1Y88A

Crystal structure of protein of unknown function af1548
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
184
structure length
184
Chain Sequence
b'NLYFQGHMVARLLEEHGFETKTNVIVQGNCVEQEIDVVAERDGERYMIECKFHNIPVYTGLKEAMYTYARFLDVEKHGFTQPWIFTNTKFSEEAKKYAGCVGIKLTGWSYPEKEGIEVLLESKGLYPITILRIDKEVLDELVRAGLVFCRDVVSAGEEKLREIGLSAKKAREVIAEAKKVIGGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AF1548
publication title The crystal structure of hypothetical protein AF1548 from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 59
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2004-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1y88A02
3.40.1350.10 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 1y88A01
5HHIA 2WTFA 4BWMA 4EBCA 4BDPA 3PMLA 3OSPA 1NK4A 3AJVA 4RU9A 5KFUA 2HVHA 4DF8A 2C22A 4C8OA 1IPIA 4F91B 1TAQA 2HHSA 1EXNA 4Q8FA 5D46A 5KG3A 2CV8A 5KFYA 8ICRA 1IM4A 1GEFA 3RH5A 3T5LA 1BGXT 2NRTA 4BGDA 5CJ7A 5D4BA 3SI8A 2ZJ8A 1TK8A 2NRXA 4KN4A 3LWMA 3KHHA 5IIJA 2FPKA 3FYHA 1ZJMA 3C2LA 1RXVA 4FBUA 4JV1A 1CUKA 5KG7A 3GILA 2ASJA 3JPPA 5J2FA 4ELVA 3TI0A 3JPTA 3ETLA 3OHBA 5KFSA 4DL6A 1KLNA 7ICPA 3ISDA 3V6HA 1KDHA 1HH1A 4RQ0A 1SL0A 9ICVA 2ISPA 1HJPA 2JEFA 9ICXA 4QBOA 5CA7A 2C28A 4K4HA 3G6VA 4YMNA 2IHNA 4DSJA 8ICUA 3RRHA 4QZ8A 4DQRA 4JWMA 3C1ZA 5KFTA 3PW7A 8ICWA 4MFAA 4KLLA 5DG8A 4ECUA 5BOLA 4O3PA 3BQ2A 3ZDCA 5CB1A 1WCLA 3EYZA 3AU6A 2ALZA 1ZQDA 3PW4A 4NM2A 4BXOA 1UT8A 2XO7A 2WIZA 2KZMA 5KFBA 7ICVA 2UVVA 3JPOA 3V7JA 1UT5A 3H8SA 2JEGA 3ZDDA 4QZAA 5F9NA 1NKCA 4M9NA 7ICOA 4PHDA 1S76D 2ZYZB 1L3VA 1ZQJA 4DSEA 4DEZA 4Q8EA 8ICVA 9ICLA 2HW3A 4F3OA 4RQ2A 4QZIA 3AUOA 3QEBZ 1L3SA 4J9NA 1A79A 3H8WA 3PO5A 3NGDA 1TFRA 8ICPA 5DB8A 2RDJA 2WCWA 5DB7A 4DL3A 5KFKA 4TQSA 5FDKA 5HHHA 2INBA 4M9HA 4O9MA 1BPBA 4QWAA 2ZJ5A 3SV4A 4JWNA 2RDIA 4F4XA 2VA8A 3PX4A 8ICXA 4F4YA 4YN4A 3EW9A 2P66A 4TKDA 2FMQA 4FS2A 2BCVA 4DFMA 2R8GA 2FPLA 4F2RA 2ASLA 2ZTCA 4YVZA 5KFAA 1Z00B 2JZBB 4DL5A 3LDAA 1U4BA 4EYHB 1ZQRA 4QZFA 2J6UA 4QBNA 2B21A 4DS5A 4QWCA 2DPIA 3MDAA 4F93B 1IXRA 1ZQKA 1KFTA 1B43A 3P1ZA 2HHTA 9ICUA 3PV8A 1ZYQA 4R8UA 4RZRA 3M9NB 4NLNA 4RNNA 4UB1A 1ZQSA 2FMPA 2ZUDA 2NRZA 3HT3A 1WCNA 1X2IA 1AROP 9ICWA 4J9SA 1ZQPA 3GIKA 1S77D 3RJEA 5DBAA 5J0UA 2DPJA 4F5OA 4NM1A 3IM1A 2KN7A 3GV5B 4O3NA 4ECTA 2WCZA 5KFQA 2M9NA 4F5NA 1Z3EB 2C2RA 4K4GA 4ECRA 5KFVA 2V4RA 3ZDBA 3RJHA 1D9FA 2PFPA 1U45A 1TV9A 4Q43A 4UAZA 7ICFA 7ICNA 4KLIA 2HHUA 5KFXA 2PI4A 4O3SA 5BPCA 8ICEA 4IQVA 2FCOA 1MC8A 5HMMA 3MFHA 3LWLA 3QZ8A 1NKEA 4ELTA 5DQHA 4KN7A 3NTUA 4F50A 2BKEA 2FPMA 5KG4A 1ZQCA 5KFFA 5IINA 1QSSA 5DDYA 3GV7B 4RQ6A 2R8KA 4I2IA 8ICHA 2MUTB 1XMXA 5KFIA 1U9LA 1U48A 3AJVB 5IIIA 4UQGA 2LYHA 9ICNA 1X9SA 4EBDA 1OB9A 3RB3A 3C1YA 4ED8A 5KT6A 5EWEA 4YR3A 4R63A 2W9AA 4DL4A 4G3IA 9ICJA 3MR3A 4GC6A 3ISCA 4DS4A 3IHQB 4MFCA 4ED6A 8ICOA 2WJ0A 3AU2A 2C2EA 4Q44A 3RR7A 3B0XA 4J9QA 4M0AA 2KTQA 7ICEA 3H7IA 3V7KA 3BDPA 1SKRA 3TFRA 2A1JA 4M6WA 5DB9A 1NK5A 2AGPA 4I2BA 4KTQA 4DQPA 4UAWA 1UA0A 3RB4A 5KFDA 1LV5A 8ICMA 3BJYA 1R11A 4QZDA 4DOBA 5KT5A 3GIJA 4CCHA 1ZQEA 1ZQAA 1ZP7A 2BCSA 4ELUA 2BGWA 3RH6A 2J6SA 2Y1JA 4PGYA 4B9LA 4MEXA 4JV0A 4XA5A 4J9OA 3TAPA 4TUQA 1B22A 1NJYA 3T3FA 5TZVA 4BXOB 8ICLA 1TKDA 5KFEA 2F1HA 5HNKA 5L1KA 1T7PA 4M9LA 8ICNA 3M9OB 3Q8MA 3RAXA 8ICBA 4JK1A 5KFNA 4I2DA 4J9RA 2UVRA 4IR9A 2XY7A 1D8LA 2I9GA 9ICSA 2J6TA 5KFGA 3HWTA 1COOA 5J0PA 3ORYA 4ECSA 1NK8A 2FMSA 1BVSA 2C2DA 1MQ3A 4I2GA 9ICKA 1DOQA 2H5XA 1ZQIA 3Q8QB 5DBBA 8ICJA 5L1LA 1NK6A 4KLGA 5BOMA 1OB8A 2WIWA 3MABA 4YP3A 5KFHA 5J0TA 5J2CA 1NK7A 1S0OA 2ASDA 2PFQA 1TAUA 1ZQWA 4B9NA 7ICMA 3RB0A 4ECXA 3T5HA 1JN3A 4IRKA 2JEIA 4LZGA 3MDCA 1K1SA 5KT7A 4EBEA 4ED7A 4I2FA 1S9FA 3PX6A 4R65A 5DBCA 1ZQMA 4KLQA 2NRVA 4RT2A 3V7LA 8ICAA 4DSIA 3GQCA 8ICZA 5KFZA 3PX0A 4F5QA 8ICYA 2GW6A 4O5CA 3C2MA 1V9PA 3SYZA 2F1JA 5CHGA 4F8RA 1D8YA 2AJQA 4QZHA 2W8LA 2IBKA 3JPSA 1ZQUA 3UXPA 3P1ZB 4Z6DA 3JPNA 3Q8LA 3QEAZ 2OSTA 1D9DA 2BHNA 4YMMA 4GXKA 3BQTA 3H8JA 4DO9A 4DLGA 1ZQYA 5J0WA 1CEZA 4ED3A 3GIIA 2NRWA 2W9BA 4IQWA 3ZD8A 1TK5A 3GFKB 3V6JA 9ICHA 5J2BA 1S97A 2F1IA 4RQ3A 3PW2A 4PGQA 3M8SA 2P6UA 4PHPA 4F4KA 7ICQA 4IQTA 3TAQA 3Q8KA 4KLEA 2R8HA 5J2GA 1BPEA 1QSYA 1BPZA 4UB4A 1ZQOA 4B9MA 4B9VA 5KFPA 1R0VA 4YQWA 4B9UA 2ZJAA 4DOAA 4TKKA 4LVSA 5J2HA 7ICKA 3PMNA 4I29A 9ICMA 1TVAA 4DQQA 9ICTA 3MR6A 8ICSA 4C8NA 4DFKA 4R66A 4E0DA 3UQ0A 4YCXA 2KFNA 2PFOA 7ICSA 5KFCA 4QWDA 2FLNA 3PY8A 5CWRA 7ICHA 4RUCA 3QZ7A 2AU0A 4MF2A 2XY5A 4QWBA 4ECVA 2FLPA 4PGXA 4TURA 2I1QA 4I2JA 1MSWD 3OGUA 8ICKA 9ICCA 2XCPA 1T8EA 2W9CA 4XUSA 4UBBA 2FLLA 4Q45A 5J0OA 2IA6A 2PFNA 9ICEA 5KG0A 4ED1A 4KLHA 4RQ4A 1JX4A 1NOMA 5DQGA 3RAQA 1QLNA 5DLGA 1LB2B 4KLJA 2ZTDA 3HPOA 3PO4A 8ICCA 4F4ZA 3ZDAA 2HHXA 2BCRA 1BPXA 2PI5A 3RR8A 1DGSA 3RJGA 3UQ2A 5L9XA 1KFSA 1ZQBA 4Z6CA 3MR5A 4PPXA 1Y1OA 4B9TA 4IR1A 3P1YA 2ZUBA 4P4MA 5DLFA 2AGOA 2A1JB 1U47A 5DKWA 1ZQXA 1RZTA 1KSPA 3GDXA 4ECWA 2IMWP 4XQ8A 1Z00A 3GIMA 5DGBA 4O3OA 4EZ9A 3LK9A 2HHWA 8ICIA 1ZQGA 3H4BA 3FDSA 1A76A 4K4IA 3K75D 5KT3A 3TARA 1XS9D 3TFSA 2VLDA 5J0QA 4YXJA 5DG7A 1A77A 4RQ1A 1K1QA 4F5PA 4GXJA 3TANA 2AGQA 1T3NA 1NKBA 4PH5A 3BQ1A 4ECQA 7ICLA 3RBDA 3E2EA 4NLGA 3SZ2A 4PHEA 1S0MA 5KFLA 3EZ5A 3T5JA 2KZ3A 4YG2A 5J2IA 3Q8PB 5KFOA 3RTVA 5KTQA 1QTMA 3TQ1A 2PXIA 5DGAA 2BCUA 4NY8A 4R64A 1NJXA 2UVUA 3HX0A 7ICIA 2ISOA 4C8MA 4RQ5A 7ICUA 3G6XA 4ECYA 5IILA 2KZZA 1SZPA 2GWSA 1ZQFA 1PZNA 4O5EA 2XGPA 1ZQZA 3N4MB 4EEYA 4FBTA 1KRPA 1XO1A 4ECZA 1JIHA 2XY6A 3EPIA 4UB2A 5KFJA 2BQUA 1RYRA 4I28A 4KLDA 5J2KA 4X5VA 2MUTA 4YMOA 3B0YA 3UXNA 1XWLA 4QZBA 1SKSA 1SL2A 5KFMA 1SKWA 3OSNA 9ICGA 2XC9A 4MF8A 4DFJA 3THVA 4DSKA 4UBCA 4M47A 4M04A 4MFFA 2BPCA 4DSLA 4QZCA 5HMLA 4DL2A 3C5GA 2Q0ZX 4O3RA 7ICRA 4QZEA 1HUOA 4EYIB 1C7YA 4QZGA 2KFZA 2DFLA 5EOZA 4KLTA 4JUZA 8ICFA 3M8RA 4O0IA 8ICGA 9ICFA 1ZQVA 4IQUA 1ZQTA 1NK0A 4P4OA 4YR2A 3HW8A 4P4PA 4KLOA 5DB6A 4J9PA 8ICQA 4ED2A 3N97B 1BPDA 5J2AA 1X9MA 2W9BB 1X9WA 1MQ2A 3MFIA 2IHMA 4BWJA 7ICTA 5IIOA 3RB6A 1ZETA 3Q8SB 4DOCA 5IIMA 4M9GA 2HVIA 4FO6A 2BR0A 5EWFA 2BCQA 4JV2A 3H4DA 2GJWA 3RH4A 1ZJNA 4I2AA 2MAXA 3ZD9A 4R8UB 5L1IA 2XCAA 3PW0A 5KT4A 2R8JA 3EWAA 3RJFA 4QZ9A 5J29A 1NJWA 1NK9A 4QW8A 4I27A 4NLKA 4RT3A 3GV8B 1ZQHA 3PW5A 4KLFA 4YR0A 3FOVA 4YD2A 4EZ6A 1JXLA 2HHVA 3HP6A 4YD1A 5KG5A 1KTQA 4FS1A 2AQ4A 5KG6A 2BQRA 4J9KA 4KLUA 7ICJA 1TK0A 1H38A 4F5RA 4F4WA 3RBEA 4IRCA 3MBYA 2W9CB 4DQIA 4UAYA 4GXIA 3PR4A 3G6YA 4ED0A 2OKFA 5DG9A 1XSPA 4GC7A 3M9MB 1XSLA 3RJIA 1QSLA 2JEJA 4HYKA 1ZQNA 2ZYZA 2V4QA 2Y1IA 3RJKA 4GLXA 4PHAA 9ICQA 5JUMA 4M9JA 5C5JA 2AQ0A 3OHAA 4J9MA 4J9LA 1RYSA 2P6RA 4NXZA 3ISBA 1XC9A 2W9MA 3H40A 1N48A 1RXWA 2UVWA 4I2CA 1JMSA 1NJZA 1BPYA 1KFDA 3KHGA 5KFRA 5HP4A 1S0VA 1U49A 3KHLA 4O3QA 9ICIA 3UPQA 4QBLA 4KMUA 4I2HA 5J0SA 3RJJA 5KFWA 4KLMA 3C21A 5KT2A 4DQSA 2VA2A 4RPXA 4C8LA 7ICGA 1L3TA 2VANA 4DL7A 4RNOA 3MGHA 1JXEA 5J0RA 4QWEA 2R8IA 2BQ3A 4NLZA 9ICBA 9ICOA 1KEJA 5EWGA 2EO0A 1L5UA 4DFPA 2ZTEA 5KG2A 4TUSA 3PVXA 4LZDA 4M6WB 3OJSA 2BDPA 5J2JA 4IRDA 4O5KA 8ICTA 2JZBA 4B9SA 4RQ8A 4DF4A 4RQ7A 3PNCA 4Z6EA 4XRHA 2ZUCA 4Z6FA 4F92B 3OJUA 5J0YA 2V9WA 4F2SA 4MEYA 9ICAA 1L3UA 3JPRA 2BPFA 4DWIA 4I2EA 5CP2A 4RNMA 9ICRA 5F9LA 4RPZA 4TQRA 1T0FA 4TUPA 1ZQLA 4YXMA 2BPGA 3ZDEA 5D49A 3Q8RB 4C8KA 3EPGA 5DDMA 2W8KA 1HUZA 3V6KA 1T4GA 4UB5A 1RLVA 1SL1A 3C23A 1S0NA 3KTQA 1RPLA 3MR2A 3T5KA 3IEYA 2VA3A 3UXOA 3RRGA 4QW9A 4DLEA 3JPQA 5KG1A 1S10A 5L1JA 1UA1A 2OWOA 1XSNA 4M2YA 2ATLA 4KITB 3SV3A 1ZQQA 5DQIA 5CR0A 1F1ZA 4P2HA 1RZNA 4UB3A 4ZH4A 3DNXA 3PR5B 4YFKA 4DSFA 3QE9Y 1N56A 5J2EA 4RPYA 1Y88A 3KHRA 2HHQA 3MGIA 5J2DA 2XGQA 3V72A 1XU4A 3C5FA 4RUAA 5IIKA 3BQ0A 5J0XA 3C2KA 9ICPA 3K4GA 4KLSA
chains in the Genus database with same CATH superfamily
