5HWYA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 10 mm na+ and zero ca2+
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
Knots found
sequence length
300
structure length
300
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEENNDKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Uncharacterized membrane protein MJ0091
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
total genus 133
structure length 300
sequence length 300
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hwyA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hwyA02
5HWYA 3V5UA 5HYAA 5HXEA 5JDGA 5HXCA 5JDMA 5JDFA 5HXRA 5JDLA 5HXSA 5JDQA 3V5SA 5JDHA 5HXHA 5JDNA 5HWXA
chains in the Genus database with same CATH superfamily
1T7SA 3ZJ1A 5FXWA 2WSSV 2HPLA 3ETVA 3KBTA 3RX6A 1KFYA 4QX7B 2WDVA 2XAGB 5F8PA 5EK4A 4Q25A 5H6RB 5TAOA 2KWIB 4YXDA 3VKHA 2W63A 3AEDA 1R8IA 3AXJB 4GOUA 1HNWT 3CX6B 2DCFA 3RIFA 2E8IA 4MHCA 5L3EB 4ERRA 2WB5A 4ILBA 2V7KA 2WCAA 4I55E 2NOXA 5JDFA 5LXTE 4KI0F 2WBLA 3N2KE 2ODVA 4NUVA 2VKDA 3T1YT 3T8OA 2FJEA 2HN2A 4DV2T 5L3FB 3UT5E 2V5CA 2JQHA 3MKDA 2FJDA 3ZKRA 5LMNT 3GMIA 2XAJB 3UU5A 4I50E 2DL1A 3E0ZA 3O1IA 1D1BA 3L3PA 3LFMA 4JUYA 3AE4A 4JI7T 3ABVA 5AQQB 1VOMA 4TZ4C 4EGWA 4J2CA 5FVLA 5FXVA 4AXPA 2WS3A 5LJNA 2LKGA 1E7PA 1CHUA 3EI0A 3JAEA 3ONLC 3V5UA 2D2SA 3VR9A 3RKGA 2E2AA 3SS1A 3AECA 3IA3A 2MPKA 3HR0A 3N9OA 3AXJA 4WBNE 4M1PA 3RF1A 4IDPA 1MIVA 5LGNB 1HG2A 2V6YB 1YKEB 4KHPT 1HX1B 2WAUA 2WP9A 3OYXA 2XQ6A 1S35A 4WW0A 4W8PA 3MACA 4YTMA 4GK5E 2VVSA 2WDRA 1US7B 2WWUA 2JQKA 3A7MA 5AQSB 4IE4A 2C0SA 2FJAA 3VU7H 5T1DA 2LM2A 3RYIE 4HWFA 2CBJA 4U74A 5HWXA 2PG8A 4HKAA 4QHOA 2QVAA 5L3DB 1M7KA 3RC3A 1HNZT 5ABGA 1T8BA 2RA1A 2VL8A 2MAWA 3ONJA 1WCRA 5JREA 3CX7B 2CWYA 1IBMT 4YY3T 4BA9A 4F7GB 1SE7A 3AA6B 3F57A 4UELA 1LVKA 4CI2B 2XSAA 3G06A 3PE0A 2N9DA 3L09A 3K3OA 2CWOA 4IL9A 3RKOA 5AQIB 4GYSA 4BGOA 2V6YA 1W09A 4I4TE 3ZCIA 4JI2T 4A56A 4IDQA 1IBKT 4HFEA 2BKPA 4ADZA 2UUBT 4TV8E 2X51A 4U2YA 4TWDA 2SPCA 3EDVA 2BG9C 4ILCA 2Q9QC 2CPTA 3NBXX 3ZMTB 3SFDA 2CHNA 2YK0A 1QLBA 5JDNA 4IT4A 3RIAA 5L4HA 4MLKA 5AQLB 2P9BA 5AQJB 5J2UE 4HWCA 4JLEA 5IWAT 5BMVE 2XM2A 1D1CA 4ZI7E 3Q5WA 2DNXA 2KLQA 4KP3C 5FYMA 3K3NA 4O2AE 3EDUA 4LF7T 4EB6E 3TLTA 2G0UA 3C4ZA 1UX4A 2YOEA 4HFIA 5JTGA 2F4VT 2J47A 1OEDE 2YKSA 5LMUT 4H9RC 1HFAA 3KVAA 4JEUB 4BAYB 1WFDA 1MIYA 4QKNA 3C64A 3JAFA 1FIOA 4H63V 3N9NA 2IHR1 2A9UA 4F8HA 4YHJA 2WY2A 4DIDB 3PJAA 2X9WA 3I0OA 2BKOA 3Q2MA 4QH5A 5AQKB 1NAFA 4IHJE 2XHEB 2LSJA 3ZEFB 1J1JA 2RPAA 4YTNA 1D1AA 4MBQA 3R84B 4PW8A 5FY0A 4PK4A 3N9QA 4X65T 5HCJA 3SRZA 3NVOA 3FZHB 4EAHA 1B7TA 1VRBA 2C5KT 1JNRA 1G8XA 2LM9A 5HWYA 2HPJA 3NKZA 5L47A 5JDGA 5HEJA 5FL1A 3KV4A 2LT3A 2XQ5A 2VKJA 1HG5A 3PUQA 2E5VA 5LHIB 4EZHA 4IE6A 4EIWA 4BJNA 3FXEB 4DUYT 2JMKA 5LNKA 2KT9A 1XMOT 4DR7T 3EUHA 1WYCA 5DQWA 3Q9DA 2JRKA 3OVUA 2XQYA 3KVBA 3SWHA 5HXCA 3N9PA 2Q9QB 2W00A 2X0LB 4ZS3A 2DWGA 5AQVB 4JI5T 5L3GB 1HF8A 5DABA 4LFBT 2Q9QD 4BJMA 3N9MA 4JI6T 2WMNA 2JPFA 2PJQA 5FNVE 4CN4A 2KGXA 3RC8A 4PNIA 3BQLA 4UR9A 4COFA 2X9XA 1MNEA 3J7Yq 4G63A 2VKOA 4OK0A 5JRCB 3AE8A 4CQIA 4WBOA 1W9RA 5LYJE 3UU8A 3ZN0B 3AVSA 2XQ3A 5HCMA 4UVBB 4WYVA 4H9SE 4DVDA 2L10A 3RRCA 2IUBA 5LGTB 3T1HT 3CQCB 2X66A 2BDEA 4JV5T 2Q9QA 3LJCA 3PUZF 4H63H 5E0OA 3HA4A 1H7CA 4LF4T 2X9YA 2B76A 3RI5A 5C2TA 2LEHA 4YSYA 5AQTB 3WSCA 1D0XA 1WR6A 2WZHA 3NZQA 4KUMB 1V9DA 3AAEB 2NW8A 2V6XA 1E1HB 1KNPA 4OX9T 4XAXB 2I6HA 3C51A 3L39A 1Y64B 2H88A 3DTOA 2DI4A 5L4EA 2A3DA 4ILAA 4UVAB 1ZP0A 2IIUA 4HGAA 4DNDA 2BBJA 5FY7A 2E9XC 1HCIA 3C4XA 5HXRA 1BR0A 5JRCA 4TUYE 5FVKA 5CA1E 5HEGA 3JADA 2NW9A 1X9BA 1QSDA 3K3QC 3MK7C 2MOZA 2WDQA 1HTJF 4PJJA 4H9PC 2XZEA 3ESLA 3K8PC 4YT0A 5DJQC 3ZN1B 4DR4T 2XAQB 2PBIA 1BR4A 2IC6A 5AQRB 2AXDS 4E7ZA 2X9HA 1OEDB 4FI5A 2R6GF 2V5DA 3AE2A 1KK7A 2VL0A 3H3MA 3C4WA 4X64T 3P4SA 3QOFA 2A72A 2CXLA 3UTKA 3CK6A 1ZOYA 2HH7A 3H3AA 3AAAB 2W61A 3RIUC 2VK9A 2K24A 2OA5A 4O4JE 3GWHA 4QH4A 1UURA 1XZYA 2WU2A 4O4IE 4WNKA 2XY8B 4KMCA 3ZSSA 2N1GA 1I6ZA 4CN1A 1EZ3A 4PAGA 2GK9A 4PJNA 2ACXA 2LHRA 2H7VC 4U72A 2V8SV 1XWMA 2VWAA 5LGUB 4AKRB 4GKJT 1XDPA 2UXCT 4O4HE 3HI2A 2D0TA 1JNZA 3VHLA 3NRXA 4EXTA 4JI1T 1OEDA 3VR8A 3UQ4A 5J2TE 2OV9A 1LKXA 1NEKA 2BS4A 2J4GA 2JQQA 2CLYC 5FZTA 1WLXA 4NXNT 3RYCE 5F3JA 3RYHE 2CE7A 2XQ9A 3ZPOA 4JI0T 2LHNA 4L9IA 3AAIA 2E9XB 3FBZA 3AE7A 4QXCB 4GKKT 2ES0A 2HN1A 2WZIA 3LSVA 