3DNXA

Spo1766 protein of unknown function from silicibacter pomeroyi.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
146
structure length
146
Chain Sequence
LDLQPGQRLARGVARHLRAHGFVSVEEFVPARGLRVDVMGLGPKGEIWVIECKSSRADFQADAKWQGYLEWCDRYFWAVDMEFPAELLPAESGLLIADAYDAEIVRMAPEQKLAPARRKVLIQKFATHAARRLQALRDPEGHGIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of SPO1766 protein of unknown function from Silicibacter pomeroyi.
rcsb
source organism Silicibacter pomeroyi
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein SPO1766
total genus 42
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06319 MmcB-like DNA repair protein MmcB-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1350.10 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 3dnxA00
1GEFA 2ZYZB 2FCOA 4TKKA 3P1ZB 2WJ0A 1A79A 3AJVA 5FDKA 1HH1A 1RZNA 3P1ZA 1OB9A 4TKDA 3DNXA 1F1ZA 1ZP7A 3P1YA 2EO0A 2WCZA 1XMXA 4QBLA 2ZYZA 2WIWA 4QBNA 2WIZA 2GJWA 1R0VA 1RLVA 2WCWA 1R11A 2GW6A 2OKFA 3FOVA 2CV8A 1Y88A 1T0FA 3AJVB 3IEYA 1OB8A 1IPIA 1Y1OA 2VLDA 4QBOA 2OSTA 2INBA
chains in the Genus database with same CATH superfamily
1GEFA 2ZYZB 2FCOA 2IXSA 4TKKA 4DA2A 3P1ZB 2WJ0A 1A79A 3IF0X 3BT7A 3AJVA 5FDKA 2FKHB 3IEYB 1HH1A 1RZNA 3P1ZA 1OB9A 4TKDA 4E6ZA 4DAVA 2FL3A 3DNXA 1F1ZA 1ZP7A 3P1YA 4DAPA 2EO0A 2WCZA 1XMXA 4QBLA 2ZYZA 2FKCA 2CZRA 2WIWA 4QBNA 2FLCA 2WIZA 2GJWA 1R0VA 1RLVA 4G6UA 2VS1A 2WCWA 1R11A 2GW6A 2BH2A 2JJQA 2OKFA 4LQEA 4G6VA 3FOVA 2CV8A 1Y88A 1T0FA 3AJVB 3IEYA 1OB8A 1IPIA 2DBSA 1Y1OA 4ZQUA 2VLDA 4QBOA 2INBA 4EV1A 1UWVA 2OSTA 1YNMA 2W8MA 2Z0RA
chains in the Genus database with same CATH topology
1GEFA 2ZYZB 2FCOA 2IXSA 4TKKA 4DA2A 3P1ZB 2WJ0A 1A79A 3IF0X 3BT7A 3AJVA 5FDKA 2FKHB 3IEYB 1HH1A 1RZNA 3P1ZA 1OB9A 4TKDA 4E6ZA 4DAVA 2FL3A 3DNXA 1F1ZA 1ZP7A 3P1YA 4DAPA 2EO0A 2WCZA 1XMXA 4QBLA 2ZYZA 2FKCA 2CZRA 2WIWA 4QBNA 2FLCA 2WIZA 2GJWA 1R0VA 1RLVA 4G6UA 2VS1A 2WCWA 1R11A 2GW6A 2BH2A 2JJQA 2OKFA 4LQEA 4G6VA 3FOVA 2CV8A 1Y88A 1T0FA 3AJVB 3IEYA 1OB8A 1IPIA 2DBSA 1Y1OA 4ZQUA 2VLDA 4QBOA 2INBA 4EV1A 1UWVA 2OSTA 1YNMA 2W8MA 2Z0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GEF A;  2ZYZ B;  2FCO A;  4TKK A;  3P1Z B;  2WJ0 A;  1A79 A;  3AJV A;  5FDK A;  1HH1 A;  1RZN A;  3P1Z A;  1OB9 A;  4TKD A;  3DNX A;  1F1Z A;  1ZP7 A;  3P1Y A;  2EO0 A;  2WCZ A;  1XMX A;  4QBL A;  2ZYZ A;  2WIW A;  4QBN A;  2WIZ A;  2GJW A;  1R0V A;  1RLV A;  2WCW A;  1R11 A;  2GW6 A;  2OKF A;  3FOV A;  2CV8 A;  1Y88 A;  1T0F A;  3AJV B;  3IEY A;  1OB8 A;  1IPI A;  1Y1O A;  2VLD A;  4QBO A;  2OST A;  2INB A; 
#chains in the Genus database with same CATH topology
 1GEF A;  2ZYZ B;  2FCO A;  2IXS A;  4TKK A;  4DA2 A;  3P1Z B;  2WJ0 A;  1A79 A;  3IF0 X;  3BT7 A;  3AJV A;  5FDK A;  2FKH B;  3IEY B;  1HH1 A;  1RZN A;  3P1Z A;  1OB9 A;  4TKD A;  4E6Z A;  4DAV A;  2FL3 A;  3DNX A;  1F1Z A;  1ZP7 A;  3P1Y A;  4DAP A;  2EO0 A;  2WCZ A;  1XMX A;  4QBL A;  2ZYZ A;  2FKC A;  2CZR A;  2WIW A;  4QBN A;  2FLC A;  2WIZ A;  2GJW A;  1R0V A;  1RLV A;  4G6U A;  2VS1 A;  2WCW A;  1R11 A;  2GW6 A;  2BH2 A;  2JJQ A;  2OKF A;  4LQE A;  4G6V A;  3FOV A;  2CV8 A;  1Y88 A;  1T0F A;  3AJV B;  3IEY A;  1OB8 A;  1IPI A;  2DBS A;  1Y1O A;  4ZQU A;  2VLD A;  4QBO A;  2INB A;  4EV1 A;  1UWV A;  2OST A;  1YNM A;  2W8M A;  2Z0R A; 
#chains in the Genus database with same CATH homology
 1GEF A;  2ZYZ B;  2FCO A;  2IXS A;  4TKK A;  4DA2 A;  3P1Z B;  2WJ0 A;  1A79 A;  3IF0 X;  3BT7 A;  3AJV A;  5FDK A;  2FKH B;  3IEY B;  1HH1 A;  1RZN A;  3P1Z A;  1OB9 A;  4TKD A;  4E6Z A;  4DAV A;  2FL3 A;  3DNX A;  1F1Z A;  1ZP7 A;  3P1Y A;  4DAP A;  2EO0 A;  2WCZ A;  1XMX A;  4QBL A;  2ZYZ A;  2FKC A;  2CZR A;  2WIW A;  4QBN A;  2FLC A;  2WIZ A;  2GJW A;  1R0V A;  1RLV A;  4G6U A;  2VS1 A;  2WCW A;  1R11 A;  2GW6 A;  2BH2 A;  2JJQ A;  2OKF A;  4LQE A;  4G6V A;  3FOV A;  2CV8 A;  1Y88 A;  1T0F A;  3AJV B;  3IEY A;  1OB8 A;  1IPI A;  2DBS A;  1Y1O A;  4ZQU A;  2VLD A;  4QBO A;  2INB A;  4EV1 A;  1UWV A;  2OST A;  1YNM A;  2W8M A;  2Z0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...