5HWYA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 10 mm na+ and zero ca2+
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
Knots found
sequence length
300
structure length
300
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEENNDKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized membrane protein MJ0091
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 133
structure length 300
sequence length 300
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5hwyA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5hwyA02
5HXHA 5JDLA 5JDHA 5JDFA 5HYAA 3V5UA 5HXRA 5HXCA 5JDQA 5HXEA 5JDMA 5JDNA 5HWYA 5JDGA 5HWXA 3V5SA 5HXSA
chains in the Genus database with same CATH superfamily
4E7ZA 4BJMA 3J9X1 1J5WA 4TNVA 3CVRA 4Z90A 3ZC0A 3NKZA 3QC9A 3ZCIA 3BK9A 3FZKB 2DHRA 5L4EA 3RHWA 4JEHB 1WRDA 4ISSA 4AKHA 3LK42 4O4IE 5AQHB 5CGMA 3L39A 1YD8G 2WDQA 4IE0A 1IAPA 4OYKA 4ZI2C 1W0BA 3ONJA 2NW7A 5CB4E 2JRKA 3M1CA 3P4QA 3ZT7A 3T1HT 1FMVA 1HTJF 2WBLA 4AXPA 2FJEA 5HEGA 3WAKA 2NW9A 5E0OA 2KBBA 2WSSV 5AQQB 2VL0A 2V26A 1D1AA 3AE4A 3I9YA 2DWGA 3ZJ1A 4U2YA 3I9WA 3PUWF 2V7MA 3ZLIA 1J5ET 1G8XA 5AFUL 2WU2A 5AQOB 4X20E 1JNZA 4H9RC 4IE4A 3TLSA 1SUMB 1U5PA 5HCMA 1VCSA 4EEDA 2XUEA 4G63A 1FMWA 3N9LA 3O4XE 5FKYA 5FXVA 4TWHA 2W66A 4DBRA 3PUZF 5HEUA 4ILUA 3C64A 2YKSA 3SRZA 4B3RT 1M62A 2UXBT 4DR3T 3E22E 1QUUA 3ZPOA 3RGLA 1SJ7A 2CBIA 1N34T 4JI1T 2R6GF 4XAXB 3C4WA 4F6RC 5AQIB 3HL6A 5ABFB 4YTMA 2NP9A 5HXCA 2RPAA 2XTLA 4U2ZA 4O2BE 3P50A 2ODVA 3RLFF 1WR0A 4UVBB 5CA0E 5JR9A 1W09A 3KFWX 2XQ9A 2H3RA 2NTXA 4UF0B 3K8PC 3GMIA 3PUVF 2P9BA 3PUSA 3ZYKA 1IJ6A 2KSRA 5FXXA 3LBXA 4ASKA 1FJGT 1X79A 5FMNA 5LJNA 2ZM0A 4PK6A 2IC9A 3ESLA 2RA1A 3ZMVB 2GK9A 4X66T 2ZM8A 4I50E 1XNRT 3PU3A 3QB5A 2WU5A 4HWCA 4PJLA 2XSBA 2XASB 2W61A 3PU8A 5LHHB 2WAUA 2H88A 3ZEFB 5ABGA 4UXNB 2XQYA 2LJLA 1SE7A 1R8IA 5HWXA 2VKHA 3N9OA 4ZI3D 2IIUA 4O2AE 4CI1B 2Q9QD 3OJAA 3PE0A 4HFCA 4X5TA 2XQ5A 3BQLA 3AXJA 3VRAA 4ILBA 4BJNA 1SJ8A 1YQ4A 4AQGA 5LGUB 2JPFA 1WYCA 2XAFB 4J2CA 1IBLT 4MHCA 4AKRB 5L2LA 4HN9A 4NUVA 2UUCT 2WMOA 2ACXA 4PK5A 4IL4A 4LFCT 4QWNB 4YJ2E 2H7OA 2X9XA 2HPLA 2K5BB 1MIVA 2CRBA 3MXZA 3KV6A 3WI3A 5ETWA 2YEVC 2ACZA 4YFSA 4YY3T 1XDPA 3MACA 4DV0T 1WYBA 2X0HA 5LBMA 3BQKA 3JADA 4JYAT 3VR9A 3HKEE 4ZS2A 1MNEA 3ZJ2A 5CFBA 1WFDA 3L8RA 2X0YA 2X67A 4DO0A 2Q9QB 2BKNA 4EXTA 3QOFA 1S94A 4H63H 1UGOA 3Q9DA 4TN7B 3UUXB 4EZHA 4AKIA 1BR2A 3HKDE 1W0AA 4A5XA 2LHRA 1I94T 3LG7A 3ANWB 2IW5B 4QXCB 4P0BA 4AQFC 2Y6XA 3N2GE 5JDQA 4U31A 3H3MA 2QRXA 5JRCA 4AQYT 5L3EB 3DJBA 1KNRA 2LOSA 3AE8A 3UU8A 1D1BA 3FYQA 2YDQA 4UIGA 5JDNA 2KINB 3UUBA 5KDMC 4DMVA 2LHNA 4CN4A 2Q9QC 3EHZA 3Q5EA 2VB6A 1L0VA 2L3LA 2WM9A 1CHUA 4KUMB 4TV8E 5HAXA 3P4RA 3C4XA 1LKXA 3PJAA 2CCQA 3AAAB 4QHOA 4ERRA 4I4TE 2ZMAA 5H6QB 3AVSA 5EK3A 3VHLA 3RIAA 2E9XD 2XJ7A 3V5UA 4TWFA 1G73A 1UK5A 5LYJE 2KWIB 4ZI2D 2PBIA 5J1GA 2SPCA 3UT5E 2BG9A 4E7SA 5LOVE 3OYZA 2LSJA 3C4ZA 4FJOA 2JMKA 3DYJA 1BR0A 3MA9A 1AJ3A 2FBWA 2XPKA 4ZS3A 4Z8XA 4B3MT 2QVAA 3KVAA 3AEFA 3I1AA 4O8SA 1KNPA 2PG8A 2B1EA 3IEEA 4OFZA 1T7SA 5JDHA 2CEAA 4UV9B 5FXZA 5DQWA 2E2AA 2CLYB 3ETVA 4KHZF 5DABA 4HFHA 4OK0A 3SOLA 1E2AA 3NRXA 3U3IA 2M6BA 3JAFA 4NXNT 2W63A 4U7IA 4QX8B 3PURA 4TNWA 5F8PA 2UUAT 3N9QA 1DU2A 4H9NC 3UU6A 3I0QA 4ISTA 3RI5A 4LF5T 2IHR1 5FY7A 3U78A 2VQET 3FZFB 1XNQT 4AKGA 2HPJA 5EK2A 3HA4A 1W9RA 4CXWA 4JI0T 2XAQB 5FY0A 4PNIA 3CQCB 2LSGA 3AAEB 5FXWA 5LJMA 4W8PA 5C3JA 2A9UA 3IA3A 3RIFA 4I55E 1IJ5A 4JBWF 1KFYA 5JTGA 5C8YE 2V5CA 4IL9A 2CLYC 2E9XC 1N33T 2MBGA 2EHOB 2LEHA 1HX8A 2XQ6A 3F2EA 3O9XA 2HN1A 3AE5A 5LMUT 3NBXX 2K48A 2L9QA 5J2UE 4GYRA 1MMAA 4IHJE 5IUXA 3ABVA 2ZM2A 4JUYA 4DV5T 3LFMA 4ANJA 5FL0A 2WZIA 3AE1A 2PTFA 2G0UA 4GK5E 4P0AA 2E9XA 1ZP0A 4HEAA 3ZCJA 3QK6A 3P7IA 3FHNA 2V6YA 1U4QA 2NTYA 3EDVA 2X51A 2IMLA 4ECGA 3AEDA 4LFBT 4WBNE 2I6HA 2W0GA 2X0CA 3P4WA 2X9WA 2FJAA 5LGTB 2KMFA 3OYXA 4PJNA 4EEBA 4B6XA 2LE8A 3C98B 4CN1A 4WNKA 4ZXLA 4KP3C 2X66A 2XQ3A 4ZHQE 2I59A 2BKPA 2PJQA 1XMOT 1YKHB 4CI2B 2YOEA 4X1YE 3TLVA 4DR5T 2UU9T 1V9DA 5AQRB 1MIYA 4L9IA 2C0SA 2XSAA 2VKJA 5FVLA 2QGSA 1T98A 3LBXB 3T1YT 5FY1A 2UXDT 1KF6A 2FUPA 1NENA 5JVDE 4IDPA 3FXDB 3UQ7A 3FBLA 5AQGB 2XAGB 5HCJA 5L3GB 4MLKA 2CXFA 2DL1A 4KHPT 4XZCA 4O4HE 2D9DA 2JQQA 2CMRA 1SHZC 1UX5A 5JH7E 4YSZA 2N1GA 2XM1A 5LHGB 1SA0E 3ZMUB 2VVSA 3ZC1A 5JDLA 3CX8B 1S35A 2ZLYA 3LJCA 3EAMA 3CWZB 2BDEA 