3I9WA 1SA0E 4GK0E 1NENA 3NRYA 4X66T 2KSRA 3TLWA 3F2EA 1J5WA 2M67A 2E9XD 5ABHA 4JI8T 4ZEYA 3CIRA 4L5GA 4Z8XA 1MIWA 3P4WA 3UUBA 3ZMVB 2UU9T 2D0UA 1J5ET 2CMRA 2DLRA 4U3CA 4DV5T 3C50A 2LRLA 3W15B 4PJLA 2LSGA 4ASKA 4HFBA 1OWAA 3NZPA 5FP3A 5HEUA 3ZCJA 2OLTA 3AB3B 3OJAA 2WQYA 4CXWA 2UXXB 3UFGA 3CKDA 1HR0T 4ZZCA 3Q5EA 4K0UA 3PU8A 1KNRA 3RQWA 2W4XA 2EHOC 2I0MA 1CUNA 3MJXA 3UUNA 2E9XA 3AE9A 4QXBB 1D0YA 4JI3T 3FZKB 4Z90A 2KZ7B 2XUEA 4X1YE 4HFDA 2KMFA 2LRKA 4L0RA 4YSZA 2QGSA 3O1JA 4O4LE 2FUPA 4P0BA 2DHRA 3ZYMA 1BR2A 4B3ST 3JC6C 4AQGA 4EZ4A 2NTXA 3AEGA 2VKHA 3UU3A 1I94T 4NPPA 5F5WA 2CRBA 3CQGB 5M4YA 5LJMA 3ZC0A 3A8YC 4P0AA 3GN5B 2ACZA 3ZYKA 3E08A 2YEVC 2ZM0A 3O9XA 3CQXC 3HKCE 3AVRA 3X1DA 2K3WA 5CA0E 4A98A 3I9YA 4CI3B 4JYAT 2CXFA 3PDYA 2CLYB 4IE7A 4B3MT 5JH7E 1D0ZA 1ZV4X 5KDMC 5LBQB 4TNVA 4PJMA 2FJBA 2FBWA 4ZOLE 4EYYR 2K5BB 5J0ZA 4DR3T 2X0YA 5HXSA 4X5TA 5EK3A 1N34T 1MNDA 2V7JA 3ETUA 3AE3A 1SJ8A 2Y6XA 3RIUA 4LF9T 5JDMA 2K48A 3KV9A 3WAJA 4UV8B 4LF6T 4O2BE 2BBHA 4IDOA 4CXXA 3P8CD 4X1IE 3TLUA 2NW7A 3P7IA 2V7IA 3RYFE 1MMNA 5AQFB 2L7NA 1UUSA 1WRDA 5L3CB 1IAPA 4DV4T 4K0KT 2LOPA 5HAXA 3GN5A 3A5XA 5ADXL 2YINA 1UX5A 5GONE 4QXHB 1LVFA 2XTLA 4AIUA 1N33T 4AQYT 2LSKA 2X67A 2MTQA 2ZMAA 4O8SA 1YQ3A 4EOZB 4AKHA 3ZYLA 3SFEA 4AKIA 4NIQA 3RGLA 2H89A 4OYKA 1FJGT 4EEDA 2EHOB 3P4QA 3EAMA 4YTPA 1HS7A 3KV6A 3WURA 4XBFB 3ONXA 2BS2A 4UXNB 5EZYE 2YU2A 1HX8A 1OEDC 2XPKA 3ZC1A 4QH1A 2CM0A 5C8YE 4FJOA 3ZMUB 1OXZA 2CHOA 2YN6A 4PFPA 2MTCA 2LSYA 2EHOD 5AQOB 2UXNB 2XM1A 4IGUA 4EYUA 3AT7A 3PHF1 1SUMB 3AY5A 5CB4E 4TX5A 3PUAA 1S94A 4LFAT 3J9X1 1Z0PA 3JC6D 3RH3A 3UULA 4DV1T 4X20E 2XAFB 5LB7B 2J62A 2UXBT 2B1EA 3EVYA 3EHZA 3CPZA 3SOLA 4ZI3C 3CX8B 5FXZA 2L8KA 2LLYA 2W2UA 3IHRA 2EHOA 4LFCT 4DR2T 4HWIB 4NXMT 4H9NC 1MMAA 4U33A 1XDOA 4ILUA 2PTFA 4HN9A 3HKBE 3LBXB 3AA7B 4IREA 5JDHA 5L3BB 4B3RT 5LP6E 3LDQB 1FEWA 4F6RC 3FXDB 4UF0B 3RPUA 2ODUA 4OYJA 3PUSA 5ABFB 2NP9A 2IAKA 3GA8A 5JDQA 4Z91A 5FL0A 3N9LA 5KXJA 3JCFA 5IHYA 2AE9A 3DJBA 4AQFA 2V7MA 5JDLA 4A5XA 3FZLB 3K1SA 3AE1A 2D9DA 4H9OC 2DWKA 3PUGA 2KXPB 3UU6A 4UV9B 3UQ7A 4OHFA 1BR1A 3ZT5A 4TWHA 4CXYA 2JIWA 4PFOA 3F31A 3V5SA 2J1DG 2BZBA 4B6XA 1XNQT 5ETWA 3ZMZB 5HEHA 1VCTA 3L8RA 4X1KE 4DV3T 3B5MA 1T98A 4YFSA 3LBXA 2LKHA 4YHHT 3VRBA 5LG4A 3PURA 2JMHA 3QB5K 3N2GE 1YD8G 3RQUA 5AQPB 1FMVA 5JVDE 4DV0T 4UF0A 3MXZA 5ABFA 2A2FX 3FZFB 2LE8A 2WM9A 2BVLA 2BVMA 4ISSA 4IE5A 2YU1A 4MFRA 3VJZA 1DU2A 2X0CA 1G73A 4IDZA 3DYJA 4ONRA 1YKHB 3UUMA 1MMDA 1NWMX 2XJ7A 4HFCA 2MBGA 1IBLT 2CA5A 2QA7A 3B57A 4C90A 4HTEA 3ZJ2A 3KINB 3PUWF 3M3ZB 5LCYA 2XAHB 3RLFF 1HNXT 2IMLA 5LA6E 1MMGA 1WYBA 1T72A 5FKYA 1VCSA 4HFHA 5AFUL 5CGMA 2M6IA 5AQNB 3OTOT 4G2AA 3WAKA 2WMOA 5BR8T 4PK6A 2WWVA 2X68A 4GYRA 2JJ9A 4ZS2A 4PK5A 4ECGA 2E5LT 2BG9E 3MA9A 3QNUA 5HXHA 2C5JA 4U7YA 3NWIA 4E7SA 1XNRT 5CFBA 3E22E 2QRXA 4ZI3D 1L0VA 2V26A 3FB2A 3ZMSB 2D5UA 5AQGB 5FMNA 2H7OA 3ANWB 3ZT7A 4I43B 3AEFA 5FY1A 4LMLA 5FXXA 3OBVE 4KBMB 5HEOA 4ZZBA 5A1LA 4TNWA 2V7LA 4DMVA 2HHHT 4CI1B 4HWHA 2PFVA 1FMWA 2KNDA 5CJ5A 2VQET 2YDQA 5HXEA 2NR4A 4EEBA 1LRZA 4DBQA 4CZZB 1U5PA 4XZCA 5ABEA 2XQ7A 5AQMB 2CBIA 5J1GA 4AISA 3B13A 4IE0A 2LQUA 3QC9A 4CN6A 3S4UA 2Z6EA 4HEAA 2W67A 2VURA 4YSXA 1SHZC 1UCUA 2C5IT 3P4PA 2UUCT 3LK3B 2I59A 3KDSE 4KX6A 4EV6A 1IJ5A 2XQ4A 3FHNA 1UGOA 4ZI2C 3ANWA 4LF5T 2Y48B 4DV6T 4UIGA 3OYZA 4ISTA 3AA1B 3C98B 4X62T 3R6NA 1YXRA 3RHWA 5AQHB 3IF8B 2JQ9A 3HL6A 3HKDE 3VRAA 3O4XE 3CMLA 3BQIA 3QK6A 4QWNB 4AKLA 3PV0F 3PUXF 3FBLA 4H9QC 3QUJA 1E2AA 3OKQA 3N2OA 3PUVF 2XQ8A 4AQFC 5JR9C 2XSBA 3PJAJ 3PUYF 2LJLA 4U31A 1KNZA 4DR1T 4TV9E 5H6QB 3TKLB 2K9AA 4UVCB 2ZM8A 3P4RA 4U7IA 5IYZE 2UXDT 1W0BA 3H37A 4B3TT 3AEBA 4WZXA 5LHGB 4ZXLA 5AQUB 3FZMB 3BK9A 3IBPA 5IUXA 3QB5A 3I0QA 4A97A 1ZHCA 2VB6A 4U2ZA 3U78A 4TWFA 1N32T 1W0AA 1YQ4A 2L9QA 5LBMA 4IL4A 2RP4A 1N36T 3FYQA 5LG3A 3UFEA 2VASA 5DQVA 3AEAA 3RRWA 1U4QA 1M62A 3BQKA 1Y01A 3I1AA 4DO0A 3AE5A 1AJ3A 1KF6A 4HE8A 4JI4T 4N78D 4YJ2E 3KFWX 4LF8T 3LK2B 3WI3A 2BS3A 2QYWA 3TLSA 3CWZB 4LMJA 3TLVA 4ANJA 4C91A 4DR6T 3AA0B 2IC9A 2X0HA 1ZKEA 2IDOB 2L3LA 4OFZA 2VVNA 4DBRA 4QX8B 3N5LA 1UK5A 1ZEEA 3P50A 4UEMA 3UUXB 2YDSA 2BKNA 3IEEA 4YJ3E 3M65A 3LK42 2XQAA 5JQGE 4AI6A 4GIWA 1QUUA 2VQFT 1O3XA 2BG9B 4ZI2D 2W62A 4HFVA 3ZSTA 1Z8UA 4JEHB 1GQEA 3ZLIA 2XASB 2KINB 3O1HA 2IW5B 3U3IA 5JR9B 3KBUA 4YLHA 2ZM6T 1SJ7A 2ZM2A 3MZKB 5HYAA 4DMWA 4IDNA 3ZT6A 4P09A 2V1DB 5LHHB 3OPCA 3Q5XA 3PF0A 2KBBA 1IJ6A 2H3RA 2KWHA 1KEYA 3LG7A 2KVPA 2Y8DA 3KV5A 2M6BA 3UU4A 5KMGP 5C3JA 2WU5A 5L2LA 4DV7T 2CEAA 3PTRB 4NUUA 4KHZF 4IIJE 1YW0A 4DUZT 3PU3A 4MALA 3AEEA 1WR0A 3CVRA 2ZLYA 5EK2A 4LMKA 1XMQT 2BG9A 1IZNB 3EABA 3VKGA 2LOSA 2N2NA 2NTYA 2YDRA 2CCQA 3AE6A 4TN7B 4P1NA 2MYSA 1X79A 2W0GA 3Q5DA 4HWDA 3HKEE 4JBWF 5JR9A 2NWBA 4I0UA 3DP7A 4AKGA 4DR5T 3D0TA 3M1CA 5KX5E 4V1Av 2W66A 2UUAT 2CXDA 4ZHQE 5LOVE 2LSIA
