5HWYA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 10 mm na+ and zero ca2+
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
Knots found
sequence length
300
structure length
300
Chain Sequence
b'MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEENNDKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized membrane protein MJ0091
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 133
structure length 300
sequence length 300
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hwyA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hwyA02
5JDLA 5HWYA 5HXSA 5HXRA 5JDNA 5HYAA 5HXEA 5HXCA 3V5UA 5HWXA 5JDHA 3V5SA 5JDQA 5JDGA 5JDFA 5HXHA 5JDMA
chains in the Genus database with same CATH superfamily
1UUSA 1E1HB 3ZN0B 5J2TE 1HX8A 2DWKA 4PJMA 4L5GA 4DR2T 2VQET 3PU3A 2LM9A 4HFHA 4AQGA 2V1DB 1XZYA 4YTMA 4IDZA 2AXDS 4OHFA 3ZPOA 2JJ9A 4EEBA 3M1CA 4GIWA 4IE5A 2H7VC 3C98B 3ETUA 2EHOB 2XAFB 4NPPA 2Y8DA 3AEDA 2X66A 3FZLB 4HWDA 4AKRB 3PUXF 2UUCT 3PDYA 3RX6A 4QH1A 4ISTA 5JDHA 5FY7A 2CMRA 2OA5A 1ZV4X 2MPKA 1IBKT 3IF8B 2Z6EA 1W09A 3ZLIA 3OJAA 3A8YC 3B57A 3N9QA 4WYVA 4EV6A 3PUQA 2DCFA 2X9YA 5T1DA 4TUYE 1WRDA 1HCIA 1J5WA 4UVAB 2LEHA 3HR0A 2ZM0A 2XM1A 4B6XA 4YSXA 4M1PA 1HFAA 4YFSA 3GN5A 3E08A 4JI1T 2KWHA 4MBQA 2CXLA 3RQWA 2WWVA 4UXNB 1HR0T 4JUYA 2NWBA 4ZXLA 2LKGA 3UQ7A 2B1EA 4PAGA 4DBQA 3UFGA 4AKGA 5HEJA 4JBWF 1DU2A 3C51A 1S94A 2EHOD 5J1GA 4IE4A 2WS3A 5AQKB 4IGUA 4EYYR 4OFZA 5L3GB 4ONRA 3LBXA 2WMNA 3HL6A 3LBXB 4X64T 1KK7A 3VR9A 5FY1A 1MMDA 2W67A 3RGLA 4DVDA 3SS1A 4E7ZA 4DUYT 2DWGA 2LSKA 2VWAA 2BBHA 3U3IA 2BBJA 2L9QA 4DIDB 3K3QC 2YN6A 3FXEB 3O1IA 1YXRA 5DABA 2KT9A 5AQGB 3ONLC 2KLQA 4HTEA 3O1JA 4A56A 3MXZA 2YDSA 2Q9QC 2RPAA 2R6GF 3K3NA 4TWDA 2N2NA 3RKGA 2YOEA 5ABHA 2LHNA 1QUUA 3AE9A 2H88A 5CFBA 3PUVF 4PJJA 5BMVE 4IL4A 3SFEA 1FJGT 3QC9A 2DNXA 3UUXB 3UUNA 1HS7A 2FJAA 2WWUA 3R6NA 5J2UE 1E2AA 3AEFA 4LFCT 1CHUA 4DR7T 3NRYA 2LOPA 2CWYA 2XJ7A 2LKHA 5HXEA 2FJEA 2WDQA 4LF7T 3TLSA 3KV9A 4HGAA 2HN1A 2MYSA 4K0UA 4LF6T 4GYSA 4X65T 2XQAA 2PG8A 2FJDA 1WFDA 4V1Av 2KXPB 3KBUA 3ABVA 1KEYA 4WW0A 1KFYA 4LMKA 5L3BB 1QSDA 1ZOYA 3AE5A 3DTOA 4KHPT 5LB7B 3AT7A 3R84B 3L09A 4CI1B 3VU7H 3FBLA 5LHGB 4EAHA 2WU2A 5AQFB 2G0UA 5ADXL 4CXWA 3PUSA 3HKDE 1XNRT 5AFUL 1GQEA 1NAFA 1LVKA 4MALA 5HEOA 5L47A 2IIUA 3WURA 2XAJB 3VKHA 4B3ST 4NXMT 5JTGA 1M62A 5IWAT 3P8CD 2OV9A 3ZC1A 3O4XE 3RHWA 4OX9T 3OVUA 3AE3A 4IE0A 2J1DG 2LRLA 1BR0A 2JMHA 5CJ5A 2HHHT 2NR4A 2B76A 3ZSSA 2VKHA 3QK6A 4EXTA 3F2EA 4EOZB 5LHIB 2EHOC 2MOZA 2VKOA 2UUAT 2L10A 1UCUA 4ILUA 2JQHA 3AE6A 1LRZA 2HPJA 2X0HA 1YQ3A 4DR3T 4JI5T 2W4XA 3M3ZB 3RPUA 5E0OA 4H63V 2LSJA 4ILCA 3LDQB 3CPZA 5FY0A 4EEDA 2XQ9A 1BR4A 4I43B 2F4VT 2Q9QA 2Q9QB 4ZZCA 3ZSTA 2ES0A 2D5UA 2XQ3A 2W00A 4TWFA 2WAUA 4JEHB 4PW8A 1HX1B 3AE4A 2V26A 2OLTA 4I55E 3U78A 2E2AA 4TNVA 4O4LE 4X5TA 3P7IA 4AKIA 3FXDB 4LMLA 2BKPA 4GKKT 2K9AA 4OK0A 3ZC0A 2PTFA 3CKDA 4HKAA 4AQYT 3AEGA 5FVLA 4DR1T 2BS4A 2KZ7B 2VL0A 2ODVA 3CQXC 3V5SA 1I94T 4NXNT 1WLXA 5HXRA 1YKHB 1OEDB 4YTPA 4H9QC 2FBWA 4CI3B 3B13A 4E7SA 2RP4A 1XDPA 3BQKA 3EABA 2XZEA 3W15B 1SUMB 1W9RA 3SOLA 3ZJ1A 4H9SE 4CQIA 1U4QA 3H37A 4FI5A 5F3JA 1MNEA 1CUNA 2XUEA 5FXXA 1VCTA 2A2FX 5L4HA 1YW0A 2WM9A 3ZMTB 4HN9A 4LF8T 3N9LA 4DV0T 5EK2A 5KXJA 3NBXX 5AQSB 4LF5T 3VKGA 3MK7C 5ABFA 3EDUA 4QXHB 2ACZA 1BR2A 3EUHA 3O1HA 2MTCA 3FZHB 1D0ZA 3BQIA 2QGSA 3IHRA 1MNDA 4UVCB 2W61A 5LA6E 1YKEB 2H7OA 4O2BE 2BDEA 3RLFF 2I59A 4X62T 4IE6A 5LP6E 3VHLA 5HAXA 3CQGB 4BA9A 3HI2A 3WSCA 4U3CA 4COFA 4JV5T 4YHJA 3UT5E 2FJBA 5ETWA 3RI5A 2NW8A 3FZFB 4JI6T 2H3RA 1MMAA 4KUMB 4I50E 3AB3B 3C64A 3PE0A 2EHOA 3UUMA 4QHOA 1T8BA 5LJMA 5FYMA 4DR6T 2ZM2A 4OYKA 3ZMZB 3P50A 3ZYMA 1LVFA 3Q5XA 2K5BB 5LCYA 3KFWX 2XAQB 4A97A 4DV6T 3ONJA 3SRZA 1WR0A 5F5WA 1ZP0A 4HEAA 3UU3A 2WY2A 3TLVA 5HWYA 4JYAT 2YK0A 3TKLB 4YT0A 2V7JA 3Q2MA 3QB5A 1FMVA 3JC6D 4H63H 1HG2A 1BR1A 2KSRA 4W8PA 3PUWF 5JR9B 4GKJT 4IIJE 4CN1A 3RQUA 2E8IA 2IUBA 5HYAA 1VOMA 3C4WA 3ANWA 3LFMA 2KMFA 1G8XA 2WSSV 3LJCA 3ANWB 3UTKA 4ZS2A 3F57A 3Q9DA 3AY5A 4O8SA 1U5PA 2YEVC 2IAKA 4Z8XA 2C5KT 3QOFA 2JIWA 4CZZB 2ZM6T 2E9XC 2K24A 2UXCT 4WNKA 3G06A 1IJ5A 4IREA 3ZCJA 1YD8G 4Q25A 1MIVA 3PU8A 2I0MA 4HFBA 4U72A 3UFEA 4X1YE 2JMKA 3AA0B 4ANJA 1VRBA 3AVRA 1NEKA 3LG7A 4OYJA 2W2UA 5JDGA 5HCMA 4EZHA 1UGOA 5AQHB 3LK2B 4LF4T 3WAJA 2XY8B 5GONE 3FYQA 1IBMT 3PURA 3RC3A 4H9OC 4YHHT 5HXSA 