4IDOA 3ZT6A 2YN6A 1HNWT 3UTKA 1J1JA 2YINA 2WWUA 4HTEA 2LRKA 2VVNA 3X1DA 2NWBA 4KX6A 5HXEA 4H63V 3UU3A 4DNDA 5L3BB 2ES0A 2IAKA 2Y48B 3EDUA 5BMVE 1Y01A 3OTOT 1LVKA 2LKHA 5TAOA 1VOMA 3J7Yq 1T72A 3P8CD 2X0LB 4MFRA 4X64T 1HS7A 4G2AA 4YHJA 3OKQA 1OEDB 4IE6A 2X9YA 3IBPA 1WLXA 4O4JE 5F3JA 2MOZA 3QUJA 1MMGA 1BR4A 3RH3A 4L0RA 4DV1T 3RYCE 3ZMTB 4ONRA 3C51A 2J47A 4DV4T 2JQHA 3AE9A 3T8OA 4ZZCA 2C5IT 5LNKA 1XZYA 1OEDE 4X1IE 3DP7A 4AKLA 2KXPB 5AQVB 2Y8DA 4LFAT 1HR0T 3ZMZB 3A8YC 3RYIE 3D0TA 3ZT5A 3PJAJ 4PK4A 2LSYA 4UR9A 2CM0A 3RYFE 3RPUA 3SWHA 3K1SA 4PFPA 2XM2A 2LSIA 4DV3T 4U3CA 4KMCA 2N2NA 1OEDC 1VRBA 3O1IA 3L09A 3KVBA 1YXRA 3UU5A 5GONE 5BR8T 2KGXA 3VJZA 1UCUA 2V1DB 4H9PC 2CHOA 2W67A 3LK3B 3RYHE 2QA7A 4A98A 5T1DA 1HNXT 2D0TA 2A2FX 3CKDA 2VKOA 4IGUA 2MYSA 3N2KE 4YJ3E 2KZ7B 3FXEB 5FYMA 3AA0B 3RKOA 2WP9A 2M6IA 4YXDA 4IDQA 3OBVE 2UXXB 4LF6T 3KBTA 4JI5T 4YT0A 5LP6E 3RC3A 4C90A 2BS4A 4DR2T 2WS3A 4C91A 4EIWA 1LVFA 3AE3A 4K0UA 2BG9B 2H7VC 5FNVE 4GYSA 3B13A 3WURA 4UVCB 3M3ZB 1E7PA 3CPZA 2Z6EA 2M67A 4ZZBA 3JC6D 4LF9T 3F31A 2MPKA 5ABHA 2J4GA 2D0UA 4AQFA 1MMNA 3O1HA 3PUAA 4HFVA 2BG9E 2ZM6T 3CX7B 4WBOA 5HEOA 3E08A 3W15B 3IHRA 3P4SA 4LF8T 4ILCA 5L47A 4WW0A 2W00A 4PAGA 3EVYA 3AY5A 3AAIA 4QH1A 3RIUC 2BBHA 3C50A 2MAWA 3EI0A 4BA9A 5HWYA 3AE6A 1US7B 3R84B 2FJBA 1XMQT 2Q9QA 4JI4T 1M7KA 3AA6B 3G06A 5M4YA 2UXNB 2C5JA 5ADXL 3TLWA 3B57A 2CWYA 2E5LT 3AECA 4EZ4A 2PFVA 3A7MA 2YK0A 2XQ8A 3KV5A 5ABEA 1HG5A 3KBUA 2UXCT 5HXHA 3GN5B 1H7CA 2YU2A 4WYVA 1MIWA 4IE7A 4B3ST 2LSKA 3TLTA 2RP4A 3FBZA 5AQMB 3AE7A 3QB5K 2NW8A 2X9HA 4EGWA 2X68A 4N78D 3NZQA 2MTCA 1HCIA 1D0ZA 2EHOD 4ILAA 1N36T 1WR6A 2DNXA 3CQGB 4YTNA 5L4HA 1EZ3A 1X9BA 2F4VT 2JQKA 3JC6C 3S4UA 2B76A 5CA1E 3AB3B 3UQ4A 1MMDA 3UUNA 1Z0PA 3QNUA 4DR4T 2IC6A 3EABA 2KWHA 4HFIA 3KINB 1UUSA 1FIOA 2H89A 2WDVA 1ZKEA 4Q25A 4EYYR 4JI2T 2JQ9A 5L3CB 4ZOLE 4LMLA 2XY8B 5LXTE 2WQYA 4CN6A 4QH5A 3VKGA 4DV2T 5HXRA 2K9AA 4DUZT 4DV6T 1XWMA 4HKAA 2JMHA 5AQSB 4YSXA 1KEYA 3PV0F 5AQUB 3PTRB 4HWIB 3PUQA 3UU4A 3N2OA 1ZHCA 5DJQC 3LDQB 4IREA 4LMKA 3IF8B 5KX5E 4NUUA 4AIUA 5FVKA 3MKDA 2XAHB 3F57A 4CXYA 4BGOA 4TUYE 3RX6A 2L8KA 1N32T 4UV8B 4QX7B 2CXLA 2KVPA 4DR1T 4IDZA 4U72A 2L7NA 3Q2MA 3AEAA 4H9OC 4H9SE 3GA8A 4LMJA 3SFDA 3DTOA 5KMGP 4YTPA 4GK0E 4UVAB 3VR8A 4PFOA 5JR9B 4OX9T 4HFDA 3N9PA 3NRYA 1LRZA 2EHOC 5DQVA 2XQ4A 3VU7H 4PW8A 4KBMB 2D5UA 5AQFB 2A72A 2W4XA 3N5LA 1HNZT 3SS1A 3KDSE 2IDOB 1WCRA 3E0ZA 5FZTA 3N9NA 2LKGA 2BS2A 4M1PA 2N9DA 2EHOA 5IHYA 1KNZA 4X62T 2WB5A 4AI6A 3CMLA 1D0YA 5H6RB 3FZMB 4I0UA 1YW0A 4CZZB 2LQUA 4CXXA 1VCTA 4V1Av 2OA5A 3EUHA 5AQJB 5JR9C 5JDGA 4CI3B 2E8IA 4P1NA 5LGNB 3HKCE 2LM2A 4JLEA 4X1KE 3Q5DA 3AXJB 3ZYLA 3PHF1 4B3TT 4GIWA 4JEUB 4UEMA 1NEKA 5IWAT 2C5KT 5HYAA 3RC8A 2J1DG 5LA6E 3ETUA 3MJXA 4FI5A 3O1JA 2CXDA 1IBMT 4YSYA 1YQ3A 2BVLA 3BQIA 4JI3T 4LF7T 4U33A 5JDFA 1T8BA 2VKDA 3V5SA 4MBQA 1Z8UA 1QSDA 4BAYB 4U7YA 3VRBA 4HWFA 3HR0A 3KV4A 1B7TA 3PUXF 2HHHT 3JCFA 4DBQA 2WZHA 2QYWA 4MALA 3A5XA 2W62A 4NXMT 2LOPA 3RQWA 3PDYA 1IZNB 4HFEA 3TKLB 2D2SA 3ZSSA 3WAJA 2WY2A 3AEEA 3ZN1B 4NPPA 2V6XA 4GOUA 1NAFA 1UURA 3H3AA 2XAJB 2DLRA 5JREA 4H9QC 2LLYA 2LM9A 4IDNA 5ABFA 3ONLC 4IE5A 4HFBA 4TV9E 1ZOYA 2VASA 2A3DA 3RKGA 2DCFA 5L3FB 3KV9A 2V7LA 3AT7A 4X65T 3K3QC 3PUYF 3FZHB 4WZXA 3RRCA 4QXHB 3L3PA 1OWAA 2JJ9A 2KNDA 4TZ4C 2WMNA 3ZMSB 3ZKRA 5JRCB 4UF0A 4HWDA 1HFAA 3AA7B 3UUMA 2ODUA 4L5GA 2E5VA 4ADZA 3MK7C 3ZYMA 5LHIB 3P4PA 1XDOA 2V8SV 3WSCA 2WWVA 3AEGA 2BVMA 2V7IA 3AVRA 3RQUA 5EZYE 5HEHA 4DUYT 3HKBE 4OYJA 5HEJA 5IYZE 4DMWA 2IUBA 3FZLB 1D0XA 4UELA 4LF4T 4XBFB 3LK2B 1OXZA 2CHNA 5FL1A 2XQAA 2AE9A 1KK7A 3ONXA 2YU1A 4CQIA 3CK6A 3Q5XA 4K0KT 2FJDA 3OPCA 3CX6B 4NIQA 4QH4A 1OEDA 5JQGE 5HXSA 3NWIA 3Q5WA 2DWKA 4GKJT 2J62A 1O3XA 1HG2A 4ZEYA 2VL8A 3TLUA 2KLQA 4JI8T 3K3NA 4IIJE 3RRWA 4TX5A 3FB2A 3ZN0B 2CBJA 2NOXA 2YDSA 3UFEA 4QXBB 5LMNT 5LBQB 2BZBA 5J2TE 1D1CA 3UFGA 2CE7A 1QLBA 1GQEA 2XHEB 1UX4A 3JAEA 4JI7T 1CUNA 2BKOA 2BBJA 2BS3A 3B5MA 3N9MA 4KI0F 4U74A 4ZI3C 5AQNB 4EB6E 4A97A 4HGAA 2V5DA 4O4LE 4EYUA 2K3WA 4JV5T 1HX1B 4HE8A 2JIWA 5F5WA 3AE2A 3VKHA 2XZEA 4QKNA 5J0ZA 1NWMX 3I0OA 2BG9C 4HWHA 3GWHA 4ZI7E 4EOZB 2CWOA 2UUBT 5C2TA 4DV7T 2KT9A 3RIUA 3SFEA 4DIDB 1JNRA 1BR1A 3NVOA 3ANWA 1E1HB 1FEWA 1MNDA 2V7JA 5AQLB 3PF0A 5FP3A 1HF8A 3PUGA 2WDRA 4YLHA 3AEBA 2AXDS 2CA5A 4PJJA 5AQPB 3AA1B 4Z91A 2OV9A 5AQKB 2VWAA 4F8HA 5AQTB 2WCAA 2DI4A 4TWDA 2XQ7A 2HN2A 1I6ZA 4DVDA 1Y64B 4P09A 5LG3A 2LRLA 2YDRA 5EK4A 5L3DB 2L10A 5A1LA 3K3OA 4I43B 3UULA 3CIRA 4DR7T 4GKKT 2VURA 5LG4A 1IBKT 2E9XB 5LB7B 4COFA 3M65A 2HH7A 3ZSTA 4EAHA 4OHFA 5KXJA 1ZEEA 2V6YB 4AISA 3HI2A 5JDMA 4DR6T 2NR4A 4F7GB 3OVUA 3R6NA 4EV6A 4IT4A 5CJ5A 1YKEB 2OLTA 2W2UA 3NZPA 2VQFT 4YHHT 2I0MA 1ZV4X 4A56A 3LSVA 3H37A 2K24A 2V7KA 4JI6T 2CPTA 3GN5A 3CQXC 2MTQA 3MZKB 2LT3A 5LCYA 4PJMA 2VK9A 3RF1A