chains in the Genus database with same CATH topology
5FMNA 2W00A 2H7OA 2X0LB 3ANWB 3CQGB 3ZJ1A 5M4YA 5LJMA 3ZC0A 5FXWA 4I43B 4P0AA 4ZS3A 5FY1A 2WSSV 3GN5B 3ZYKA 2DWGA 2HPLA 3E08A 3ETVA 3KBTA 2YEVC 5FXXA 3OBVE 4KBMB 3RX6A 2ZM0A 4QX7B 3O9XA 5A1LA 5L3GB 3CQXC 1HF8A 3HKCE 5DABA 3AVRA 2Q9QD 4BJMA 2XAGB 2V7LA 5F8PA 4DMVA 3N9MA 5EK4A 2WMNA 4CI1B 2JPFA 2PJQA 5FNVE 5CA0E 3I9YA 5H6RB 4CI3B 2CXFA 2PFVA 5TAOA 3PDYA 2CLYB 1FMWA 2KWIB 2KNDA 4IE7A 5JH7E 4PNIA 3RC8A 1D0ZA 1ZV4X 3BQLA 5KDMC 5LBQB 3VKHA 2W63A 5HXEA 4GOUA 2X9XA 1MNEA 4PJMA 1LRZA 3J7Yq 3CX6B 2VKOA 4G63A 4ZOLE 4EYYR 2DCFA 4DBQA 2K5BB 4CZZB 1U5PA 4XZCA 4OK0A 2E8IA 5HXSA 4MHCA 5L3EB 5JRCB 5EK3A 1MNDA 4WBOA 2V7JA 4CQIA 4ERRA 5LYJE 3ETUA 2V7KA 4I55E 2NOXA 3ZN0B 3AVSA 2Y6XA 5J1GA 5JDFA 5LXTE 3B13A 4IE0A 2LQUA 3QC9A 4UVBB 4H9SE 2WBLA 3S4UA 4DVDA 3N2KE 3RRCA 2ODVA 2K48A 3KV9A 5JDMA 2Z6EA 4NUVA 4HEAA 5LGTB 3WAJA 4UV8B 4O2BE 2VKDA 1SHZC 1UCUA 2C5IT 3T8OA 3LK3B 5L3FB 2I59A 3UT5E 4CXXA 3MKDA 3P8CD 4X1IE 3CQCB 3KDSE 3GMIA 1IJ5A 2NW7A 2X66A 3P7IA 2BDEA 2Q9QA 3LJCA 2XAJB 2V7IA 3RYFE 1MMNA 4I50E 3E0ZA 3O1IA 1D1BA 3L3PA 3LFMA 3FHNA 4ZI2C 3ANWA 2Y48B 4H63H 4JUYA 1WRDA 5E0OA 5L3CB 1IAPA 3HA4A 1H7CA 2X9YA 4UIGA 3OYZA 4ISTA 2LOPA 5HAXA 3AA1B 3C98B 3R6NA 1VOMA 4TZ4C 3GN5A 3A5XA 5ADXL 4J2CA 2LEHA 2YINA 1UX5A 5GONE 3WSCA 4QXHB 1LVFA 1D0XA 1WR6A 2XTLA 3NZQA 3IF8B 4KUMB 3HL6A 5FXVA 4AXPA 1V9DA 3AAEB 2LSKA 2X67A 3HKDE 5LJNA 2NW8A 1E1HB 2MTQA 3O4XE 3CMLA 3V5UA 3BQIA 2D2SA 2ZMAA 3QK6A 4O8SA 4XAXB 4EOZB 3C51A 4QWNB 4AKLA 3SS1A 4AKHA 1Y64B 3ZYLA 3DTOA 2DI4A 2A3DA 4AKIA 3FBLA 4UVAB 4H9QC 3HR0A 3N9OA 4WBNE 3QUJA 4M1PA 1MIVA 4OYKA 5LGNB 1HG2A 3OKQA 4HGAA 5FY7A 4DNDA 2E9XC 1HCIA 1YKEB 3C4XA 5HXRA 1BR0A 2EHOB 2WAUA 3N2OA 5JRCA 3OYXA 4TUYE 1HS7A 5CA1E 3KV6A 1S35A 4WW0A 4AQFC 3WURA 5JR9C 4XBFB 3MACA 3ONXA 4UXNB 5EZYE 2YU2A 1HX8A 2NW9A 3ZC1A 2LJLA 2CM0A 1KNZA 4GK5E 5C8YE 4FJOA 3ZMUB 1QSDA 1OXZA 3K3QC 4TV9E 3MK7C 5H6QB 2MOZA 4PFPA 1HTJF 3TKLB 1US7B 4PJJA 2K9AA 2MTCA 2WWUA 4UVCB 2LSYA 4H9PC 2EHOD 3ESLA 2UXNB 2ZM8A 3K8PC 4IE4A 4IGUA 4EYUA 3AT7A 3PHF1 5IYZE 5DJQC 2C0SA 3VU7H 3H37A 3ZN1B 5T1DA 3RYIE 5CB4E 2XAQB 2PBIA 1BR4A 4U74A 4TX5A 3PUAA 1S94A 2IC6A 2PG8A 5HWXA 4HKAA 4QHOA 5LHGB 4E7ZA 5L3DB 3BK9A 3RC3A 2X9HA 3IBPA 3J9X1 1Z0PA 3I0QA 4FI5A 3JC6D 3RH3A 2RA1A 3UULA 2VL8A 4X20E 2XAFB 1ZHCA 5JREA 3CX7B 2CWYA 4BA9A 2VB6A 1KK7A 3AA6B 3U78A 4UELA 1LVKA 2B1EA 3C4WA 2L9QA 3EVYA 5LBMA 3PE0A 4CI2B 2N9DA 2A72A 2RP4A 3CPZA 3L09A 2CXLA 3K3OA 3SOLA 2CWOA 4ZI3C 3RKOA 3UFEA 3CX8B 5FXZA 3UTKA 4GYSA 4BGOA 2L8KA 2VASA 5DQVA 3RRWA 4I4TE 3ZCIA 3IHRA 2EHOA 1U4QA 3BQKA 3I1AA 4DO0A 2HH7A 1AJ3A 3H3AA 4HE8A 4H9NC 3AAAB 1MMAA 2W61A 4ILUA 4A56A 4HN9A 2VK9A 3HKBE 3LBXB 4N78D 3AA7B 5JDHA 5L3BB 4YJ2E 2K24A 3KFWX 2OA5A 4ADZA 4O4JE 3GWHA 3LK2B 4TV8E 3WI3A 2X51A 5LP6E 3CWZB 4ANJA 4C91A 3AA0B 1FEWA 4F6RC 2SPCA 3FXDB 2IC9A 4UF0B 3RPUA 2ODUA 4OYJA 3PUSA 4WNKA 4O4IE 3EDVA 4KMCA 1ZKEA 2NP9A 2L3LA 2N1GA 2Q9QC 4OFZA 2IAKA 3GA8A 5JDQA 1EZ3A 4PAGA 2GK9A 3NBXX 4QX8B 4DBRA 4PJNA 2ACXA 3N9LA 2LHRA 3N5LA 3ZMTB 1ZEEA 2YK0A 2H7VC 5JDNA 4U72A 4UEMA 3UUXB 5LGUB 2VWAA 5IHYA 4AKRB 4MLKA 2P9BA 3DJBA 3IEEA 4AQFA 2V7MA 4YJ3E 5J2UE 4O4HE 3M65A 3HI2A 2D0TA 4JLEA 3VHLA 5BMVE 3LK42 5JDLA 5JQGE 3NRXA 1D1CA 4EXTA 4AI6A 4GIWA 4ZI7E 3Q5WA 5J2TE 1QUUA 1LKXA 2DNXA 2KLQA 4KP3C 5FYMA 4H9OC 3K3NA 2DWKA 3PUGA 2KXPB 1O3XA 4O2AE 3EDUA 4UV9B 4ZI2D 2JQQA 2CLYC 4OHFA 4EB6E 2W62A 1WLXA 1BR1A 4HFVA 3RYCE 5F3JA 3RYHE 4CXYA 4PFOA 3F31A 2CE7A 2G0UA 3C4ZA 3V5SA 3ZPOA 1UX4A 2J1DG 2BZBA 4B6XA 4JEHB 2LHNA 4L9IA 5ETWA 3ZLIA 3AAIA 2E9XB 3FBZA 2XASB 3ZMZB 4X1KE 4QXCB 2ES0A 4H9RC 2KINB 4ZHQE 1HFAA 3O1HA 2IW5B 3KVAA 3U3IA 4JEUB 3I9WA 1T98A 5JR9B 3KBUA 4YLHA 1SA0E 4GK0E 4BAYB 4YFSA 3NRYA 3LBXA 1MIYA 4QKNA 5LG4A 2ZM2A 3C64A 3PURA 3MZKB 5HYAA 3F2EA 2JMHA 3N2GE 1FIOA 1YD8G 4DMWA 4H63V 3N9NA 4P09A 1FMVA 2V1DB 4YHJA 5JVDE 5LHHB 2M67A 3Q5XA 2E9XD 