3ALRA 4UB8U 3AJVA 4RU9A 1QQ5A 5KFUA 4DF8A 1N5WA 4UATA 1TAQA 2HHSA 2FKHB 1EXNA 1DRGA 4Q8FA 8ICRA 3N7SC 1IM4A 3RH5A 3T5LA 4AYBC 4U6PA 4BGDA 5D4BA 3SI8A 2E1EA 2WB1F 2F44A 2FPKA 3L5KA 1RXVA 4JV1A 2HI0A 3JPPA 2KIVA 3JPTA 4OJLA 5KFSA 7ICPA 3ISDA 1KDHA 5ALTA 5T14A 4FZNA 4QBOA 1UQVA 3GZFA 4DQRA 3C1ZA 3PW7A 4KLLA 3BQ2A 5E79U 1PVRA 3PW4A 2XO7A 1UT5A 3H8SA 3ZDDA 4M9NA 5F9NA 1ZQJA 4DEZA 2QKQA 2D3DA 3PO5A 3NGDA 1TFRA 3D6JA 5DB8A 2RDJA 1SZHA 2JH1A 2Y9TA 4Y2SA 1JROA 3IF0X 2FMQA 4C80A 2FI1A 4YVZA 1U4BA 1ZQRA 3QUBA 4DS5A 3MDAA 1B43A 2JR5A 4RZRA 3M9NB 4RNNA 2ZUDA 3IG5A 5TISU 1WCNA 9ICWA 5J0UA 3GV5B 5KFQA 2C2RA 5KFVA 2GLEA 4DAPA 2IOFK 7ICNA 4UAZA 2G5HB 4IQVA 2FCOA 2KJ9A 1ZD3A 2CN1A 4KN7A 2FPMA 4OCZA 1ZQCA 2R8KA 5IINA 5KFIA 3BZCA 2DUYA 5AKKA 4ED8A 5KT6A 3MR3A 3QU2A 3L3FX 2KK0A 1J2MA 3IHQB 5H2FU 3ISCA 2WJ0A 3AU2A 2QLTA 3NVVA 2DWQA 2A1JA 1NK5A 4UAWA 5J8YC 3BJYA 2HDOA 2WFAA 3H0LB 3WKCA 1OUQA 2BCSA 2KG5A 1KW4A 4B9LA 5AI4A 4JV0A 1NJYA 3MC1A 3T3FA 4BXOB 8ICLA 2NO4A 5KFEA 5L1KA 1T7PA 2QARB 3Q8MA 4J9RA 4EELA 3ORYA 9ICKA 1DOQA 1SV0C 5DBBA 1JALA 5L1LA 2WIWA 5A0LA 5ALUA 5F3XB 1NK7A 4B9NA 7ICMA 1T3QA 2KD1A 3T5HA 3RB0A 2HOFA 4IRKA 2WAQF 4LZGA 1YZ7A 2H3QA 2LKYA 5KT7A 4I2FA 4UAUA 2NRVA 2K60A 1L7PA 4A8EA 3C2MA 2CZRA 2ZIWB 5CHGA 4OJ6A 2AJQA 3UXPA 1D9DA 2BHNA 3WK7A 4GXKA 3BQTA 3H8JA 5J0WA 4ED3A 2W9BA 3ZD8A 5J2BA 3PW2A 1QQ7A 2P6UA 4PHPA 2R8HA 1QSYA 1BPZA 4UB4A 1ED1A 4LVSA 1TVAA 4DQQA 8ICSA 4E0DA 3I76A 4QWDA 5ALQA 4DA2A 5CWRA 3QZ7A 4MF2A 4PL2A 3IEYB 2XY5A 2OH2A 4QWBA 4PGXA 4I2JA 1MSWD 9ICCA 2LM1A 2XCPA 1T8EA 4XUSA 5J0OA 2IA6A 9ICEA 3O0FA 1A6SA 4KLHA 4RQ4A 1JX4A 4G6VA 3PO4A 3ZDAA 2HHXA 2BCRA 1KBUA 4Y2TA 3UQ2A 4OJPA 4PZNA 4B9TA 4IR1A 4DSJA 5ALIA 1Z00A 3GIMA 3LK9A 2HCFA 3N7RC 4FZLA 4PL1A 4YXJA 1F5SA 5DG7A 2D8CA 3QXGA 3RBDA 4PHEA 5AM5A 5KFLA 3T5JA 3RTVA 2PXIA 2DBYA 2RHFA 1NJXA 7ICIA 4RQ5A 3G6XA 2PKEA 1SZPA 2KICA 2LBOA 3TKAA 1PZNA 1ZQZA 4Y2VA 3N4MB 4ECZA 2EAMA 4F71A 2BZFA 2WF8A 2MU2A 4YMOA 3B0YA 3UXNA 3OSNA 4DFJA 2BPCA 5HMLA 3C5GA 2YB1A 1C7YA 2DFLA 3M8RA 4O0IA 2KSOA 9ICFA 4IQUA 1ZQTA 4P4OA 1N62A 1X9WA 1CI4A 5AKHA 3BS5A 5IIMA 4M9GA 2F8LA 2HVIA 4FO6A 5EWFA 1L7NA 3H4DA 4PZOA 1ZJNA 2XVTA 3ZD9A 5L1IA 5KT4A 2H3ZA 2K4IA 5J29A 1QQ6A 4I27A 3GV8B 1ZQHA 1F44A 4KLFA 1COKA 5JTIA 2IOFA 1NZBA 3HP6A 4JMUA 2AQ4A 5KG6A 2BQRA 1TK0A 4F5RA 4IRCA 5KL8B 4UAYA 4GXIA 3PR4A 4ED0A 2EAOA 1RG6A 4GLXA 3TADA 3OHAA 4J9LA 1WYGA 2G06A 3ED5A 1NJZA 1BPYA 3KHGA 3SAFA 5KFRA 5HP4A 1X6JA 4RQNA 1U49A 4CDGA 4I2HA 3C21A 4C8LA 2BQ3A 1JXEA 2MRLA 4Y2QA 1KEJA 1L5UA 1Z1VA 4DFPA 5KG2A 4US8A 5J2JA 1L8OA 2K8BB 4Z6FA 4F92B 4F2SA 2O6KA 4DWIA 2BPFA 5CP2A 4RPZA 1YNMA 2KNJA 2BPGA 1ZQ1C 4C8KA 3KTQA 3HRDD 3UXOA 2VA3A 4QW9A 3JPQA 1S10A 1UA1A 2OWOA 2HMXA 1KKXA 3SV3A 1B0XA 4QNLA 1F1ZA 4UARA 1RZNA 4UB3A 4ZH4A 3DNXA 3PR5B 3ICXA 5J2EA 1KL9A 5CRXA 3MGIA 5EE1A 4RUAA 2W43A 2EO0A 2VJ4A 4KLSA 2WTFA 4BDPA 3PMLA 1NK4A 2XI9A 5D46A 5KG3A 3QU4A 5CJ7A 2NRTA 5AKGA 4KN4A 3L4PA 4FBUA 3EUB2 5J2FA 3LVVA 1KLNA 1HH1A 1ZOLA 2IHNA 1NI3A 3RRHA 5DG8A 4ECUA 4O3PA 3ZDCA 5CB1A 4BXOA 2ALZA 1UT8A 2JEGA 2QARA 2VJ5A 1V38A 2ZYZB 4PHDA 3CYMA 2WF6A 4JB3A 8ICVA 2HW3A 4F3OA 4QZIA 1L3SA 4J9NA 1A79A 5G5HA 2RLTA 5FDKA 2INBA 3F53A 4M9HA 4O9MA 1BPBA 1FO4A 3SV4A 4JWNA 3PX4A 8ICXA 4F4YA 4YN4A 3EW9A 2Z0RA 3NUQA 2W11A 2R8GA 5ALOA 4FZMA 2ZTCA 1Z00B 4EYHB 2ZIWA 2B21A 1V85A 4F93B 3ONNA 5G5GA 2HHTA 9ICUA 1ZYQA 4E6ZA 3KBBA 2NRZA 3HT3A 3SQIA 1AROP 4F5OA 3IM1A 5ALPA 4F5NA 1L6NA 2W7PA 1Q3VA 3TADC 1SIJA 1TV9A 3F5EA 1BNOA 8ICEA 5EE3A 5ALHA 1IV8A 2Z7JA 3NTUA 2BKEA 5KFFA 5DDYA 4I2IA 1XMXA 9ICNA 3C1YA 4YR3A 3BZKA 4R63A 2DL0A 4DL4A 4G3IA 3UMGA 8ICOA 3WKBA 4Q44A 1Q8KA 2KSOB 4M0AA 4LJXA 3H7IA 5AM1A 3BDPA 5DB9A 4G9BA 5KNIA 4DQPA 3RB4A 1RQLA 4DCCA 1WWVA 5AIBA 2EZZA 5KT5A 3BS5B 4CCHA 1ZQAA 4ELUA 3BS7A 2Y1JA 4MEXA 3TAPA 1TKDA 2OCEA 3M9OB 5AM4A 4NL9A 2E8NA 3SAGA 9ICSA 3HWTA 1COOA 4BX9C 1BVSA 4CGZA 4P0PB 2C2DA 4KX3A 4NJ8A 5ALYA 4B6JA 4KLGA 3I1YA 1UHUA 3MABA 1S0OA 3SMVA 3QU5A 2KEYA 3MDCA 4ED7A 4KLQA 8ICAA 3GQCA 8ICZA 5KFZA 4UAVA 3PSIA 4US9A 3WKEA 2F1JA 4F8RA 1IG6A 1ZQUA 3P1ZB 3JPNA 3KFUF 3TACB 1CEZA 3N28A 1PK3A 1F0MA 1TK5A 1K5OA 3GFKB 4KX5A 4F4KA 4IQTA 2ZIUB 4KLEA 1ZQOA 2YQEA 1ECWA 2K8AA 4DOAA 5K4LA 3H0MB 2E8MA 9ICMA 3AQFA 1KN5A 3MR6A 1SV4A 4YCXA 5KFCA 3AEVA 1Z19A 2FLNA 2AU0A 2ZIXA 1D8BA 1M6YA 2I1QA 1ZD5A 2FLLA 4Q45A 2PFNA 5KG0A 4ED1A 1URJA 5ALLA 1NOMA 4FE3A 5DLGA 2EDUA 5ALMA 1S5LU 3UMCA 3RR8A 4BJQA 1LKYB 4EV1A 4C7YA 2ZUBA 1KSPA 3RJHA 4XQ8A 2HHWA 1NNLA 3H4BA 5ALVA 1XS9D 1K1QA 1UWVA 1L8LA 2LHTA 3SZ2A 4U7CA 1S0MA 2XIDA 2BCUA 4UASA 3HX0A 4USAA 7ICUA 1B4FA 5ALSA 2XGPA 5AK5A 5ALKA 4BUGA 4FBTA 3OPXA 2YTUA 3WK9A 4UB2A 5KFJA 4I28A 2MUTA 5AKLA 3E58A 1SKSA 1SKWA 2XC9A 3THVA 4M04A 4DSLA 4QZCA 7ICRA 1HUOA 8ICFA 1C20A 8ICGA 2VS1A 2RRDA 1NK0A 2HOIA 4P4PA 4KLOA 4J9PA 3E0FA 2CRXA 3DEEA 1MQ2A 5IIOA 3M6KA 4DOCA 3QUCA 2WHEA 2BCQA 2WF9A 4NL9C 2GJWA 5ALRA 4AYBF 3PW0A 3RJFA 4QZ9A 1NK9A 4NLKA 4WJ3B 2JHDA 4YR0A 1JXLA 1J2NA 3WKAA 4J9KA 4KLUA 7ICJA 3RBEA 3AN1A 3MBYA 3MGVA 2W9CB 5FP0A 3UM9A 1A0PA 3CNHA 4GC7A 5ALZA 3RJIA 1QSLA 1ZQNA 2ZYZA 5JU5A 3RJKA 9ICQA 5JUMA 4M9JA 5AKXA 2YN4A 2P6RA 4J9MA 4NWIA 4NXZA 3H40A 1RXWA 1S8OA 2UVWA 4I2CA 3PSFA 5AI5A 2Q4TA 2JH7A 1P7DA 3KZXA 2GH1A 5KT2A 2VA2A 4RPXA 3QU9A 4DL7A 3MGHA 5J0RA 4QWEA 4NLZA 2IOHA 1PK1A 2JRZA 4TUSA 1N2XA 4LZDA 2BDPA 4IRDA 2ES6A 3PNCA 4XRHA 4UW9A 4MEYA 9ICAA 3JPRA 2HBMA 4I2EA 9ICRA 1T0FA 4YXMA 3ZDEA 3DDHA 1HUZA 1T4GA 4UB5A 1RLVA 1S0NA 1UPHA 2K4EA 4DLEA 3A0HU 5L1JA 4M2YA 2NYVA 4P2HA 2HHQA 4RPYA 1Y88A 5EE9A 2XGQA 2D6FC 3OTQA 4FS2A 9ICPA 3K4GA 1RM6C 4EBCA 4Y2PA 2PMZC 2HVHA 5HR7A 4C8OA 2CV8A 5KFYA 2FLCA 3DV9A 2W03A 5IIJA 3FYHA 1ZRMA 5KG7A 2ASJA 3GILA 2HSZA 4ELVA 4ACOA 3TI0A 3OHBA 1OW5A 3V6HA 2MA1A 4RQ0A 1SL0A 9ICVA 5ALWA 1HJPA 9ICXA 5CA7A 2C28A 8ICUA 4QZ8A 4MFAA 3AL0B 2F8KA 5AI8A 1WCLA 3EYZA 2ZXIA 1ZQDA 2WIZA 2KZMA 5KFBA 7ICVA 2UVVA 3JPOA 7ICOA 4QZAA 1NKCA 1S76D 1L3VA 2A3VA 2QB0A 4DSEA 4P0PA 2ZIXB 3QEBZ 5AI6A 2WCWA 5DB7A 4DL3A 4TQSA 5AKEA 5HHHA 4QWAA 2ZJ5A 2WF7A 3CP8A 3PSTA 4F4XA 1SWWA 2WF5A 2P66A 2AXTU 2BCVA 4DFMA 4F2RA 2FPLA 2ASLA 5KAFU 4DL5A 2JZBB 3H0RB 3LDAA 2DPIA 2EZXA 1ZQKA 1KFTA 2EAPA 2G08A 3P1ZA 5GTIU 4R8UA 1X6IA 4UB1A 1ZQSA 1AQ6A 1X2IA 2P35A 3M7DA 2G0AA 2XICA 4J9SA 3IG8A 5AM0A 3GIKA 4MHVA 3RJEA 1N5XA 2Y9UA 2ZIUA 4ECRA 2PFPA 4Q43A 3F2BA 5KFXA 2PI4A 4O3SA 5BPCA 5HMMA 3MFHA 1NKEA 1DXSA 3HILA 4F50A 3WK8A 5KG4A 1QSSA 8ICHA 3NRWA 3GV7B 1TE2A 2MUTB 2W3SA 2DKZA 1U48A 4QJFB 5IIIA 2LYHA 4EBDA 3RB3A 5EE0A 1XO0A 1IIPA 4GC6A 4DS4A 4MFCA 4ED6A 2C2EA 4EENA 3SAHA 3RR7A 7ICEA 1LKYA 4IS7A 4I2BA 1VLBA 1N60A 1R11A 2H3FA 4DOBA 3KKAA 1ZQEA 4RQMA 4O3MA 2BH2A 3RFAA 1TAMA 1B22A 5AIAA 5TZVA 5HNKA 8ICNA 2E1FA 3RAXA 8ICBA 4JK1A 5KFNA 4I2DA 4IR9A 2XY7A 2I9GA 1T94A 2J6TA 1NZPA 2FE9A 2F3NA 4IL6U 5KFGA 2FMSA 1NK8A 1MQ3A 4I2GA 2H5XA 8ICJA 1NK6A 5BOMA 2ZIVA 1OB8A 4YP3A 5KFHA 1TAUA 5J2CA 1ZQWA 4ECXA 1JN3A 4P0QB 2JEIA 2OXOA 2FJ6A 1S9FA 3PX6A 4R65A 5DBCA 4RT2A 3V7LA 3PX0A 2PMZF 4F5QA 2YX8A 8ICYA 1X40A 4PJ0U 3A0BU 4QZHA 4NV0A 5ALFA 3Q8LA 4YMMA 1SWVA 1ZQYA 4DLGA 3GIIA 2DQNB 4IQWA 2W7OA 1PK1B 5ALGA 1S97A 2F1IA 2G09A 3B9JA 4PGQA 3TAQA 3QX7A 1L7MA 3SENA 5J2GA 1FIQA 3QYPA 4YQWA 4TKKA 2ZJAA 3FAHA 5J2HA 7ICKA 3PMNA 3FC4A 3AQEA 4R66A 2KFNA 7ICSA 7ICHA 4RUCA 1VJ5A 4Y2RA 2KIWA 4TURA 3OGUA 2W9CA 4UBBA 4NLBA 4EEKA 3F2DA 5DQGA 3RAQA 1QLNA 1LB2B 2W55A 2Y0SC 3UMBA 2N1RA 4F4ZA 2CXYA 4CNQA 5AICA 4EX6A 4J03A 3RJGA 1PVQA 1KFSA 2HBLA 4OJ5A 3P1YA 4P4MA 2AGOA 2IMWP 5DKWA 1ZQXA 4ECWA 2AH5A 4EZ9A 3LYSA 4O3OA 5DGBA 1ZQGA 2B0CA 4K4IA 2BDUA 3TARA 2VLDA 1A77A 4RQ1A 4CRXA 2AGQA 1T3NA 1NKBA 4PH5A 2HBJA 7ICLA 1GO3F 3PSPA 4CF4A 2OYYA 3C28A 3EZ5A 1OXJA 5J2IA 5KTQA 3TQ1A 5DGAA 2UVUA 2ISOA 5AK6A 4C8MA 2DGZA 2KZZA 2GWSA 3NRZA 4DFDA 4EEYA 1XO1A 2XY6A 1DGJA 3EPIA 3M1YA 2BQUA 1RYRA 5GTHU 4KLDA 2KV2A 4FFDA 5J2KA 1HIWA 1XWLA 9ICGA 3NS1A 1SL2A 4MF8A 2QB0B 4DSKA 4QBNA 4MFFA 4DL2A 2Q0ZX 4O3RA 5C0YA 1QH9A 4QZEA 4EYIB 4QZGA 5EOZA 4Y2YA 4CF3A 5CEHA 2E8PA 1BNPA 2ODGA 3CW2C 3HW8A 5DB6A 8ICQA 3KKAC 1BPDA 1X9MA 1DK3A 3MFIA 4DAVA 3AM9A 2EQYA 3RB6A 1ZETA 3Q8SB 3NASA 1YT3A 2BR0A 2LM4A 4F72A 1O08A 4I2AA 2K4PA 2KVSA 4R8UB 2R8JA 2XCAA 3KD3A 4QW8A 1RQNA 3PW5A 5KAIU 4EZ6A 2HHVA 2MSNA 4YD1A 1KTQA 4FS1A 1ZRNA 4F4WA 1L7OA 4Y2XA 4QIWC 2B6GA 2OKFA 1XSPA 1XSLA 2Y1IA 3PZPA 4PHAA 5C5JA 2AQ0A 3ISBA 1XC9A 2H3VA 1PUZA 2JJQA 1S0VA 3KHLA 1SB3C 2FDRA 4QBLA 4KMUA 5J0SA 3RJJA 5KFWA 7ICGA 2NV3A 4DQSA 2ESEA 5KL1B 1V97A 4RNOA 3RF9A 4UB6U 3NVWA 3PVXA 2E8OA 4CE6A 4O5KA 2JZBA 2LPEA 4Z6EA 2YMLA 4OO1J 5J0YA 3QUTA 2V9WA 1L3UA 1PVPA 4RNMA 4C4SA 5D49A 3Q8RB 3U26A 3HJEA 5DDMA 2W8KA 3V6KA 1SL1A 3C23A 1RPLA 3MR2A 