chains in the Genus database with same CATH topology
3AAAB 3RYIE 3D0TA 3EUHA 4BJMA 3J9X1 4QHOA 4ERRA 4E7ZA 4I4TE 2ZMAA 2LSYA 4PK4A 5JR9C 5H6QB 5JDGA 3CVRA 2CM0A 4CI3B 2E8IA 3RYFE 3AVSA 5EK3A 3RPUA 3VHLA 3ZC0A 5LGNB 3HKCE 3QC9A 2E9XD 3SWHA 4JLEA 3ZCIA 4PFPA 3BK9A 2DHRA 4X1KE 2LSIA 3V5UA 4JEHB 1WRDA 3ZYLA 3PHF1 1G73A 5LYJE 2KWIB 4GIWA 4JEUB 4KMCA 2N2NA 4ISSA 4UEMA 4ZI2D 4AKHA 1VRBA 3LK42 3O1IA 2PBIA 5J1GA 2SPCA 3L09A 3UT5E 3KVBA 4O4IE 2C5KT 5HYAA 3RC8A 5GONE 2J1DG 1YD8G 4E7SA 5LA6E 4IE0A 5LOVE 1IAPA 3ETUA 3OYZA 4OYKA 4ZI2C 3VJZA 1UCUA 2LSJA 3C4ZA 2NW7A 4FJOA 2V1DB 4H9PC 2JMKA 5CB4E 3MJXA 4FI5A 3LK3B 2JRKA 2CXDA 3O1JA 3RYHE 2QA7A 1BR0A 5T1DA 3M1CA 2D0TA 2A2FX 2BVLA 3BQIA 3CKDA 2VKOA 4IGUA 3MA9A 2MYSA 5JDFA 1AJ3A 3N2KE 4ZS3A 4YJ3E 2KZ7B 1FMVA 2VKDA 4Z8XA 3V5SA 3FXEB 1HTJF 4MBQA 5FYMA 3AA0B 2WBLA 4AXPA 3RKOA 1QSDA 3WAKA 3KVAA 4BAYB 3HR0A 3KV4A 1B7TA 2NW9A 5E0OA 3I1AA 3OBVE 4O8SA 2UXXB 2WSSV 3KBTA 4DBQA 4MALA 2PG8A 3A5XA 2W62A 2B1EA 2LOPA 3IEEA 4OFZA 5LP6E 2V26A 1D1AA 3RC3A 4C90A 5JDHA 3PDYA 2CEAA 3I9YA 1IZNB 2DWGA 3TKLB 3ZJ1A 2D2SA 1LVFA 4UV9B 4C91A 4EIWA 3WAJA 5FXZA 4K0UA 3I9WA 5DQWA 2CLYB 2H7VC 3ETVA 5FNVE 4GYSA 3ZN1B 3B13A 2V7MA 3WURA 5DABA 4UVCB 3ZLIA 4GOUA 1NAFA 4OK0A 3H3AA 3SOLA 1G8XA 3NRXA 3U3IA 3CPZA 2XAJB 2Z6EA 2DLRA 5AFUL 5JREA 2M67A 4H9QC 2W63A 4QX8B 3PURA 3JC6D 4X20E 5F8PA 2LM9A 3F31A 3N9QA 4H9RC 4IE4A 4IE5A 2D0UA 1U5PA 4AQFA 4H9NC 1MMNA 3O1HA 3I0QA 4TV9E 3PUAA 4HFVA 4ISTA 2VASA 2A3DA 5FY7A 3CX7B 2DCFA 4WBOA 3U78A 5L3FB 3KV9A 2V7LA 3E08A 2XUEA 3IHRA 4G63A 3W15B 1FMWA 3N9LA 3O4XE 3AT7A 5FXVA 4AKGA 3K3QC 2HPJA 3RRCA 4DBRA 4WW0A 4QXHB 2W00A 4PAGA 3L3PA 1OWAA 2JJ9A 3EVYA 5EK2A 2KNDA 4TZ4C 2WMNA 3ZMSB 4ILUA 3C64A 3HA4A 4CXWA 3SRZA 2XAQB 5FY0A 3AAIA 4PNIA 5JRCB 4UF0A 3C50A 4BA9A 5HWYA 3CQCB 2LSGA 3E22E 1QUUA 3ZPOA 1HFAA 3AA7B 3AAEB 3UUMA 2ODUA 1US7B 4L5GA 5FXWA 3R84B 4ADZA 5LJMA 2Q9QA 3MK7C 3ZYMA 5LHIB 3AA6B 4I55E 4XAXB 5M4YA 2UXNB 3C4WA 2C5JA 1IJ5A 4F6RC 5ADXL 3WSCA 5C8YE 3HL6A 2NP9A 2BVMA 2CLYC 2E9XC 2V7IA 3B57A 5HXCA 2CWYA 2MBGA 2EHOB 2XTLA 4EZ4A 2LEHA 3AVRA 1HX8A 2PFVA 5EZYE 4O2BE 3F2EA 3O9XA 2ODVA 2YK0A 3KV5A 3HKBE 3NBXX 4OYJA 4UVBB 5CA0E 1HG5A 5IYZE 5JR9A 2K48A 3KBUA 2L9QA 4DMWA 5HXHA 3GN5B 5J2UE 4GYRA 1MMAA 1H7CA 4IHJE 2ZM2A 1D0XA 4JUYA 4UELA 3KFWX 4XBFB 3LFMA 4ANJA 3LK2B 1OXZA 2H3RA 2NTXA 1KK7A 2YU2A 3ONXA 4UF0B 2G0UA 2YU1A 4GK5E 4CQIA 1MIWA 3Q5XA 4P0AA 2E9XA 3K8PC 3GMIA 3CX6B 4HEAA 2P9BA 3ZCJA 3PUSA 3QK6A 4IE7A 3ZYKA 3P7IA 3FHNA 2LSKA 1IJ6A 1U4QA 5JQGE 2NTYA 5HXSA 5FXXA 3EDVA 3Q5WA 3LBXA 4ASKA 2RP4A 2X51A 3FBZA 4ECGA 1X79A 2NW8A 4WBNE 2DWKA 2W0GA 5FMNA 1O3XA 1HG2A 5LJNA 2ZM0A 2X9HA 2VL8A 2X9WA 4PK6A 5LGTB 2IC9A 2KMFA 2KLQA 3OYXA 3ESLA 2RA1A 2X68A 4PJNA 3K3NA 4IIJE 4N78D 3RRWA 3ZMVB 3NZQA 2GK9A 4TX5A 2MTCA 4B6XA 2ZM8A 1HCIA 2LE8A 4I50E 3FB2A 3ZN0B 1D0ZA 3C98B 3PU3A 4WNKA 2EHOD 2X66A 4KP3C 4ZHQE 2NOXA 3UFEA 2I59A 4PJLA 4QXBB 2PJQA 1WR6A 2W61A 2DNXA 2XASB 3CQGB 3PU8A 5LHHB 2WAUA 1YKHB 4CI2B 4X1YE 5LBQB 3ZEFB 2BZBA 1V9DA 4UXNB 1EZ3A 5J2TE 1D1CA 1MIYA 4L9IA 2C0SA 3JC6C 2XQYA 3S4UA 2CE7A 2VKJA 2XHEB 5CA1E 3AB3B 1MMDA 1UX4A 2QGSA 1T98A 2LJLA 3UUNA 1Z0PA 1CUNA 3LBXB 5HWXA 2VKHA 5FY1A 3N9OA 2IC6A 4ZI3D 2KWHA 4O2AE 4CI1B 3N9MA 2Q9QD 5JVDE 3OJAA 3PE0A 3BQLA 3FXDB 3KINB 4U74A 3FBLA 4ZI3C 4BJNA 1FIOA 2XAGB 4EB6E 4AQGA 5L3GB 1ZKEA 2JPFA 1WYCA 2XAFB 4EYYR 5LGUB 4HGAA 4J2CA 4MLKA 2CXFA 5L3CB 4O4LE 4ZOLE 4EYUA 4MHCA 4AKRB 4XZCA 5LXTE 4HE8A 4HN9A 4O4HE 4NUVA 5L2LA 2JQQA 2WMOA 2CMRA 1SHZC 1UX5A 3VKGA 3VKHA 4QKNA 2ACXA 4PK5A 5HXRA 2K9AA 4HKAA 2JMHA 5JH7E 1NWMX 3I0OA 2N1GA 3GWHA 4QWNB 4ZI7E 4EOZB 5LHGB 1SA0E 4YJ2E 2H7OA 2CWOA 3ZMUB 2X9XA 2HPLA 3ZC1A 5JDLA 2K5BB 1MIVA 2KT9A 3MXZA 3PTRB 3PUQA 3KV6A 3CX8B 1S35A 3N2OA 3WI3A 2ZLYA 2YEVC 5ETWA 3LJCA 4YFSA 1BR1A 1ZHCA 3ANWA 5DJQC 1E1HB 3CWZB 1FEWA 1MNDA 2BDEA 3MACA 1WYBA 5LBMA 3BQKA 2V7JA 3IF8B 3HKEE 4ZS2A 3UTKA 3PF0A 5KX5E 1MNEA 5FP3A 