2X9WA 3I0OA 3PF0A 3Q2MA 4UF0A 3MXZA 4L5GA 1IJ6A 4Z8XA 2A2FX 1MIWA 1NAFA 4IHJE 2H3RA 2KWHA 2XHEB 2LSJA 3ZMVB 2LE8A 3ZEFB 2D0UA 3LG7A 2Y8DA 3KV5A 2CMRA 2DLRA 1D1AA 2WM9A 2BVLA 4MBQA 5KMGP 2BVMA 3R84B 4PW8A 4ISSA 5L2LA 5FY0A 4IE5A 4PK4A 2YU1A 3C50A 4MFRA 3VJZA 1G73A 4IDZA 3N9QA 4ONRA 1YKHB 2CEAA 3PTRB 4NUUA 3UUMA 1MMDA 1NWMX 3W15B 4PJLA 4IIJE 3SRZA 1YW0A 2MBGA 2LSGA 4ASKA 3PU3A 4MALA 2CA5A 2QA7A 1OWAA 3B57A 3NZPA 4EAHA 1B7TA 4C90A 4HTEA 1VRBA 5FP3A 3CVRA 2C5KT 3ZCJA 3KINB 3ZJ2A 1G8XA 3AB3B 2XAHB 5LCYA 2ZLYA 2LM9A 3OJAA 5HWYA 5EK2A 5LA6E 1MMGA 1IZNB 1WYBA 4CXWA 2UXXB 3CKDA 2HPJA 3VKGA 2LOSA 5JDGA 5AFUL 2N2NA 4G2AA 3KV4A 3WAKA 2LT3A 2NTYA 2WMOA 4K0UA 3PU8A 2VKJA 1HG5A 3PUQA 4PK6A 5LHIB 2EHOC 1CUNA 2CCQA 2X68A 3MJXA 3UUNA 4EZHA 2E9XA 4IE6A 4GYRA 2JJ9A 4BJNA 4EIWA 4TN7B 3FXEB 4QXBB 2JMKA 1D0YA 4ZS2A 2MYSA 4PK5A 5LNKA 4ECGA 1X79A 2W0GA 2KZ7B 2XUEA 3MA9A 4X1YE 3HKEE 5HXHA 2KT9A 5JR9A 2NWBA 2C5JA 2KMFA 4L0RA 4E7SA 3EUHA 1WYCA 2QGSA 3O1JA 3DP7A 4AKGA 3E22E 5DQWA 3D0TA 4O4LE 3Q9DA 2JRKA 4ZI3D 4P0BA 2DHRA 2XQYA 3KVBA 3SWHA 3ZYMA 3M1CA 1BR2A 5KX5E 3JC6C 4V1Av 4AQGA 4EZ4A 2NTXA 5HXCA 2V26A 2VKHA 3FB2A 3N9PA 3ZMSB 2D5UA 2CXDA 3F57A 2Q9QB 5LOVE 2LSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWY A;  3V5U A;  5HYA A;  5HXE A;  5JDG A;  5HXC A;  5JDM A;  5JDF A;  5HXR A;  5JDL A;  5HXS A;  5JDQ A;  3V5S A;  5JDH A;  5HXH A;  5JDN A;  5HWX A; 
#chains in the Genus database with same CATH topology
 1T7S A;  3ZJ1 A;  5FXW A;  2WSS V;  2HPL A;  3ETV A;  3KBT A;  3RX6 A;  1KFY A;  4QX7 B;  2WDV A;  2XAG B;  5F8P A;  5EK4 A;  4Q25 A;  5H6R B;  5TAO A;  2KWI B;  4YXD A;  3VKH A;  2W63 A;  3AED A;  1R8I A;  3AXJ B;  4GOU A;  1HNW T;  3CX6 B;  2DCF A;  3RIF A;  2E8I A;  4MHC A;  5L3E B;  4ERR A;  2WB5 A;  4ILB A;  2V7K A;  2WCA A;  4I55 E;  2NOX A;  5JDF A;  5LXT E;  4KI0 F;  2WBL A;  3N2K E;  2ODV A;  4NUV A;  2VKD A;  3T1Y T;  3T8O A;  2FJE A;  2HN2 A;  4DV2 T;  5L3F B;  3UT5 E;  2V5C A;  2JQH A;  3MKD A;  2FJD A;  3ZKR A;  5LMN T;  3GMI A;  2XAJ B;  3UU5 A;  4I50 E;  2DL1 A;  3E0Z A;  3O1I A;  1D1B A;  3L3P A;  3LFM A;  4JUY A;  3AE4 A;  4JI7 T;  3ABV A;  5AQQ B;  1VOM A;  4TZ4 C;  4EGW A;  4J2C A;  5FVL A;  5FXV A;  4AXP A;  2WS3 A;  5LJN A;  2LKG A;  1E7P A;  1CHU A;  3EI0 A;  3JAE A;  3ONL C;  3V5U A;  2D2S A;  3VR9 A;  3RKG A;  2E2A A;  3SS1 A;  3AEC A;  3IA3 A;  2MPK A;  3HR0 A;  3N9O A;  3AXJ A;  4WBN E;  4M1P A;  3RF1 A;  4IDP A;  1MIV A;  5LGN B;  1HG2 A;  2V6Y B;  1YKE B;  4KHP T;  1HX1 B;  2WAU A;  2WP9 A;  3OYX A;  2XQ6 A;  1S35 A;  4WW0 A;  4W8P A;  3MAC A;  4YTM A;  4GK5 E;  2VVS A;  2WDR A;  1US7 B;  2WWU A;  2JQK A;  3A7M A;  5AQS B;  4IE4 A;  2C0S A;  2FJA A;  3VU7 H;  5T1D A;  2LM2 A;  3RYI E;  4HWF A;  2CBJ A;  4U74 A;  5HWX A;  2PG8 A;  4HKA A;  4QHO A;  2QVA A;  5L3D B;  1M7K A;  3RC3 A;  1HNZ T;  5ABG A;  1T8B A;  2RA1 A;  2VL8 A;  2MAW A;  3ONJ A;  1WCR A;  5JRE A;  3CX7 B;  2CWY A;  1IBM T;  4YY3 T;  4BA9 A;  4F7G B;  1SE7 A;  3AA6 B;  3F57 A;  4UEL A;  1LVK A;  4CI2 B;  2XSA A;  3G06 A;  3PE0 A;  2N9D A;  3L09 A;  3K3O A;  2CWO A;  4IL9 A;  3RKO A;  5AQI B;  4GYS A;  4BGO A;  2V6Y A;  1W09 A;  4I4T E;  3ZCI A;  4JI2 T;  4A56 A;  4IDQ A;  1IBK T;  4HFE A;  2BKP A;  4ADZ A;  2UUB T;  4TV8 E;  2X51 A;  4U2Y A;  4TWD A;  2SPC A;  3EDV A;  2BG9 C;  4ILC A;  2Q9Q C;  2CPT A;  3NBX X;  3ZMT B;  3SFD A;  2CHN A;  2YK0 A;  1QLB A;  5JDN A;  4IT4 A;  3RIA A;  5L4H A;  4MLK A;  5AQL B;  2P9B A;  5AQJ B;  5J2U E;  4HWC A;  4JLE A;  5IWA T;  5BMV E;  2XM2 A;  1D1C A;  4ZI7 E;  3Q5W A;  2DNX A;  2KLQ A;  4KP3 C;  5FYM A;  3K3N A;  4O2A E;  3EDU A;  4LF7 T;  4EB6 E;  3TLT A;  2G0U A;  3C4Z A;  1UX4 A;  2YOE A;  4HFI A;  5JTG A;  2F4V T;  2J47 A;  1OED E;  2YKS A;  5LMU T;  4H9R C;  1HFA A;  3KVA A;  4JEU B;  4BAY B;  1WFD A;  1MIY A;  4QKN A;  3C64 A;  3JAF A;  1FIO A;  4H63 V;  3N9N A;  2IHR 1;  2A9U A;  4F8H A;  4YHJ A;  2WY2 A;  4DID B;  3PJA A;  2X9W A;  3I0O A;  2BKO A;  3Q2M A;  4QH5 A;  5AQK B;  1NAF A;  4IHJ E;  2XHE B;  2LSJ A;  3ZEF B;  1J1J A;  2RPA A;  4YTN A;  1D1A A;  4MBQ A;  3R84 B;  4PW8 A;  5FY0 A;  4PK4 A;  3N9Q A;  4X65 T;  5HCJ A;  3SRZ A;  3NVO A;  3FZH B;  4EAH A;  1B7T A;  1VRB A;  2C5K T;  1JNR A;  1G8X A;  2LM9 A;  5HWY A;  2HPJ A;  3NKZ A;  5L47 A;  5JDG