1Y88A

Crystal structure of protein of unknown function af1548
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
184
structure length
184
Chain Sequence
NLYFQGHMVARLLEEHGFETKTNVIVQGNCVEQEIDVVAERDGERYMIECKFHNIPVYTGLKEAMYTYARFLDVEKHGFTQPWIFTNTKFSEEAKKYAGCVGIKLTGWSYPEKEGIEVLLESKGLYPITILRIDKEVLDELVRAGLVFCRDVVSAGEEKLREIGLSAKKAREVIAEAKKVIGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AF1548
publication title The crystal structure of hypothetical protein AF1548 from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 59
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2004-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1y88A02
3.40.1350.10 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 1y88A01
4FS1A 1T0FA 5J0PA 2ZJ5A 4ECVA 1ZQBA 4YMNA 1S10A 4QZEA 2BQRA 5DB7A 4RQ3A 3HT3A 3G6VA 4ECQA 4YQWA 4I2EA 4QZHA 2RDJA 1NK0A 2R8GA 4RZRA 2J6UA 1A76A 3PW0A 1ZQDA 1EXNA 4ECYA 5J2EA 4F4WA 5KFOA 2W9BA 4I2AA 9ICIA 4DLGA 1MQ3A 4UAZA 1DGSA 4MEXA 4B9VA 4ELUA 4IRDA 2GJWA 4G3IA 2XGQA 2F1JA 4F4KA 1KEJA 4KTQA 4R8UA 2NRXA 1SKSA 2XO7A 5CP2A 7ICQA 1L3TA 2DFLA 3SYZA 8ICAA 1HJPA 3EWAA 1UA1A 2BPFA 3RJJA 5DLFA 2P66A 4EBEA 2ZTDA 3PX4A 3ZDDA 1NOMA 4DOCA 1X9SA 3OSNA 4I29A 1ZQHA 1BPYA 4YXJA 1BPEA 4ED2A 3PO5A 1RXVA 2EO0A 2FPMA 4YCXA 5EWGA 3THVA 5J2KA 5J2HA 2KZMA 5J2AA 5BOLA 3MDAA 2HHXA 4PGQA 1XMXA 5HHIA 2WIZA 4M9GA 4DSJA 3AU6A 1A79A 5DG9A 9ICOA 5L1LA 4DOAA 3MFHA 1ZQJA 3ISCA 8ICIA 4DQPA 4DS5A 5DB9A 7ICLA 1K1SA 2BQUA 4JUZA 4M9JA 4XA5A 3KHGA 1ZQYA 4O3RA 1ZP7A 4RPZA 1S9FA 4B9LA 2R8IA 4TQRA 5CB1A 5C5JA 2PFPA 4ECSA 2W9AA 4KLEA 3MGHA 7ICRA 2HHWA 1DOQA 1ZQEA 2W9MA 3GV5B 4I2BA 3LWMA 3KTQA 7ICPA 5KT5A 3KHHA 5BPCA 4F50A 8ICSA 1ZQPA 4M6WA 5KFAA 3RH5A 3RJFA 3RB0A 4YD1A 3M9NB 3ZDCA 4F2SA 4M47A 4KLSA 4RQ2A 4QZ8A 4QWDA 2KFZA 5CWRA 4DSKA 9ICTA 1ZETA 8ICVA 2JEFA 1ZQGA 3C23A 5KG3A 5KG6A 1NJZA 