3T5KA 3AMZA 2LYAA 3IDWA 1XSNA 2IXSA 2ATLA 5AHXA 1ZQQA 5DQIA 5CR0A 2W8MA 1N56A 4YFKA 2ZIVB 2Y0SF 3V72A 1XU4A 3D2SA 3ZI4A 5IIKA 3BQ0A 5J0XA 3C2KA 4GFJA 5HHIA 4BWMA 3OSPA 1IPIA 1FFUA 2C22A 4F91B 2F2AB 1GEFA 3ETRA 3K1RB 1BGXT 2ZJ8A 1TK8A 2NRXA 3LWMA 3KHHA 1ZJMA 3C2LA 1CUKA 3ETLA 4DL6A 3BQ7A 2LI6A 2ISPA 2JEFA 4K4HA 3G6VA 4YMNA 4JWMA 5KFTA 8ICWA 2W3RA 3I28A 5AM3A 4OJOA 5BOLA 3AU6A 3K1ZA 3M6ZA 4NM2A 5ALDA 3V7JA 2CPRA 2YMPA 2A19A 4Q8EA 9ICLA 4RQ2A 3AUOA 3H8WA 2OEHA 8ICPA 2NO5A 2GOLA 2VKQA 1RYUA 5KFKA 2E5SA 4P0QA 3F2CA 3N7PD 1Z4NA 4LQEA 2RDIA 2VA8A 1FEZA 3VC8A 4TKDA 5ALNA 5KFAA 8ICIA 2J6UA 1MN8A 1X42A 4QZFA 4QWCA 1IXRA 2KOBA 1O03A 3PV8A 1J97A 4NLNA 1Q46A 2H3IA 2FMPA 5AKZA 5B5EU 2A1AA 5B66U 1KQQA 1ZQPA 1S77D 2R18A 5DBAA 2DPJA 4NM1A 2KN7A 2E3TA 4O3NA 4ECTA 2WCZA 3BT7A 2M9NA 1X66A 4K4GA 1Z3EB 3HKZC 3J81j 2V4RA 2ZXHA 3ZDBA 1FFVA 1D9FA 1N61A 1U45A 2KJ8A 4QIWF 7ICFA 4KLIA 2HHUA 2I6XA 1MC8A 3LWLA 4ELTA 3QZ8A 1JUDA 3WK4A 5DQHA 2KVCA 2JV3A 4RQ6A 1U9LA 2W04A 1SXEA 3AJVB 2ZG6A 4UQGA 5JRTA 1X9SA 1OB9A 3C29A 5EWEA 2W9AA 9ICJA 2YMQA 2W54A 1WWUA 4C7ZA 3NVZA 1RDFA 3B0XA 4J9QA 2KTQA 3V7KA 1SKRA 3TFRA 4M6WA 3QNMA 2AGPA 4KTQA 8ICMA 2OSTA 1UA0A 5KFDA 1LV5A 4QZDA 3GIJA 2FL3A 3QUQA 2JMGA 1ZP7A 2YB4A 2BGWA 1ZXIA 3RH6A 2J6SA 4PGYA 4G6UA 2YMMA 3SEIA 4XA5A 4J9OA 4TUQA 2F1HA 4M9LA 3IRUA 2UVRA 1D8LA 5AK3A 4ECSA 5J0PA 1N63A 1ZQIA 3Q8QB 3WU2U 4OD0A 5J0TA 2ASDA 2PFQA 3KOOA 1K1SA 4EBEA 1HEKA 1CRXA 1ZQMA 3IV6A 4DSIA 3SR6A 2F77X 5AKJA 3IP4B 1WUDA 2GW6A 4O5CA 1V9PA 3SYZA 2LMRA 1D8YA 1Z1BA 2W8LA 2IBKA 3JPSA 4CF5A 4Z6DA 2EANA 3QEAZ 4DO9A 2NRWA 9ICHA 3V6JA 4RQ3A 3M8SA 7ICQA 1YZ6A 3Q8KA 1BPEA 4B9VA 4B9MA 2YY6A 5KFPA 1R0VA 4B9UA 4I29A 4KMOB 9ICTA 4C8NA 4DFKA 3UQ0A 1ZD2P 2HOQA 3D2NA 2PFOA 3PY8A 2I5HA 4ECVA 2FLPA 1DK2A 2OM6A 8ICKA 1JRPA 2HBKA 1QCKA 2G07A 3KZIU 1VDVA 3D2QA 4KLJA 2ZTDA 3HPOA 8ICCA 1BPXA 2PI5A 2VIXA 1DGSA 4ICAA 5L9XA 1ZQBA 4Z6CA 3MR5A 4PPXA 1Y1OA 5DLFA 1U47A 1RZTA 2A1JB 2FKCA 3GDXA 4C4RA 3FDSA 1A76A 3K75D 5KT3A 3TFSA 2JXJA 5J0QA 2WB1C 4F5PA 4GXJA 3TANA 1MA7A 1Z4OA 2DBSA 3BQ1A 4ECQA 3E2EA 4NLGA 2AHOB 2M0NA 5HR6A 2KHQA 3IN5A 2KKVA 2KZ3A 4YG2A 3Q8PB 5KFOA 4NY8A 1QTMA 5AKIA 4R64A 3HKZF 4ECYA 5IILA 1JI7A 4O5EA 3R9KA 1KRPA 1JIHA 3LVWA 4X5VA 1ZQFA 4QZBA 5KFMA 2EH9A 3GU3A 4M47A 4UBCA 4ZQUA 3WK6A 5AI9A 4C0ZA 2KFZA 1SXDA 1UCVA 2QB1A 3WKDA 4KLTA 4JUZA 5AM2A 2KE7A 1ZQVA 2OHFA 2KKPA 4YR2A 4ED2A 3N97B 5J2AA 2LYBA 2F76X 2W9BB 5AI0A 2RP5A 2IHMA 4BWJA 7ICTA 3F5AA 4Y2JA 3WK5A 4JV2A 3RH4A 4AP9A 2MAXA 3EWAA 2DF4B 1NJWA 3T79A 2EZYA 4EX7A 1WG8A 2KJ5A 4RT3A 3FOVA 4YD2A 5KG5A 1H38A 4DQIA 3G6YA 5DG9A 3M9MB 2JEJA 4HYKA 2V4QA 1LVHA 1X9XA 1RYSA 2W9MA 1N48A 5ALXA 5AK4A 1JMSA 1KFDA 2G5IB 2L5YA 3VCBA 4O3QA 9ICIA 3UPQA 4KLMA 3QU7A 1L3TA 2VANA 3SD7A 4HAIA 2R8IA 9ICBA 4ZOHC 9ICOA 4IC9A 5EWGA 5L1MA 1Q3UA 2ZTEA 3NVYA 4M6WB 3OJSA 8ICTA 1ZD4A 4GIBA 4B9SA 4RQ8A 4DF4A 4RQ7A 2RQ5A 2ZUCA 5ALJA 2K4HA 3S6JA 3OJUA 3H8MA 5ALEA 5F9LA 5J8YA 4TQRA 4NLCA 4TUPA 1XNSA 2KHVA 1ZQLA 4C4TA 2KMDA 3EPGA 2KP7A 2GO7A 3IEYA 5AKYA 2K89A 3RRGA 5KG1A 2DKXA 4KITB 1SGGA 2JGAA 4DSFA 3QE9Y 3KHRA 4Y2UA 5J2DA 2WAQC 3C5FA 1SV0A 3CRXA 2K8CB 3FM9A
chains in the Genus database with same CATH topology
5HHIA 2WTFA 4BWMA 4EBCA 4BDPA 3PMLA 3OSPA 1NK4A 3AJVA 4RU9A 5KFUA 2HVHA 4DF8A 2C22A 4C8OA 1IPIA 4F91B 1TAQA 2HHSA 2FKHB 1EXNA 4Q8FA 5D46A 5KG3A 2CV8A 5KFYA 8ICRA 1IM4A 2FLCA 1GEFA 3RH5A 3T5LA 1BGXT 2NRTA 4BGDA 5CJ7A 5D4BA 3SI8A 2ZJ8A 1TK8A 2NRXA 4KN4A 3LWMA 3KHHA 5IIJA 2FPKA 3FYHA 1ZJMA 3C2LA 1RXVA 4FBUA 4JV1A 1CUKA 5KG7A 3GILA 2ASJA 3JPPA 5J2FA 4ELVA 3TI0A 3JPTA 3ETLA 3OHBA 5KFSA 4DL6A 1KLNA 7ICPA 3ISDA 3V6HA 1KDHA 1HH1A 4RQ0A 1SL0A 9ICVA 2ISPA 1HJPA 2JEFA 9ICXA 4QBOA 5CA7A 2C28A 4K4HA 3G6VA 4YMNA 2IHNA 4DSJA 8ICUA 3RRHA 4QZ8A 4DQRA 4JWMA 3C1ZA 5KFTA 3PW7A 8ICWA 4MFAA 4KLLA 5DG8A 4ECUA 5BOLA 4O3PA 3BQ2A 3ZDCA 5CB1A 1WCLA 3EYZA 3AU6A 2ALZA 1ZQDA 3PW4A 4NM2A 4BXOA 1UT8A 2XO7A 2WIZA 2KZMA 5KFBA 7ICVA 2UVVA 3JPOA 3V7JA 1UT5A 3H8SA 2JEGA 3ZDDA 4QZAA 5F9NA 1NKCA 4M9NA 7ICOA 4PHDA 1S76D 2ZYZB 1L3VA 1ZQJA 4DSEA 4DEZA 4Q8EA 8ICVA 9ICLA 2HW3A 4F3OA 4RQ2A 4QZIA 3AUOA 3QEBZ 1L3SA 4J9NA 1A79A 3H8WA 3PO5A 3NGDA 1TFRA 8ICPA 5DB8A 2RDJA 2WCWA 5DB7A 4DL3A 5KFKA 4TQSA 5FDKA 5HHHA 2INBA 4M9HA 4O9MA 4LQEA 1BPBA 4QWAA 2ZJ5A 3SV4A 4JWNA 2RDIA 4F4XA 2VA8A 3PX4A 8ICXA 4F4YA 3IF0X 4YN4A 3EW9A 2P66A 2Z0RA 4TKDA 2FMQA 4FS2A 2BCVA 4DFMA 2R8GA 2FPLA 4F2RA 2ASLA 2ZTCA 4YVZA 5KFAA 1Z00B 2JZBB 4DL5A 3LDAA 1U4BA 4EYHB 1ZQRA 4QZFA 2J6UA 4QBNA 2B21A 4DS5A 4QWCA 2DPIA 3MDAA 4F93B 1IXRA 1ZQKA 1KFTA 1B43A 3P1ZA 2HHTA 9ICUA 3PV8A 1ZYQA 4E6ZA 4R8UA 4RZRA 3M9NB 4NLNA 4RNNA 4UB1A 1ZQSA 2FMPA 2ZUDA 2NRZA 3HT3A 1WCNA 1X2IA 1AROP 9ICWA 4J9SA 1ZQPA 3GIKA 1S77D 3RJEA 5DBAA 5J0UA 2DPJA 4F5OA 4NM1A 3IM1A 2KN7A 3GV5B 4O3NA 4ECTA 2WCZA 3BT7A 5KFQA 2M9NA 4F5NA 1Z3EB 2C2RA 4K4GA 4ECRA 5KFVA 2V4RA 3ZDBA 3RJHA 4DAPA 1D9FA 2PFPA 1U45A 1TV9A 4Q43A 4UAZA 7ICFA 7ICNA 4KLIA 2HHUA 5KFXA 2PI4A 4O3SA 5BPCA 8ICEA 4IQVA 2FCOA 1MC8A 5HMMA 3MFHA 3LWLA 3QZ8A 1NKEA 4ELTA 5DQHA 4KN7A 3NTUA 4F50A 2BKEA 2FPMA 5KG4A 1ZQCA 5KFFA 5IINA 1QSSA 5DDYA 3GV7B 4RQ6A 2R8KA 4I2IA 8ICHA 2MUTB 1XMXA 5KFIA 1U9LA 1U48A 3AJVB 5IIIA 4UQGA 2LYHA 9ICNA 1X9SA 4EBDA 1OB9A 3RB3A 3C1YA 4ED8A 5KT6A 5EWEA 4YR3A 4R63A 2W9AA 4DL4A 4G3IA 9ICJA 3MR3A 4GC6A 3ISCA 4DS4A 3IHQB 4MFCA 4ED6A 8ICOA 2WJ0A 3AU2A 2C2EA 4Q44A 3RR7A 3B0XA 4J9QA 4M0AA 2KTQA 7ICEA 3H7IA 3V7KA 3BDPA 1SKRA 3TFRA 2A1JA 4M6WA 5DB9A 1NK5A 2AGPA 4I2BA 4KTQA 4DQPA 4UAWA 1UA0A 3RB4A 5KFDA 1LV5A 8ICMA 3BJYA 1R11A 4QZDA 4DOBA 5KT5A 3GIJA 2FL3A 4CCHA 1ZQEA 1ZQAA 1ZP7A 2BCSA 4ELUA 2BGWA 3RH6A 2J6SA 2Y1JA 4PGYA 4B9LA 4G6UA 4MEXA 2BH2A 4JV0A 4XA5A 4J9OA 3TAPA 4TUQA 1B22A 1NJYA 3T3FA 5TZVA 4BXOB 8ICLA 1TKDA 5KFEA 2F1HA 5HNKA 5L1KA 1T7PA 4M9LA 8ICNA 3M9OB 3Q8MA 3RAXA 8ICBA 4JK1A 5KFNA 4I2DA 4J9RA 2UVRA 4IR9A 2XY7A 1D8LA 2I9GA 9ICSA 2J6TA 5KFGA 3HWTA 1COOA 5J0PA 3ORYA 4ECSA 1NK8A 2FMSA 1BVSA 2C2DA 1MQ3A 4I2GA 9ICKA 1DOQA 2H5XA 1ZQIA 3Q8QB 5DBBA 8ICJA 5L1LA 1NK6A 4KLGA 5BOMA 1OB8A 2WIWA 3MABA 4YP3A 5KFHA 5J0TA 5J2CA 1NK7A 1S0OA 2ASDA 2PFQA 1TAUA 1ZQWA 4B9NA 7ICMA 3RB0A 4ECXA 3T5HA 1JN3A 4IRKA 2JEIA 4LZGA 3MDCA 1K1SA 5KT7A 4EBEA 4ED7A 4I2FA 1S9FA 3PX6A 4R65A 5DBCA 1ZQMA 4KLQA 2NRVA 4RT2A 3V7LA 8ICAA 4DSIA 3GQCA 8ICZA 5KFZA 3PX0A 4F5QA 8ICYA 2GW6A 4O5CA 3C2MA 1V9PA 3SYZA 2F1JA 5CHGA 4F8RA 2CZRA 1D8YA 2AJQA 4QZHA 2W8LA 2IBKA 3JPSA 1ZQUA 3UXPA 3P1ZB 4Z6DA 3JPNA 3Q8LA 3QEAZ 2OSTA 1D9DA 2BHNA 4YMMA 4GXKA 3BQTA 3H8JA 4DO9A 4DLGA 1ZQYA 5J0WA 1CEZA 4ED3A 3GIIA 2NRWA 2W9BA 4IQWA 3ZD8A 1TK5A 3GFKB 3V6JA 9ICHA 5J2BA 1S97A 2F1IA 4RQ3A 3PW2A 4PGQA 3M8SA 2P6UA 4PHPA 4F4KA 7ICQA 4IQTA 3TAQA 3Q8KA 4KLEA 2R8HA 5J2GA 1BPEA 1QSYA 1BPZA 4UB4A 1ZQOA 4B9MA 4B9VA 5KFPA 1R0VA 4YQWA 4B9UA 2ZJAA 4DOAA 4TKKA 4LVSA 5J2HA 7ICKA 3PMNA 4I29A 9ICMA 1TVAA 4DQQA 9ICTA 3MR6A 8ICSA 4C8NA 4DFKA 4R66A 4E0DA 3UQ0A 4YCXA 2KFNA 2PFOA 7ICSA 5KFCA 4QWDA 4DA2A 2FLNA 3PY8A 5CWRA 7ICHA 4RUCA 3QZ7A 2AU0A 4MF2A 3IEYB 2FKCA 2XY5A 4QWBA 4ECVA 2FLPA 4PGXA 4TURA 2I1QA 4I2JA 1MSWD 3OGUA 8ICKA 9ICCA 2XCPA 1T8EA 2W9CA 4XUSA 4UBBA 2FLLA 4Q45A 5J0OA 2IA6A 2PFNA 9ICEA 5KG0A 4ED1A 4KLHA 4RQ4A 1JX4A 1NOMA 5DQGA 3RAQA 1QLNA 4G6VA 5DLGA 1LB2B 4KLJA 2ZTDA 3HPOA 3PO4A 8ICCA 4F4ZA 3ZDAA 2HHXA 2BCRA 1BPXA 2PI5A 3RR8A 1DGSA 3RJGA 3UQ2A 5L9XA 1KFSA 1ZQBA 4Z6CA 3MR5A 4PPXA 1Y1OA 4B9TA 4IR1A 3P1YA 4EV1A 2ZUBA 4P4MA 5DLFA 2AGOA 2A1JB 1U47A 5DKWA 1ZQXA 1RZTA 1KSPA 3GDXA 4ECWA 2IMWP 4XQ8A 1Z00A 3GIMA 5DGBA 4O3OA 4EZ9A 3LK9A 2HHWA 8ICIA 1ZQGA 3H4BA 3FDSA 1A76A 4K4IA 3K75D 5KT3A 3TARA 1XS9D 3TFSA 2VLDA 5J0QA 4YXJA 5DG7A 1A77A 4RQ1A 1K1QA 4F5PA 4GXJA 3TANA 2AGQA 1T3NA 1NKBA 2DBSA 4PH5A 3BQ1A 4ECQA 1UWVA 7ICLA 3RBDA 3E2EA 4NLGA 3SZ2A 4PHEA 1S0MA 5KFLA 3EZ5A 3T5JA 2KZ3A 4YG2A 5J2IA 3Q8PB 5KFOA 3RTVA 5KTQA 1QTMA 3TQ1A 2PXIA 5DGAA 2BCUA 4NY8A 4R64A 1NJXA 2UVUA 3HX0A 7ICIA 2ISOA 4C8MA 4RQ5A 7ICUA 3G6XA 4ECYA 5IILA 2KZZA 1SZPA 2GWSA 1ZQFA 1PZNA 4O5EA 2XGPA 1ZQZA 3N4MB 4EEYA 4FBTA 1KRPA 1XO1A 4ECZA 1JIHA 2XY6A 3EPIA 4UB2A 5KFJA 2BQUA 1RYRA 4I28A 4KLDA 5J2KA 4X5VA 2MUTA 4YMOA 3B0YA 3UXNA 1XWLA 4QZBA 1SKSA 1SL2A 5KFMA 1SKWA 3OSNA 9ICGA 2XC9A 4MF8A 