2VURA 4X1IE 1H7CA 2WDVA 5ABEA 4DV2T 5JRCA 3AECA 4CN4A 5JRCB 3MZKB 5HCJA 3PUGA 2CRBA 2A3DA 4U7IA 1UX5A 4AKHA 1IJ6A 1NWMX 2KNDA 2CXFA 3CIRA 5AQUB 4AISA 5A1LA 5FL0A 4L0RA 1VCSA 1X79A 5EK4A 3BK9A 1UK5A 3AE1A 3KV5A 4PFPA 2M6BA 4X20E 3I0OA 3RKOA 3E22E 3GA8A 3AA7B 4DV4T 3EVYA 4F8HA 3ZEFB 5KDMC 4MFRA 5FL1A 3WI3A 4JI3T 1Z8UA 3EDVA 2V7KA 2WDRA 2XQ5A 5IUXA 1FIOA 3FZMB 5LXTE 2BVMA 2CLYB 5IHYA 2CBIA 3CX6B 3PF0A 3AVSA 1SHZC 2M6IA 2UXXB 5DJQC 1Z0PA 4ILBA 3AXJA 3J9X1 3AXJB 1G73A 1OEDC 2CA5A 2X9XA 4CI2B 3RC8A 4MHCA 3C4XA 1OWAA 2W63A 3IA3A 4O2AE 3EI0A 3N2KE 3QNUA 3ZYLA 4YTNA 5LOVE 2E5VA 4HFIA 1M7KA 3ETVA 3P4SA 4YSZA 2NW7A 1KNZA 2GK9A 3HKEE 4IE7A 5ABGA 2BG9C 3TLTA 1JNRA 1ZHCA 4EYUA 3JC6C 4DV7T 2WMOA 4K0KT 4G2AA 2C5IT 1SE7A 2VK9A 3Q5EA 3I9WA 2E9XA 4ZOLE 3RYCE 2KWIB 2E9XB 1I6ZA 4EGWA 3GWHA 3MACA 2Y48B 5LHHB 4DV5T 1OEDE 4QX8B 2HN2A 4AKLA 5DQVA 2A72A 4WBOA 5AQVB 2W66A 2DLRA 2XQ6A 3AEBA 3ZT6A 1MIWA 3AEAA 3VRBA 2YU1A 3AAEB 5HWXA 4YJ2E 3AAAB 4EB6E 2IC6A 1OXZA 4DUZT 3K1SA 1WCRA 2DI4A 2ZMAA 2W0GA 1MMNA 2H89A 3ZMSB 3DJBA 2UU9T 5FZTA 3VRAA 2AE9A 4JI0T 2L3LA 2JRKA 4QXBB 2CXDA 3NZQA 1LKXA 2YDRA 4BGOA 3V5UA 3VJZA 3B5MA 2VVNA 2JQ9A 3JADA 2UXDT 2ZM8A 3LK42 3I9YA 2BVLA 2P9BA 3P4PA 4PJNA 4FJOA 3QUJA 4QH4A 4YLHA 5LG4A 5LGNB 1W0BA 2WQYA 2ZLYA 4UV8B 4HFDA 3H3MA 3ZJ2A 3ZYKA 4U2YA 5AQLB 1ZEEA 5L3CB 4F6RC 5JR9C 1WYBA 4X1KE 1N34T 2E9XD 5HEHA 4XAXB 2XAGB 4TV8E 4O4JE 2X67A 5FNVE 3PJAJ 5LG3A 2V7LA 3L39A 2XHEB 1HNZT 2XM2A 3RYIE 2LSGA 5LBMA 1R8IA 4GK5E 2V5CA 5AQNB 5JREA 5LMNT 1OEDA 3GMIA 3CQCB 1SJ8A 4Z91A 2V5DA 3PUAA 4AQFC 3K3OA 1XDOA 3P4QA 3PHF1 2XQYA 1T98A 2BS2A 2K3WA 3OBVE 2CBJA 4DMVA 2JQQA 2HH7A 4U7YA 2A9UA 2LHRA 4B3TT 4QX7B 4TV9E 2DHRA 3I1AA 5F8PA 1HNXT 3I0QA 5AQJB 5JDNA 2UUBT 5KMGP 2X0YA 2BG9A 2J62A 3KV6A 4HE8A 3RRWA 5AQOB 2BG9B 3CX8B 1YQ4A 5FKYA 2PJQA 5FXVA 4ZI3C 3FBZA 4UVBB 3UU4A 1FEWA 4UF0A 4UF0B 5AQIB 1ZKEA 3OYXA 2VQFT 2C5JA 2YKSA 3E0ZA 4QH5A 4HFEA 2WU5A 4IDOA 2J47A 4DR5T 5CA1E 3KDSE 1WYCA 3NWIA 2LE8A 5H6RB 5LMUT 1IZNB 2YINA 3N9PA 5FP3A 4YSYA 2XQ4A 5DQWA 2XQ8A 2D0UA 4EIWA 1KNPA 3KBTA 3HKCE 5LYJE 4ZI7E 3MJXA 1EZ3A 1J5ET 2L8KA 3A7MA 3JAFA 2V6YB 1AJ3A 3HA4A 4PJLA 4UR9A 4HWFA 5AQRB 3JCFA 3C50A 3N2OA 4CN6A 3T1YT 5CB4E 3DYJA 4LFBT 4KBMB 5L3FB 4GYRA 2CLYC 2VVSA 3H3AA 3RIAA 3M65A 4ILAA 4AIUA 2WCAA 5JQGE 3CWZB 3N5LA 3FZKB 2V7MA 2UXBT 2SPCA 2L7NA 4CXXA 5JDMA 4YJ3E 5IYZE 1N33T 5BR8T 2IC9A 2KBBA 3WAKA 4DR4T 1N32T 2WB5A 4JI7T 2NW9A 1W0AA 1SJ7A 5JR9A 4HFCA 3UU5A 1B7TA 3UQ4A 2IHR1 1J1JA 4U2ZA 2KINB 4QKNA 4ECGA 2WZIA 2DL1A 1QLBA 2LM2A 2CE7A 2KVPA 5LNKA 4ADZA 4DMWA 4P0AA 4X66T 2CCQA 4PK5A 2CEAA 3KV4A 3RH3A 4IHJE 3NVOA 4ZS3A 3KVBA 2ACXA 2CHOA 4L9IA 3GN5B 2LLYA 4J2CA 2RA1A 4AQFA 3RIUC 1WR6A 4TWHA 3RF1A 2LQUA 3N9NA 3C4ZA 3MA9A 3PJAA 4HFVA 4I4TE 4ERRA 3AE7A 4JI2T 1UX4A 4KX6A 2M67A 4PFOA 5JDLA 2D2SA 2HPLA 3S4UA 3OYZA 5JDQA 1D1BA 1S35A 3UULA 4O4HE 2IW5B 2CPTA 3KINB 2X0CA 4U31A 4KMCA 4LF9T 2UXNB 1D1CA 2NTXA 3ZMUB 4B3MT 3ONXA 5HEUA 5AQTB 4AXPA 3OTOT 5LJNA 3TLUA 1Y64B 4DV3T 2QYWA 2CM0A 5HXHA 2VL8A 4KI0F 2V6XA 2JQKA 4H9RC 4PK4A 5FXWA 1JNZA 3CMLA 2NTYA 1D1AA 4UEMA 5EZYE 2YDQA 4ZHQE 2BKOA 4JI8T 3AE8A 4IL9A 4NUVA 3ZKRA 5HXCA 5L3EB 3Q5WA 3ZT5A 5L2LA 4XBFB 5JDFA 3L3PA 3O9XA 3LSVA 2XASB 3NRXA 3OPCA 3Q5DA 4ISSA 1US7B 3PTRB 2XQ7A 3AE2A 4HWHA 4ZZBA 1XWMA 2I6HA 1L0VA 3PUZF 3CX7B 4F7GB 2CWOA 4ZI2D 1N36T 3RIFA 2NP9A 4YXDA 3TLWA 4IDQA 3EAMA 3KVAA 2XTLA 3F31A 2E5LT 3FHNA 1IBLT 1HTJF 3JAEA 1XNQT 1E7PA 2D9DA 4TZ4C 5AQPB 2LT3A 4KHZF 3PV0F 5HEGA 4UV9B 3CK6A 3QB5K 3AA1B 4C90A 4ZI3D 3AEEA 1O3XA 2LJLA 4O4IE 2D0TA 1HG5A 2V7IA 4PNIA 3NKZA 2W62A 5M4YA 4LFAT 5LGUB 2QRXA 5C3JA 4U74A 5EK3A 2CHNA 3T8OA 4WZXA 4UIGA 3SFDA 3X1DA 2N9DA 4BAYB 3BQLA 5AQMB 3RIUA 1IAPA 3D0TA 2LSIA 4U33A 4NIQA 3RRCA 1Y01A 2WZHA 4EZ4A 4I0UA 4JEUB 2MAWA 3ZCIA 5C8YE 5FVKA 2X0LB 4GOUA 3RYHE 2BG9E 1V9DA 3P4RA 4DO0A 5C2TA 4Z90A 2IDOB 2K48A 2ODUA 4YY3T 4HWCA 3NZPA 2IMLA 3UUBA 3UU6A 1MMGA 5L4EA 3EHZA 3A5XA 3N2GE 4JLEA 4A98A 3ZMVB 2BS3A 2VKJA 4KP3C 5LBQB 4BJNA 3AAIA 5JH7E 2Y6XA 4PK6A 5TAOA 2YU2A 1NENA 3N9OA 2V8SV 4HWIB 1FMWA 3J7Yq 4H9PC 2C0SA 4B3RT 2JPFA 4P0BA 1SA0E 3N9MA 2N1GA 1XMOT 4TNWA 4ZEYA 5AQQB 2X9HA 4UELA 4DBRA 3HKBE 1D0YA 2XPKA 2XSAA 5CGMA 3AA6B 2MTQA 2FUPA 1D0XA 2NOXA 4NUUA 4XZCA 4CXYA 4JI4T 3ZN1B 3FB2A 2QA7A 1UURA 2KGXA 3RYFE 2LSYA 4TX5A 4DNDA 2WP9A 1X9BA 3T1HT 2VASA 3CVRA 3IBPA 3OKQA 3L8RA 2LRKA 4QWNB 1HNWT 5KX5E 4ZI2C 1HF8A 1KNRA 3IEEA 2PBIA 1T7SA 5FMNA 5LGTB 2WBLA 4QXCB 2LOSA 2VB6A 4DV1T 2PFVA 2X51A 1KF6A 4BJMA 5JVDE 2XAHB 3UU8A 5H6QB 3ESLA 3VR8A 3K8PC 2X68A 4TN7B 4IDNA 4A5XA 4N78D 2XSBA 4AI6A 1MIYA 5J0ZA 4C91A 4GK0E 3MKDA 1XMQT 3LK3B 5L3DB 4P09A 4WBNE 4IDPA 4IT4A 4LMJA 4MLKA 3P4WA 2QVAA 3ZT7A 1T72A 4P1NA 5FXZA 5CA0E 2BKNA 2Q9QD 4G63A 5ABFB 3PUYF 2MBGA 2VKDA 2J4GA 4ASKA 2BZBA 3SWHA 4H9NC 2X9WA 2V6YA 3DP7A