A;  5HEJ A;  5FL1 A;  3KV4 A;  2LT3 A;  2XQ5 A;  2VKJ A;  1HG5 A;  3PUQ A;  2E5V A;  5LHI B;  4EZH A;  4IE6 A;  4EIW A;  4BJN A;  3FXE B;  4DUY T;  2JMK A;  5LNK A;  2KT9 A;  1XMO T;  4DR7 T;  3EUH A;  1WYC A;  5DQW A;  3Q9D A;  2JRK A;  3OVU A;  2XQY A;  3KVB A;  3SWH A;  5HXC A;  3N9P A;  2Q9Q B;  2W00 A;  2X0L B;  4ZS3 A;  2DWG A;  5AQV B;  4JI5 T;  5L3G B;  1HF8 A;  5DAB A;  4LFB T;  2Q9Q D;  4BJM A;  3N9M A;  4JI6 T;  2WMN A;  2JPF A;  2PJQ A;  5FNV E;  4CN4 A;  2KGX A;  3RC8 A;  4PNI A;  3BQL A;  4UR9 A;  4COF A;  2X9X A;  1MNE A;  3J7Y q;  4G63 A;  2VKO A;  4OK0 A;  5JRC B;  3AE8 A;  4CQI A;  4WBO A;  1W9R A;  5LYJ E;  3UU8 A;  3ZN0 B;  3AVS A;  2XQ3 A;  5HCM A;  4UVB B;  4WYV A;  4H9S E;  4DVD A;  2L10 A;  3RRC A;  2IUB A;  5LGT B;  3T1H T;  3CQC B;  2X66 A;  2BDE A;  4JV5 T;  2Q9Q A;  3LJC A;  3PUZ F;  4H63 H;  5E0O A;  3HA4 A;  1H7C A;  4LF4 T;  2X9Y A;  2B76 A;  3RI5 A;  5C2T A;  2LEH A;  4YSY A;  5AQT B;  3WSC A;  1D0X A;  1WR6 A;  2WZH A;  3NZQ A;  4KUM B;  1V9D A;  3AAE B;  2NW8 A;  2V6X A;  1E1H B;  1KNP A;  4OX9 T;  4XAX B;  2I6H A;  3C51 A;  3L39 A;  1Y64 B;  2H88 A;  3DTO A;  2DI4 A;  5L4E A;  2A3D A;  4ILA A;  4UVA B;  1ZP0 A;  2IIU A;  4HGA A;  4DND A;  2BBJ A;  5FY7 A;  2E9X C;  1HCI A;  3C4X A;  5HXR A;  1BR0 A;  5JRC A;  4TUY E;  5FVK A;  5CA1 E;  5HEG A;  3JAD A;  2NW9 A;  1X9B A;  1QSD A;  3K3Q C;  3MK7 C;  2MOZ A;  2WDQ A;  1HTJ F;  4PJJ A;  4H9P C;  2XZE A;  3ESL A;  3K8P C;  4YT0 A;  5DJQ C;  3ZN1 B;  4DR4 T;  2XAQ B;  2PBI A;  1BR4 A;  2IC6 A;  5AQR B;  2AXD S;  4E7Z A;  2X9H A;  1OED B;  4FI5 A;  2R6G F;  2V5D A;  3AE2 A;  1KK7 A;  2VL0 A;  3H3M A;  3C4W A;  4X64 T;  3P4S A;  3QOF A;  2A72 A;  2CXL A;  3UTK A;  3CK6 A;  1ZOY A;  2HH7 A;  3H3A A;  3AAA B;  2W61 A;  3RIU C;  2VK9 A;  2K24 A;  2OA5 A;  4O4J E;  3GWH A;  4QH4 A;  1UUR A;  1XZY A;  2WU2 A;  4O4I E;  4WNK A;  2XY8 B;  4KMC A;  3ZSS A;  2N1G A;  1I6Z A;  4CN1 A;  1EZ3 A;  4PAG A;  2GK9 A;  4PJN A;  2ACX A;  2LHR A;  2H7V C;  4U72 A;  2V8S V;  1XWM A;  2VWA A;  5LGU B;  4AKR B;  4GKJ T;  1XDP A;  2UXC T;  4O4H E;  3HI2 A;  2D0T A;  1JNZ A;  3VHL A;  3NRX A;  4EXT A;  4JI1 T;  1OED A;  3VR8 A;  3UQ4 A;  5J2T E;  2OV9 A;  1LKX A;  1NEK A;  2BS4 A;  2J4G A;  2JQQ A;  2CLY C;  5FZT A;  1WLX A;  4NXN T;  3RYC E;  5F3J A;  3RYH E;  2CE7 A;  2XQ9 A;  3ZPO A;  4JI0 T;  2LHN A;  4L9I A;  3AAI A;  2E9X B;  3FBZ A;  3AE7 A;  4QXC B;  4GKK T;  2ES0 A;  2HN1 A;  2WZI A;  3LSV A;  3I9W A;  1SA0 E;  4GK0 E;  1NEN A;  3NRY A;  4X66 T;  2KSR A;  3TLW A;  3F2E A;  1J5W A;  2M67 A;  2E9X D;  5ABH A;  4JI8 T;  4ZEY A;  3CIR A;  4L5G A;  4Z8X A;  1MIW A;  3P4W A;  3UUB A;  3ZMV B;  2UU9 T;  2D0U A;  1J5E T;  2CMR A;  2DLR A;  4U3C A;  4DV5 T;  3C50 A;  2LRL A;  3W15 B;  4PJL A;  2LSG A;  4ASK A;  4HFB A;  1OWA A;  3NZP A;  5FP3 A;  5HEU A;  3ZCJ A;  2OLT A;  3AB3 B;  3OJA A;  2WQY A;  4CXW A;  2UXX B;  3UFG A;  3CKD A;  1HR0 T;  4ZZC A;  3Q5E A;  4K0U A;  3PU8 A;  1KNR A;  3RQW A;  2W4X A;  2EHO C;  2I0M A;  1CUN A;  3MJX A;  3UUN A;  2E9X A;  3AE9 A;  4QXB B;  1D0Y A;  4JI3 T;  3FZK B;  4Z90 A;  2KZ7 B;  2XUE A;  4X1Y E;  4HFD A;  2KMF A;  2LRK A;  4L0R A;  4YSZ A;  2QGS A;  3O1J A;  4O4L E;  2FUP A;  4P0B A;  2DHR A;  3ZYM A;  1BR2 A;  4B3S T;  3JC6 C;  4AQG A;  4EZ4 A;  2NTX A;  3AEG A;  2VKH A;  3UU3 A;  1I94 T;  4NPP A;  5F5W A;  2CRB A;  3CQG B;  5M4Y A;  5LJM A;  3ZC0 A;  3A8Y C;  4P0A A;  3GN5 B;  2ACZ A;  3ZYK A;  3E08 A;  2YEV C;  2ZM0 A;  3O9X A;  3CQX C;  3HKC E;  3AVR A;  3X1D A;  2K3W A;  5CA0 E;  4A98 A;  3I9Y A;  4CI3 B;  4JYA T;  2CXF A;  3PDY A;  2CLY B;  4IE7 A;  4B3M T;  5JH7 E;  1D0Z A;  1ZV4 X;  5KDM C;  5LBQ B;  4TNV A;  4PJM A;  2FJB A;  2FBW A;  4ZOL E;  4EYY R;  2K5B B;  5J0Z A;  4DR3 T;  2X0Y A;  5HXS A;  4X5T A;  5EK3 A;  1N34 T;  1MND A;  2V7J A;  3ETU A;  3AE3 A;  1SJ8 A;  2Y6X A;  3RIU A;  4LF9 T;  5JDM A;  2K48 A;  3KV9 A;  3WAJ A;  4UV8 B;  4LF6 T;  4O2B E;  2BBH A;  4IDO A;  4CXX A;  3P8C D;  4X1I E;  3TLU A;  2NW7 A;  3P7I A;  2V7I A;  3RYF E;  1MMN A;  5AQF B;  2L7N A;  1UUS A;  1WRD A;  5L3C B;  1IAP A;  4DV4 T;  4K0K T;  2LOP A;  5HAX A;  3GN5 A;  3A5X A;  5ADX L;  2YIN A;  1UX5 A;  5GON E;  4QXH B;  1LVF A;  2XTL A;  4AIU A;  1N33 T;  4AQY T;  2LSK A;  2X67 A;  2MTQ A;  