4DFJA 3THVA 4DSKA 4UBCA 4M47A 4M04A 4MFFA 2BPCA 4DSLA 4QZCA 5HMLA 4DL2A 3C5GA 4ZQUA 2Q0ZX 4O3RA 7ICRA 4QZEA 1HUOA 4EYIB 1C7YA 4QZGA 2KFZA 2DFLA 5EOZA 4KLTA 4JUZA 8ICFA 3M8RA 4O0IA 8ICGA 9ICFA 1ZQVA 2VS1A 4IQUA 1ZQTA 1NK0A 4P4OA 4YR2A 3HW8A 4P4PA 4KLOA 5DB6A 4J9PA 8ICQA 4ED2A 3N97B 1BPDA 5J2AA 1X9MA 2W9BB 1X9WA 1MQ2A 3MFIA 4DAVA 2IHMA 4BWJA 7ICTA 5IIOA 3RB6A 1ZETA 3Q8SB 4DOCA 5IIMA 4M9GA 2HVIA 4FO6A 2BR0A 5EWFA 2BCQA 4JV2A 3H4DA 2GJWA 3RH4A 1ZJNA 4I2AA 2MAXA 3ZD9A 4R8UB 5L1IA 2XCAA 3PW0A 5KT4A 2R8JA 3EWAA 3RJFA 4QZ9A 5J29A 1NJWA 1NK9A 4QW8A 4I27A 4NLKA 4RT3A 3GV8B 1ZQHA 3PW5A 4KLFA 4YR0A 3FOVA 4YD2A 4EZ6A 1JXLA 2HHVA 3HP6A 4YD1A 5KG5A 1KTQA 4FS1A 2AQ4A 5KG6A 2BQRA 4J9KA 4KLUA 7ICJA 1TK0A 1H38A 4F5RA 4F4WA 3RBEA 4IRCA 3MBYA 2W9CB 4DQIA 4UAYA 4GXIA 3PR4A 3G6YA 4ED0A 2OKFA 5DG9A 1XSPA 4GC7A 3M9MB 1XSLA 3RJIA 1QSLA 2JEJA 4HYKA 1ZQNA 2ZYZA 2V4QA 2Y1IA 3RJKA 4GLXA 4PHAA 9ICQA 5JUMA 4M9JA 5C5JA 2AQ0A 3OHAA 4J9MA 4J9LA 1RYSA 2P6RA 4NXZA 3ISBA 1XC9A 2W9MA 3H40A 1N48A 1RXWA 2JJQA 2UVWA 4I2CA 1JMSA 1NJZA 1BPYA 1KFDA 3KHGA 5KFRA 5HP4A 1S0VA 1U49A 3KHLA 4O3QA 9ICIA 3UPQA 4QBLA 4KMUA 4I2HA 5J0SA 3RJJA 5KFWA 4KLMA 3C21A 5KT2A 4DQSA 2VA2A 4RPXA 4C8LA 7ICGA 1L3TA 2VANA 4DL7A 4RNOA 3MGHA 1JXEA 5J0RA 4QWEA 2R8IA 2BQ3A 4NLZA 9ICBA 9ICOA 1KEJA 5EWGA 2EO0A 1L5UA 4DFPA 2ZTEA 5KG2A 4TUSA 3PVXA 4LZDA 4M6WB 3OJSA 2BDPA 5J2JA 4IRDA 4O5KA 8ICTA 2JZBA 4B9SA 4RQ8A 4DF4A 4RQ7A 3PNCA 4Z6EA 4XRHA 2ZUCA 4Z6FA 4F92B 3OJUA 5J0YA 2V9WA 4F2SA 4MEYA 9ICAA 1L3UA 3JPRA 2BPFA 4DWIA 4I2EA 5CP2A 4RNMA 9ICRA 5F9LA 4RPZA 4TQRA 1T0FA 1YNMA 4TUPA 1ZQLA 4YXMA 2BPGA 3ZDEA 5D49A 3Q8RB 4C8KA 3EPGA 5DDMA 2W8KA 1HUZA 3V6KA 1T4GA 4UB5A 1RLVA 1SL1A 3C23A 1S0NA 3KTQA 1RPLA 3MR2A 3T5KA 3IEYA 2VA3A 3UXOA 3RRGA 4QW9A 4DLEA 3JPQA 5KG1A 1S10A 5L1JA 1UA1A 2OWOA 1XSNA 4M2YA 2IXSA 2ATLA 4KITB 3SV3A 1ZQQA 5DQIA 5CR0A 1F1ZA 2W8MA 4P2HA 1RZNA 4UB3A 4ZH4A 3DNXA 3PR5B 4YFKA 4DSFA 3QE9Y 1N56A 5J2EA 4RPYA 1Y88A 3KHRA 2HHQA 3MGIA 5J2DA 2XGQA 3V72A 1XU4A 3C5FA 4RUAA 5IIKA 3BQ0A 5J0XA 3C2KA 9ICPA 3K4GA 4KLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HHI A;  2WTF A;  4BWM A;  4EBC A;  4BDP A;  3PML A;  3OSP A;  1NK4 A;  3AJV A;  4RU9 A;  5KFU A;  2HVH A;  4DF8 A;  2C22 A;  4C8O A;  1IPI A;  4F91 B;  1TAQ A;  2HHS A;  1EXN A;  4Q8F A;  5D46 A;  5KG3 A;  2CV8 A;  5KFY A;  8ICR A;  1IM4 A;  1GEF A;  3RH5 A;  3T5L A;  1BGX T;  2NRT A;  4BGD A;  5CJ7 A;  5D4B A;  3SI8 A;  2ZJ8 A;  1TK8 A;  2NRX A;  4KN4 A;  3LWM A;  3KHH A;  5IIJ A;  2FPK A;  3FYH A;  1ZJM A;  3C2L A;  1RXV A;  4FBU A;  4JV1 A;  1CUK A;  5KG7 A;  3GIL A;  2ASJ A;  3JPP A;  5J2F A;  4ELV A;  3TI0 A;  3JPT A;  3ETL A;  3OHB A;  5KFS A;  4DL6 A;  1KLN A;  7ICP A;  3ISD A;  3V6H A;  1KDH A;  1HH1 A;  4RQ0 A;  1SL0 A;  9ICV A;  2ISP A;  1HJP A;  2JEF A;  9ICX A;  4QBO A;  5CA7 A;  2C28 A;  4K4H A;  3G6V A;  4YMN A;  2IHN A;  4DSJ A;  8ICU A;  3RRH A;  4QZ8 A;  4DQR A;  4JWM A;  3C1Z A;  5KFT A;  3PW7 A;  8ICW A;  4MFA A;  4KLL A;  5DG8 A;  4ECU A;  5BOL A;  4O3P A;  3BQ2 A;  3ZDC A;  5CB1 A;  1WCL A;  3EYZ A;  3AU6 A;  2ALZ A;  1ZQD A;  3PW4 A;  4NM2 A;  4BXO A;  1UT8 A;  2XO7 A;  2WIZ A;  2KZM A;  5KFB A;  7ICV A;  2UVV A;  3JPO A;  3V7J A;  1UT5 A;  3H8S A;  2JEG A;  3ZDD A;  4QZA A;  5F9N A;  1NKC A;  4M9N A;  7ICO A;  4PHD A;  1S76 D;  2ZYZ B;  1L3V A;  1ZQJ A;  4DSE A;  4DEZ A;  4Q8E A;  8ICV A;  9ICL A;  2HW3 A;  4F3O A;  4RQ2 A;  4QZI A;  3AUO A;  3QEB Z;  1L3S A;  4J9N A;  1A79 A;  3H8W A;  3PO5 A;  3NGD A;  1TFR A;  8ICP A;  5DB8 A;  2RDJ A;  2WCW A;  5DB7 A;  4DL3 A;  5KFK A;  4TQS A;  5FDK A;  5HHH A;  2INB A;  4M9H A;  4O9M A;  1BPB A;  4QWA A;  2ZJ5 A;  3SV4 A;  4JWN A;  2RDI A;  4F4X A;  2VA8 A;  3PX4 A;  8ICX A;  4F4Y A;  4YN4 A;  3EW9 A;  2P66 A;  4TKD A;  2FMQ A;  4FS2 A;  2BCV A;  4DFM A;  2R8G A;  2FPL A;  4F2R A;  2ASL A;  2ZTC A;  4YVZ A;  5KFA A;  1Z00 B;  2JZB B;  4DL5 A;  3LDA A;  1U4B A;  4EYH B;  1ZQR A;  4QZF A;  2J6U A;  4QBN A;  2B21 A;  4DS5 A;  4QWC A;  2DPI A;  3MDA A;  4F93 B;  1IXR A;  1ZQK A;  1KFT A;  1B43 A;  3P1Z A;  2HHT A;  9ICU A;  3PV8 A;  1ZYQ A;  4R8U A;  4RZR A;  3M9N B;  4NLN A;  4RNN A;  4UB1 A;  1ZQS A;  2FMP A;  2ZUD A;  2NRZ A;  3HT3 A;  1WCN A;  1X2I A;  1ARO P;  9ICW A;  4J9S A;  1ZQP A;  3GIK A;  1S77 D;  3RJE A;  5DBA A;  5J0U A;  2DPJ A;  4F5O A;  4NM1 A;  3IM1 A;  2KN7 A;  3GV5 B;  4O3N A;  4ECT A;  2WCZ A;  5KFQ A;  2M9N A;  4F5N A;  1Z3E B;  2C2R A;  4K4G A;  4ECR A;  5KFV A;  2V4R A;  3ZDB A;  3RJH A;  1D9F A;  2PFP A;  1U45 A;  1TV9 A;  4Q43 A;  4UAZ A;  7ICF A;  7ICN A;  4KLI A;  2HHU A;  5KFX A;  2PI4 A;  4O3S A;  5BPC A;  8ICE A;  4IQV A;  2FCO A;  1MC8 A;  5HMM A;  3MFH A;  3LWL A;  3QZ8 A;  1NKE A;  4ELT A;  5DQH A;  4KN7 A;  3NTU A;  4F50 A;  2BKE A;  2FPM A;  5KG4 A;  1ZQC A;  5KFF A;  5IIN A;  1QSS A;  5DDY A;  3GV7 B;  4RQ6 A;  2R8K A;  4I2I A;  8ICH A;  2MUT B;  1XMX A;  5KFI A;  1U9L A;  1U48 A;  3AJV B;  5III A;  4UQG A;  2LYH A;  9ICN A;  1X9S A;  4EBD A;  1OB9 A;  3RB3 A;  3C1Y A;  4ED8 A;  5KT6 A;  5EWE A;  4YR3 A;  4R63 A;  2W9A A;  4DL4 A;  4G3I A;  9ICJ A;  3MR3 A;  4GC6 A;  3ISC A;  4DS4 A;  3IHQ B;  4MFC A;  4ED6 A;  8ICO A;  2WJ0 A;  3AU2 A;  2C2E A;  4Q44 A;  3RR7 A;  3B0X A;  4J9Q A;  4M0A A;  2KTQ A;  7ICE A;  3H7I A;  3V7K A;  3BDP A;  1SKR A;  3TFR A;  2A1J A;  4M6W A;  5DB9 A;  1NK5 A;  2AGP A;  4I2B A;  4KTQ A;  4DQP A;  4UAW A;  1UA0 A;  3RB4 A;  5KFD A;  1LV5 A;  8ICM A;  3BJY A;  1R11 A;  4QZD A;  4DOB A;  5KT5 A;  3GIJ A;  4CCH A;  1ZQE A;  1ZQA A;  1ZP7 A;  2BCS A;  4ELU A;  2BGW A;  3RH6 A;  2J6S A;  2Y1J A;  4PGY A;  4B9L A;  4MEX A;  4JV0 A;  4XA5 A;  4J9O A;  3TAP A;  4TUQ A;  1B22 A;  1NJY A;  3T3F A;  5TZV A;  4BXO B;  8ICL A;  1TKD A;  5KFE A;  2F1H A;  5HNK A;  5L1K A;  1T7P A;  4M9L A;  8ICN A;  3M9O B;  3Q8M A;  3RAX A;  8ICB A;  4JK1 A;  5KFN A;  4I2D A;  4J9R A;  2UVR A;  4IR9 A;  2XY7 A;  1D8L A;  2I9G A;  9ICS A;  2J6T A;  5KFG A;  3HWT A;  1COO A;  5J0P A;  3ORY A;  4ECS A;  1NK8 A;  2FMS A;  1BVS A;  2C2D A;  1MQ3 A;  4I2G A;  9ICK A;  1DOQ A;  2H5X A;  1ZQI A;  3Q8Q B;  5DBB A;  8ICJ A;  5L1L A;  1NK6 A;  4KLG A;  5BOM A;  1OB8 A;  2WIW A;  3MAB A;  4YP3 A;  5KFH A;  5J0T A;  5J2C A;  1NK7 A;  1S0O A;  2ASD A;  2PFQ A;  1TAU A;  1ZQW A;  4B9N A;  7ICM A;  3RB0 A;  4ECX A;  3T5H A;  1JN3 A;  4IRK A;  2JEI A;  4LZG A;  3MDC A;  1K1S A;  5KT7 A;  4EBE A;  4ED7 A;  4I2F A;  1S9F A;  3PX6 A;  4R65 A;  5DBC A;  1ZQM A;  4KLQ A;  2NRV A;  4RT2 A;  3V7L A;  8ICA A;  4DSI A;  3GQC A;  8ICZ A;  5KFZ A;  3PX0 A;  4F5Q A;  8ICY A;  2GW6 A;  4O5C A;  3C2M A;  1V9P A;  3SYZ A;  2F1J A;  5CHG A;  4F8R A;  1D8Y A;  2AJQ A;  4QZH A;  2W8L A;  2IBK A;  3JPS A;  1ZQU A;  3UXP A;  3P1Z B;  4Z6D A;  3JPN A;  3Q8L A;  3QEA Z;  2OST A;  1D9D A;  2BHN A;  4YMM A;  4GXK A;  3BQT A;  3H8J A;  4DO9 A;  4DLG A;  1ZQY A;  5J0W A;  1CEZ A;  4ED3 A;  3GII A;  2NRW A;  2W9B A;  4IQW A;  3ZD8 A;  1TK5 A;  3GFK B;  3V6J A;  9ICH A;  5J2B A;  1S97 A;  2F1I A;  4RQ3 A;  3PW2 A;  4PGQ A;  3M8S A;  2P6U A;  4PHP A;  4F4K A;  7ICQ A;  4IQT A;  3TAQ A;  3Q8K A;  4KLE A;  2R8H A;  5J2G A;  1BPE A;  1QSY A;  1BPZ A;  4UB4 A;  1ZQO A;  4B9M A;  4B9V A;  5KFP A;  1R0V A;  4YQW A;  4B9U A;  2ZJA A;  4DOA A;  4TKK A;  4LVS A;  5J2H A;  7ICK A;  3PMN A;  4I29 A;  9ICM A;  1TVA A;  4DQQ A;  9ICT A;  3MR6 A;  8ICS A;  4C8N A;  4DFK A;  4R66 A;  4E0D A;  3UQ0 A;  4YCX A;  2KFN A;  2PFO A;  7ICS A;  5KFC A;  4QWD A;  2FLN A;  3PY8 A;  5CWR A;  7ICH A;  4RUC A;  3QZ7 A;  2AU0 A;  4MF2 A;  2XY5 A;  4QWB A;  4ECV A;  2FLP A;  4PGX A;  4TUR A;  2I1Q A;  4I2J A;  1MSW D;  3OGU A;  8ICK A;  9ICC A;  2XCP A;  1T8E A;  2W9C A;  4XUS A;  4UBB A;  2FLL A;  4Q45 A;  5J0O A;  2IA6 A;  2PFN A;  9ICE A;  5KG0 A;  4ED1 A;  4KLH A;  4RQ4 A;  1JX4 A;  1NOM A;  5DQG A;  3RAQ A;  1QLN A;  5DLG A;  1LB2 B;  4KLJ A;  2ZTD A;  3HPO A;  3PO4 A;  8ICC A;  4F4Z A;  3ZDA A;  2HHX A;  2BCR A;  1BPX A;  2PI5 A;  3RR8 A;  1DGS A;  3RJG A;  3UQ2 A;  5L9X A;  1KFS A;  1ZQB A;  4Z6C A;  