3ZJ2A 1HF8A 3PUGA 4NUUA 4YLHA 2YINA 2X67A 2CA5A 2WWUA 4HTEA 3MKDA 4DO0A 2XAHB 3F57A 4PJJA 4CXYA 2Q9QB 4BGOA 3AA1B 4TUYE 3RX6A 2L8KA 2VWAA 4EXTA 1S94A 4H63H 4UV8B 3Q9DA 4QX7B 2DI4A 2CXLA 4TN7B 3UUXB 4EZHA 4AKIA 1BR2A 4IDZA 4U72A 3HKDE 3Q2MA 2NWBA 4H9OC 5HXEA 4H9SE 3GA8A 1Y64B 4P09A 4DVDA 3DTOA 5KMGP 4H63V 5EK4A 4DNDA 4GK0E 2LHRA 4UVAB 5L3BB 2ES0A 2IAKA 2Y48B 3EDUA 5BMVE 4PFOA 5JR9B 3LG7A 3ANWB 5L3DB 1LVKA 5TAOA 3N9PA 1VOMA 5A1LA 3J7Yq 3K3OA 3NRYA 2IW5B 1LRZA 4QXCB 3P8CD 2X0LB 4P0BA 4I43B 4AQFC 2EHOC 5DQVA 2Y6XA 3N2GE 3UULA 5JDQA 4MFRA 3VU7H 5LG4A 4PW8A 1HS7A 2E9XB 4KBMB 4G2AA 2D5UA 3M65A 4YHJA 2HH7A 3OKQA 4IE6A 2A72A 4EAHA 2X9YA 4OHFA 5JRCA 1ZEEA 3N5LA 3IBPA 3HI2A 3SS1A 5JDMA 5L3EB 3DJBA 3KDSE 2LOSA 1WLXA 4O4JE 5F3JA 2MOZA 3QUJA 1MMGA 1D1BA 3E0ZA 3R6NA 3N9NA 1BR4A 1YKEB 4UIGA 5JDNA 3RH3A 2KINB 4M1PA 5KDMC 2N9DA 2EHOA 3NZPA 4L0RA 4DMVA 2LHNA 5IHYA 2Q9QC 3RYCE 3ZMTB 1KNZA 4ONRA 3C51A 1ZV4X 4A56A 3H37A 3T8OA 4AI6A 2VB6A 2C5IT 3CMLA 2K24A 5LNKA 2V7KA 1D0YA 5H6RB 2L3LA 2WM9A 4X1IE 1YW0A 4KUMB 4TV8E 3DP7A 5HAXA 4AKLA 4CZZB 3GN5A 3C4XA 3CQXC 2LQUA 2KXPB 2MTQA 1LKXA 3MZKB 2LT3A 2Y8DA 5LCYA 4CXXA 4V1Av 4PJMA 2CCQA 2VK9A 3ZMZB 2OA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXH A;  5JDL A;  5JDH A;  5JDF A;  5HYA A;  3V5U A;  5HXR A;  5HXC A;  5JDQ A;  5HXE A;  5JDM A;  5JDN A;  5HWY A;  5JDG A;  5HWX A;  3V5S A;  5HXS A; 
#chains in the Genus database with same CATH topology
 4E7Z A;  4BJM A;  3J9X 1;  1J5W A;  4TNV A;  3CVR A;  4Z90 A;  3ZC0 A;  3NKZ A;  3QC9 A;  3ZCI A;  3BK9 A;  3FZK B;  2DHR A;  5L4E A;  3RHW A;  4JEH B;  1WRD A;  4ISS A;  4AKH A;  3LK4 2;  4O4I E;  5AQH B;  5CGM A;  3L39 A;  1YD8 G;  2WDQ A;  4IE0 A;  1IAP A;  4OYK A;  4ZI2 C;  1W0B A;  3ONJ A;  2NW7 A;  5CB4 E;  2JRK A;  3M1C A;  3P4Q A;  3ZT7 A;  3T1H T;  1FMV A;  1HTJ F;  2WBL A;  4AXP A;  2FJE A;  5HEG A;  3WAK A;  2NW9 A;  5E0O A;  2KBB A;  2WSS V;  5AQQ B;  2VL0 A;  2V26 A;  1D1A A;  3AE4 A;  3I9Y A;  2DWG A;  3ZJ1 A;  4U2Y A;  3I9W A;  3PUW F;  2V7M A;  3ZLI A;  1J5E T;  1G8X A;  5AFU L;  2WU2 A;  5AQO B;  4X20 E;  1JNZ A;  4H9R C;  4IE4 A;  3TLS A;  1SUM B;  1U5P A;  5HCM A;  1VCS A;  4EED A;  2XUE A;  4G63 A;  1FMW A;  3N9L A;  3O4X E;  5FKY A;  5FXV A;  4TWH A;  2W66 A;  4DBR A;  3PUZ F;  5HEU A;  4ILU A;  3C64 A;  2YKS A;  3SRZ A;  4B3R T;  1M62 A;  2UXB T;  4DR3 T;  3E22 E;  1QUU A;  3ZPO A;  3RGL A;  1SJ7 A;  2CBI A;  1N34 T;  4JI1 T;  2R6G F;  4XAX B;  3C4W A;  4F6R C;  5AQI B;  3HL6 A;  5ABF B;  4YTM A;  2NP9 A;  5HXC A;  2RPA A;  2XTL A;  4U2Z A;  4O2B E;  3P50 A;  2ODV A;  3RLF F;  1WR0 A;  4UVB B;  5CA0 E;  5JR9 A;  1W09 A;  3KFW X;  2XQ9 A;  2H3R A;  2NTX A;  4UF0 B;  3K8P C;  3GMI A;  3PUV F;  2P9B A;  3PUS A;  3ZYK A;  1IJ6 A;  2KSR A;  5FXX A;  3LBX A;  4ASK A;  1FJG T;  1X79 A;  5FMN A;  5LJN A;  2ZM0 A;  4PK6 A;  2IC9 A;  3ESL A;  2RA1 A;  3ZMV B;  2GK9 A;  4X66 T;  2ZM8 A;  4I50 E;  1XNR T;  3PU3 A;  3QB5 A;  2WU5 A;  4HWC A;  4PJL A;  2XSB A;  2XAS B;  2W61 A;  3PU8 A;  5LHH B;  2WAU A;  2H88 A;  3ZEF B;  5ABG A;  4UXN B;  2XQY A;  2LJL A;  1SE7 A;  1R8I A;  5HWX A;  2VKH A;  3N9O A;  4ZI3 D;  2IIU A;  4O2A E;  4CI1 B;  2Q9Q D;  3OJA A;  3PE0 A;  4HFC A;  4X5T A;  2XQ5 A;  3BQL A;  3AXJ A;  3VRA A;  4ILB A;  4BJN A;  1SJ8 A;  1YQ4 A;  4AQG A;  5LGU B;  2JPF A;  1WYC A;  2XAF B;  4J2C A;  1IBL T;  4MHC A;  4AKR B;  5L2L A;  4HN9 A;  4NUV A;  2UUC T;  2WMO A;  2ACX A;  4PK5 A;  4IL4 A;  4LFC T;  4QWN B;  4YJ2 E;  2H7O A;  2X9X A;  2HPL A;  2K5B B;  1MIV A;  2CRB A;  3MXZ A;  3KV6 A;  3WI3 A;  5ETW A;  2YEV C;  2ACZ A;  4YFS A;  4YY3 T;  1XDP A;  3MAC A;  4DV0 T;  1WYB A;  2X0H A;  5LBM A;  3BQK A;  3JAD A;  4JYA T;  3VR9 A;  3HKE E;  4ZS2 A;  1MNE A;  3ZJ2 A;  5CFB A;  1WFD A;  3L8R A;  2X0Y A;  2X67 A;  4DO0 A;  2Q9Q B;  2BKN A;  4EXT A;  3QOF A;  1S94 A;  4H63 H;  1UGO A;  3Q9D A;  4TN7 B;  3UUX B;  4EZH A;  4AKI A;  1BR2 A;  3HKD E;  1W0A A;  4A5X A;  2LHR A;  1I94 T;  3LG7 A;  3ANW B;  2IW5 B;  4QXC B;  4P0B A;  4AQF C;  2Y6X A;  3N2G E;  5JDQ A;  4U31 A;  3H3M A;  2QRX A;  5JRC A;  4AQY T;  5L3E B;  3DJB A;  1KNR A;  2LOS A;  3AE8 A;  3UU8 A;  1D1B A;  3FYQ A;  2YDQ A;  4UIG A;  5JDN A;  2KIN B;  3UUB A;  5KDM C;  4DMV A;  2LHN A;  4CN4 A;  2Q9Q C;  3EHZ A;  3Q5E A;  2VB6 A;  