LM9 A;  1MMG A;  5LGU B;  4BA9 A;  4AKH A;  3LBX B;  3ZPO A;  3C50 A;  4JEH B;  4TV9 E;  2XHE B;  3CKD A;  1NAF A;  5KMG P;  3LJC A;  4I4T E;  4IE7 A;  4X1Y E;  3N9L A;  5IHY A;  3T8O A;  4MFR A;  5HWX A;  2E9X C;  4H9S E;  3ZMS B;  2PFV A;  4EB6 E;  2DWK A;  2KXP B;  3MXZ A;  5E0O A;  2VKO A;  4L5G A;  3RYC E;  3FB2 A;  5CB4 E;  3HR0 A;  1MIV A;  2K24 A;  4YFS A;  5LNK A;  4HFV A;  2KIN B;  2NTY A;  3O9X A;  3RYI E;  3C64 A;  1SHZ C;  4I55 E;  2X67 A;  3F57 A;  5JRE A;  2GK9 A;  3OJA A;  2CXD A;  4AKG A;  4UV9 B;  4V1A v;  3UFE A;  2K48 A;  5JR9 B;  5LJN A;  4GYS A;  4Z8X A;  3DTO A;  4J2C A;  4H9Q C;  2XAQ B;  1ZV4 X;  1HFA A;  3NRY A;  3IBP A;  2HPL A;  2RA1 A;  4QXB B;  2EHO B;  3MJX A;  3ZYK A;  2DWG A;  3SS1 A;  1MND A;  2C5K T;  3V5S A;  3ONX A;  4C91 A;  3KV9 A;  3VKG A;  4HEA A;  2EHO C;  2P9B A;  2UXN B;  5L3B B;  3PDY A;  5T1D A;  4E7Z A;  5ADX L;  2X51 A;  2ACX A;  4GOU A;  4P09 A;  1YD8 G;  3ZMU B;  2MTQ A;  4DBQ A;  2UXX B;  3JC6 D;  2L3L A;  3OYX A;  5HXE A;  1FIO A;  4BJM A;  4CXX A;  4PJL A;  5FXX A;  1O3X A;  3V5U A;  2KLQ A;  4NUU A;  4AKI A;  4YJ2 E;  2Y6X A;  2WBL A;  4X20 E;  1MMD A;  2WWU A;  3WAJ A;  3I0Q A;  2LSY A;  2EHO D;  5HAX A;  4DBR A;  2IC9 A;  5LGT B;  2BZB A;  3PF0 A;  2CCQ A;  3CPZ A;  4O2A E;  4PK5 A;  4PFP A;  4TUY E;  3KV4 A;  3I9W A;  4PK6 A;  3B13 A;  3KBU A;  3KDS E;  4ONR A;  3VJZ A;  2XAG B;  3KV6 A;  3QC9 A;  4AQF C;  2E8I A;  2J1D G;  1YKE B;  3NZP A;  1QUU A;  2JMH A;  3PE0 A;  3KV5 A;  3B57 A;  3KVB A;  3N2G E;  2MOZ A;  4EZ4 A;  3DJB A;  2V26 A;  3D0T A;  2LOP A;  3W15 B;  5HXS A;  4YJ3 E;  3GMI A;  4HGA A;  4I50 E;  5FP3 A;  4UIG A;  3C51 A;  4X1K E;  2D5U A;  2SPC A;  5EK2 A;  1WYC A;  3LG7 A;  1IJ5 A;  5HXC A;  2LQU A;  3C4W A;  4BJN A;  2CEA A;  2WSS V;  1BR1 A;  3P7I A;  3MK7 C;  2XQY A;  4WBN E;  4UF0 B;  2E9X D;  5TAO A;  2C0S A;  1LRZ A;  2IAK A;  5L2L A;  4O8S A;  3GN5 B;  3ETU A;  2WMN A;  4KBM B;  3FHN A;  3AAI A;  1HCI A;  4H9O C;  2CXF A;  4TZ4 C;  3P8C D;  4QHO A;  4ZI3 C;  3KIN B;  4EAH A;  4EZH A;  3LK4 2;  4JUY A;  2NP9 A;  1IZN B;  4WW0 A;  2D0U A;  5LG4 A;  3Q5X A;  4G63 A;  4TN7 B;  1KNZ A;  2G0U A;  3CX6 B;  3N9Q A;  3RPU A;  5A1L A;  1HG2 A;  3SRZ A;  1CUN A;  3AVS A;  2BVM A;  3PU3 A;  4H63 H;  5HYA A;  3EUH A;  3LK3 B;  3ZMT B;  1MIY A;  2KT9 A;  5F8P A;  5JR9 C;  4MLK A;  1MIW A;  1WR6 A;  2N2N A;  2VB6 