3MR5 A;  4PPX A;  1Y1O A;  4B9T A;  4IR1 A;  3P1Y A;  2ZUB A;  4P4M A;  5DLF A;  2AGO A;  2A1J B;  1U47 A;  5DKW A;  1ZQX A;  1RZT A;  1KSP A;  3GDX A;  4ECW A;  2IMW P;  4XQ8 A;  1Z00 A;  3GIM A;  5DGB A;  4O3O A;  4EZ9 A;  3LK9 A;  2HHW A;  8ICI A;  1ZQG A;  3H4B A;  3FDS A;  1A76 A;  4K4I A;  3K75 D;  5KT3 A;  3TAR A;  1XS9 D;  3TFS A;  2VLD A;  5J0Q A;  4YXJ A;  5DG7 A;  1A77 A;  4RQ1 A;  1K1Q A;  4F5P A;  4GXJ A;  3TAN A;  2AGQ A;  1T3N A;  1NKB A;  4PH5 A;  3BQ1 A;  4ECQ A;  7ICL A;  3RBD A;  3E2E A;  4NLG A;  3SZ2 A;  4PHE A;  1S0M A;  5KFL A;  3EZ5 A;  3T5J A;  2KZ3 A;  4YG2 A;  5J2I A;  3Q8P B;  5KFO A;  3RTV A;  5KTQ A;  1QTM A;  3TQ1 A;  2PXI A;  5DGA A;  2BCU A;  4NY8 A;  4R64 A;  1NJX A;  2UVU A;  3HX0 A;  7ICI A;  2ISO A;  4C8M A;  4RQ5 A;  7ICU A;  3G6X A;  4ECY A;  5IIL A;  2KZZ A;  1SZP A;  2GWS A;  1ZQF A;  1PZN A;  4O5E A;  2XGP A;  1ZQZ A;  3N4M B;  4EEY A;  4FBT A;  1KRP A;  1XO1 A;  4ECZ A;  1JIH A;  2XY6 A;  3EPI A;  4UB2 A;  5KFJ A;  2BQU A;  1RYR A;  4I28 A;  4KLD A;  5J2K A;  4X5V A;  2MUT A;  4YMO A;  3B0Y A;  3UXN A;  1XWL A;  4QZB A;  1SKS A;  1SL2 A;  5KFM A;  1SKW A;  3OSN A;  9ICG A;  2XC9 A;  4MF8 A;  4DFJ A;  3THV A;  4DSK A;  4UBC A;  4M47 A;  4M04 A;  4MFF A;  2BPC A;  4DSL A;  4QZC A;  5HML A;  4DL2 A;  3C5G A;  2Q0Z X;  4O3R A;  7ICR A;  4QZE A;  1HUO A;  4EYI B;  1C7Y A;  4QZG A;  2KFZ A;  2DFL A;  5EOZ A;  4KLT A;  4JUZ A;  8ICF A;  3M8R A;  4O0I A;  8ICG A;  9ICF A;  1ZQV A;  4IQU A;  1ZQT A;  1NK0 A;  4P4O A;  4YR2 A;  3HW8 A;  4P4P A;  4KLO A;  5DB6 A;  4J9P A;  8ICQ A;  4ED2 A;  3N97 B;  1BPD A;  5J2A A;  1X9M A;  2W9B B;  1X9W A;  1MQ2 A;  3MFI A;  2IHM A;  4BWJ A;  7ICT A;  5IIO A;  3RB6 A;  1ZET A;  3Q8S B;  4DOC A;  5IIM A;  4M9G A;  2HVI A;  4FO6 A;  2BR0 A;  5EWF A;  2BCQ A;  4JV2 A;  3H4D A;  2GJW A;  3RH4 A;  1ZJN A;  4I2A A;  2MAX A;  3ZD9 A;  4R8U B;  5L1I A;  2XCA A;  3PW0 A;  5KT4 A;  2R8J A;  3EWA A;  3RJF A;  4QZ9 A;  5J29 A;  1NJW A;  1NK9 A;  4QW8 A;  4I27 A;  4NLK A;  4RT3 A;  3GV8 B;  1ZQH A;  3PW5 A;  4KLF A;  4YR0 A;  3FOV A;  4YD2 A;  4EZ6 A;  1JXL A;  2HHV A;  3HP6 A;  4YD1 A;  5KG5 A;  1KTQ A;  4FS1 A;  2AQ4 A;  5KG6 A;  2BQR A;  4J9K A;  4KLU A;  7ICJ A;  1TK0 A;  1H38 A;  4F5R A;  4F4W A;  3RBE A;  4IRC A;  3MBY A;  2W9C B;  4DQI A;  4UAY A;  4GXI A;  3PR4 A;  3G6Y A;  4ED0 A;  2OKF A;  5DG9 A;  1XSP A;  4GC7 A;  3M9M B;  1XSL A;  3RJI A;  1QSL A;  2JEJ A;  4HYK A;  1ZQN A;  2ZYZ A;  2V4Q A;  2Y1I A;  3RJK A;  4GLX A;  4PHA A;  9ICQ A;  5JUM A;  4M9J A;  5C5J A;  2AQ0 A;  3OHA A;  4J9M A;  4J9L A;  1RYS A;  2P6R A;  4NXZ A;  3ISB A;  1XC9 A;  2W9M A;  3H40 A;  1N48 A;  1RXW A;  2UVW A;  4I2C A;  1JMS A;  1NJZ A;  1BPY A;  1KFD A;  3KHG A;  5KFR A;  5HP4 A;  1S0V A;  1U49 A;  3KHL A;  4O3Q A;  9ICI A;  3UPQ A;  4QBL A;  4KMU A;  4I2H A;  5J0S A;  3RJJ A;  5KFW A;  4KLM A;  3C21 A;  5KT2 A;  4DQS A;  2VA2 A;  4RPX A;  4C8L A;  7ICG A;  1L3T A;  2VAN A;  4DL7 A;  4RNO A;  3MGH A;  1JXE A;  5J0R A;  4QWE A;  2R8I A;  2BQ3 A;  4NLZ A;  9ICB A;  9ICO A;  1KEJ A;  5EWG A;  2EO0 A;  1L5U A;  4DFP A;  2ZTE A;  5KG2 A;  4TUS A;  3PVX A;  4LZD A;  4M6W B;  3OJS A;  2BDP A;  5J2J A;  4IRD A;  4O5K A;  8ICT A;  2JZB A;  4B9S A;  4RQ8 A;  4DF4 A;  4RQ7 A;  3PNC A;  4Z6E A;  4XRH A;  2ZUC A;  4Z6F A;  4F92 B;  3OJU A;  5J0Y A;  2V9W A;  4F2S A;  4MEY A;  9ICA A;  1L3U A;  3JPR A;  2BPF A;  4DWI A;  4I2E A;  5CP2 A;  4RNM A;  9ICR A;  5F9L A;  4RPZ A;  4TQR A;  1T0F A;  4TUP A;  1ZQL A;  4YXM A;  2BPG A;  3ZDE A;  5D49 A;  3Q8R B;  4C8K A;  3EPG A;  5DDM A;  2W8K A;  1HUZ A;  3V6K A;  1T4G A;  4UB5 A;  1RLV A;  1SL1 A;  3C23 A;  1S0N A;  3KTQ A;  1RPL A;  3MR2 A;  3T5K A;  3IEY A;  2VA3 A;  3UXO A;  3RRG A;  4QW9 A;  4DLE A;  3JPQ A;  5KG1 A;  1S10 A;  5L1J A;  1UA1 A;  2OWO A;  1XSN A;  4M2Y A;  2ATL A;  4KIT B;  3SV3 A;  1ZQQ A;  5DQI A;  5CR0 A;  1F1Z A;  4P2H A;  1RZN A;  4UB3 A;  4ZH4 A;  3DNX A;  3PR5 B;  4YFK A;  4DSF A;  3QE9 Y;  1N56 A;  5J2E A;  4RPY A;  1Y88 A;  3KHR A;  2HHQ A;  3MGI A;  5J2D A;  2XGQ A;  3V72 A;  1XU4 A;  3C5F A;  4RUA A;  5IIK A;  3BQ0 A;  5J0X A;  3C2K A;  9ICP A;  3K4G A;  4KLS A; 
#chains in the Genus database with same CATH topology
 3ALR A;  4UB8 U;  3AJV A;  4RU9 A;  1QQ5 A;  5KFU A;  4DF8 A;  1N5W A;  4UAT A;  1TAQ A;  2HHS A;  2FKH B;  1EXN A;  1DRG A;  4Q8F A;  8ICR A;  3N7S C;  1IM4 A;  3RH5 A;  3T5L A;  4AYB C;  4U6P A;  4BGD A;  5D4B A;  3SI8 A;  2E1E A;  2WB1 F;  2F44 A;  2FPK A;  3L5K A;  1RXV A;  4JV1 A;  2HI0 A;  3JPP A;  2KIV A;  3JPT A;  4OJL A;  5KFS A;  7ICP A;  3ISD A;  1KDH A;  5ALT A;  5T14 A;  4FZN A;  4QBO A;  1UQV A;  3GZF A;  4DQR A;  3C1Z A;  3PW7 A;  4KLL A;  3BQ2 A;  5E79 U;  1PVR A;  3PW4 A;  2XO7 A;  1UT5 A;  3H8S A;  3ZDD A;  4M9N A;  5F9N A;  1ZQJ A;  4DEZ A;  2QKQ A;  2D3D A;  3PO5 A;  3NGD A;  1TFR A;  3D6J A;  5DB8 A;  2RDJ A;  1SZH A;  2JH1 A;  2Y9T A;  4Y2S A;  1JRO A;  3IF0 X;  2FMQ A;  4C80 A;  2FI1 A;  4YVZ A;  1U4B A;  1ZQR A;  3QUB A;  4DS5 A;  3MDA A;  1B43 A;  2JR5 A;  4RZR A;  3M9N B;  4RNN A;  2ZUD A;  3IG5 A;  5TIS U;  1WCN A;  9ICW A;  5J0U A;  3GV5 B;  5KFQ A;  2C2R A;  5KFV A;  2GLE A;  4DAP A;  2IOF K;  7ICN A;  4UAZ A;  2G5H B;  4IQV A;  2FCO A;  2KJ9 A;  1ZD3 A;  2CN1 A;  4KN7 A;  2FPM A;  4OCZ A;  1ZQC A;  2R8K A;  5IIN A;  5KFI A;  3BZC A;  2DUY A;  5AKK A;  4ED8 A;  5KT6 A;  3MR3 A;  3QU2 A;  3L3F X;  2KK0 A;  1J2M A;  3IHQ B;  5H2F U;  3ISC A;  2WJ0 A;  3AU2 A;  2QLT A;  3NVV A;  2DWQ A;  2A1J A;  1NK5 A;  4UAW A;  5J8Y C;  3BJY A;  2HDO A;  2WFA A;  3H0L B;  3WKC A;  1OUQ A;  2BCS A;  2KG5 A;  1KW4 A;  4B9L A;  5AI4 A;  4JV0 A;  1NJY A;  3MC1 A;  3T3F A;  4BXO B;  8ICL A;  2NO4 A;  5KFE A;  5L1K A;  1T7P A;  2QAR B;  3Q8M A;  4J9R A;  4EEL A;  3ORY A;  9ICK A;  1DOQ A;  1SV0 C;  5DBB A;  1JAL A;  5L1L A;  2WIW A;  5A0L A;  5ALU A;  5F3X B;  1NK7 A;  4B9N A;  7ICM A;  1T3Q A;  2KD1 A;  3T5H A;  3RB0 A;  2HOF A;  4IRK A;  2WAQ F;  4LZG A;  1YZ7 A;  2H3Q A;  2LKY A;  5KT7 A;  4I2F A;  4UAU A;  2NRV A;  2K60 A;  1L7P A;  4A8E A;  3C2M A;  2CZR A;  2ZIW B;  5CHG A;  4OJ6 A;  2AJQ A;  3UXP A;  1D9D A;  2BHN A;  3WK7 A;  4GXK A;  3BQT A;  3H8J A;  5J0W A;  4ED3 A;  2W9B A;  3ZD8 A;  5J2B A;  3PW2 A;  1QQ7 A;  2P6U A;  4PHP A;  2R8H A;  1QSY A;  1BPZ A;  4UB4 A;  1ED1 A;  4LVS A;  1TVA A;  4DQQ A;  8ICS A;  4E0D A;  3I76 A;  4QWD A;  5ALQ A;  4DA2 A;  5CWR A;  3QZ7 A;  4MF2 A;  4PL2 A;  3IEY B;  2XY5 A;  2OH2 A;  4QWB A;  4PGX A;  4I2J A;  1MSW D;  9ICC A;  2LM1 A;  2XCP A;  1T8E A;  4XUS A;  5J0O A;  2IA6 A;  9ICE A;  3O0F A;  1A6S A;  4KLH A;  4RQ4 A;  1JX4 A;  4G6V A;  3PO4 A;  3ZDA A;  2HHX A;  2BCR A;  1KBU A;  4Y2T A;  3UQ2 A;  4OJP A;  4PZN A;  4B9T A;  4IR1 A;  4DSJ A;  5ALI A;  1Z00 A;  3GIM A;  3LK9 A;  2HCF A;  3N7R C;  4FZL A;  4PL1 A;  4YXJ A;  1F5S A;  5DG7 A;  2D8C A;  3QXG A;  3RBD A;  4PHE A;  5AM5 A;  5KFL A;  3T5J A;  3RTV A;  2PXI A;  2DBY A;  2RHF A;  1NJX A;  7ICI A;  4RQ5 A;  3G6X A;  2PKE A;  1SZP A;  2KIC A;  2LBO A;  3TKA A;  1PZN A;  1ZQZ A;  4Y2V A;  3N4M B;  4ECZ A;  2EAM A;  4F71 A;  2BZF A;  2WF8 A;  2MU2 A;  4YMO A;  3B0Y A;  3UXN A;  3OSN A;  4DFJ A;  2BPC A;  5HML A;  3C5G A;  2YB1 A;  1C7Y A;  2DFL A;  3M8R A;  4O0I A;  2KSO A;  9ICF A;  4IQU A;  1ZQT A;  4P4O A;  1N62 A;  1X9W A;  1CI4 A;  5AKH A;  3BS5 A;  5IIM A;  4M9G A;  2F8L A;  2HVI A;  4FO6 A;  5EWF A;  1L7N A;  3H4D A;  4PZO A;  1ZJN A;  2XVT A;  3ZD9 A;  5L1I A;  5KT4 A;  2H3Z A;  2K4I A;  5J29 A;  1QQ6 A;  4I27 A;  3GV8 B;  1ZQH A;  1F44 A;  4KLF A;  1COK A;  5JTI A;  2IOF A;  1NZB A;  3HP6 A;  4JMU A;  2AQ4 A;  5KG6 A;  2BQR A;  1TK0 A;  4F5R A;  4IRC A;  5KL8 B;  4UAY A;  4GXI A;  3PR4 A;  4ED0 A;  2EAO A;  1RG6 A;  4GLX A;  3TAD A;  3OHA A;  4J9L A;  1WYG A;  2G06 A;  3ED5 A;  1NJZ A;  1BPY A;  3KHG A;  3SAF A;  5KFR A;  5HP4 A;  1X6J A;  4RQN A;  1U49 A;  4CDG A;  4I2H A;  3C21 A;  4C8L A;  2BQ3 A;  1JXE A;  2MRL A;  4Y2Q A;  1KEJ A;  1L5U A;  1Z1V A;  4DFP A;  5KG2 A;  