1L0V A;  2L3L A;  2WM9 A;  1CHU A;  4KUM B;  4TV8 E;  5HAX A;  3P4R A;  3C4X A;  1LKX A;  3PJA A;  2CCQ A;  3AAA B;  4QHO A;  4ERR A;  4I4T E;  2ZMA A;  5H6Q B;  3AVS A;  5EK3 A;  3VHL A;  3RIA A;  2E9X D;  2XJ7 A;  3V5U A;  4TWF A;  1G73 A;  1UK5 A;  5LYJ E;  2KWI B;  4ZI2 D;  2PBI A;  5J1G A;  2SPC A;  3UT5 E;  2BG9 A;  4E7S A;  5LOV E;  3OYZ A;  2LSJ A;  3C4Z A;  4FJO A;  2JMK A;  3DYJ A;  1BR0 A;  3MA9 A;  1AJ3 A;  2FBW A;  2XPK A;  4ZS3 A;  4Z8X A;  4B3M T;  2QVA A;  3KVA A;  3AEF A;  3I1A A;  4O8S A;  1KNP A;  2PG8 A;  2B1E A;  3IEE A;  4OFZ A;  1T7S A;  5JDH A;  2CEA A;  4UV9 B;  5FXZ A;  5DQW A;  2E2A A;  2CLY B;  3ETV A;  4KHZ F;  5DAB A;  4HFH A;  4OK0 A;  3SOL A;  1E2A A;  3NRX A;  3U3I A;  2M6B A;  3JAF A;  4NXN T;  2W63 A;  4U7I A;  4QX8 B;  3PUR A;  4TNW A;  5F8P A;  2UUA T;  3N9Q A;  1DU2 A;  4H9N C;  3UU6 A;  3I0Q A;  4IST A;  3RI5 A;  4LF5 T;  2IHR 1;  5FY7 A;  3U78 A;  2VQE T;  3FZF B;  1XNQ T;  4AKG A;  2HPJ A;  5EK2 A;  3HA4 A;  1W9R A;  4CXW A;  4JI0 T;  2XAQ B;  5FY0 A;  4PNI A;  3CQC B;  2LSG A;  3AAE B;  5FXW A;  5LJM A;  4W8P A;  5C3J A;  2A9U A;  3IA3 A;  3RIF A;  4I55 E;  1IJ5 A;  4JBW F;  1KFY A;  5JTG A;  5C8Y E;  2V5C A;  4IL9 A;  2CLY C;  2E9X C;  1N33 T;  2MBG A;  2EHO B;  2LEH A;  1HX8 A;  2XQ6 A;  3F2E A;  3O9X A;  2HN1 A;  3AE5 A;  5LMU T;  3NBX X;  2K48 A;  2L9Q A;  5J2U E;  4GYR A;  1MMA A;  4IHJ E;  5IUX A;  3ABV A;  2ZM2 A;  4JUY A;  4DV5 T;  3LFM A;  4ANJ A;  5FL0 A;  2WZI A;  3AE1 A;  2PTF A;  2G0U A;  4GK5 E;  4P0A A;  2E9X A;  1ZP0 A;  4HEA A;  3ZCJ A;  3QK6 A;  3P7I A;  3FHN A;  2V6Y A;  1U4Q A;  2NTY A;  3EDV A;  2X51 A;  2IML A;  4ECG A;  3AED A;  4LFB T;  4WBN E;  2I6H A;  2W0G A;  2X0C A;  3P4W A;  2X9W A;  2FJA A;  5LGT B;  2KMF A;  3OYX A;  4PJN A;  4EEB A;  4B6X A;  2LE8 A;  3C98 B;  4CN1 A;  4WNK A;  4ZXL A;  4KP3 C;  2X66 A;  2XQ3 A;  4ZHQ E;  2I59 A;  2BKP A;  2PJQ A;  1XMO T;  1YKH B;  4CI2 B;  2YOE A;  4X1Y E;  3TLV A;  4DR5 T;  2UU9 T;  1V9D A;  5AQR B;  1MIY A;  4L9I A;  2C0S A;  2XSA A;  2VKJ A;  5FVL A;  2QGS A;  1T98 A;  3LBX B;  3T1Y T;  5FY1 A;  2UXD T;  1KF6 A;  2FUP A;  1NEN A;  5JVD E;  4IDP A;  3FXD B;  3UQ7 A;  3FBL A;  5AQG B;  2XAG B;  5HCJ A;  5L3G B;  4MLK A;  2CXF A;  2DL1 A;  4KHP T;  4XZC A;  4O4H E;  2D9D A;  2JQQ A;  2CMR A;  1SHZ C;  1UX5 A;  5JH7 E;  4YSZ A;  2N1G A;  2XM1 A;  5LHG B;  1SA0 E;  3ZMU B;  2VVS A;  3ZC1 A;  5JDL A;  3CX8 B;  1S35 A;  2ZLY A;  3LJC A;  3EAM A;  3CWZ B;  2BDE A;  4IDO A;  3ZT6 A;  2YN6 A;  1HNW T;  3UTK A;  1J1J A;  2YIN A;  2WWU A;  4HTE A;  2LRK A;  2VVN A;  3X1D A;  2NWB A;  4KX6 A;  5HXE A;  4H63 V;  3UU3 A;  4DND A;  5L3B B;  2ES0 A;  2IAK A;  2Y48 B;  3EDU A;  5BMV E;  1Y01 A;  3OTO T;  1LVK A;  2LKH A;  5TAO A;  1VOM A;  3J7Y q;  1T72 A;  3P8C D;  2X0L B;  4MFR A;  4X64 T;  1HS7 A;  4G2A A;  4YHJ A;  3OKQ A;  1OED B;  4IE6 A;  2X9Y A;  3IBP A;  1WLX A;  4O4J E;  5F3J A;  2MOZ A;  3QUJ A;  1MMG A;  1BR4 A;  3RH3 A;  4L0R A;  4DV1 T;  3RYC E;  3ZMT B;  4ONR A;  3C51 A;  2J47 A;  4DV4 T;  2JQH A;  3AE9 A;  3T8O A;  4ZZC A;  2C5I T;  5LNK A;  1XZY A;  1OED E;  4X1I E;  3DP7 A;  4AKL A;  2KXP B;  5AQV B;  2Y8D A;  4LFA T;  1HR0 T;  3ZMZ B;  3A8Y C;  3RYI E;  3D0T A;  3ZT5 A;  3PJA J;  4PK4 A;  2LSY A;  4UR9 A;  2CM0 A;  3RYF E;  3RPU A;  3SWH A;  3K1S A;  4PFP A;  2XM2 A;  2LSI A;  4DV3 T;  4U3C A;  4KMC A;  2N2N A;  1OED C;  1VRB A;  3O1I A;  3L09 A;  3KVB A;  1YXR A;  3UU5 A;  5GON E;  5BR8 T;  2KGX A;  3VJZ A;  1UCU A;  2V1D B;  4H9P C;  2CHO A;  2W67 A;  3LK3 B;  3RYH E;  2QA7 A;  4A98 A;  5T1D A;  1HNX T;  2D0T A;  2A2F X;  3CKD A;  2VKO A;  4IGU A;  2MYS A;  3N2K E;  4YJ3 E;  2KZ7 B;  3FXE B;  5FYM A;  3AA0 B;  3RKO A;  2WP9 A;  2M6I A;  4YXD A;  4IDQ A;  3OBV E;  2UXX B;  4LF6 T;  3KBT A;  4JI5 T;  4YT0 A;  5LP6 E;  3RC3 A;  4C90 A;  2BS4 A;  4DR2 T;  2WS3 A;  4C91 A;  4EIW A;  1LVF A;  3AE3 A;  4K0U A;  2BG9 B;  2H7V C;  5FNV E;  4GYS A;  3B13 A;  3WUR A;  4UVC B;  3M3Z B;  1E7P A;  3CPZ A;  2Z6E A;  2M67 A;  4ZZB A;  3JC6 D;  4LF9 T;  3F31 A;  2MPK A;  5ABH A;  2J4G A;  2D0U A;  4AQF A;  1MMN A;  3O1H A;  3PUA A;  4HFV A;  2BG9 E;  2ZM6 T;  3CX7 B;  4WBO A;  5HEO A;  3E08 A;  3W15 B;  3IHR A;  3P4S A;  4LF8 T;  4ILC A;  5L47 A;  4WW0 A;  2W00 A;  4PAG A;  