2ZMA A;  4O8S A;  1YQ3 A;  4EOZ B;  4AKH A;  3ZYL A;  3SFE A;  4AKI A;  4NIQ A;  3RGL A;  2H89 A;  4OYK A;  1FJG T;  4EED A;  2EHO B;  3P4Q A;  3EAM A;  4YTP A;  1HS7 A;  3KV6 A;  3WUR A;  4XBF B;  3ONX A;  2BS2 A;  4UXN B;  5EZY E;  2YU2 A;  1HX8 A;  1OED C;  2XPK A;  3ZC1 A;  4QH1 A;  2CM0 A;  5C8Y E;  4FJO A;  3ZMU B;  1OXZ A;  2CHO A;  2YN6 A;  4PFP A;  2MTC A;  2LSY A;  2EHO D;  5AQO B;  2UXN B;  2XM1 A;  4IGU A;  4EYU A;  3AT7 A;  3PHF 1;  1SUM B;  3AY5 A;  5CB4 E;  4TX5 A;  3PUA A;  1S94 A;  4LFA T;  3J9X 1;  1Z0P A;  3JC6 D;  3RH3 A;  3UUL A;  4DV1 T;  4X20 E;  2XAF B;  5LB7 B;  2J62 A;  2UXB T;  2B1E A;  3EVY A;  3EHZ A;  3CPZ A;  3SOL A;  4ZI3 C;  3CX8 B;  5FXZ A;  2L8K A;  2LLY A;  2W2U A;  3IHR A;  2EHO A;  4LFC T;  4DR2 T;  4HWI B;  4NXM T;  4H9N C;  1MMA A;  4U33 A;  1XDO A;  4ILU A;  2PTF A;  4HN9 A;  3HKB E;  3LBX B;  3AA7 B;  4IRE A;  5JDH A;  5L3B B;  4B3R T;  5LP6 E;  3LDQ B;  1FEW A;  4F6R C;  3FXD B;  4UF0 B;  3RPU A;  2ODU A;  4OYJ A;  3PUS A;  5ABF B;  2NP9 A;  2IAK A;  3GA8 A;  5JDQ A;  4Z91 A;  5FL0 A;  3N9L A;  5KXJ A;  3JCF A;  5IHY A;  2AE9 A;  3DJB A;  4AQF A;  2V7M A;  5JDL A;  4A5X A;  3FZL B;  3K1S A;  3AE1 A;  2D9D A;  4H9O C;  2DWK A;  3PUG A;  2KXP B;  3UU6 A;  4UV9 B;  3UQ7 A;  4OHF A;  1BR1 A;  3ZT5 A;  4TWH A;  4CXY A;  2JIW A;  4PFO A;  3F31 A;  3V5S A;  2J1D G;  2BZB A;  4B6X A;  1XNQ T;  5ETW A;  3ZMZ B;  5HEH A;  1VCT A;  3L8R A;  4X1K E;  4DV3 T;  3B5M A;  1T98 A;  4YFS A;  3LBX A;  2LKH A;  4YHH T;  3VRB A;  5LG4 A;  3PUR A;  2JMH A;  3QB5 K;  3N2G E;  1YD8 G;  3RQU A;  5AQP B;  1FMV A;  5JVD E;  4DV0 T;  4UF0 A;  3MXZ A;  5ABF A;  2A2F X;  3FZF B;  2LE8 A;  2WM9 A;  2BVL A;  2BVM A;  4ISS A;  4IE5 A;  2YU1 A;  4MFR A;  3VJZ A;  1DU2 A;  2X0C A;  1G73 A;  4IDZ A;  3DYJ A;  4ONR A;  1YKH B;  3UUM A;  1MMD A;  1NWM X;  2XJ7 A;  4HFC A;  2MBG A;  1IBL T;  2CA5 A;  2QA7 A;  3B57 A;  4C90 A;  4HTE A;  3ZJ2 A;  3KIN B;  3PUW F;  3M3Z B;  5LCY A;  2XAH B;  3RLF F;  1HNX T;  2IML A;  5LA6 E;  1MMG A;  1WYB A;  1T72 A;  5FKY A;  1VCS A;  4HFH A;  5AFU L;  5CGM A;  2M6I A;  5AQN B;  3OTO T;  4G2A A;  3WAK A;  2WMO A;  5BR8 T;  4PK6 A;  2WWV A;  2X68 A;  4GYR A;  2JJ9 A;  4ZS2 A;  4PK5 A;  4ECG A;  2E5L T;  2BG9 E;  3MA9 A;  3QNU A;  5HXH A;  2C5J A;  4U7Y A;  3NWI A;  4E7S A;  1XNR T;  5CFB A;  3E22 E;  2QRX A;  4ZI3 D;  1L0V A;  2V26 A;  3FB2 A;  3ZMS B;  2D5U A;  5AQG B;  5FMN A;  2H7O A;  3ANW B;  3ZT7 A;  4I43 B;  3AEF A;  5FY1 A;  4LML A;  5FXX A;  3OBV E;  4KBM B;  5HEO A;  4ZZB A;  5A1L A;  4TNW A;  2V7L A;  4DMV A;  2HHH T;  4CI1 B;  4HWH A;  2PFV A;  1FMW A;  2KND A;  5CJ5 A;  2VQE T;  2YDQ A;  5HXE A;  2NR4 A;  4EEB A;  1LRZ A;  4DBQ A;  4CZZ B;  1U5P A;  4XZC A;  5ABE A;  2XQ7 A;  5AQM B;  2CBI A;  5J1G A;  4AIS A;  3B13 A;  4IE0 A;  2LQU A;  3QC9 A;  4CN6 A;  3S4U A;  2Z6E A;  4HEA A;  2W67 A;  2VUR A;  4YSX A;  1SHZ C;  1UCU A;  2C5I T;  3P4P A;  2UUC T;  3LK3 B;  2I59 A;  3KDS E;  4KX6 A;  4EV6 A;  1IJ5 A;  2XQ4 A;  3FHN A;  1UGO A;  4ZI2 C;  3ANW A;  4LF5 T;  2Y48 B;  4DV6 T;  4UIG A;  3OYZ A;  4IST A;  3AA1 B;  3C98 B;  4X62 T;  3R6N A;  1YXR A;  3RHW A;  5AQH B;  3IF8 B;  2JQ9 A;  3HL6 A;  3HKD E;  3VRA A;  3O4X E;  3CML A;  3BQI A;  3QK6 A;  4QWN B;  4AKL A;  3PV0 F;  3PUX F;  3FBL A;  4H9Q C;  3QUJ A;  1E2A A;  3OKQ A;  3N2O A;  3PUV F;  2XQ8 A;  4AQF C;  5JR9 C;  2XSB A;  3PJA J;  3PUY F;  2LJL A;  4U31 A;  1KNZ A;  4DR1 T;  4TV9 E;  5H6Q B;  3TKL B;  2K9A A;  4UVC B;  2ZM8 A;  3P4R A;  4U7I A;  5IYZ E;  2UXD T;  1W0B A;  3H37 A;  4B3T T;  3AEB A;  4WZX A;  5LHG B;  4ZXL A;  5AQU B;  3FZM B;  3BK9 A;  3IBP A;  5IUX A;  3QB5 A;  3I0Q A;  4A97 A;  1ZHC A;  2VB6 A;  4U2Z A;  3U78 A;  4TWF A;  1N32 T;  1W0A A;  1YQ4 A;  2L9Q A;  5LBM A;  4IL4 A;  2RP4 A;  1N36 T;  3FYQ A;  5LG3 A;  3UFE A;  2VAS A;  5DQV A;  3AEA A;  3RRW A;  1U4Q A;  1M62 A;  3BQK A;  1Y01 A;  3I1A A;  4DO0 A;  3AE5 A;  1AJ3 A;  1KF6 A;  4HE8 A;  4JI4 T;  4N78 D;  4YJ2 E;  3KFW X;  4LF8 T;  3LK2 B;  3WI3 A;  2BS3 A;  2QYW A;  3TLS A;  3CWZ B;  4LMJ A;  3TLV A;  4ANJ A;  4C91 A;  4DR6 T;  3AA0 B;  2IC9 A;  2X0H A;  1ZKE A;  2IDO B;  2L3L A;  4OFZ A;  2VVN A;  4DBR A;  4QX8 B;  3N5L A;  1UK5 A;  1ZEE A;  3P50 A;  4UEM A;  3UUX B;  2YDS A;  2BKN A;  3IEE A;  4YJ3 