4US8 A;  5J2J A;  1L8O A;  2K8B B;  4Z6F A;  4F92 B;  4F2S A;  2O6K A;  4DWI A;  2BPF A;  5CP2 A;  4RPZ A;  1YNM A;  2KNJ A;  2BPG A;  1ZQ1 C;  4C8K A;  3KTQ A;  3HRD D;  3UXO A;  2VA3 A;  4QW9 A;  3JPQ A;  1S10 A;  1UA1 A;  2OWO A;  2HMX A;  1KKX A;  3SV3 A;  1B0X A;  4QNL A;  1F1Z A;  4UAR A;  1RZN A;  4UB3 A;  4ZH4 A;  3DNX A;  3PR5 B;  3ICX A;  5J2E A;  1KL9 A;  5CRX A;  3MGI A;  5EE1 A;  4RUA A;  2W43 A;  2EO0 A;  2VJ4 A;  4KLS A;  2WTF A;  4BDP A;  3PML A;  1NK4 A;  2XI9 A;  5D46 A;  5KG3 A;  3QU4 A;  5CJ7 A;  2NRT A;  5AKG A;  4KN4 A;  3L4P A;  4FBU A;  3EUB 2;  5J2F A;  3LVV A;  1KLN A;  1HH1 A;  1ZOL A;  2IHN A;  1NI3 A;  3RRH A;  5DG8 A;  4ECU A;  4O3P A;  3ZDC A;  5CB1 A;  4BXO A;  2ALZ A;  1UT8 A;  2JEG A;  2QAR A;  2VJ5 A;  1V38 A;  2ZYZ B;  4PHD A;  3CYM A;  2WF6 A;  4JB3 A;  8ICV A;  2HW3 A;  4F3O A;  4QZI A;  1L3S A;  4J9N A;  1A79 A;  5G5H A;  2RLT A;  5FDK A;  2INB A;  3F53 A;  4M9H A;  4O9M A;  1BPB A;  1FO4 A;  3SV4 A;  4JWN A;  3PX4 A;  8ICX A;  4F4Y A;  4YN4 A;  3EW9 A;  2Z0R A;  3NUQ A;  2W11 A;  2R8G A;  5ALO A;  4FZM A;  2ZTC A;  1Z00 B;  4EYH B;  2ZIW A;  2B21 A;  1V85 A;  4F93 B;  3ONN A;  5G5G A;  2HHT A;  9ICU A;  1ZYQ A;  4E6Z A;  3KBB A;  2NRZ A;  3HT3 A;  3SQI A;  1ARO P;  4F5O A;  3IM1 A;  5ALP A;  4F5N A;  1L6N A;  2W7P A;  1Q3V A;  3TAD C;  1SIJ A;  1TV9 A;  3F5E A;  1BNO A;  8ICE A;  5EE3 A;  5ALH A;  1IV8 A;  2Z7J A;  3NTU A;  2BKE A;  5KFF A;  5DDY A;  4I2I A;  1XMX A;  9ICN A;  3C1Y A;  4YR3 A;  3BZK A;  4R63 A;  2DL0 A;  4DL4 A;  4G3I A;  3UMG A;  8ICO A;  3WKB A;  4Q44 A;  1Q8K A;  2KSO B;  4M0A A;  4LJX A;  3H7I A;  5AM1 A;  3BDP A;  5DB9 A;  4G9B A;  5KNI A;  4DQP A;  3RB4 A;  1RQL A;  4DCC A;  1WWV A;  5AIB A;  2EZZ A;  5KT5 A;  3BS5 B;  4CCH A;  1ZQA A;  4ELU A;  3BS7 A;  2Y1J A;  4MEX A;  3TAP A;  1TKD A;  2OCE A;  3M9O B;  5AM4 A;  4NL9 A;  2E8N A;  3SAG A;  9ICS A;  3HWT A;  1COO A;  4BX9 C;  1BVS A;  4CGZ A;  4P0P B;  2C2D A;  4KX3 A;  4NJ8 A;  5ALY A;  4B6J A;  4KLG A;  3I1Y A;  1UHU A;  3MAB A;  1S0O A;  3SMV A;  3QU5 A;  2KEY A;  3MDC A;  4ED7 A;  4KLQ A;  8ICA A;  3GQC A;  8ICZ A;  5KFZ A;  4UAV A;  3PSI A;  4US9 A;  3WKE A;  2F1J A;  4F8R A;  1IG6 A;  1ZQU A;  3P1Z B;  3JPN A;  3KFU F;  3TAC B;  1CEZ A;  3N28 A;  1PK3 A;  1F0M A;  1TK5 A;  1K5O A;  3GFK B;  4KX5 A;  4F4K A;  4IQT A;  2ZIU B;  4KLE A;  1ZQO A;  2YQE A;  1ECW A;  2K8A A;  4DOA A;  5K4L A;  3H0M B;  2E8M A;  9ICM A;  3AQF A;  1KN5 A;  3MR6 A;  1SV4 A;  4YCX A;  5KFC A;  3AEV A;  1Z19 A;  2FLN A;  2AU0 A;  2ZIX A;  1D8B A;  1M6Y A;  2I1Q A;  1ZD5 A;  2FLL A;  4Q45 A;  2PFN A;  5KG0 A;  4ED1 A;  1URJ A;  5ALL A;  1NOM A;  4FE3 A;  5DLG A;  2EDU A;  5ALM A;  1S5L U;  3UMC A;  3RR8 A;  4BJQ A;  1LKY B;  4EV1 A;  4C7Y A;  2ZUB A;  1KSP A;  3RJH A;  4XQ8 A;  2HHW A;  1NNL A;  3H4B A;  5ALV A;  1XS9 D;  1K1Q A;  1UWV A;  1L8L A;  2LHT A;  3SZ2 A;  4U7C A;  1S0M A;  2XID A;  2BCU A;  4UAS A;  3HX0 A;  4USA A;  7ICU A;  1B4F A;  5ALS A;  2XGP A;  5AK5 A;  5ALK A;  4BUG A;  4FBT A;  3OPX A;  2YTU A;  3WK9 A;  4UB2 A;  5KFJ A;  4I28 A;  2MUT A;  5AKL A;  3E58 A;  1SKS A;  1SKW A;  2XC9 A;  3THV A;  4M04 A;  4DSL A;  4QZC A;  7ICR A;  1HUO A;  8ICF A;  1C20 A;  8ICG A;  2VS1 A;  2RRD A;  1NK0 A;  2HOI A;  4P4P A;  4KLO A;  4J9P A;  3E0F A;  2CRX A;  3DEE A;  1MQ2 A;  5IIO A;  3M6K A;  4DOC A;  3QUC A;  2WHE A;  2BCQ A;  2WF9 A;  4NL9 C;  2GJW A;  5ALR A;  4AYB F;  3PW0 A;  3RJF A;  4QZ9 A;  1NK9 A;  4NLK A;  4WJ3 B;  2JHD A;  4YR0 A;  1JXL A;  1J2N A;  3WKA A;  4J9K A;  4KLU A;  7ICJ A;  3RBE A;  3AN1 A;  3MBY A;  3MGV A;  2W9C B;  5FP0 A;  3UM9 A;  1A0P A;  3CNH A;  4GC7 A;  5ALZ A;  3RJI A;  1QSL A;  1ZQN A;  2ZYZ A;  5JU5 A;  3RJK A;  9ICQ A;  5JUM A;  4M9J A;  5AKX A;  2YN4 A;  2P6R A;  4J9M A;  4NWI A;  4NXZ A;  3H40 A;  1RXW A;  1S8O A;  2UVW A;  4I2C A;  3PSF A;  5AI5 A;  2Q4T A;  2JH7 A;  1P7D A;  3KZX A;  2GH1 A;  5KT2 A;  2VA2 A;  4RPX A;  3QU9 A;  4DL7 A;  3MGH A;  5J0R A;  4QWE A;  4NLZ A;  2IOH A;  1PK1 A;  2JRZ A;  4TUS A;  1N2X A;  4LZD A;  2BDP A;  4IRD A;  2ES6 A;  3PNC A;  4XRH A;  4UW9 A;  4MEY A;  9ICA A;  3JPR A;  2HBM A;  4I2E A;  9ICR A;  1T0F A;  4YXM A;  3ZDE A;  3DDH A;  1HUZ A;  1T4G A;  4UB5 A;  1RLV A;  1S0N A;  1UPH A;  2K4E A;  4DLE A;  3A0H U;  5L1J A;  4M2Y A;  2NYV A;  4P2H A;  2HHQ A;  4RPY A;  1Y88 A;  5EE9 A;  2XGQ A;  2D6F C;  3OTQ A;  4FS2 A;  9ICP A;  3K4G A;  1RM6 C;  4EBC A;  4Y2P A;  2PMZ C;  2HVH A;  5HR7 A;  4C8O A;  2CV8 A;  5KFY A;  2FLC A;  3DV9 A;  2W03 A;  5IIJ A;  3FYH A;  1ZRM A;  5KG7 A;  2ASJ A;  3GIL A;  2HSZ A;  4ELV A;  4ACO A;  3TI0 A;  3OHB A;  1OW5 A;  3V6H A;  2MA1 A;  4RQ0 A;  1SL0 A;  9ICV A;  5ALW A;  1HJP A;  9ICX A;  5CA7 A;  2C28 A;  8ICU A;  4QZ8 A;  4MFA A;  3AL0 B;  2F8K A;  5AI8 A;  1WCL A;  3EYZ A;  2ZXI A;  1ZQD A;  2WIZ A;  2KZM A;  5KFB A;  7ICV A;  2UVV A;  3JPO A;  7ICO A;  4QZA A;  1NKC A;  1S76 D;  1L3V A;  2A3V A;  2QB0 A;  4DSE A;  4P0P A;  2ZIX B;  3QEB Z;  5AI6 A;  2WCW A;  5DB7 A;  4DL3 A;  4TQS A;  5AKE A;  5HHH A;  4QWA A;  2ZJ5 A;  2WF7 A;  3CP8 A;  3PST A;  4F4X A;  1SWW A;  2WF5 A;  2P66 A;  2AXT U;  2BCV A;  4DFM A;  4F2R A;  2FPL A;  2ASL A;  5KAF U;  4DL5 A;  2JZB B;  3H0R B;  3LDA A;  2DPI A;  2EZX A;  1ZQK A;  1KFT A;  2EAP A;  2G08 A;  3P1Z A;  5GTI U;  4R8U A;  1X6I A;  4UB1 A;  1ZQS A;  1AQ6 A;  1X2I A;  2P35 A;  3M7D A;  2G0A A;  2XIC A;  4J9S A;  3IG8 A;  5AM0 A;  3GIK A;  4MHV A;  3RJE A;  1N5X A;  2Y9U A;  2ZIU A;  4ECR A;  2PFP A;  4Q43 A;  3F2B A;  5KFX A;  2PI4 A;  4O3S A;  5BPC A;  5HMM A;  3MFH A;  1NKE A;  1DXS A;  3HIL A;  4F50 A;  3WK8 A;  5KG4 A;  1QSS A;  8ICH A;  3NRW A;  3GV7 B;  1TE2 A;  2MUT B;  2W3S A;  2DKZ A;  1U48 A;  4QJF B;  5III A;  2LYH A;  4EBD A;  3RB3 A;  5EE0 A;  1XO0 A;  1IIP A;  4GC6 A;  4DS4 A;  4MFC A;  4ED6 A;  2C2E A;  4EEN A;  3SAH A;  3RR7 A;  7ICE A;  1LKY A;  4IS7 A;  4I2B A;  1VLB A;  1N60 A;  1R11 A;  2H3F A;  4DOB A;  3KKA A;  1ZQE A;  4RQM A;  4O3M A;  2BH2 A;  3RFA A;  1TAM A;  1B22 A;  5AIA A;  5TZV A;  5HNK A;  8ICN A;  2E1F A;  3RAX A;  8ICB A;  4JK1 A;  5KFN A;  4I2D A;  4IR9 A;  2XY7 A;  2I9G A;  1T94 A;  2J6T A;  1NZP A;  2FE9 A;  2F3N A;  4IL6 U;  5KFG A;  2FMS A;  1NK8 A;  1MQ3 A;  4I2G A;  2H5X A;  8ICJ A;  1NK6 A;  5BOM A;  2ZIV A;  1OB8 A;  4YP3 A;  5KFH A;  1TAU A;  5J2C A;  1ZQW A;  4ECX A;  1JN3 A;  4P0Q B;  2JEI A;  2OXO A;  2FJ6 A;  1S9F A;  3PX6 A;  4R65 A;  5DBC A;  4RT2 A;  3V7L A;  3PX0 A;  2PMZ F;  4F5Q A;  2YX8 A;  8ICY A;  1X40 A;  4PJ0 U;  3A0B U;  4QZH A;  4NV0 A;  5ALF A;  3Q8L A;  4YMM A;  1SWV A;  1ZQY A;  4DLG A;  3GII A;  2DQN B;  4IQW A;  2W7O A;  1PK1 B;  5ALG A;  1S97 A;  2F1I A;  2G09 A;  3B9J A;  4PGQ A;  3TAQ A;  3QX7 A;  1L7M A;  3SEN A;  5J2G A;  1FIQ A;  3QYP A;  4YQW A;  4TKK A;  2ZJA A;  3FAH A;  5J2H A;  7ICK A;  3PMN A;  3FC4 A;  3AQE A;  4R66 A;  2KFN A;  7ICS A;  7ICH A;  4RUC A;  1VJ5 A;  4Y2R A;  2KIW A;  4TUR A;  3OGU A;  2W9C A;  4UBB A;  4NLB A;  4EEK A;  3F2D A;  5DQG A;  3RAQ A;  1QLN A;  1LB2 B;  2W55 A;  2Y0S C;  3UMB A;  2N1R A;  4F4Z A;  2CXY A;  4CNQ A;  5AIC A;  4EX6 A;  4J03 A;  3RJG A;  1PVQ A;  1KFS A;  2HBL A;  4OJ5 A;  3P1Y A;  4P4M A;  2AGO A;  2IMW P;  5DKW A;  1ZQX A;  4ECW A;  2AH5 A;  4EZ9 A;  3LYS A;  4O3O A;  5DGB A;  1ZQG A;  2B0C A;  4K4I A;  2BDU A;  3TAR A;  2VLD A;  1A77 A;  4RQ1 A;  4CRX A;  2AGQ A;  1T3N A;  1NKB A;  4PH5 A;  2HBJ A;  7ICL A;  1GO3 F;  3PSP A;  4CF4 A;  2OYY A;  3C28 A;  3EZ5 A;  1OXJ A;  5J2I A;  5KTQ A;  3TQ1 A;  5DGA A;  2UVU A;  2ISO A;  5AK6 A;  4C8M A;  2DGZ A;  2KZZ A;  2GWS A;  3NRZ A;  4DFD A;  4EEY A;  1XO1 A;  2XY6 A;  1DGJ A;  3EPI A;  3M1Y A;  2BQU A;  1RYR A;  5GTH U;  4KLD A;  2KV2 A;  4FFD A;  5J2K A;  1HIW A;  1XWL A;  9ICG A;  3NS1 A;  1SL2 A;  4MF8 A;  2QB0 B;  4DSK A;  4QBN A;  4MFF A;  4DL2 A;  2Q0Z X;  4O3R A;  5C0Y A;  1QH9 A;  4QZE A;  4EYI B;  4QZG A;  5EOZ A;  4Y2Y A;  4CF3 A;  5CEH A;  2E8P A;  1BNP A;  2ODG A;  3CW2 C;  3HW8 A;  5DB6 A;  