3EVY A;  3AY5 A;  3AAI A;  4QH1 A;  3RIU C;  2BBH A;  3C50 A;  2MAW A;  3EI0 A;  4BA9 A;  5HWY A;  3AE6 A;  1US7 B;  3R84 B;  2FJB A;  1XMQ T;  2Q9Q A;  4JI4 T;  1M7K A;  3AA6 B;  3G06 A;  5M4Y A;  2UXN B;  2C5J A;  5ADX L;  3TLW A;  3B57 A;  2CWY A;  2E5L T;  3AEC A;  4EZ4 A;  2PFV A;  3A7M A;  2YK0 A;  2XQ8 A;  3KV5 A;  5ABE A;  1HG5 A;  3KBU A;  2UXC T;  5HXH A;  3GN5 B;  1H7C A;  2YU2 A;  4WYV A;  1MIW A;  4IE7 A;  4B3S T;  2LSK A;  3TLT A;  2RP4 A;  3FBZ A;  5AQM B;  3AE7 A;  3QB5 K;  2NW8 A;  2X9H A;  4EGW A;  2X68 A;  4N78 D;  3NZQ A;  2MTC A;  1HCI A;  1D0Z A;  2EHO D;  4ILA A;  1N36 T;  1WR6 A;  2DNX A;  3CQG B;  4YTN A;  5L4H A;  1EZ3 A;  1X9B A;  2F4V T;  2JQK A;  3JC6 C;  3S4U A;  2B76 A;  5CA1 E;  3AB3 B;  3UQ4 A;  1MMD A;  3UUN A;  1Z0P A;  3QNU A;  4DR4 T;  2IC6 A;  3EAB A;  2KWH A;  4HFI A;  3KIN B;  1UUS A;  1FIO A;  2H89 A;  2WDV A;  1ZKE A;  4Q25 A;  4EYY R;  4JI2 T;  2JQ9 A;  5L3C B;  4ZOL E;  4LML A;  2XY8 B;  5LXT E;  2WQY A;  4CN6 A;  4QH5 A;  3VKG A;  4DV2 T;  5HXR A;  2K9A A;  4DUZ T;  4DV6 T;  1XWM A;  4HKA A;  2JMH A;  5AQS B;  4YSX A;  1KEY A;  3PV0 F;  5AQU B;  3PTR B;  4HWI B;  3PUQ A;  3UU4 A;  3N2O A;  1ZHC A;  5DJQ C;  3LDQ B;  4IRE A;  4LMK A;  3IF8 B;  5KX5 E;  4NUU A;  4AIU A;  5FVK A;  3MKD A;  2XAH B;  3F57 A;  4CXY A;  4BGO A;  4TUY E;  3RX6 A;  2L8K A;  1N32 T;  4UV8 B;  4QX7 B;  2CXL A;  2KVP A;  4DR1 T;  4IDZ A;  4U72 A;  2L7N A;  3Q2M A;  3AEA A;  4H9O C;  4H9S E;  3GA8 A;  4LMJ A;  3SFD A;  3DTO A;  5KMG P;  4YTP A;  4GK0 E;  4UVA B;  3VR8 A;  4PFO A;  5JR9 B;  4OX9 T;  4HFD A;  3N9P A;  3NRY A;  1LRZ A;  2EHO C;  5DQV A;  2XQ4 A;  3VU7 H;  4PW8 A;  4KBM B;  2D5U A;  5AQF B;  2A72 A;  2W4X A;  3N5L A;  1HNZ T;  3SS1 A;  3KDS E;  2IDO B;  1WCR A;  3E0Z A;  5FZT A;  3N9N A;  2LKG A;  2BS2 A;  4M1P A;  2N9D A;  2EHO A;  5IHY A;  1KNZ A;  4X62 T;  2WB5 A;  4AI6 A;  3CML A;  1D0Y A;  5H6R B;  3FZM B;  4I0U A;  1YW0 A;  4CZZ B;  2LQU A;  4CXX A;  1VCT A;  4V1A v;  2OA5 A;  3EUH A;  5AQJ B;  5JR9 C;  5JDG A;  4CI3 B;  2E8I A;  4P1N A;  5LGN B;  3HKC E;  2LM2 A;  4JLE A;  4X1K E;  3Q5D A;  3AXJ B;  3ZYL A;  3PHF 1;  4B3T T;  4GIW A;  4JEU B;  4UEM A;  1NEK A;  5IWA T;  2C5K T;  5HYA A;  3RC8 A;  2J1D G;  5LA6 E;  3ETU A;  3MJX A;  4FI5 A;  3O1J A;  2CXD A;  1IBM T;  4YSY A;  1YQ3 A;  2BVL A;  3BQI A;  4JI3 T;  4LF7 T;  4U33 A;  5JDF A;  1T8B A;  2VKD A;  3V5S A;  4MBQ A;  1Z8U A;  1QSD A;  4BAY B;  4U7Y A;  3VRB A;  4HWF A;  3HR0 A;  3KV4 A;  1B7T A;  3PUX F;  2HHH T;  3JCF A;  4DBQ A;  2WZH A;  2QYW A;  4MAL A;  3A5X A;  2W62 A;  4NXM T;  2LOP A;  3RQW A;  3PDY A;  1IZN B;  4HFE A;  3TKL B;  2D2S A;  3ZSS A;  3WAJ A;  2WY2 A;  3AEE A;  3ZN1 B;  4NPP A;  2V6X A;  4GOU A;  1NAF A;  1UUR A;  3H3A A;  2XAJ B;  2DLR A;  5JRE A;  4H9Q C;  2LLY A;  2LM9 A;  4IDN A;  5ABF A;  3ONL C;  4IE5 A;  4HFB A;  4TV9 E;  1ZOY A;  2VAS A;  2A3D A;  3RKG A;  2DCF A;  5L3F B;  3KV9 A;  2V7L A;  3AT7 A;  4X65 T;  3K3Q C;  3PUY F;  3FZH B;  4WZX A;  3RRC A;  4QXH B;  3L3P A;  1OWA A;  2JJ9 A;  2KND A;  4TZ4 C;  2WMN A;  3ZMS B;  3ZKR A;  5JRC B;  4UF0 A;  4HWD A;  1HFA A;  3AA7 B;  3UUM A;  2ODU A;  4L5G A;  2E5V A;  4ADZ A;  3MK7 C;  3ZYM A;  5LHI B;  3P4P A;  1XDO A;  2V8S V;  3WSC A;  2WWV A;  3AEG A;  2BVM A;  2V7I A;  3AVR A;  3RQU A;  5EZY E;  5HEH A;  4DUY T;  3HKB E;  4OYJ A;  5HEJ A;  5IYZ E;  4DMW A;  2IUB A;  3FZL B;  1D0X A;  4UEL A;  4LF4 T;  4XBF B;  3LK2 B;  1OXZ A;  2CHN A;  5FL1 A;  2XQA A;  2AE9 A;  1KK7 A;  3ONX A;  2YU1 A;  4CQI A;  3CK6 A;  3Q5X A;  4K0K T;  2FJD A;  3OPC A;  3CX6 B;  4NIQ A;  4QH4 A;  1OED A;  5JQG E;  5HXS A;  3NWI A;  3Q5W A;  2DWK A;  4GKJ T;  2J62 A;  1O3X A;  1HG2 A;  4ZEY A;  2VL8 A;  3TLU A;  2KLQ A;  4JI8 T;  3K3N A;  4IIJ E;  3RRW A;  4TX5 A;  3FB2 A;  3ZN0 B;  2CBJ A;  2NOX A;  2YDS A;  3UFE A;  4QXB B;  5LMN T;  5LBQ B;  2BZB A;  5J2T E;  1D1C A;  3UFG A;  2CE7 A;  1QLB A;  1GQE A;  2XHE B;  1UX4 A;  3JAE A;  4JI7 T;  1CUN A;  2BKO A;  2BBJ A;  2BS3 A;  3B5M A;  3N9M A;  4KI0 F;  4U74 A;  4ZI3 C;  5AQN B;  4EB6 E;  4A97 A;  4HGA A;  2V5D A;  4O4L E;  4EYU A;  2K3W A;  4JV5 T;  1HX1 B;  4HE8 A;  2JIW A;  5F5W A;  3AE2 A;  3VKH A;  2XZE A;  4QKN A;  5J0Z A;  1NWM X;  3I0O A;  2BG9 C;  4HWH A;  3GWH A;  4ZI7 E;  