chains in the Genus database with same CATH topology
4PFOA 5JDLA 1E1HB 2ES0A 3ZN0B 2D5UA 2D2SA 5J2TE 2HPLA 1HX8A 2DWKA 4PJMA 2NW7A 2W00A 3OYZA 4L5GA 3S4UA 1D1BA 5JDQA 1KNZA 1S35A 3UULA 3PU3A 2GK9A 3HKEE 4O4HE 2LM9A 2WAUA 2IW5B 4AQGA 2V1DB 4IE7A 4JEHB 3KINB 4PW8A 4IDZA 4KMCA 2UXNB 1D1CA 4OHFA 2V26A 2JJ9A 2NTXA 3ZPOA 3ZMUB 4I55E 3U78A 4O4LE 3P7IA 3M1CA 4AKIA 3FXDB 3ONXA 1ZHCA 4GIWA 4IE5A 4EYUA 2K9AA 2H7VC 3C98B 3JC6C 3ETUA 2EHOB 4OK0A 2XAFB 3ZC0A 4AXPA 2WMOA 3CKDA 5LJNA 4HKAA 2Y8DA 4G2AA 2C5IT 1Y64B 2X66A 2VK9A 3I9WA 2E9XA 4ZOLE 2CM0A 3RYCE 2KWIB 2KZ7B 2E9XB 5HXHA 2ODVA 2VL8A 3CQXC 4AKRB 4H9RC 4PK4A 5FXWA 3CMLA 3V5SA 3GWHA 2NTYA 3PDYA 1D1AA 1WLXA 4UEMA 5HXRA 3RX6A 3MACA 2Y48B 1YKHB 5EZYE 4ISTA 4ZHQE 5JDHA 5LHHB 5FY7A 2CMRA 4NUVA 4H9QC 4QX8B 4AKLA 3B13A 4CI3B 4E7SA 5DQVA 2A72A 2RP4A 5HXCA 5L3EB 3BQKA 3Q5WA 5L2LA 4XBFB 2OA5A 1ZV4X 5JDFA 4WBOA 3L3PA 3W15B 3IF8B 2Z6EA 2DLRA 3SOLA 3O9XA 3ZJ1A 4H9SE 4CQIA 1U4QA 2XASB 3H37A 4FI5A 1MIWA 3ZLIA 3NRXA 3OJAA 5F3JA 1MNEA 2YU1A 1CUNA 2XUEA 4ISSA 5FXXA 1US7B 2A2FX 3B57A 3N9QA 1YW0A 2WM9A 3AAEB 3PTRB 5HWXA 3PUQA 3ZMTB 4HN9A 4YJ2E 3AAAB 4EB6E 2IC6A 1OXZA 2DCFA 2X9YA 5T1DA 2DI4A 3N9LA 2ZMAA 3CX7B 4TUYE 1WRDA 1HCIA 2CWOA 2W0GA 5EK2A 1MMNA 3ZMSB 4ZI2D 3DJBA 4UVAB 2LEHA 2NP9A 3HR0A 2ZM0A 4B6XA 3NBXX 3KVAA 1HFAA 2XTLA 3F31A 4M1PA 4YFSA 3VKGA 3FHNA 3GN5A 3E08A 2KWHA 4MBQA 1HTJF 2CXLA 2L3LA 2JRKA 4QXBB 3MK7C 3EDUA 4QXHB 4UXNB 2CXDA 3NZQA 1BR2A 1LKXA 3EUHA 4BGOA 3V5UA 3VJZA 4TZ4C 3O1HA 2LT3A 2MTCA 4JUYA 2NWBA 2ZM8A 3LK42 1D0ZA 3BQIA 2B1EA 2QGSA 3I9YA 2BVLA 2P9BA 4PAGA 4DBQA 4PJNA 3IHRA 4UV9B 4FJOA 1MNDA 3QUJA 4UVCB 4YLHA 4AKGA 3AA1B 4C90A 4ZI3D 2W61A 5LG4A 5LA6E 5LGNB 1O3XA 1YKEB 2H7OA 2BDEA 2LJLA 4O2BE 2ZLYA 4UV8B 3C51A 4O4IE 1S94A 2EHOD 2I59A 3ZJ2A 5J1GA 3ZYKA 4IE6A 5LP6E 2D0TA 3VHLA 5L3CB 4IE4A 1ZEEA 1HG5A 5HAXA 3CQGB 4BA9A 4F6RC 2V7IA 4IGUA 4EYYR 4OFZA 5L3GB 4PNIA 3HI2A 5JR9C 1WYBA 3WSCA 4ONRA 4X1KE 2W62A 3LBXA 2WMNA 4YHJA 3UT5E 2E9XD 3HL6A 5M4YA 3LBXB 5ETWA 2NW8A 5LGUB 1KK7A 4XAXB 2XAGB 2H3RA 4TV8E 1MMAA 4O4JE 5FY1A 2X67A 1MMDA 4KUMB 5FNVE 4I50E 4U74A 3AB3B 3C64A 5EK3A 3PE0A 2EHOA 4DVDA 3UUMA 3T8OA 3SS1A 4E7ZA 4QHOA 5LJMA 2DWGA 2LSKA 4UIGA 5FYMA 2V7LA 2VWAA 2XHEB 3U3IA 2ZM2A 3RYIE 2N9DA 2LSGA 4OYKA 3ZMZB 3ZYMA 5LBMA 2L9QA 4BAYB 4GK5E 1LVFA 3K3QC 5JREA 3Q5XA 3BQLA 2K5BB 5LCYA 3FXEB 3GMIA 3CQCB 3KFWX 2XAQB 1IAPA 3O1IA 3PUAA 3SRZA 4AQFC 3D0TA 2LSIA 3K3OA 4HEAA 5DABA 2KT9A 3PHF1 2XQYA 2KLQA 1T98A 5HWYA 2YK0A 4HTEA 3TKLB 3O1JA 3RRCA 3OBVE 4DMVA 4A56A 2JQQA 3MXZA 2V7JA 3Q2MA 2HH7A 1FMVA 2Q9QC 2LHRA 3JC6D 4H63H 3K3NA 4QX7B 1HG2A 4EZ4A 1BR1A 4TV9E 2N2NA 2DHRA 4JEUB 3I1AA 5JR9B 5F8PA 2LHNA 3ZCIA 5C8YE 4IIJE 3I0QA 1QUUA 2E8IA 5JDNA 5HYAA 5KMGP 1VOMA 2X0LB 4GOUA 4HE8A 3KV6A 3RRWA 3RYHE 1V9DA 4PJJA 4DO0A 3CX8B 3C4WA 5BMVE 3ANWA 3LFMA 2KMFA 1G8XA 2WSSV 3LJCA 3ANWB 2PJQA 2K48A 3UTKA 2ODUA 5FXVA 3QC9A 4ZI3C 2DNXA 3FBZA 4UVBB 3UUXB 1FEWA 4UF0A 3UUNA 4ZS2A 3F57A 3NZPA 1HS7A 3Q9DA 4UF0B 1ZKEA 4O8SA 3OYXA 1U5PA 2YEVC 1MMGA 2IAKA 2WWUA 3R6NA 4Z8XA 2C5KT 2C5JA 3A5XA 5J2UE 3N2GE 4JLEA 3E0ZA 3ZMVB 4CZZB 2E9XC 5CA1E 3NRYA 2K24A 2LOPA 3KDSE 4WNKA 1WYCA 2CWYA 2LE8A 2VKJA 4KP3C 5H6RB 5LBQB 1IJ5A 4BJNA 5HXEA 3AAIA 3ZCJA 1IZNB 1YD8G 2YINA 3N9PA 5JH7E 1MIVA 2Y6XA 5FP3A 5DQWA 3PU8A 3KV9A 4PK6A 5TAOA 2D0UA 2YU2A 4HGAA 4EIWA 2MYSA 3KBTA 3N9OA 4U72A 3UFEA 3HKCE 4K0UA 4X1YE 2JMKA 5LYJE 1FMWA 4GYSA 3J7Yq 3AA0B 4H9PC 4ANJA 1VRBA 4ZI7E 2C0SA 3MJXA 2JPFA 4P0BA 1EZ3A 1SA0E 2PG8A 3AVRA 2L8KA 3N9MA 2N1GA 4V1Av 2KXPB 1AJ3A 3HA4A 3KBUA 4PJLA 2X9HA 4UELA 3LG7A 4WW0A 4OYJA 4DBRA 3HKBE 1D0YA 5JDGA 4EZHA 3LK2B 3C50A 3N2OA 5L3BB 1QSDA 3AA6B 2MTQA 3WAJA 1D0XA 2NOXA 4NUUA 4XZCA 5CB4E 3DTOA 3AT7A 4KBMB 5GONE 4CXYA 3R84B 5L3FB 4GYRA 2CLYC 3H3AA 3L09A 3PURA 3RC3A 3ZN1B 4H9OC 3M65A 4CI1B 3VU7H 5HXSA 3FB2A 2QA7A 3FBLA 4X1IE 1H7CA 3RYFE 5LHGB 2LSYA 4EAHA 4TX5A 5JRCA 4DNDA 5JRCB 2G0UA 