4TQSA 3M9OB 1U48A 3QEAZ 1JXEA 5KFDA 3GDXA 3P1ZA 4O5KA 4F2RA 1KFTA 4J9NA 4PGYA 1XSLA 4B9MA 2BHNA 4YD2A 4DLEA 4F3OA 1A77A 4BGDA 4ED0A 8ICRA 8ICJA 1U4BA 3RJIA 2V9WA 2PXIA 3AJVB 2A1JA 1L3SA 4B9SA 2ATLA 1D8YA 2XCAA 3M9MB 4KITB 1TK0A 4NLZA 5BOMA 5D46A 3MFIA 3QZ8A 1JN3A 3MR5A 1Z00B 4KN7A 3RB4A 3Q8KA 2NRTA 1KTQA 5F9LA 4J9PA 2MUTB 2KN7A 3B0YA 3GV8B 2C28A 7ICMA 5DBAA 3PR4A 5J2IA 1T7PA 3UXOA 3Q8LA 2J6SA 5KT6A 4QZAA 1IXRA 4QZBA 4J9KA 4NLKA 4PHPA 9ICXA 5DBCA 4KLMA 1NK4A 1OB8A 4R65A 3RJHA 5HMLA 9ICGA 4O3OA 3UXNA 4FBUA 8ICOA 4DL6A 4GXJA 2PI4A 3K75D 5DQIA 5DB6A 4DFKA 3TI0A 1RZTA 4J9OA 4PHDA 8ICNA 9ICAA 1D9FA 2IHMA 4RQ7A 3V7LA 2FMQA 1KLNA 4RQ0A 4ELTA 5EWFA 3QZ7A 5J0QA 3GQCA 7ICUA 1NK5A 4JV0A 4B9UA 9ICCA 4O9MA 5J0RA 1N56A 4NLGA 4EBDA 3K4GA 5DBBA 2C2DA 7ICNA 1ZQWA 1ZQFA 1F1ZA 4CCHA 1KFSA 1JXLA 3Q8MA 1ZQTA 4BWJA 4GXIA 4RNOA 1UA0A 1SZPA 4C8NA 5DB8A 4RQ4A 4JWMA 2WJ0A 9ICFA 2NRZA 3E2EA 2JZBA 4O3PA 3PMLA 5KG7A 4ECTA 4NM1A 4KMUA 3PNCA 2FLNA 8ICHA 4K4IA 5J0TA 3PVXA 8ICGA 8ICCA 4UB1A 3SV3A 3DNXA 4DL5A 3RRHA 3UPQA 3JPSA 5KFPA 5L9XA 1T4GA 1Y88A 3RAXA 3GIIA 2ZJ8A 5KFKA 1LB2B 4TUSA 1RYSA 2W9CB 2ZTEA 4Q8FA 1S0VA 4DFJA 2HVIA 5JUMA 3HW8A 3EPGA 4J9MA 4DOBA 4M2YA 4I27A 4DFMA 4MEYA 3ISDA 3TFSA 4F92B 2ALZA 1B22A 4RPXA 4R64A 3OGUA 4DQRA 4KLFA 4Z6EA 1WCNA 3C2LA 3V6JA 1TK5A 4C8KA 9ICJA 1NKEA 1SL2A 4M9NA 4Z6DA 3G6XA 5KFJA 1TAUA 4MFCA 4I2HA 3GIMA 1AROP 4TUPA 4C8OA 1HH1A 4ED3A 5IIIA 4F4YA 2HHUA 3H7IA 2GWSA 4ED1A 1ZQRA 4NY8A 8ICYA 4RPYA 3BQ0A 1WCLA 4I2CA 3BQTA 5J29A 2BCUA 2PFNA 3NTUA 4RT3A 4Q44A 4RQ6A 4F5PA 5KFMA 1ZQXA 1QSLA 2IBKA 8ICPA 1QSYA 4B9NA 3PR5B 2XY6A 5CJ7A 1BPDA 4PPXA 2HHSA 2FPKA 9ICMA 3LDAA 5HMMA 3Q8SB 3RH4A 3BDPA 3Q8PB 4DS4A 8ICEA 4DQSA 3RTVA 3C1ZA 1ZJNA 8ICFA 4LZGA 5J2CA 4Z6FA 1TV9A 1U9LA 1U49A 1MQ2A 1ZQZA 5KFXA 5KFWA 3SI8A 3JPTA 5IIJA 3OHAA 3PW5A 5DDYA 4UB4A 1HUOA 2HW3A 4ECRA 4YMMA 3ETLA 5J2GA 