4EOZ B;  2CWO A;  2UUB T;  5C2T A;  4DV7 T;  2KT9 A;  3RIU A;  3SFE A;  4DID B;  1JNR A;  1BR1 A;  3NVO A;  3ANW A;  1E1H B;  1FEW A;  1MND A;  2V7J A;  5AQL B;  3PF0 A;  5FP3 A;  1HF8 A;  3PUG A;  2WDR A;  4YLH A;  3AEB A;  2AXD S;  2CA5 A;  4PJJ A;  5AQP B;  3AA1 B;  4Z91 A;  2OV9 A;  5AQK B;  2VWA A;  4F8H A;  5AQT B;  2WCA A;  2DI4 A;  4TWD A;  2XQ7 A;  2HN2 A;  1I6Z A;  4DVD A;  1Y64 B;  4P09 A;  5LG3 A;  2LRL A;  2YDR A;  5EK4 A;  5L3D B;  2L10 A;  5A1L A;  3K3O A;  4I43 B;  3UUL A;  3CIR A;  4DR7 T;  4GKK T;  2VUR A;  5LG4 A;  1IBK T;  2E9X B;  5LB7 B;  4COF A;  3M65 A;  2HH7 A;  3ZST A;  4EAH A;  4OHF A;  5KXJ A;  1ZEE A;  2V6Y B;  4AIS A;  3HI2 A;  5JDM A;  4DR6 T;  2NR4 A;  4F7G B;  3OVU A;  3R6N A;  4EV6 A;  4IT4 A;  5CJ5 A;  1YKE B;  2OLT A;  2W2U A;  3NZP A;  2VQF T;  4YHH T;  2I0M A;  1ZV4 X;  4A56 A;  3LSV A;  3H37 A;  2K24 A;  2V7K A;  4JI6 T;  2CPT A;  3GN5 A;  3CQX C;  2MTQ A;  3MZK B;  2LT3 A;  5LCY A;  4PJM A;  2VK9 A;  3RF1 A; 
#chains in the Genus database with same CATH homology
 3AAA B;  3RYI E;  3D0T A;  3EUH A;  4BJM A;  3J9X 1;  4QHO A;  4ERR A;  4E7Z A;  4I4T E;  2ZMA A;  2LSY A;  4PK4 A;  5JR9 C;  5H6Q B;  5JDG A;  3CVR A;  2CM0 A;  4CI3 B;  2E8I A;  3RYF E;  3AVS A;  5EK3 A;  3RPU A;  3VHL A;  3ZC0 A;  5LGN B;  3HKC E;  3QC9 A;  2E9X D;  3SWH A;  4JLE A;  3ZCI A;  4PFP A;  3BK9 A;  2DHR A;  4X1K E;  2LSI A;  3V5U A;  4JEH B;  1WRD A;  3ZYL A;  3PHF 1;  1G73 A;  5LYJ E;  2KWI B;  4GIW A;  4JEU B;  4KMC A;  2N2N A;  4ISS A;  4UEM A;  4ZI2 D;  4AKH A;  1VRB A;  3LK4 2;  3O1I A;  2PBI A;  5J1G A;  2SPC A;  3L09 A;  3UT5 E;  3KVB A;  4O4I E;  2C5K T;  5HYA A;  3RC8 A;  5GON E;  2J1D G;  1YD8 G;  4E7S A;  5LA6 E;  4IE0 A;  5LOV E;  1IAP A;  3ETU A;  3OYZ A;  4OYK A;  4ZI2 C;  3VJZ A;  1UCU A;  2LSJ A;  3C4Z A;  2NW7 A;  4FJO A;  2V1D B;  4H9P C;  2JMK A;  5CB4 E;  3MJX A;  4FI5 A;  3LK3 B;  2JRK A;  2CXD A;  3O1J A;  3RYH E;  2QA7 A;  1BR0 A;  5T1D A;  3M1C A;  2D0T A;  2A2F X;  2BVL A;  3BQI A;  3CKD A;  2VKO A;  4IGU A;  3MA9 A;  2MYS A;  5JDF A;  1AJ3 A;  3N2K E;  4ZS3 A;  4YJ3 E;  2KZ7 B;  1FMV A;  2VKD A;  4Z8X A;  3V5S A;  3FXE B;  1HTJ F;  4MBQ A;  5FYM A;  3AA0 B;  2WBL A;  4AXP A;  3RKO A;  1QSD A;  3WAK A;  3KVA A;  4BAY B;  3HR0 A;  3KV4 A;  1B7T A;  2NW9 A;  5E0O A;  3I1A A;  3OBV E;  4O8S A;  2UXX B;  2WSS V;  3KBT A;  4DBQ A;  4MAL A;  2PG8 A;  3A5X A;  2W62 A;  2B1E A;  2LOP A;  3IEE A;  4OFZ A;  5LP6 E;  2V26 A;  1D1A A;  3RC3 A;  4C90 A;  5JDH A;  3PDY A;  2CEA A;  3I9Y A;  1IZN B;  2DWG A;  3TKL B;  3ZJ1 A;  2D2S A;  1LVF A;  4UV9 B;  4C91 A;  4EIW A;  3WAJ A;  5FXZ A;  4K0U A;  3I9W A;  5DQW A;  2CLY B;  2H7V C;  3ETV A;  5FNV E;  4GYS A;  3ZN1 B;  3B13 A;  2V7M A;  3WUR A;  5DAB A;  4UVC B;  3ZLI A;  4GOU A;  1NAF A;  4OK0 A;  3H3A A;  3SOL A;  1G8X A;  3NRX A;  3U3I A;  3CPZ A;  2XAJ B;  2Z6E A;  2DLR A;  5AFU L;  5JRE A;  2M67 A;  4H9Q C;  2W63 A;  4QX8 B;  3PUR A;  3JC6 D;  4X20 E;  5F8P A;  2LM9 A;  3F31 A;  3N9Q A;  4H9R C;  4IE4 A;  4IE5 A;  2D0U A;  1U5P A;  4AQF A;  4H9N C;  1MMN A;  3O1H A;  3I0Q A;  4TV9 E;  3PUA A;  4HFV A;  4IST A;  2VAS A;  2A3D A;  5FY7 A;  3CX7 B;  2DCF A;  4WBO A;  3U78 A;  5L3F B;  3KV9 A;  2V7L A;  3E08 A;  2XUE A;  3IHR A;  4G63 A;  3W15 B;  1FMW A;  3N9L A;  3O4X E;  3AT7 A;  5FXV A;  4AKG A;  3K3Q C;  2HPJ A;  3RRC A;  4DBR A;  4WW0 A;  4QXH B;  2W00 A;  4PAG A;  3L3P A;  1OWA A;  2JJ9 A;  3EVY A;  5EK2 A;  2KND A;  4TZ4 C;  2WMN A;  3ZMS B;  4ILU A;  3C64 A;  3HA4 A;  4CXW A;  3SRZ A;  2XAQ B;  5FY0 A;  3AAI A;  4PNI A;  5JRC B;  4UF0 A;  3C50 A;  4BA9 A;  5HWY A;  3CQC B;  2LSG A;  3E22 E;  1QUU A;  3ZPO A;  1HFA A;  3AA7 B;  3AAE B;  3UUM A;  2ODU A;  1US7 B;  4L5G A;  5FXW A;  3R84 B;  4ADZ A;  5LJM A;  2Q9Q A;  3MK7 C;  3ZYM A;  5LHI B;  3AA6 B;  4I55 E;  4XAX B;  5M4Y A;  2UXN B;  3C4W A;  2C5J A;  1IJ5 A;  4F6R C;  5ADX L;  3WSC A;  5C8Y E;  3HL6 A;  2NP9 A;  2BVM A;  2CLY C;  2E9X C;  2V7I A;  3B57 A;  5HXC A;  2CWY A;  2MBG A;  2EHO B;  2XTL A;  4EZ4 A;  2LEH A;  3AVR A;  1HX8 A;  2PFV A;  5EZY E;  4O2B E;  3F2E A;  3O9X A;  2ODV A;  2YK0 A;  3KV5 A;  3HKB E;  3NBX X;  4OYJ A;  4UVB B;  5CA0 E;  1HG5 A;  5IYZ E;  5JR9 A;  2K48 A;  3KBU A;  2L9Q A;  4DMW A;  5HXH A;  3GN5 B;  5J2U E;  4GYR