5JQGE 3CWZB 3MZKB 4CXWA 5ADXL 3PUSA 3HKDE 2VASA 3N5LA 5AFUL 2V7MA 3CVRA 3IBPA 3PUGA 3OKQA 1NAFA 2A3DA 2SPCA 4CXXA 5JDMA 4QWNB 5KX5E 1LVKA 1UX5A 4YJ3E 5IYZE 4ZI2C 4MALA 4AKHA 1HF8A 1IJ6A 1NWMX 2KNDA 3IEEA 2IC9A 2CXFA 2PBIA 5FMNA 2XAJB 3WURA 3WAKA 5LGTB 2WBLA 4QXCB 3VKHA 5A1LA 4L0RA 2LOSA 2VB6A 2NW9A 1X79A 2PFVA 5EK4A 3P8CD 2X51A 3BK9A 3ZC1A 4BJMA 5JVDE 3O4XE 2XAHB 5JR9A 3KV5A 4PFPA 5H6QB 3ESLA 1B7TA 3K8PC 4IE0A 2X68A 4TN7B 4X20E 2J1DG 3I0OA 4N78D 4AI6A 3RKOA 3E22E 1MIYA 1BR0A 4C91A 2KINB 3GA8A 4QKNA 4ECGA 2JMHA 3AA7B 4GK0E 3EVYA 3MKDA 2VKHA 3QK6A 3ZEFB 3LK3B 5KDMC 5L3DB 4MFRA 4EXTA 3F2EA 4P09A 3WI3A 4EOZB 5LHIB 2EHOC 2MOZA 2CE7A 2VKOA 5LNKA 4ADZA 4DMWA 3EDVA 4WBNE 4P0AA 2V7KA 2CCQA 4PK5A 1UCUA 2CEAA 1FIOA 4ILUA 5LXTE 2BVMA 2CLYB 1LRZA 4MLKA 5IHYA 3KV4A 3RH3A 4IHJE 3CX6B 2HPJA 4ZS3A 3PF0A 3KVBA 2ACXA 3AVSA 1SHZC 2UXXB 5FXZA 5CA0E 4L9IA 5DJQC 1Z0PA 3GN5B 2Q9QD 3J9X1 4J2CA 4G63A 1G73A 3RPUA 2RA1A 4AQFA 2CA5A 2X9XA 4CI2B 5E0OA 4H63V 1WR6A 3RC8A 4MHCA 2LQUA 2LSJA 3N9NA 3C4XA 2MBGA 2VKDA 3C4ZA 3MA9A 1OWAA 2W63A 4ASKA 2BZBA 4HFVA 4O2AE 3SWHA 4H9NC 3CPZA 2X9WA 3N2KE 3ZYLA 5LOVE 5FY0A 1BR4A 4I43B 4I4TE 2Q9QA 4ERRA 2Q9QB 1UX4A 3ETVA 3DP7A 2M67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDL A;  5HWY A;  5HXS A;  5HXR A;  5JDN A;  5HYA A;  5HXE A;  5HXC A;  3V5U A;  5HWX A;  5JDH A;  3V5S A;  5JDQ A;  5JDG A;  5JDF A;  5HXH A;  5JDM A; 
#chains in the Genus database with same CATH topology
 1UUS A;  1E1H B;  3ZN0 B;  5J2T E;  1HX8 A;  2DWK A;  4PJM A;  4L5G A;  4DR2 T;  2VQE T;  3PU3 A;  2LM9 A;  4HFH A;  4AQG A;  2V1D B;  1XZY A;  4YTM A;  4IDZ A;  2AXD S;  4OHF A;  3ZPO A;  2JJ9 A;  4EEB A;  3M1C A;  4GIW A;  4IE5 A;  2H7V C;  3C98 B;  3ETU A;  2EHO B;  2XAF B;  4NPP A;  2Y8D A;  3AED A;  2X66 A;  3FZL B;  4HWD A;  4AKR B;  3PUX F;  2UUC T;  3PDY A;  3RX6 A;  4QH1 A;  4IST A;  5JDH A;  5FY7 A;  2CMR A;  2OA5 A;  1ZV4 X;  2MPK A;  1IBK T;  3IF8 B;  2Z6E A;  1W09 A;  3ZLI A;  3OJA A;  3A8Y C;  3B57 A;  3N9Q A;  4WYV A;  4EV6 A;  3PUQ A;  2DCF A;  2X9Y A;  5T1D A;  4TUY E;  1WRD A;  1HCI A;  1J5W A;  4UVA B;  2LEH A;  3HR0 A;  2ZM0 A;  2XM1 A;  4B6X A;  4YSX A;  4M1P A;  1HFA A;  4YFS A;  3GN5 A;  3E08 A;  4JI1 T;  2KWH A;  4MBQ A;  2CXL A;  3RQW A;  2WWV A;  4UXN B;  1HR0 T;  4JUY A;  2NWB A;  4ZXL A;  2LKG A;  3UQ7 A;  2B1E A;  4PAG A;  4DBQ A;  3UFG A;  4AKG A;  5HEJ A;  4JBW F;  1DU2 A;  3C51 A;  1S94 A;  2EHO D;  5J1G A;  4IE4 A;  2WS3 A;  5AQK B;  4IGU A;  4EYY R;  4OFZ A;  5L3G B;  4ONR A;  3LBX A;  2WMN A;  3HL6 A;  3LBX B;  4X64 T;  1KK7 A;  3VR9 A;  5FY1 A;  1MMD A;  2W67 A;  3RGL A;  4DVD A;  3SS1 A;  4E7Z A;  4DUY T;  2DWG A;  2LSK A;  2VWA A;  2BBH A;  3U3I A;  2BBJ A;  2L9Q A;  4DID B;  3K3Q C;  2YN6 A;  3FXE B;  3O1I A;  1YXR A;  5DAB A;  2KT9 A;  5AQG B;  3ONL C;  2KLQ A;  4HTE A;  3O1J A;  4A56 A;  3MXZ A;  2YDS A;  2Q9Q C;  2RPA A;  2R6G F;  3K3N A;  4TWD A;  2N2N A;  3RKG A;  2YOE A;  5ABH A;  2LHN A;  1QUU A;  3AE9 A;  2H88 A;  5CFB A;  3PUV F;  4PJJ A;  5BMV E;  4IL4 A;  3SFE A;  1FJG T;  3QC9 A;  2DNX A;  3UUX B;  3UUN A;  1HS7 A;  2FJA A;  2WWU A;  3R6N A;  5J2U E;  1E2A A;  3AEF A;  4LFC T;  1CHU A;  4DR7 T;  3NRY A;  2LOP A;  2CWY A;  2XJ7 A;  2LKH A;  5HXE A;  2FJE A;  2WDQ A;  4LF7 T;  3TLS A;  3KV9 A;  4HGA A;  2HN1 A;  2MYS A;  4K0U A;  4LF6 T;  4GYS A;  4X65 T;  2XQA A;  2PG8 A;  2FJD A;  1WFD A;  4V1A v;  2KXP B;  3KBU A;  3ABV A;  1KEY A;  4WW0 A;  1KFY A;  4LMK A;  5L3B B;  1QSD A;  1ZOY A;  3AE5 A;  3DTO A;  4KHP T;  5LB7 B;  3AT7 A;  3R84 B;  3L09 A;  4CI1 B;  3VU7 H;  3FBL A;  5LHG B;  4EAH A;  2WU2 A;  5AQF B;  2G0U A;  5ADX L;  4CXW A;  3PUS A;  3HKD E;  1XNR T;  5AFU L;  1GQE A;  1NAF A;  1LVK A;  4MAL A;  5HEO A;  5L47 A;  2IIU A;  3WUR A;  2XAJ B;  3VKH A;  4B3S T;  4NXM T;  5JTG A;  1M62 A;  5IWA T;  3P8C D;  2OV9 A;  3ZC1 A;  3O4X E;  3RHW A;  4OX9 T;  3OVU A;  3AE3 A;  4IE0 A;  2J1D G;  2LRL A;  1BR0 A;  2JMH A;  5CJ5 A;  2HHH T;  2NR4 A;  2B76 A;  3ZSS A;  2VKH A;  3QK6 A;  4EXT A;  3F2E A;  4EOZ B;  5LHI B;  2EHO C;  2MOZ A;  2VKO A;  2UUA T;  2L10 A;  1UCU A;  4ILU A;  2JQH A;  3AE6 A;  1LRZ A;  2HPJ A;  2X0H A;  1YQ3 A;  4DR3 T;  4JI5 T;  2W4X A;  3M3Z B;  3RPU A;  5E0O A;  4H63 V;  2LSJ A;  4ILC A;  3LDQ B;  3CPZ A;  5FY0 A;  4EED A;  