A;  2ZM8 A;  2C5I T;  2V7I A;  4PAG A;  2X9Y A;  3K3Q C;  4B6X A;  5J1G A;  2W00 A;  2W63 A;  4UF0 A;  1D0X A;  2XUE A;  3UUM A;  2WMO A;  3AA7 B;  4NUV A;  3N9O A;  5FNV E;  5DQV A;  1V9D A;  3ZCJ A;  3ANW B;  3S4U A;  3ESL A;  3HI2 A;  2KZ7 B;  2NOX A;  2X9X A;  3AT7 A;  2Q9Q A;  2LHN A;  2V7M A;  3LK2 B;  5LBQ B;  4BAY B;  2MYS A;  3ETV A;  1U4Q A;  3PHF 1;  4OYK A;  3QK6 A;  2Y8D A;  2W62 A;  1WYB A;  4OK0 A;  4AQF A;  4ZI2 D;  2L8K A;  3N2K E;  2QGS A;  2DNX A;  4EXT A;  3SOL A;  3J7Y q;  2LSI A;  3HL6 A;  3L3P A;  2DLR A;  4OYJ A;  2CE7 A;  3OKQ A;  1G73 A;  5LHI B;  1Z0P A;  3R6N A;  3PUQ A;  2A2F X;  1SA0 E;  2NW8 A;  3JC6 C;  1X79 A;  3RC3 A;  4K0U A;  4EOZ B;  3CVR A;  2LSK A;  5FYM A;  5J2T E;  2ES0 A;  4CI2 B;  5C8Y E;  2YK0 A;  2Z6E A;  3VKH A;  3N5L A;  3CX8 B;  1AJ3 A;  1U5P A;  4O4L E;  5FXZ A;  3C4Z A;  2MBG A;  3GA8 A;  4KMC A;  3N9M A;  3UUX B;  5LBM A;  3ZYM A;  1B7T A;  4TX5 A;  2DHR A;  3BQK A;  4IE6 A;  3K3N A;  1EZ3 A;  5L3C B;  4ZOL E;  3GN5 A;  3I9Y A;  1ZHC A;  4IIJ E;  4WNK A;  4DVD A;  2HPJ A;  2KWH A;  2CM0 A;  3ZCI A;  3IHR A;  2X66 A;  5ETW A;  5LHH B;  4JEU B;  2EHO A;  2OA5 A;  1HX8 A;  2Q9Q C;  2YEV C;  2WAU A;  3F2E A;  4HE8 A;  2H7O A;  5FMN A;  2ODU A;  3FBZ A;  5JDL A;  3FBL A;  3O1H A;  1MMN A;  5LHG B;  4ANJ A;  3BQI A;  5L3G B;  1FMV A;  1HG5 A;  2W61 A;  3HKE E;  4U74 A;  3ZMZ B;  1BR4 A;  5KDM C;  3RYF E;  2Q9Q B;  4WBO A;  1D1C A;  3MA9 A;  3O4X E;  4ILU A;  2C5J A;  2X9W A;  4KUM B;  4EYY R;  3H37 A;  4ISS A;  4UV8 B;  4ASK A;  2YU1 A;  3SWH A;  3M1C A;  4CZZ B;  3ZJ2 A;  3MKD A;  3Q2M A;  5FXV A;  4DO0 A;  3C4X A;  2XAJ B;  3Q9D A;  3HA4 A;  3MZK B;  4GK0 E;  3O1J A;  1MNE A;  4OHF A;  4MBQ A;  3O1I A;  5LOV E;  3ZLI A;  4IE4 A;  3RC8 A;  5JDM A;  3L09 A;  3ZN0 B;  2XAS B;  2ZM2 A;  3LFM A;  2N1G A;  3ZYL A;  3AA1 B;  2CWY A;  4GIW A;  1D1A A;  3K8P C;  5LA6 E;  5JRC A;  3EDV A;  4H9P C;  3ZN1 B;  2IW5 B;  3H3A A;  1D1B A;  5JRC B;  4FI5 A;  4QKN A;  2JPF A;  1HF8 A;  4MHC A;  4QWN B;  2A72 A;  2LEH A;  2LJL A;  4G2A A;  2VAS A;  4AI6 A;  3VU7 H;  3U3I A;  1BR2 A;  5LP6 E;  5KX5 E;  4QX8 B;  4H9N C;  3TKL B;  3CQX C;  4CXW A;  4CQI A;  1G8X A;  1T98 A;  3PUG A;  3N9P A;  5JVD E;  4EIW A;  3QUJ A;  3CML A;  2XTL A;  5JDG A;  3I1A A;  3MAC A;  2PG8 A;  2RP4 A;  2LSG A;  3NZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...