A;  1MMA A;  1H7C A;  4IHJ E;  2ZM2 A;  1D0X A;  4JUY A;  4UEL A;  3KFW X;  4XBF B;  3LFM A;  4ANJ A;  3LK2 B;  1OXZ A;  2H3R A;  2NTX A;  1KK7 A;  2YU2 A;  3ONX A;  4UF0 B;  2G0U A;  2YU1 A;  4GK5 E;  4CQI A;  1MIW A;  3Q5X A;  4P0A A;  2E9X A;  3K8P C;  3GMI A;  3CX6 B;  4HEA A;  2P9B A;  3ZCJ A;  3PUS A;  3QK6 A;  4IE7 A;  3ZYK A;  3P7I A;  3FHN A;  2LSK A;  1IJ6 A;  1U4Q A;  5JQG E;  2NTY A;  5HXS A;  5FXX A;  3EDV A;  3Q5W A;  3LBX A;  4ASK A;  2RP4 A;  2X51 A;  3FBZ A;  4ECG A;  1X79 A;  2NW8 A;  4WBN E;  2DWK A;  2W0G A;  5FMN A;  1O3X A;  1HG2 A;  5LJN A;  2ZM0 A;  2X9H A;  2VL8 A;  2X9W A;  4PK6 A;  5LGT B;  2IC9 A;  2KMF A;  2KLQ A;  3OYX A;  3ESL A;  2RA1 A;  2X68 A;  4PJN A;  3K3N A;  4IIJ E;  4N78 D;  3RRW A;  3ZMV B;  3NZQ A;  2GK9 A;  4TX5 A;  2MTC A;  4B6X A;  2ZM8 A;  1HCI A;  2LE8 A;  4I50 E;  3FB2 A;  3ZN0 B;  1D0Z A;  3C98 B;  3PU3 A;  4WNK A;  2EHO D;  2X66 A;  4KP3 C;  4ZHQ E;  2NOX A;  3UFE A;  2I59 A;  4PJL A;  4QXB B;  2PJQ A;  1WR6 A;  2W61 A;  2DNX A;  2XAS B;  3CQG B;  3PU8 A;  5LHH B;  2WAU A;  1YKH B;  4CI2 B;  4X1Y E;  5LBQ B;  3ZEF B;  2BZB A;  1V9D A;  4UXN B;  1EZ3 A;  5J2T E;  1D1C A;  1MIY A;  4L9I A;  2C0S A;  3JC6 C;  2XQY A;  3S4U A;  2CE7 A;  2VKJ A;  2XHE B;  5CA1 E;  3AB3 B;  1MMD A;  1UX4 A;  2QGS A;  1T98 A;  2LJL A;  3UUN A;  1Z0P A;  1CUN A;  3LBX B;  5HWX A;  2VKH A;  5FY1 A;  3N9O A;  2IC6 A;  4ZI3 D;  2KWH A;  4O2A E;  4CI1 B;  3N9M A;  2Q9Q D;  5JVD E;  3OJA A;  3PE0 A;  3BQL A;  3FXD B;  3KIN B;  4U74 A;  3FBL A;  4ZI3 C;  4BJN A;  1FIO A;  2XAG B;  4EB6 E;  4AQG A;  5L3G B;  1ZKE A;  2JPF A;  1WYC A;  2XAF B;  4EYY R;  5LGU B;  4HGA A;  4J2C A;  4MLK A;  2CXF A;  5L3C B;  4O4L E;  4ZOL E;  4EYU A;  4MHC A;  4AKR B;  4XZC A;  5LXT E;  4HE8 A;  4HN9 A;  4O4H E;  4NUV A;  5L2L A;  2JQQ A;  2WMO A;  2CMR A;  1SHZ C;  1UX5 A;  3VKG A;  3VKH A;  4QKN A;  2ACX A;  4PK5 A;  5HXR A;  2K9A A;  4HKA A;  2JMH A;  5JH7 E;  1NWM X;  3I0O A;  2N1G A;  3GWH A;  4QWN B;  4ZI7 E;  4EOZ B;  5LHG B;  1SA0 E;  4YJ2 E;  2H7O A;  2CWO A;  3ZMU B;  2X9X A;  2HPL A;  3ZC1 A;  5JDL A;  2K5B B;  1MIV A;  2KT9 A;  3MXZ A;  3PTR B;  3PUQ A;  3KV6 A;  3CX8 B;  1S35 A;  3N2O A;  3WI3 A;  2ZLY A;  2YEV C;  5ETW A;  3LJC A;  4YFS A;  1BR1 A;  1ZHC A;  3ANW A;  5DJQ C;  1E1H B;  3CWZ B;  1FEW A;  1MND A;  2BDE A;  3MAC A;  1WYB A;  5LBM A;  3BQK A;  2V7J A;  3IF8 B;  3HKE E;  4ZS2 A;  3UTK A;  3PF0 A;  5KX5 E;  1MNE A;  5FP3 A;  3ZJ2 A;  1HF8 A;  3PUG A;  4NUU A;  4YLH A;  2YIN A;  2X67 A;  2CA5 A;  2WWU A;  4HTE A;  3MKD A;  4DO0 A;  2XAH B;  3F57 A;  4PJJ A;  4CXY A;  2Q9Q B;  4BGO A;  3AA1 B;  4TUY E;  3RX6 A;  2L8K A;  2VWA A;  4EXT A;  1S94 A;  4H63 H;  4UV8 B;  3Q9D A;  4QX7 B;  2DI4 A;  2CXL A;  4TN7 B;  3UUX B;  4EZH A;  4AKI A;  1BR2 A;  4IDZ A;  4U72 A;  3HKD E;  3Q2M A;  2NWB A;  4H9O C;  5HXE A;  4H9S E;  3GA8 A;  1Y64 B;  4P09 A;  4DVD A;  3DTO A;  5KMG P;  4H63 V;  5EK4 A;  4DND A;  4GK0 E;  2LHR A;  4UVA B;  5L3B B;  2ES0 A;  2IAK A;  2Y48 B;  3EDU A;  5BMV E;  4PFO A;  5JR9 B;  3LG7 A;  3ANW B;  5L3D B;  1LVK A;  5TAO A;  3N9P A;  1VOM A;  5A1L A;  3J7Y q;  3K3O A;  3NRY A;  2IW5 B;  1LRZ A;  4QXC B;  3P8C D;  2X0L B;  4P0B A;  4I43 B;  4AQF C;  2EHO C;  5DQV A;  2Y6X A;  3N2G E;  3UUL A;  5JDQ A;  4MFR A;  3VU7 H;  5LG4 A;  4PW8 A;  1HS7 A;  2E9X B;  4KBM B;  4G2A A;  2D5U A;  3M65 A;  4YHJ A;  2HH7 A;  3OKQ A;  4IE6 A;  2A72 A;  4EAH A;  2X9Y A;  4OHF A;  5JRC A;  1ZEE A;  3N5L A;  3IBP A;  3HI2 A;  3SS1 A;  5JDM A;  5L3E B;  3DJB A;  3KDS E;  2LOS A;  1WLX A;  4O4J E;  5F3J A;  2MOZ A;  3QUJ A;  1MMG A;  1D1B A;  3E0Z A;  3R6N A;  3N9N A;  1BR4 A;  1YKE B;  4UIG A;  5JDN A;  3RH3 A;  2KIN B;  4M1P A;  5KDM C;  2N9D A;  2EHO A;  3NZP A;  4L0R A;  4DMV A;  2LHN A;  5IHY A;  2Q9Q C;  3RYC E;  3ZMT B;  1KNZ A;  4ONR A;  3C51 A;  1ZV4 X;  4A56 A;  3H37 A;  3T8O A;  4AI6 A;  2VB6 A;  2C5I T;  3CML A;  2K24 A;  5LNK A;  2V7K A;  1D0Y A;  5H6R B;  2L3L A;  2WM9 A;  4X1I E;  1YW0 A;  4KUM B;  4TV8 E;  3DP7 A;  5HAX A;  4AKL A;  4CZZ B;  3GN5 A;  3C4X A;  3CQX C;  2LQU A;  2KXP B;  2MTQ A;  1LKX A;  3MZK B;  2LT3 A;  2Y8D A;  5LCY A;  4CXX A;  4V1A v;  4PJM A;  2CCQ A;  2VK9 A;  3ZMZ B;  2OA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...