2XQ9 A;  1BR4 A;  4I43 B;  2F4V T;  2Q9Q A;  2Q9Q B;  4ZZC A;  3ZST A;  2ES0 A;  2D5U A;  2XQ3 A;  2W00 A;  4TWF A;  2WAU A;  4JEH B;  4PW8 A;  1HX1 B;  3AE4 A;  2V26 A;  2OLT A;  4I55 E;  3U78 A;  2E2A A;  4TNV A;  4O4L E;  4X5T A;  3P7I A;  4AKI A;  3FXD B;  4LML A;  2BKP A;  4GKK T;  2K9A A;  4OK0 A;  3ZC0 A;  2PTF A;  3CKD A;  4HKA A;  4AQY T;  3AEG A;  5FVL A;  4DR1 T;  2BS4 A;  2KZ7 B;  2VL0 A;  2ODV A;  3CQX C;  3V5S A;  1I94 T;  4NXN T;  1WLX A;  5HXR A;  1YKH B;  1OED B;  4YTP A;  4H9Q C;  2FBW A;  4CI3 B;  3B13 A;  4E7S A;  2RP4 A;  1XDP A;  3BQK A;  3EAB A;  2XZE A;  3W15 B;  1SUM B;  1W9R A;  3SOL A;  3ZJ1 A;  4H9S E;  4CQI A;  1U4Q A;  3H37 A;  4FI5 A;  5F3J A;  1MNE A;  1CUN A;  2XUE A;  5FXX A;  1VCT A;  2A2F X;  5L4H A;  1YW0 A;  2WM9 A;  3ZMT B;  4HN9 A;  4LF8 T;  3N9L A;  4DV0 T;  5EK2 A;  5KXJ A;  3NBX X;  5AQS B;  4LF5 T;  3VKG A;  3MK7 C;  5ABF A;  3EDU A;  4QXH B;  2ACZ A;  1BR2 A;  3EUH A;  3O1H A;  2MTC A;  3FZH B;  1D0Z A;  3BQI A;  2QGS A;  3IHR A;  1MND A;  4UVC B;  2W61 A;  5LA6 E;  1YKE B;  2H7O A;  4O2B E;  2BDE A;  3RLF F;  2I59 A;  4X62 T;  4IE6 A;  5LP6 E;  3VHL A;  5HAX A;  3CQG B;  4BA9 A;  3HI2 A;  3WSC A;  4U3C A;  4COF A;  4JV5 T;  4YHJ A;  3UT5 E;  2FJB A;  5ETW A;  3RI5 A;  2NW8 A;  3FZF B;  4JI6 T;  2H3R A;  1MMA A;  4KUM B;  4I50 E;  3AB3 B;  3C64 A;  3PE0 A;  2EHO A;  3UUM A;  4QHO A;  1T8B A;  5LJM A;  5FYM A;  4DR6 T;  2ZM2 A;  4OYK A;  3ZMZ B;  3P50 A;  3ZYM A;  1LVF A;  3Q5X A;  2K5B B;  5LCY A;  3KFW X;  2XAQ B;  4A97 A;  4DV6 T;  3ONJ A;  3SRZ A;  1WR0 A;  5F5W A;  1ZP0 A;  4HEA A;  3UU3 A;  2WY2 A;  3TLV A;  5HWY A;  4JYA T;  2YK0 A;  3TKL B;  4YT0 A;  2V7J A;  3Q2M A;  3QB5 A;  1FMV A;  3JC6 D;  4H63 H;  1HG2 A;  1BR1 A;  2KSR A;  4W8P A;  3PUW F;  5JR9 B;  4GKJ T;  4IIJ E;  4CN1 A;  3RQU A;  2E8I A;  2IUB A;  5HYA A;  1VOM A;  3C4W A;  3ANW A;  3LFM A;  2KMF A;  1G8X A;  2WSS V;  3LJC A;  3ANW B;  3UTK A;  4ZS2 A;  3F57 A;  3Q9D A;  3AY5 A;  4O8S A;  1U5P A;  2YEV C;  2IAK A;  4Z8X A;  2C5K T;  3QOF A;  2JIW A;  4CZZ B;  2ZM6 T;  2E9X C;  2K24 A;  2UXC T;  4WNK A;  3G06 A;  1IJ5 A;  4IRE A;  3ZCJ A;  1YD8 G;  4Q25 A;  1MIV A;  3PU8 A;  2I0M A;  4HFB A;  4U72 A;  3UFE A;  4X1Y E;  2JMK A;  3AA0 B;  4ANJ A;  1VRB A;  3AVR A;  1NEK A;  3LG7 A;  4OYJ A;  2W2U A;  5JDG A;  5HCM A;  4EZH A;  1UGO A;  5AQH B;  3LK2 B;  4LF4 T;  3WAJ A;  2XY8 B;  5GON E;  3FYQ A;  1IBM T;  3PUR A;  3RC3 A;  4H9O C;  4YHH T;  5HXS A;  2VUR A;  4X1I E;  1H7C A;  2WDV A;  5ABE A;  4DV2 T;  5JRC A;  3AEC A;  4CN4 A;  5JRC B;  3MZK B;  5HCJ A;  3PUG A;  2CRB A;  2A3D A;  4U7I A;  1UX5 A;  4AKH A;  1IJ6 A;  1NWM X;  2KND A;  2CXF A;  3CIR A;  5AQU B;  4AIS A;  5A1L A;  5FL0 A;  4L0R A;  1VCS A;  1X79 A;  5EK4 A;  3BK9 A;  1UK5 A;  3AE1 A;  3KV5 A;  4PFP A;  2M6B A;  4X20 E;  3I0O A;  3RKO A;  3E22 E;  3GA8 A;  3AA7 B;  4DV4 T;  3EVY A;  4F8H A;  3ZEF B;  5KDM C;  4MFR A;  5FL1 A;  3WI3 A;  4JI3 T;  1Z8U A;  3EDV A;  2V7K A;  2WDR A;  2XQ5 A;  5IUX A;  1FIO A;  3FZM B;  5LXT E;  2BVM A;  2CLY B;  5IHY A;  2CBI A;  3CX6 B;  3PF0 A;  3AVS A;  1SHZ C;  2M6I A;  2UXX B;  5DJQ C;  1Z0P A;  4ILB A;  3AXJ A;  3J9X 1;  3AXJ B;  1G73 A;  1OED C;  2CA5 A;  2X9X A;  4CI2 B;  3RC8 A;  4MHC A;  3C4X A;  1OWA A;  2W63 A;  3IA3 A;  4O2A E;  3EI0 A;  3N2K E;  3QNU A;  3ZYL A;  4YTN A;  5LOV E;  2E5V A;  4HFI A;  1M7K A;  3ETV A;  3P4S A;  4YSZ A;  2NW7 A;  1KNZ A;  2GK9 A;  3HKE E;  4IE7 A;  5ABG A;  2BG9 C;  3TLT A;  1JNR A;  1ZHC A;  4EYU A;  3JC6 C;  4DV7 T;  2WMO A;  4K0K T;  4G2A A;  2C5I T;  1SE7 A;  2VK9 A;  3Q5E A;  3I9W A;  2E9X A;  4ZOL E;  3RYC E;  2KWI B;  2E9X B;  1I6Z A;  4EGW A;  3GWH A;  3MAC A;  2Y48 B;  5LHH B;  4DV5 T;  1OED E;  4QX8 B;  2HN2 A;  4AKL A;  5DQV A;  2A72 A;  4WBO A;  5AQV B;  2W66 A;  2DLR A;  2XQ6 A;  3AEB A;  3ZT6 A;  1MIW A;  3AEA A;  3VRB A;  2YU1 A;  3AAE B;  5HWX A;  4YJ2 E;  3AAA B;  4EB6 E;  2IC6 A;  1OXZ A;  4DUZ T;  3K1S A;  1WCR A;  2DI4 A;  2ZMA A;  2W0G A;  1MMN A;  2H89 A;  3ZMS B;  3DJB A;  2UU9 T;  5FZT A;  3VRA A;  2AE9 A;  4JI0 T;  2L3L A;  2JRK A;  4QXB B;  2CXD A;  3NZQ A;  1LKX A;  2YDR A;  4BGO A;  3V5U A;  3VJZ A;  3B5M A;  2VVN A;  2JQ9 A;  3JAD A;  2UXD T;  2ZM8 A;  3LK4 2;  3I9Y A;  2BVL A;  2P9B A;  3P4P A;  4PJN