8ICQ A;  3KKA C;  1BPD A;  1X9M A;  1DK3 A;  3MFI A;  4DAV A;  3AM9 A;  2EQY A;  3RB6 A;  1ZET A;  3Q8S B;  3NAS A;  1YT3 A;  2BR0 A;  2LM4 A;  4F72 A;  1O08 A;  4I2A A;  2K4P A;  2KVS A;  4R8U B;  2R8J A;  2XCA A;  3KD3 A;  4QW8 A;  1RQN A;  3PW5 A;  5KAI U;  4EZ6 A;  2HHV A;  2MSN A;  4YD1 A;  1KTQ A;  4FS1 A;  1ZRN A;  4F4W A;  1L7O A;  4Y2X A;  4QIW C;  2B6G A;  2OKF A;  1XSP A;  1XSL A;  2Y1I A;  3PZP A;  4PHA A;  5C5J A;  2AQ0 A;  3ISB A;  1XC9 A;  2H3V A;  1PUZ A;  2JJQ A;  1S0V A;  3KHL A;  1SB3 C;  2FDR A;  4QBL A;  4KMU A;  5J0S A;  3RJJ A;  5KFW A;  7ICG A;  2NV3 A;  4DQS A;  2ESE A;  5KL1 B;  1V97 A;  4RNO A;  3RF9 A;  4UB6 U;  3NVW A;  3PVX A;  2E8O A;  4CE6 A;  4O5K A;  2JZB A;  2LPE A;  4Z6E A;  2YML A;  4OO1 J;  5J0Y A;  3QUT A;  2V9W A;  1L3U A;  1PVP A;  4RNM A;  4C4S A;  5D49 A;  3Q8R B;  3U26 A;  3HJE A;  5DDM A;  2W8K A;  3V6K A;  1SL1 A;  3C23 A;  1RPL A;  3MR2 A;  3T5K A;  3AMZ A;  2LYA A;  3IDW A;  1XSN A;  2IXS A;  2ATL A;  5AHX A;  1ZQQ A;  5DQI A;  5CR0 A;  2W8M A;  1N56 A;  4YFK A;  2ZIV B;  2Y0S F;  3V72 A;  1XU4 A;  3D2S A;  3ZI4 A;  5IIK A;  3BQ0 A;  5J0X A;  3C2K A;  4GFJ A;  5HHI A;  4BWM A;  3OSP A;  1IPI A;  1FFU A;  2C22 A;  4F91 B;  2F2A B;  1GEF A;  3ETR A;  3K1R B;  1BGX T;  2ZJ8 A;  1TK8 A;  2NRX A;  3LWM A;  3KHH A;  1ZJM A;  3C2L A;  1CUK A;  3ETL A;  4DL6 A;  3BQ7 A;  2LI6 A;  2ISP A;  2JEF A;  4K4H A;  3G6V A;  4YMN A;  4JWM A;  5KFT A;  8ICW A;  2W3R A;  3I28 A;  5AM3 A;  4OJO A;  5BOL A;  3AU6 A;  3K1Z A;  3M6Z A;  4NM2 A;  5ALD A;  3V7J A;  2CPR A;  2YMP A;  2A19 A;  4Q8E A;  9ICL A;  4RQ2 A;  3AUO A;  3H8W A;  2OEH A;  8ICP A;  2NO5 A;  2GOL A;  2VKQ A;  1RYU A;  5KFK A;  2E5S A;  4P0Q A;  3F2C A;  3N7P D;  1Z4N A;  4LQE A;  2RDI A;  2VA8 A;  1FEZ A;  3VC8 A;  4TKD A;  5ALN A;  5KFA A;  8ICI A;  2J6U A;  1MN8 A;  1X42 A;  4QZF A;  4QWC A;  1IXR A;  2KOB A;  1O03 A;  3PV8 A;  1J97 A;  4NLN A;  1Q46 A;  2H3I A;  2FMP A;  5AKZ A;  5B5E U;  2A1A A;  5B66 U;  1KQQ A;  1ZQP A;  1S77 D;  2R18 A;  5DBA A;  2DPJ A;  4NM1 A;  2KN7 A;  2E3T A;  4O3N A;  4ECT A;  2WCZ A;  3BT7 A;  2M9N A;  1X66 A;  4K4G A;  1Z3E B;  3HKZ C;  3J81 j;  2V4R A;  2ZXH A;  3ZDB A;  1FFV A;  1D9F A;  1N61 A;  1U45 A;  2KJ8 A;  4QIW F;  7ICF A;  4KLI A;  2HHU A;  2I6X A;  1MC8 A;  3LWL A;  4ELT A;  3QZ8 A;  1JUD A;  3WK4 A;  5DQH A;  2KVC A;  2JV3 A;  4RQ6 A;  1U9L A;  2W04 A;  1SXE A;  3AJV B;  2ZG6 A;  4UQG A;  5JRT A;  1X9S A;  1OB9 A;  3C29 A;  5EWE A;  2W9A A;  9ICJ A;  2YMQ A;  2W54 A;  1WWU A;  4C7Z A;  3NVZ A;  1RDF A;  3B0X A;  4J9Q A;  2KTQ A;  3V7K A;  1SKR A;  3TFR A;  4M6W A;  3QNM A;  2AGP A;  4KTQ A;  8ICM A;  2OST A;  1UA0 A;  5KFD A;  1LV5 A;  4QZD A;  3GIJ A;  2FL3 A;  3QUQ A;  2JMG A;  1ZP7 A;  2YB4 A;  2BGW A;  1ZXI A;  3RH6 A;  2J6S A;  4PGY A;  4G6U A;  2YMM A;  3SEI A;  4XA5 A;  4J9O A;  4TUQ A;  2F1H A;  4M9L A;  3IRU A;  2UVR A;  1D8L A;  5AK3 A;  4ECS A;  5J0P A;  1N63 A;  1ZQI A;  3Q8Q B;  3WU2 U;  4OD0 A;  5J0T A;  2ASD A;  2PFQ A;  3KOO A;  1K1S A;  4EBE A;  1HEK A;  1CRX A;  1ZQM A;  3IV6 A;  4DSI A;  3SR6 A;  2F77 X;  5AKJ A;  3IP4 B;  1WUD A;  2GW6 A;  4O5C A;  1V9P A;  3SYZ A;  2LMR A;  1D8Y A;  1Z1B A;  2W8L A;  2IBK A;  3JPS A;  4CF5 A;  4Z6D A;  2EAN A;  3QEA Z;  4DO9 A;  2NRW A;  9ICH A;  3V6J A;  4RQ3 A;  3M8S A;  7ICQ A;  1YZ6 A;  3Q8K A;  1BPE A;  4B9V A;  4B9M A;  2YY6 A;  5KFP A;  1R0V A;  4B9U A;  4I29 A;  4KMO B;  9ICT A;  4C8N A;  4DFK A;  3UQ0 A;  1ZD2 P;  2HOQ A;  3D2N A;  2PFO A;  3PY8 A;  2I5H A;  4ECV A;  2FLP A;  1DK2 A;  2OM6 A;  8ICK A;  1JRP A;  2HBK A;  1QCK A;  2G07 A;  3KZI U;  1VDV A;  3D2Q A;  4KLJ A;  2ZTD A;  3HPO A;  8ICC A;  1BPX A;  2PI5 A;  2VIX A;  1DGS A;  4ICA A;  5L9X A;  1ZQB A;  4Z6C A;  3MR5 A;  4PPX A;  1Y1O A;  5DLF A;  1U47 A;  1RZT A;  2A1J B;  2FKC A;  3GDX A;  4C4R A;  3FDS A;  1A76 A;  3K75 D;  5KT3 A;  3TFS A;  2JXJ A;  5J0Q A;  2WB1 C;  4F5P A;  4GXJ A;  3TAN A;  1MA7 A;  1Z4O A;  2DBS A;  3BQ1 A;  4ECQ A;  3E2E A;  4NLG A;  2AHO B;  2M0N A;  5HR6 A;  2KHQ A;  3IN5 A;  2KKV A;  2KZ3 A;  4YG2 A;  3Q8P B;  5KFO A;  4NY8 A;  1QTM A;  5AKI A;  4R64 A;  3HKZ F;  4ECY A;  5IIL A;  1JI7 A;  4O5E A;  3R9K A;  1KRP A;  1JIH A;  3LVW A;  4X5V A;  1ZQF A;  4QZB A;  5KFM A;  2EH9 A;  3GU3 A;  4M47 A;  4UBC A;  4ZQU A;  3WK6 A;  5AI9 A;  4C0Z A;  2KFZ A;  1SXD A;  1UCV A;  2QB1 A;  3WKD A;  4KLT A;  4JUZ A;  5AM2 A;  2KE7 A;  1ZQV A;  2OHF A;  2KKP A;  4YR2 A;  4ED2 A;  3N97 B;  5J2A A;  2LYB A;  2F76 X;  2W9B B;  5AI0 A;  2RP5 A;  2IHM A;  4BWJ A;  7ICT A;  3F5A A;  4Y2J A;  3WK5 A;  4JV2 A;  3RH4 A;  4AP9 A;  2MAX A;  3EWA A;  2DF4 B;  1NJW A;  3T79 A;  2EZY A;  4EX7 A;  1WG8 A;  2KJ5 A;  4RT3 A;  3FOV A;  4YD2 A;  5KG5 A;  1H38 A;  4DQI A;  3G6Y A;  5DG9 A;  3M9M B;  2JEJ A;  4HYK A;  2V4Q A;  1LVH A;  1X9X A;  1RYS A;  2W9M A;  1N48 A;  5ALX A;  5AK4 A;  1JMS A;  1KFD A;  2G5I B;  2L5Y A;  3VCB A;  4O3Q A;  9ICI A;  3UPQ A;  4KLM A;  3QU7 A;  1L3T A;  2VAN A;  3SD7 A;  4HAI A;  2R8I A;  9ICB A;  4ZOH C;  9ICO A;  4IC9 A;  5EWG A;  5L1M A;  1Q3U A;  2ZTE A;  3NVY A;  4M6W B;  3OJS A;  8ICT A;  1ZD4 A;  4GIB A;  4B9S A;  4RQ8 A;  4DF4 A;  4RQ7 A;  2RQ5 A;  2ZUC A;  5ALJ A;  2K4H A;  3S6J A;  3OJU A;  3H8M A;  5ALE A;  5F9L A;  5J8Y A;  4TQR A;  4NLC A;  4TUP A;  1XNS A;  2KHV A;  1ZQL A;  4C4T A;  2KMD A;  3EPG A;  2KP7 A;  2GO7 A;  3IEY A;  5AKY A;  2K89 A;  3RRG A;  5KG1 A;  2DKX A;  4KIT B;  1SGG A;  2JGA A;  4DSF A;  3QE9 Y;  3KHR A;  4Y2U A;  5J2D A;  2WAQ C;  3C5F A;  1SV0 A;  3CRX A;  2K8C B;  3FM9 A; 
#chains in the Genus database with same CATH homology
 5HHI A;  2WTF A;  4BWM A;  4EBC A;  4BDP A;  3PML A;  3OSP A;  1NK4 A;  3AJV A;  4RU9 A;  5KFU A;  2HVH A;  4DF8 A;  2C22 A;  4C8O A;  1IPI A;  4F91 B;  1TAQ A;  2HHS A;  2FKH B;  1EXN A;  4Q8F A;  5D46 A;  5KG3 A;  2CV8 A;  5KFY A;  8ICR A;  1IM4 A;  2FLC A;  1GEF A;  3RH5 A;  3T5L A;  1BGX T;  2NRT A;  4BGD A;  5CJ7 A;  5D4B A;  3SI8 A;  2ZJ8 A;  1TK8 A;  2NRX A;  4KN4 A;  3LWM A;  3KHH A;  5IIJ A;  2FPK A;  3FYH A;  1ZJM A;  3C2L A;  1RXV A;  4FBU A;  4JV1 A;  1CUK A;  5KG7 A;  3GIL A;  2ASJ A;  3JPP A;  5J2F A;  4ELV A;  3TI0 A;  3JPT A;  3ETL A;  3OHB A;  5KFS A;  4DL6 A;  1KLN A;  7ICP A;  3ISD A;  3V6H A;  1KDH A;  1HH1 A;  4RQ0 A;  1SL0 A;  9ICV A;  2ISP A;  1HJP A;  2JEF A;  9ICX A;  4QBO A;  5CA7 A;  2C28 A;  4K4H A;  3G6V A;  4YMN A;  2IHN A;  4DSJ A;  8ICU A;  3RRH A;  4QZ8 A;  4DQR A;  4JWM A;  3C1Z A;  5KFT A;  3PW7 A;  8ICW A;  4MFA A;  4KLL A;  5DG8 A;  4ECU A;  5BOL A;  4O3P A;  3BQ2 A;  3ZDC A;  5CB1 A;  1WCL A;  3EYZ A;  3AU6 A;  2ALZ A;  1ZQD A;  3PW4 A;  4NM2 A;  4BXO A;  1UT8 A;  2XO7 A;  2WIZ A;  2KZM A;  5KFB A;  7ICV A;  2UVV A;  3JPO A;  3V7J A;  1UT5 A;  3H8S A;  2JEG A;  3ZDD A;  4QZA A;  5F9N A;  1NKC A;  4M9N A;  7ICO A;  4PHD A;  1S76 D;  2ZYZ B;  1L3V A;  1ZQJ A;  4DSE A;  4DEZ A;  4Q8E A;  8ICV A;  9ICL A;  2HW3 A;  4F3O A;  4RQ2 A;  4QZI A;  3AUO A;  3QEB Z;  1L3S A;  4J9N A;  1A79 A;  3H8W A;  3PO5 A;  3NGD A;  1TFR A;  8ICP A;  5DB8 A;  2RDJ A;  2WCW A;  5DB7 A;  4DL3 A;  5KFK A;  4TQS A;  5FDK A;  5HHH A;  2INB A;  4M9H A;  4O9M A;  4LQE A;  1BPB A;  4QWA A;  2ZJ5 A;  3SV4 A;  4JWN A;  2RDI A;  4F4X A;  2VA8 A;  3PX4 A;  8ICX A;  4F4Y A;  3IF0 X;  4YN4 A;  3EW9 A;  2P66 A;  2Z0R A;  4TKD A;  2FMQ A;  4FS2 A;  2BCV A;  4DFM A;  2R8G A;  2FPL A;  4F2R A;  2ASL A;  2ZTC A;  4YVZ A;  5KFA A;  1Z00 B;  2JZB B;  4DL5 A;  3LDA A;  1U4B A;  4EYH B;  1ZQR A;  4QZF A;  2J6U A;  4QBN A;  2B21 A;  4DS5 A;  4QWC A;  2DPI A;  3MDA A;  4F93 B;  1IXR A;  1ZQK A;  1KFT A;  1B43 A;  3P1Z A;  2HHT A;  9ICU A;  3PV8 A;  1ZYQ A;  4E6Z A;  4R8U A;  4RZR A;  3M9N B;  4NLN A;  4RNN A;  4UB1 A;  1ZQS A;  2FMP A;  2ZUD A;  2NRZ A;  3HT3 A;  1WCN A;  1X2I A;  1ARO P;  9ICW A;  4J9S A;  1ZQP A;  3GIK A;  1S77 D;  3RJE A;  5DBA A;  5J0U A;  2DPJ A;  4F5O A;  4NM1 A;  3IM1 A;  2KN7 A;  3GV5 B;  4O3N A;  4ECT A;  2WCZ A;  3BT7 A;  5KFQ A;  2M9N A;  4F5N A;  1Z3E