E;  3M65 A;  3LK4 2;  2XQA A;  5JQG E;  4AI6 A;  4GIW A;  1QUU A;  2VQF T;  1O3X A;  2BG9 B;  4ZI2 D;  2W62 A;  4HFV A;  3ZST A;  1Z8U A;  4JEH B;  1GQE A;  3ZLI A;  2XAS B;  2KIN B;  3O1H A;  2IW5 B;  3U3I A;  5JR9 B;  3KBU A;  4YLH A;  2ZM6 T;  1SJ7 A;  2ZM2 A;  3MZK B;  5HYA A;  4DMW A;  4IDN A;  3ZT6 A;  4P09 A;  2V1D B;  5LHH B;  3OPC A;  3Q5X A;  3PF0 A;  2KBB A;  1IJ6 A;  2H3R A;  2KWH A;  1KEY A;  3LG7 A;  2KVP A;  2Y8D A;  3KV5 A;  2M6B A;  3UU4 A;  5KMG P;  5C3J A;  2WU5 A;  5L2L A;  4DV7 T;  2CEA A;  3PTR B;  4NUU A;  4KHZ F;  4IIJ E;  1YW0 A;  4DUZ T;  3PU3 A;  4MAL A;  3AEE A;  1WR0 A;  3CVR A;  2ZLY A;  5EK2 A;  4LMK A;  1XMQ T;  2BG9 A;  1IZN B;  3EAB A;  3VKG A;  2LOS A;  2N2N A;  2NTY A;  2YDR A;  2CCQ A;  3AE6 A;  4TN7 B;  4P1N A;  2MYS A;  1X79 A;  2W0G A;  3Q5D A;  4HWD A;  3HKE E;  4JBW F;  5JR9 A;  2NWB A;  4I0U A;  3DP7 A;  4AKG A;  4DR5 T;  3D0T A;  3M1C A;  5KX5 E;  4V1A v;  2W66 A;  2UUA T;  2CXD A;  4ZHQ E;  5LOV E;  2LSI A; 
#chains in the Genus database with same CATH homology
 5FMN A;  2W00 A;  2H7O A;  2X0L B;  3ANW B;  3CQG B;  3ZJ1 A;  5M4Y A;  5LJM A;  3ZC0 A;  5FXW A;  4I43 B;  4P0A A;  4ZS3 A;  5FY1 A;  2WSS V;  3GN5 B;  3ZYK A;  2DWG A;  2HPL A;  3E08 A;  3ETV A;  3KBT A;  2YEV C;  5FXX A;  3OBV E;  4KBM B;  3RX6 A;  2ZM0 A;  4QX7 B;  3O9X A;  5A1L A;  5L3G B;  3CQX C;  1HF8 A;  3HKC E;  5DAB A;  3AVR A;  2Q9Q D;  4BJM A;  2XAG B;  2V7L A;  5F8P A;  4DMV A;  3N9M A;  5EK4 A;  2WMN A;  4CI1 B;  2JPF A;  2PJQ A;  5FNV E;  5CA0 E;  3I9Y A;  5H6R B;  4CI3 B;  2CXF A;  2PFV A;  5TAO A;  3PDY A;  2CLY B;  1FMW A;  2KWI B;  2KND A;  4IE7 A;  5JH7 E;  4PNI A;  3RC8 A;  1D0Z A;  1ZV4 X;  3BQL A;  5KDM C;  5LBQ B;  3VKH A;  2W63 A;  5HXE A;  4GOU A;  2X9X A;  1MNE A;  4PJM A;  1LRZ A;  3J7Y q;  3CX6 B;  2VKO A;  4G63 A;  4ZOL E;  4EYY R;  2DCF A;  4DBQ A;  2K5B B;  4CZZ B;  1U5P A;  4XZC A;  4OK0 A;  2E8I A;  5HXS A;  4MHC A;  5L3E B;  5JRC B;  5EK3 A;  1MND A;  4WBO A;  2V7J A;  4CQI A;  4ERR A;  5LYJ E;  3ETU A;  2V7K A;  4I55 E;  2NOX A;  3ZN0 B;  3AVS A;  2Y6X A;  5J1G A;  5JDF A;  5LXT E;  3B13 A;  4IE0 A;  2LQU A;  3QC9 A;  4UVB B;  4H9S E;  2WBL A;  3S4U A;  4DVD A;  3N2K E;  3RRC A;  2ODV A;  2K48 A;  3KV9 A;  5JDM A;  2Z6E A;  4NUV A;  4HEA A;  5LGT B;  3WAJ A;  4UV8 B;  4O2B E;  2VKD A;  1SHZ C;  1UCU A;  2C5I T;  3T8O A;  3LK3 B;  5L3F B;  2I59 A;  3UT5 E;  4CXX A;  3MKD A;  3P8C D;  4X1I E;  3CQC B;  3KDS E;  3GMI A;  1IJ5 A;  2NW7 A;  2X66 A;  3P7I A;  2BDE A;  2Q9Q A;  3LJC A;  2XAJ B;  2V7I A;  3RYF E;  1MMN A;  4I50 E;  3E0Z A;  3O1I A;  1D1B A;  3L3P A;  3LFM A;  3FHN A;  4ZI2 C;  3ANW A;  2Y48 B;  4H63 H;  4JUY A;  1WRD A;  5E0O A;  5L3C B;  1IAP A;  3HA4 A;  1H7C A;  2X9Y A;  4UIG A;  3OYZ A;  4IST A;  2LOP A;  5HAX A;  3AA1 B;  3C98 B;  3R6N A;  1VOM A;  4TZ4 C;  3GN5 A;  3A5X A;  5ADX L;  4J2C A;  2LEH A;  2YIN A;  1UX5 A;  5GON E;  3WSC A;  4QXH B;  1LVF A;  1D0X A;  1WR6 A;  2XTL A;  3NZQ A;  3IF8 B;  4KUM B;  3HL6 A;  5FXV A;  4AXP A;  1V9D A;  3AAE B;  2LSK A;  2X67 A;  3HKD E;  5LJN A;  2NW8 A;  1E1H B;  2MTQ A;  3O4X E;  3CML A;  3V5U A;  3BQI A;  2D2S A;  2ZMA A;  3QK6 A;  4O8S A;  4XAX B;  4EOZ B;  3C51 A;  4QWN B;  4AKL A;  3SS1 A;  4AKH A;  1Y64 B;  3ZYL A;  3DTO A;  2DI4 A;  2A3D A;  4AKI A;  3FBL A;  4UVA B;  4H9Q C;  3HR0 A;  3N9O A;  4WBN E;  3QUJ A;  4M1P A;  1MIV A;  4OYK A;  5LGN B;  1HG2 A;  3OKQ A;  4HGA A;  5FY7 A;  4DND A;  2E9X C;  1HCI A;  1YKE B;  3C4X A;  5HXR A;  1BR0 A;  2EHO B;  2WAU A;  3N2O A;  5JRC A;  3OYX A;  4TUY E;  1HS7 A;  5CA1 E;  3KV6 A;  1S35 A;  4WW0 A;  4AQF C;  3WUR A;  5JR9 C;  4XBF B;  3MAC A;  3ONX A;  4UXN B;  5EZY E;  2YU2 A;  1HX8 A;  2NW9 A;  3ZC1 A;  2LJL A;  2CM0 A;  1KNZ A;  4GK5 E;  5C8Y E;  4FJO A;  3ZMU B;  1QSD A;  1OXZ A;  3K3Q C;  4TV9 E;  3MK7 C;  5H6Q B;  2MOZ A;  4PFP A;  1HTJ F;  3TKL B;  1US7 B;  4PJJ A;  2K9A A;  2MTC A;  2WWU A;  4UVC B;  2LSY A;  4H9P C;  2EHO D;  3ESL A;  2UXN B;  2ZM8 A;  3K8P C;  4IE4 A;  4IGU A;  4EYU A;  3AT7 A;  3PHF 1;  5IYZ E;  5DJQ C;  2C0S A;  3VU7 H;  3H37 A;  3ZN1 B;  5T1D A;  3RYI E;  5CB4 E;  2XAQ B;  2PBI A;  1BR4 A;  4U74 A;  4TX5 A;  3PUA A;  1S94 A;  2IC6 A;  2PG8 A;  5HWX A;  4HKA A;  4QHO A;  5LHG B;  4E7Z A;  5L3D B;  3BK9 A;  