A;  4FJO A;  3QUJ A;  4QH4 A;  4YLH A;  5LG4 A;  5LGN B;  1W0B A;  2WQY A;  2ZLY A;  4UV8 B;  4HFD A;  3H3M A;  3ZJ2 A;  3ZYK A;  4U2Y A;  5AQL B;  1ZEE A;  5L3C B;  4F6R C;  5JR9 C;  1WYB A;  4X1K E;  1N34 T;  2E9X D;  5HEH A;  4XAX B;  2XAG B;  4TV8 E;  4O4J E;  2X67 A;  5FNV E;  3PJA J;  5LG3 A;  2V7L A;  3L39 A;  2XHE B;  1HNZ T;  2XM2 A;  3RYI E;  2LSG A;  5LBM A;  1R8I A;  4GK5 E;  2V5C A;  5AQN B;  5JRE A;  5LMN T;  1OED A;  3GMI A;  3CQC B;  1SJ8 A;  4Z91 A;  2V5D A;  3PUA A;  4AQF C;  3K3O A;  1XDO A;  3P4Q A;  3PHF 1;  2XQY A;  1T98 A;  2BS2 A;  2K3W A;  3OBV E;  2CBJ A;  4DMV A;  2JQQ A;  2HH7 A;  4U7Y A;  2A9U A;  2LHR A;  4B3T T;  4QX7 B;  4TV9 E;  2DHR A;  3I1A A;  5F8P A;  1HNX T;  3I0Q A;  5AQJ B;  5JDN A;  2UUB T;  5KMG P;  2X0Y A;  2BG9 A;  2J62 A;  3KV6 A;  4HE8 A;  3RRW A;  5AQO B;  2BG9 B;  3CX8 B;  1YQ4 A;  5FKY A;  2PJQ A;  5FXV A;  4ZI3 C;  3FBZ A;  4UVB B;  3UU4 A;  1FEW A;  4UF0 A;  4UF0 B;  5AQI B;  1ZKE A;  3OYX A;  2VQF T;  2C5J A;  2YKS A;  3E0Z A;  4QH5 A;  4HFE A;  2WU5 A;  4IDO A;  2J47 A;  4DR5 T;  5CA1 E;  3KDS E;  1WYC A;  3NWI A;  2LE8 A;  5H6R B;  5LMU T;  1IZN B;  2YIN A;  3N9P A;  5FP3 A;  4YSY A;  2XQ4 A;  5DQW A;  2XQ8 A;  2D0U A;  4EIW A;  1KNP A;  3KBT A;  3HKC E;  5LYJ E;  4ZI7 E;  3MJX A;  1EZ3 A;  1J5E T;  2L8K A;  3A7M A;  3JAF A;  2V6Y B;  1AJ3 A;  3HA4 A;  4PJL A;  4UR9 A;  4HWF A;  5AQR B;  3JCF A;  3C50 A;  3N2O A;  4CN6 A;  3T1Y T;  5CB4 E;  3DYJ A;  4LFB T;  4KBM B;  5L3F B;  4GYR A;  2CLY C;  2VVS A;  3H3A A;  3RIA A;  3M65 A;  4ILA A;  4AIU A;  2WCA A;  5JQG E;  3CWZ B;  3N5L A;  3FZK B;  2V7M A;  2UXB T;  2SPC A;  2L7N A;  4CXX A;  5JDM A;  4YJ3 E;  5IYZ E;  1N33 T;  5BR8 T;  2IC9 A;  2KBB A;  3WAK A;  4DR4 T;  1N32 T;  2WB5 A;  4JI7 T;  2NW9 A;  1W0A A;  1SJ7 A;  5JR9 A;  4HFC A;  3UU5 A;  1B7T A;  3UQ4 A;  2IHR 1;  1J1J A;  4U2Z A;  2KIN B;  4QKN A;  4ECG A;  2WZI A;  2DL1 A;  1QLB A;  2LM2 A;  2CE7 A;  2KVP A;  5LNK A;  4ADZ A;  4DMW A;  4P0A A;  4X66 T;  2CCQ A;  4PK5 A;  2CEA A;  3KV4 A;  3RH3 A;  4IHJ E;  3NVO A;  4ZS3 A;  3KVB A;  2ACX A;  2CHO A;  4L9I A;  3GN5 B;  2LLY A;  4J2C A;  2RA1 A;  4AQF A;  3RIU C;  1WR6 A;  4TWH A;  3RF1 A;  2LQU A;  3N9N A;  3C4Z A;  3MA9 A;  3PJA A;  4HFV A;  4I4T E;  4ERR A;  3AE7 A;  4JI2 T;  1UX4 A;  4KX6 A;  2M67 A;  4PFO A;  5JDL A;  2D2S A;  2HPL A;  3S4U A;  3OYZ A;  5JDQ A;  1D1B A;  1S35 A;  3UUL A;  4O4H E;  2IW5 B;  2CPT A;  3KIN B;  2X0C A;  4U31 A;  4KMC A;  4LF9 T;  2UXN B;  1D1C A;  2NTX A;  3ZMU B;  4B3M T;  3ONX A;  5HEU A;  5AQT B;  4AXP A;  3OTO T;  5LJN A;  3TLU A;  1Y64 B;  4DV3 T;  2QYW A;  2CM0 A;  5HXH A;  2VL8 A;  4KI0 F;  2V6X A;  2JQK A;  4H9R C;  4PK4 A;  5FXW A;  1JNZ A;  3CML A;  2NTY A;  1D1A A;  4UEM A;  5EZY E;  2YDQ A;  4ZHQ E;  2BKO A;  4JI8 T;  3AE8 A;  4IL9 A;  4NUV A;  3ZKR A;  5HXC A;  5L3E B;  3Q5W A;  3ZT5 A;  5L2L A;  4XBF B;  5JDF A;  3L3P A;  3O9X A;  3LSV A;  2XAS B;  3NRX A;  3OPC A;  3Q5D A;  4ISS A;  1US7 B;  3PTR B;  2XQ7 A;  3AE2 A;  4HWH A;  4ZZB A;  1XWM A;  2I6H A;  1L0V A;  3PUZ F;  3CX7 B;  4F7G B;  2CWO A;  4ZI2 D;  1N36 T;  3RIF A;  2NP9 A;  4YXD A;  3TLW A;  4IDQ A;  3EAM A;  3KVA A;  2XTL A;  3F31 A;  2E5L T;  3FHN A;  1IBL T;  1HTJ F;  3JAE A;  1XNQ T;  1E7P A;  2D9D A;  4TZ4 C;  5AQP B;  2LT3 A;  4KHZ F;  3PV0 F;  5HEG A;  4UV9 B;  3CK6 A;  3QB5 K;  3AA1 B;  4C90 A;  4ZI3 D;  3AEE A;  1O3X A;  2LJL A;  4O4I E;  2D0T A;  1HG5 A;  2V7I A;  4PNI A;  3NKZ A;  2W62 A;  5M4Y A;  4LFA T;  5LGU B;  2QRX A;  5C3J A;  4U74 A;  5EK3 A;  2CHN A;  3T8O A;  4WZX A;  4UIG A;  3SFD A;  3X1D A;  2N9D A;  4BAY B;  3BQL A;  5AQM B;  3RIU A;  1IAP A;  3D0T A;  2LSI A;  4U33 A;  4NIQ A;  3RRC A;  1Y01 A;  2WZH A;  4EZ4 A;  4I0U A;  4JEU B;  2MAW A;  3ZCI A;  5C8Y E;  5FVK A;  2X0L B;  4GOU A;  3RYH E;  2BG9 E;  1V9D A;  3P4R A;  4DO0 A;  5C2T A;  4Z90 A;  2IDO B;  2K48 A;  2ODU A;  4YY3 T;  4HWC A;  3NZP A;  2IML A;  3UUB A;  3UU6 A;  1MMG A;  5L4E A;  3EHZ A;  3A5X A;  3N2G E;  4JLE A;  4A98 A;  3ZMV B;  2BS3 A;  2VKJ A;  4KP3 C;  5LBQ B;  4BJN A;  3AAI A;  5JH7 E;  2Y6X A;  4PK6 A;  5TAO A;  2YU2 A;  1NEN A;  3N9O A;  2V8S V;  4HWI B;  1FMW A;  3J7Y q;  4H9P C;  2C0S A;  4B3R T;  2JPF A;  4P0B A;  1SA0 E;  3N9M A;  2N1G A;  1XMO T;  4TNW A;  