B;  2C2R A;  4K4G A;  4ECR A;  5KFV A;  2V4R A;  3ZDB A;  3RJH A;  4DAP A;  1D9F A;  2PFP A;  1U45 A;  1TV9 A;  4Q43 A;  4UAZ A;  7ICF A;  7ICN A;  4KLI A;  2HHU A;  5KFX A;  2PI4 A;  4O3S A;  5BPC A;  8ICE A;  4IQV A;  2FCO A;  1MC8 A;  5HMM A;  3MFH A;  3LWL A;  3QZ8 A;  1NKE A;  4ELT A;  5DQH A;  4KN7 A;  3NTU A;  4F50 A;  2BKE A;  2FPM A;  5KG4 A;  1ZQC A;  5KFF A;  5IIN A;  1QSS A;  5DDY A;  3GV7 B;  4RQ6 A;  2R8K A;  4I2I A;  8ICH A;  2MUT B;  1XMX A;  5KFI A;  1U9L A;  1U48 A;  3AJV B;  5III A;  4UQG A;  2LYH A;  9ICN A;  1X9S A;  4EBD A;  1OB9 A;  3RB3 A;  3C1Y A;  4ED8 A;  5KT6 A;  5EWE A;  4YR3 A;  4R63 A;  2W9A A;  4DL4 A;  4G3I A;  9ICJ A;  3MR3 A;  4GC6 A;  3ISC A;  4DS4 A;  3IHQ B;  4MFC A;  4ED6 A;  8ICO A;  2WJ0 A;  3AU2 A;  2C2E A;  4Q44 A;  3RR7 A;  3B0X A;  4J9Q A;  4M0A A;  2KTQ A;  7ICE A;  3H7I A;  3V7K A;  3BDP A;  1SKR A;  3TFR A;  2A1J A;  4M6W A;  5DB9 A;  1NK5 A;  2AGP A;  4I2B A;  4KTQ A;  4DQP A;  4UAW A;  1UA0 A;  3RB4 A;  5KFD A;  1LV5 A;  8ICM A;  3BJY A;  1R11 A;  4QZD A;  4DOB A;  5KT5 A;  3GIJ A;  2FL3 A;  4CCH A;  1ZQE A;  1ZQA A;  1ZP7 A;  2BCS A;  4ELU A;  2BGW A;  3RH6 A;  2J6S A;  2Y1J A;  4PGY A;  4B9L A;  4G6U A;  4MEX A;  2BH2 A;  4JV0 A;  4XA5 A;  4J9O A;  3TAP A;  4TUQ A;  1B22 A;  1NJY A;  3T3F A;  5TZV A;  4BXO B;  8ICL A;  1TKD A;  5KFE A;  2F1H A;  5HNK A;  5L1K A;  1T7P A;  4M9L A;  8ICN A;  3M9O B;  3Q8M A;  3RAX A;  8ICB A;  4JK1 A;  5KFN A;  4I2D A;  4J9R A;  2UVR A;  4IR9 A;  2XY7 A;  1D8L A;  2I9G A;  9ICS A;  2J6T A;  5KFG A;  3HWT A;  1COO A;  5J0P A;  3ORY A;  4ECS A;  1NK8 A;  2FMS A;  1BVS A;  2C2D A;  1MQ3 A;  4I2G A;  9ICK A;  1DOQ A;  2H5X A;  1ZQI A;  3Q8Q B;  5DBB A;  8ICJ A;  5L1L A;  1NK6 A;  4KLG A;  5BOM A;  1OB8 A;  2WIW A;  3MAB A;  4YP3 A;  5KFH A;  5J0T A;  5J2C A;  1NK7 A;  1S0O A;  2ASD A;  2PFQ A;  1TAU A;  1ZQW A;  4B9N A;  7ICM A;  3RB0 A;  4ECX A;  3T5H A;  1JN3 A;  4IRK A;  2JEI A;  4LZG A;  3MDC A;  1K1S A;  5KT7 A;  4EBE A;  4ED7 A;  4I2F A;  1S9F A;  3PX6 A;  4R65 A;  5DBC A;  1ZQM A;  4KLQ A;  2NRV A;  4RT2 A;  3V7L A;  8ICA A;  4DSI A;  3GQC A;  8ICZ A;  5KFZ A;  3PX0 A;  4F5Q A;  8ICY A;  2GW6 A;  4O5C A;  3C2M A;  1V9P A;  3SYZ A;  2F1J A;  5CHG A;  4F8R A;  2CZR A;  1D8Y A;  2AJQ A;  4QZH A;  2W8L A;  2IBK A;  3JPS A;  1ZQU A;  3UXP A;  3P1Z B;  4Z6D A;  3JPN A;  3Q8L A;  3QEA Z;  2OST A;  1D9D A;  2BHN A;  4YMM A;  4GXK A;  3BQT A;  3H8J A;  4DO9 A;  4DLG A;  1ZQY A;  5J0W A;  1CEZ A;  4ED3 A;  3GII A;  2NRW A;  2W9B A;  4IQW A;  3ZD8 A;  1TK5 A;  3GFK B;  3V6J A;  9ICH A;  5J2B A;  1S97 A;  2F1I A;  4RQ3 A;  3PW2 A;  4PGQ A;  3M8S A;  2P6U A;  4PHP A;  4F4K A;  7ICQ A;  4IQT A;  3TAQ A;  3Q8K A;  4KLE A;  2R8H A;  5J2G A;  1BPE A;  1QSY A;  1BPZ A;  4UB4 A;  1ZQO A;  4B9M A;  4B9V A;  5KFP A;  1R0V A;  4YQW A;  4B9U A;  2ZJA A;  4DOA A;  4TKK A;  4LVS A;  5J2H A;  7ICK A;  3PMN A;  4I29 A;  9ICM A;  1TVA A;  4DQQ A;  9ICT A;  3MR6 A;  8ICS A;  4C8N A;  4DFK A;  4R66 A;  4E0D A;  3UQ0 A;  4YCX A;  2KFN A;  2PFO A;  7ICS A;  5KFC A;  4QWD A;  4DA2 A;  2FLN A;  3PY8 A;  5CWR A;  7ICH A;  4RUC A;  3QZ7 A;  2AU0 A;  4MF2 A;  3IEY B;  2FKC A;  2XY5 A;  4QWB A;  4ECV A;  2FLP A;  4PGX A;  4TUR A;  2I1Q A;  4I2J A;  1MSW D;  3OGU A;  8ICK A;  9ICC A;  2XCP A;  1T8E A;  2W9C A;  4XUS A;  4UBB A;  2FLL A;  4Q45 A;  5J0O A;  2IA6 A;  2PFN A;  9ICE A;  5KG0 A;  4ED1 A;  4KLH A;  4RQ4 A;  1JX4 A;  1NOM A;  5DQG A;  3RAQ A;  1QLN A;  4G6V A;  5DLG A;  1LB2 B;  4KLJ A;  2ZTD A;  3HPO A;  3PO4 A;  8ICC A;  4F4Z A;  3ZDA A;  2HHX A;  2BCR A;  1BPX A;  2PI5 A;  3RR8 A;  1DGS A;  3RJG A;  3UQ2 A;  5L9X A;  1KFS A;  1ZQB A;  4Z6C A;  3MR5 A;  4PPX A;  1Y1O A;  4B9T A;  4IR1 A;  3P1Y A;  4EV1 A;  2ZUB A;  4P4M A;  5DLF A;  2AGO A;  2A1J B;  1U47 A;  5DKW A;  1ZQX A;  1RZT A;  1KSP A;  3GDX A;  4ECW A;  2IMW P;  4XQ8 A;  1Z00 A;  3GIM A;  5DGB A;  4O3O A;  4EZ9 A;  3LK9 A;  2HHW A;  8ICI A;  1ZQG A;  3H4B A;  3FDS A;  1A76 A;  4K4I A;  3K75 D;  5KT3 A;  3TAR A;  1XS9 D;  3TFS A;  2VLD A;  5J0Q A;  4YXJ A;  5DG7 A;  1A77 A;  4RQ1 A;  1K1Q A;  4F5P A;  4GXJ A;  3TAN A;  2AGQ A;  1T3N A;  1NKB A;  2DBS A;  4PH5 A;  3BQ1 A;  4ECQ A;  1UWV A;  7ICL A;  3RBD A;  3E2E A;  4NLG A;  3SZ2 A;  4PHE A;  1S0M A;  5KFL A;  3EZ5 A;  3T5J A;  2KZ3 A;  4YG2 A;  5J2I A;  3Q8P B;  5KFO A;  3RTV A;  5KTQ A;  1QTM A;  3TQ1 A;  2PXI A;  5DGA A;  2BCU A;  4NY8 A;  4R64 A;  1NJX A;  2UVU A;  3HX0 A;  7ICI A;  2ISO A;  4C8M A;  4RQ5 A;  7ICU A;  3G6X A;  4ECY A;  5IIL A;  2KZZ A;  1SZP A;  2GWS A;  1ZQF A;  1PZN A;  4O5E A;  2XGP A;  1ZQZ A;  3N4M B;  4EEY A;  4FBT A;  1KRP A;  1XO1 A;  4ECZ A;  1JIH A;  2XY6 A;  3EPI A;  4UB2 A;  5KFJ A;  2BQU A;  1RYR A;  4I28 A;  4KLD A;  5J2K A;  4X5V A;  2MUT A;  4YMO A;  3B0Y A;  3UXN A;  1XWL A;  4QZB A;  1SKS A;  1SL2 A;  5KFM A;  1SKW A;  3OSN A;  9ICG A;  2XC9 A;  4MF8 A;  4DFJ A;  3THV A;  4DSK A;  4UBC A;  4M47 A;  4M04 A;  4MFF A;  2BPC A;  4DSL A;  4QZC A;  5HML A;  4DL2 A;  3C5G A;  4ZQU A;  2Q0Z X;  4O3R A;  7ICR A;  4QZE A;  1HUO A;  4EYI B;  1C7Y A;  4QZG A;  2KFZ A;  2DFL A;  5EOZ A;  4KLT A;  4JUZ A;  8ICF A;  3M8R A;  4O0I A;  8ICG A;  9ICF A;  1ZQV A;  2VS1 A;  4IQU A;  1ZQT A;  1NK0 A;  4P4O A;  4YR2 A;  3HW8 A;  4P4P A;  4KLO A;  5DB6 A;  4J9P A;  8ICQ A;  4ED2 A;  3N97 B;  1BPD A;  5J2A A;  1X9M A;  2W9B B;  1X9W A;  1MQ2 A;  3MFI A;  4DAV A;  2IHM A;  4BWJ A;  7ICT A;  5IIO A;  3RB6 A;  1ZET A;  3Q8S B;  4DOC A;  5IIM A;  4M9G A;  2HVI A;  4FO6 A;  2BR0 A;  5EWF A;  2BCQ A;  4JV2 A;  3H4D A;  2GJW A;  3RH4 A;  1ZJN A;  4I2A A;  2MAX A;  3ZD9 A;  4R8U B;  5L1I A;  2XCA A;  3PW0 A;  5KT4 A;  2R8J A;  3EWA A;  3RJF A;  4QZ9 A;  5J29 A;  1NJW A;  1NK9 A;  4QW8 A;  4I27 A;  4NLK A;  4RT3 A;  3GV8 B;  1ZQH A;  3PW5 A;  4KLF A;  4YR0 A;  3FOV A;  4YD2 A;  4EZ6 A;  1JXL A;  2HHV A;  3HP6 A;  4YD1 A;  5KG5 A;  1KTQ A;  4FS1 A;  2AQ4 A;  5KG6 A;  2BQR A;  4J9K A;  4KLU A;  7ICJ A;  1TK0 A;  1H38 A;  4F5R A;  4F4W A;  3RBE A;  4IRC A;  3MBY A;  2W9C B;  4DQI A;  4UAY A;  4GXI A;  3PR4 A;  3G6Y A;  4ED0 A;  2OKF A;  5DG9 A;  1XSP A;  4GC7 A;  3M9M B;  1XSL A;  3RJI A;  1QSL A;  2JEJ A;  4HYK A;  1ZQN A;  2ZYZ A;  2V4Q A;  2Y1I A;  3RJK A;  4GLX A;  4PHA A;  9ICQ A;  5JUM A;  4M9J A;  5C5J A;  2AQ0 A;  3OHA A;  4J9M A;  4J9L A;  1RYS A;  2P6R A;  4NXZ A;  3ISB A;  1XC9 A;  2W9M A;  3H40 A;  1N48 A;  1RXW A;  2JJQ A;  2UVW A;  4I2C A;  1JMS A;  1NJZ A;  1BPY A;  1KFD A;  3KHG A;  5KFR A;  5HP4 A;  1S0V A;  1U49 A;  3KHL A;  4O3Q A;  9ICI A;  3UPQ A;  4QBL A;  4KMU A;  4I2H A;  5J0S A;  3RJJ A;  5KFW A;  4KLM A;  3C21 A;  5KT2 A;  4DQS A;  2VA2 A;  4RPX A;  4C8L A;  7ICG A;  1L3T A;  2VAN A;  4DL7 A;  4RNO A;  3MGH A;  1JXE A;  5J0R A;  4QWE A;  2R8I A;  2BQ3 A;  4NLZ A;  9ICB A;  9ICO A;  1KEJ A;  5EWG A;  2EO0 A;  1L5U A;  4DFP A;  2ZTE A;  5KG2 A;  4TUS A;  3PVX A;  4LZD A;  4M6W B;  3OJS A;  2BDP A;  5J2J A;  4IRD A;  4O5K A;  8ICT A;  2JZB A;  4B9S A;  4RQ8 A;  4DF4 A;  4RQ7 A;  3PNC A;  4Z6E A;  4XRH A;  2ZUC A;  4Z6F A;  4F92 B;  3OJU A;  5J0Y A;  2V9W A;  4F2S A;  4MEY A;  9ICA A;  1L3U A;  3JPR A;  2BPF A;  4DWI A;  4I2E A;  5CP2 A;  4RNM A;  9ICR A;  5F9L A;  4RPZ A;  4TQR A;  1T0F A;  1YNM A;  4TUP A;  1ZQL A;  4YXM A;  2BPG A;  3ZDE A;  5D49 A;  3Q8R B;  4C8K A;  3EPG A;  5DDM A;  2W8K A;  1HUZ A;  3V6K A;  1T4G A;  4UB5 A;  1RLV A;  1SL1 A;  3C23 A;  1S0N A;  3KTQ A;  1RPL A;  3MR2 A;  3T5K A;  3IEY A;  2VA3 A;  3UXO A;  3RRG A;  4QW9 A;  4DLE A;  3JPQ A;  5KG1 A;  1S10 A;  5L1J A;  1UA1 A;  2OWO A;  1XSN A;  4M2Y A;  2IXS A;  2ATL A;  4KIT B;  3SV3 A;  1ZQQ A;  5DQI A;  5CR0 A;  1F1Z A;  2W8M A;  4P2H A;  1RZN A;  4UB3 A;  4ZH4 A;  3DNX A;  3PR5 B;  4YFK A;  4DSF A;  3QE9 Y;  1N56 A;  5J2E A;  4RPY A;  1Y88 A;  3KHR A;  2HHQ A;  3MGI A;  5J2D A;  2XGQ A;  3V72 A;  1XU4 A;  3C5F A;  4RUA A;  5IIK A;  3BQ0 A;  5J0X A;  3C2K A;  9ICP A;  3K4G A;  4KLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...