3RC3 A;  2X9H A;  3IBP A;  3J9X 1;  1Z0P A;  3I0Q A;  4FI5 A;  3JC6 D;  3RH3 A;  2RA1 A;  3UUL A;  2VL8 A;  4X20 E;  2XAF B;  1ZHC A;  5JRE A;  3CX7 B;  2CWY A;  4BA9 A;  2VB6 A;  1KK7 A;  3AA6 B;  3U78 A;  4UEL A;  1LVK A;  2B1E A;  3C4W A;  2L9Q A;  3EVY A;  5LBM A;  3PE0 A;  4CI2 B;  2N9D A;  2A72 A;  2RP4 A;  3CPZ A;  3L09 A;  2CXL A;  3K3O A;  3SOL A;  2CWO A;  4ZI3 C;  3RKO A;  3UFE A;  3CX8 B;  5FXZ A;  3UTK A;  4GYS A;  4BGO A;  2L8K A;  2VAS A;  5DQV A;  3RRW A;  4I4T E;  3ZCI A;  3IHR A;  2EHO A;  1U4Q A;  3BQK A;  3I1A A;  4DO0 A;  2HH7 A;  1AJ3 A;  3H3A A;  4HE8 A;  4H9N C;  3AAA B;  1MMA A;  2W61 A;  4ILU A;  4A56 A;  4HN9 A;  2VK9 A;  3HKB E;  3LBX B;  4N78 D;  3AA7 B;  5JDH A;  5L3B B;  4YJ2 E;  2K24 A;  3KFW X;  2OA5 A;  4ADZ A;  4O4J E;  3GWH A;  3LK2 B;  4TV8 E;  3WI3 A;  2X51 A;  5LP6 E;  3CWZ B;  4ANJ A;  4C91 A;  3AA0 B;  1FEW A;  4F6R C;  2SPC A;  3FXD B;  2IC9 A;  4UF0 B;  3RPU A;  2ODU A;  4OYJ A;  3PUS A;  4WNK A;  4O4I E;  3EDV A;  4KMC A;  1ZKE A;  2NP9 A;  2L3L A;  2N1G A;  2Q9Q C;  4OFZ A;  2IAK A;  3GA8 A;  5JDQ A;  1EZ3 A;  4PAG A;  2GK9 A;  3NBX X;  4QX8 B;  4DBR A;  4PJN A;  2ACX A;  3N9L A;  2LHR A;  3N5L A;  3ZMT B;  1ZEE A;  2YK0 A;  2H7V C;  5JDN A;  4U72 A;  4UEM A;  3UUX B;  5LGU B;  2VWA A;  5IHY A;  4AKR B;  4MLK A;  2P9B A;  3DJB A;  3IEE A;  4AQF A;  2V7M A;  4YJ3 E;  5J2U E;  4O4H E;  3M65 A;  3HI2 A;  2D0T A;  4JLE A;  3VHL A;  5BMV E;  3LK4 2;  5JDL A;  5JQG E;  3NRX A;  1D1C A;  4EXT A;  4AI6 A;  4GIW A;  4ZI7 E;  3Q5W A;  5J2T E;  1QUU A;  1LKX A;  2DNX A;  2KLQ A;  4KP3 C;  5FYM A;  4H9O C;  3K3N A;  2DWK A;  3PUG A;  2KXP B;  1O3X A;  4O2A E;  3EDU A;  4UV9 B;  4ZI2 D;  2JQQ A;  2CLY C;  4OHF A;  4EB6 E;  2W62 A;  1WLX A;  1BR1 A;  4HFV A;  3RYC E;  5F3J A;  3RYH E;  4CXY A;  4PFO A;  3F31 A;  2CE7 A;  2G0U A;  3C4Z A;  3V5S A;  3ZPO A;  1UX4 A;  2J1D G;  2BZB A;  4B6X A;  4JEH B;  2LHN A;  4L9I A;  5ETW A;  3ZLI A;  3AAI A;  2E9X B;  3FBZ A;  2XAS B;  3ZMZ B;  4X1K E;  4QXC B;  2ES0 A;  4H9R C;  2KIN B;  4ZHQ E;  1HFA A;  3O1H A;  2IW5 B;  3KVA A;  3U3I A;  4JEU B;  3I9W A;  1T98 A;  5JR9 B;  3KBU A;  4YLH A;  1SA0 E;  4GK0 E;  4BAY B;  4YFS A;  3NRY A;  3LBX A;  1MIY A;  4QKN A;  5LG4 A;  2ZM2 A;  3C64 A;  3PUR A;  3MZK B;  5HYA A;  3F2E A;  2JMH A;  3N2G E;  1FIO A;  1YD8 G;  4DMW A;  4H63 V;  3N9N A;  4P09 A;  1FMV A;  2V1D B;  4YHJ A;  5JVD E;  5LHH B;  2M67 A;  3Q5X A;  2E9X D;  2X9W A;  3I0O A;  3PF0 A;  3Q2M A;  4UF0 A;  3MXZ A;  4L5G A;  1IJ6 A;  4Z8X A;  2A2F X;  1MIW A;  1NAF A;  4IHJ E;  2H3R A;  2KWH A;  2XHE B;  2LSJ A;  3ZMV B;  2LE8 A;  3ZEF B;  2D0U A;  3LG7 A;  2Y8D A;  3KV5 A;  2CMR A;  2DLR A;  1D1A A;  2WM9 A;  2BVL A;  4MBQ A;  5KMG P;  2BVM A;  3R84 B;  4PW8 A;  4ISS A;  5L2L A;  5FY0 A;  4IE5 A;  4PK4 A;  2YU1 A;  3C50 A;  4MFR A;  3VJZ A;  1G73 A;  4IDZ A;  3N9Q A;  4ONR A;  1YKH B;  2CEA A;  3PTR B;  4NUU A;  3UUM A;  1MMD A;  1NWM X;  3W15 B;  4PJL A;  4IIJ E;  3SRZ A;  1YW0 A;  2MBG A;  2LSG A;  4ASK A;  3PU3 A;  4MAL A;  2CA5 A;  2QA7 A;  1OWA A;  3B57 A;  3NZP A;  4EAH A;  1B7T A;  4C90 A;  4HTE A;  1VRB A;  5FP3 A;  3CVR A;  2C5K T;  3ZCJ A;  3KIN B;  3ZJ2 A;  1G8X A;  3AB3 B;  2XAH B;  5LCY A;  2ZLY A;  2LM9 A;  3OJA A;  5HWY A;  5EK2 A;  5LA6 E;  1MMG A;  1IZN B;  1WYB A;  4CXW A;  2UXX B;  3CKD A;  2HPJ A;  3VKG A;  2LOS A;  5JDG A;  5AFU L;  2N2N A;  4G2A A;  3KV4 A;  3WAK A;  2LT3 A;  2NTY A;  2WMO A;  4K0U A;  3PU8 A;  2VKJ A;  1HG5 A;  3PUQ A;  4PK6 A;  5LHI B;  2EHO C;  1CUN A;  2CCQ A;  2X68 A;  3MJX A;  3UUN A;  4EZH A;  2E9X A;  4IE6 A;  4GYR A;  2JJ9 A;  4BJN A;  4EIW A;  4TN7 B;  3FXE B;  4QXB B;  2JMK A;  1D0Y A;  4ZS2 A;  2MYS A;  4PK5 A;  5LNK A;  4ECG A;  1X79 A;  2W0G A;  2KZ7 B;  2XUE A;  3MA9 A;  4X1Y E;  3HKE E;  5HXH A;  2KT9 A;  5JR9 A;  2NWB A;  2C5J A;  2KMF A;  4L0R A;  4E7S A;  3EUH A;  1WYC A;  2QGS A;  3O1J A;  3DP7 A;  4AKG A;  3E22 E;  5DQW A;  3D0T A;  4O4L E;  3Q9D A;  2JRK A;  4ZI3 D;  4P0B A;  2DHR A;  2XQY A;  3KVB A;  3SWH A;  3ZYM A;  3M1C A;  1BR2 A;  5KX5 E;  3JC6 C;  4V1A v;  4AQG A;  4EZ4 A;  2NTX A;  5HXC A;  2V26 A;  2VKH A;  3FB2 A;  3N9P A;  3ZMS B;  2D5U A;  2CXD A;  3F57 A;  2Q9Q B;  5LOV E;  2LSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...