4ZEY A;  5AQQ B;  2X9H A;  4UEL A;  4DBR A;  3HKB E;  1D0Y A;  2XPK A;  2XSA A;  5CGM A;  3AA6 B;  2MTQ A;  2FUP A;  1D0X A;  2NOX A;  4NUU A;  4XZC A;  4CXY A;  4JI4 T;  3ZN1 B;  3FB2 A;  2QA7 A;  1UUR A;  2KGX A;  3RYF E;  2LSY A;  4TX5 A;  4DND A;  2WP9 A;  1X9B A;  3T1H T;  2VAS A;  3CVR A;  3IBP A;  3OKQ A;  3L8R A;  2LRK A;  4QWN B;  1HNW T;  5KX5 E;  4ZI2 C;  1HF8 A;  1KNR A;  3IEE A;  2PBI A;  1T7S A;  5FMN A;  5LGT B;  2WBL A;  4QXC B;  2LOS A;  2VB6 A;  4DV1 T;  2PFV A;  2X51 A;  1KF6 A;  4BJM A;  5JVD E;  2XAH B;  3UU8 A;  5H6Q B;  3ESL A;  3VR8 A;  3K8P C;  2X68 A;  4TN7 B;  4IDN A;  4A5X A;  4N78 D;  2XSB A;  4AI6 A;  1MIY A;  5J0Z A;  4C91 A;  4GK0 E;  3MKD A;  1XMQ T;  3LK3 B;  5L3D B;  4P09 A;  4WBN E;  4IDP A;  4IT4 A;  4LMJ A;  4MLK A;  3P4W A;  2QVA A;  3ZT7 A;  1T72 A;  4P1N A;  5FXZ A;  5CA0 E;  2BKN A;  2Q9Q D;  4G63 A;  5ABF B;  3PUY F;  2MBG A;  2VKD A;  2J4G A;  4ASK A;  2BZB A;  3SWH A;  4H9N C;  2X9W A;  2V6Y A;  3DP7 A; 
#chains in the Genus database with same CATH homology
 4PFO A;  5JDL A;  1E1H B;  2ES0 A;  3ZN0 B;  2D5U A;  2D2S A;  5J2T E;  2HPL A;  1HX8 A;  2DWK A;  4PJM A;  2NW7 A;  2W00 A;  3OYZ A;  4L5G A;  3S4U A;  1D1B A;  5JDQ A;  1KNZ A;  1S35 A;  3UUL A;  3PU3 A;  2GK9 A;  3HKE E;  4O4H E;  2LM9 A;  2WAU A;  2IW5 B;  4AQG A;  2V1D B;  4IE7 A;  4JEH B;  3KIN B;  4PW8 A;  4IDZ A;  4KMC A;  2UXN B;  1D1C A;  4OHF A;  2V26 A;  2JJ9 A;  2NTX A;  3ZPO A;  3ZMU B;  4I55 E;  3U78 A;  4O4L E;  3P7I A;  3M1C A;  4AKI A;  3FXD B;  3ONX A;  1ZHC A;  4GIW A;  4IE5 A;  4EYU A;  2K9A A;  2H7V C;  3C98 B;  3JC6 C;  3ETU A;  2EHO B;  4OK0 A;  2XAF B;  3ZC0 A;  4AXP A;  2WMO A;  3CKD A;  5LJN A;  4HKA A;  2Y8D A;  4G2A A;  2C5I T;  1Y64 B;  2X66 A;  2VK9 A;  3I9W A;  2E9X A;  4ZOL E;  2CM0 A;  3RYC E;  2KWI B;  2KZ7 B;  2E9X B;  5HXH A;  2ODV A;  2VL8 A;  3CQX C;  4AKR B;  4H9R C;  4PK4 A;  5FXW A;  3CML A;  3V5S A;  3GWH A;  2NTY A;  3PDY A;  1D1A A;  1WLX A;  4UEM A;  5HXR A;  3RX6 A;  3MAC A;  2Y48 B;  1YKH B;  5EZY E;  4IST A;  4ZHQ E;  5JDH A;  5LHH B;  5FY7 A;  2CMR A;  4NUV A;  4H9Q C;  4QX8 B;  4AKL A;  3B13 A;  4CI3 B;  4E7S A;  5DQV A;  2A72 A;  2RP4 A;  5HXC A;  5L3E B;  3BQK A;  3Q5W A;  5L2L A;  4XBF B;  2OA5 A;  1ZV4 X;  5JDF A;  4WBO A;  3L3P A;  3W15 B;  3IF8 B;  2Z6E A;  2DLR A;  3SOL A;  3O9X A;  3ZJ1 A;  4H9S E;  4CQI A;  1U4Q A;  2XAS B;  3H37 A;  4FI5 A;  1MIW A;  3ZLI A;  3NRX A;  3OJA A;  5F3J A;  1MNE A;  2YU1 A;  1CUN A;  2XUE A;  4ISS A;  5FXX A;  1US7 B;  2A2F X;  3B57 A;  3N9Q A;  1YW0 A;  2WM9 A;  3AAE B;  3PTR B;  5HWX A;  3PUQ A;  3ZMT B;  4HN9 A;  4YJ2 E;  3AAA B;  4EB6 E;  2IC6 A;  1OXZ A;  2DCF A;  2X9Y A;  5T1D A;  2DI4 A;  3N9L A;  2ZMA A;  3CX7 B;  4TUY E;  1WRD A;  1HCI A;  2CWO A;  2W0G A;  5EK2 A;  1MMN A;  3ZMS B;  4ZI2 D;  3DJB A;  4UVA B;  2LEH A;  2NP9 A;  3HR0 A;  2ZM0 A;  4B6X A;  3NBX X;  3KVA A;  1HFA A;  2XTL A;  3F31 A;  4M1P A;  4YFS A;  3VKG A;  3FHN A;  3GN5 A;  3E08 A;  2KWH A;  4MBQ A;  1HTJ F;  2CXL A;  2L3L A;  2JRK A;  4QXB B;  3MK7 C;  3EDU A;  4QXH B;  4UXN B;  2CXD A;  3NZQ A;  1BR2 A;  1LKX A;  3EUH A;  4BGO A;  3V5U A;  3VJZ A;  4TZ4 C;  3O1H A;  2LT3 A;  2MTC A;  4JUY A;  2NWB A;  2ZM8 A;  3LK4 2;  1D0Z A;  3BQI A;  2B1E A;  2QGS A;  3I9Y A;  2BVL A;  2P9B A;  4PAG A;  4DBQ A;  4PJN A;  3IHR A;  4UV9 B;  4FJO A;  1MND A;  3QUJ A;  4UVC B;  4YLH A;  4AKG A;  3AA1 B;  4C90 A;  4ZI3 D;  2W61 A;  5LG4 A;  5LA6 E;  5LGN B;  1O3X A;  1YKE B;  2H7O A;  2BDE A;  2LJL A;  4O2B E;  2ZLY A;  4UV8 B;  3C51 A;  4O4I E;  1S94 A;  2EHO D;  2I59 A;  3ZJ2 A;  5J1G A;  3ZYK A;  4IE6 A;  5LP6 E;  2D0T A;  3VHL A;  5L3C B;  4IE4 A;  1ZEE A;  1HG5 A;  5HAX A;  3CQG B;  4BA9 A;  4F6R C;  2V7I A;  4IGU A;  4EYY R;  4OFZ A;  5L3G B;  4PNI A;  3HI2 A;  5JR9 C;  1WYB A;  3WSC A;  4ONR A;  4X1K E;  2W62 A;  3LBX A;  2WMN A;  4YHJ A;  3UT5 E;  2E9X D;  3HL6 A;  5M4Y A;  3LBX B;  5ETW A;  2NW8 A;  5LGU B;  1KK7 A;  4XAX B;  2XAG B;  2H3R A;  4TV8 E;  1MMA A;  4O4J E;  5FY1 A;  2X67 A;  1MMD A;  4KUM B;  5FNV E;  4I50 E;  4U74 A;  3AB3 B;  3C64 A;  5EK3 A;  3PE0 A;  2EHO A;  4DVD A;  3UUM A;  3T8O A;  3SS1 A;  4E7Z A;  4QHO A;  5LJM A;  2DWG A;  2LSK A;  4UIG A;  5FYM A;  2V7L A;  2VWA A;  2XHE B;  3U3I A;  2ZM2 A;  3RYI E;  2N9D A;  2LSG A;  4OYK A;  3ZMZ B;  3ZYM A;  5LBM A;  2L9Q A;  4BAY B;  4GK5 E;  1LVF A;  3K3Q C;  5JRE A;  3Q5X A;  3BQL A;  2K5B B;  5LCY A;  3FXE B;  3GMI A;  3CQC B;  3KFW X;  2XAQ B;  1IAP A;  3O1I A;  3PUA A;  3SRZ A;  4AQF C;  3D0T A;  2LSI A;  3K3O A;  4HEA A;  5DAB A;  2KT9 A;  3PHF 1;  2XQY A;  2KLQ A;  1T98 A;  5HWY A;  2YK0 A;  4HTE A;  3TKL B;  3O1J A;  3RRC A;  3OBV E;  4DMV A;  4A56 A;  2JQQ A;  3MXZ A;  2V7J A;  3Q2M A;  2HH7 A;  1FMV A;  2Q9Q C;  2LHR A;  3JC6 D;  4H63 H;  3K3N A;  4QX7 B;  1HG2 A;  4EZ4 A;  1BR1 A;  4TV9 E;  2N2N A;  2DHR A;  4JEU B;  3I1A A;  5JR9 B;  5F8P A;  2LHN A;  3ZCI A;  5C8Y E;  4IIJ E;  3I0Q A;  1QUU A;  2E8I A;  5JDN A;  5HYA A;  5KMG P;  1VOM A;  2X0L B;  4GOU A;  4HE8 A;  3KV6 A;  3RRW A;  3RYH E;  1V9D A;  4PJJ A;  4DO0 A;  3CX8 B;  3C4W A;  5BMV E;  3ANW A;  3LFM A;  2KMF A;  1G8X A;  2WSS V;  3LJC A;  3ANW B;  2PJQ A;  2K48 A;  3UTK A;  2ODU A;  5FXV A;  3QC9 A;  4ZI3 C;  2DNX A;  3FBZ A;  4UVB B;  3UUX B;  1FEW A;  4UF0 A;  3UUN A;  4ZS2 A;  3F57 A;  3NZP A;  1HS7 A;  3Q9D A;  4UF0 B;  1ZKE A;  4O8S A;  3OYX A;  1U5P A;  2YEV C;  1MMG A;  2IAK A;  2WWU A;  3R6N A;  4Z8X A;  2C5K T;  2C5J A;  3A5X A;  5J2U E;  3N2G E;  4JLE A;  3E0Z A;  3ZMV B;  4CZZ B;  2E9X C;  5CA1 E;  3NRY A;  2K24 A;  2LOP A;  3KDS E;  4WNK A;  1WYC A;  2CWY A;  2LE8 A;  2VKJ A;  4KP3 C;  5H6R B;  5LBQ B;  1IJ5 A;  4BJN A;  5HXE A;  3AAI A;  3ZCJ A;  1IZN B;  1YD8 G;  2YIN A;  3N9P A;  5JH7 E;  1MIV A;  2Y6X A;  5FP3 A;  5DQW A;  3PU8 A;  3KV9 A;  4PK6 A;  5TAO A;  2D0U A;  2YU2 A;  4HGA A;  4EIW A;  2MYS A;  3KBT A;  3N9O A;  4U72 A;  3UFE A;  3HKC E;  4K0U A;  4X1Y E;  2JMK A;  5LYJ E;  1FMW A;  4GYS A;  3J7Y q;  3AA0 B;  4H9P C;  4ANJ A;  1VRB A;  4ZI7 E;  2C0S A;  3MJX A;  2JPF A;  4P0B A;  1EZ3 A;  1SA0 E;  2PG8 A;  3AVR A;  2L8K A;  3N9M A;  2N1G A;  4V1A v;  2KXP B;  1AJ3 A;  3HA4 A;  3KBU A;  4PJL A;  2X9H A;  4UEL A;  3LG7 A;  4WW0 A;  4OYJ A;  4DBR A;  3HKB E;  1D0Y A;  5JDG A;  4EZH A;  3LK2 B;  3C50 A;  3N2O A;  5L3B B;  1QSD A;  3AA6 B;  2MTQ A;  3WAJ A;  1D0X A;  2NOX A;  4NUU A;  4XZC A;  5CB4 E;  3DTO A;  3AT7 A;  4KBM B;  5GON E;  4CXY A;  3R84 B;  5L3F B;  4GYR A;  2CLY C;  3H3A A;  3L09 A;  3PUR A;  3RC3 A;  3ZN1 B;  4H9O C;  3M65 A;  4CI1 B;  3VU7 H;  5HXS A;  3FB2 A;  2QA7 A;  3FBL A;  4X1I E;  1H7C A;  3RYF E;  5LHG B;  2LSY A;  4EAH A;  4TX5 A;  5JRC A;  4DND A;  5JRC B;  2G0U A;  5JQG E;  3CWZ B;  3MZK B;  4CXW A;  5ADX L;  3PUS A;  3HKD E;  2VAS A;  3N5L A;  5AFU L;  2V7M A;  3CVR A;  3IBP A;  3PUG A;  3OKQ A;  1NAF A;  2A3D A;  2SPC A;  4CXX A;  5JDM A;  4QWN B;  5KX5 E;  1LVK A;  1UX5 A;  4YJ3 E;  5IYZ E;  4ZI2 C;  4MAL A;  4AKH A;  1HF8 A;  1IJ6 A;  1NWM X;  2KND A;  3IEE A;  2IC9 A;  2CXF A;  2PBI A;  5FMN A;  2XAJ B;  3WUR A;  3WAK A;  5LGT B;  2WBL A;  4QXC B;  3VKH A;  5A1L A;  4L0R A;  2LOS A;  2VB6 A;  2NW9 A;  1X79 A;  2PFV A;  5EK4 A;  3P8C D;  2X51 A;  3BK9 A;  3ZC1 A;  4BJM A;  5JVD E;  3O4X E;  2XAH B;  5JR9 A;  3KV5 A;  4PFP A;  5H6Q B;  3ESL A;  1B7T A;  3K8P C;  4IE0 A;  2X68 A;  4TN7 B;  4X20 E;  2J1D G;  3I0O A;  4N78 D;  4AI6 A;  3RKO A;  3E22 E;  1MIY A;  1BR0 A;  4C91 A;  2KIN B;  3GA8 A;  4QKN A;  4ECG A;  2JMH A;  3AA7 B;  4GK0 E;  3EVY A;  3MKD A;  2VKH A;  3QK6 A;  3ZEF B;  3LK3 B;  5KDM C;  5L3D B;  4MFR A;  4EXT A;  3F2E A;  4P09 A;  3WI3 A;  4EOZ B;  5LHI B;  2EHO C;  2MOZ A;  2CE7 A;  2VKO A;  5LNK A;  4ADZ A;  4DMW A;  3EDV A;  4WBN E;  4P0A A;  2V7K A;  2CCQ A;  4PK5 A;  1UCU A;  2CEA A;  1FIO A;  4ILU A;  5LXT E;  2BVM A;  2CLY B;  1LRZ A;  4MLK A;  5IHY A;  3KV4 A;  3RH3 A;  4IHJ E;  3CX6 B;  2HPJ A;  4ZS3 A;  3PF0 A;  3KVB A;  2ACX A;  3AVS A;  1SHZ C;  2UXX B;  5FXZ A;  5CA0 E;  4L9I A;  5DJQ C;  1Z0P A;  3GN5 B;  2Q9Q D;  3J9X 1;  4J2C A;  4G63 A;  1G73 A;  3RPU A;  2RA1 A;  4AQF A;  2CA5 A;  2X9X A;  4CI2 B;  5E0O A;  4H63 V;  1WR6 A;  3RC8 A;  4MHC A;  2LQU A;  2LSJ A;  3N9N A;  3C4X A;  2MBG A;  2VKD A;  3C4Z A;  3MA9 A;  1OWA A;  2W63 A;  4ASK A;  2BZB A;  4HFV A;  4O2A E;  3SWH A;  4H9N C;  3CPZ A;  2X9W A;  3N2K E;  3ZYL A;  5LOV E;  5FY0 A;  1BR4 A;  4I43 B;  4I4T E;  2Q9Q A;  4ERR A;  2Q9Q B;  1UX4 A;  3ETV A;  3DP7 A;  2M67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...