5IINA 2HHVA 4F93B 5KTQA 3EZ5A 8ICLA 8ICTA 5KFGA 9ICSA 2WIWA 2BGWA 3BQ1A 2AJQA 5DQGA 2PFOA 3V6HA 3GV7B 2A1JB 5CR0A 4QZ9A 3KHLA 1S77D 4QW8A 5KFVA 4GXKA 5KFNA 2R8KA 2KZZA 2FLLA 4QZDA 1NJXA 1RZNA 4GC6A 4YG2A 4GC7A 1TK8A 2Y1JA 4RUAA 4ED8A 4I2FA 1KFDA 9ICRA 3RH6A 4F4ZA 3IM1A 3OHBA 2J6TA 1TVAA 1S0OA 2UVUA 4MF8A 4YN4A 4TKDA 3JPRA 5DG8A 4J9LA 1BPBA 4F5QA 1C7YA 2P6RA 4JV2A 2HHQA 4RU9A 4UBCA 1ZQMA 3G6YA 1H38A 1UT8A 4M9HA 2JEGA 4BXOB 4QWBA 5DGAA 3TQ1A 3B0XA 3T5KA 4K4GA 7ICSA 4J9SA 3V7KA 4FBTA 7ICKA 2FCOA 4NLNA 3GIJA 3MR6A 1T8EA 1BVSA 2R8JA 4XQ8A 4UBBA 1RYRA 4GLXA 4YR2A 8ICUA 2JEIA 2C2EA 3GIKA 1KSPA 3QEBZ 5EOZA 3JPPA 7ICIA 2C2RA 1TFRA 5KT3A 4YR0A 4JWNA 3ZD8A 4I2GA 3LWLA 1B43A 5KT4A 5J0SA 4UAWA 3V6KA 5DDMA 2XY5A 4M04A 1XO1A 4PGXA 3RB6A 4DWIA 4RT2A 4IQVA 4O0IA 2OWOA 4ECXA 1L5UA 1BPZA 3T5HA 4RNMA 1IM4A 3HPOA 5D49A 2ZYZB 1HUZA 3TFRA 3HP6A 5KT2A 3C5GA 3T5LA 1D9DA 1CEZA 3TANA 2KFNA 3Q8RB 4YR3A 5EWEA 3PV8A 2NRWA 1XSNA 2R8HA 2WCZA 5FDKA 3RAQA 4UB5A 5TZVA 4P4MA 7ICHA 4RNNA 2P6UA 4F5NA 5DKWA 2VA2A 4MFFA 3NGDA 5DG7A 1QTMA 4EZ6A 1NJWA 4YMOA 4RQ5A 4QWEA 4Q45A 2W9BB 1NJYA 1ZQLA 2BDPA 3EPIA 5CA7A 1SKRA 3PO4A 1COOA 4EYHB 3MR2A 2ISOA 1UT5A 9ICBA 9ICQA 3AJVA 3EYZA 1X2IA 1K1QA 4ED6A 3T5JA 2ISPA 4R8UB 2AGOA 4F8RA 2INBA 3H8WA 9ICKA 5D4BA 1LV5A 4XRHA 4R66A 5J2BA 4HYKA 4DQQA 1U47A 5KFQA 1Z00A 3H8SA 3GFKB 4DL3A 1KDHA 1ZQUA 1ZQCA 2MUTA 4M0AA 5J2DA 4UQGA 1NK9A 4P4PA 1ZQIA 2IMWP 1V9PA 3ISBA 1NK8A 4UB2A 1SL0A 5J0UA 3SV4A 1PZNA 2BKEA 5J0WA 2VA3A 3ZDBA 4YVZA 3IHQB 5KFRA 3MBYA 3MGIA 1NK7A 2W8KA 3RJGA 1L3UA 2PI5A 4C8MA 3AU2A 4K4HA 9ICEA 9ICHA 1XC9A 2VLDA 4X5VA 4KN4A 9ICVA 2I9GA 2Y1IA 4UB3A 3TARA 4KLDA 4Q43A 3Q8QB 3M8SA 3C2MA 4F5RA 3EW9A 3N4MB 7ICFA 2V4RA 1CUKA 4LVSA 3OJUA 3PW4A 5KFIA 4TKKA 1XSPA 4QBLA 1OB9A 2CV8A 3C21A 4DFPA 3BQ2A 5IIMA 1XU4A 1X9WA 2H5XA 3PMNA 5IILA 3ZDEA 4RQ1A 3M8RA 4I2DA 4IQUA 2I1QA 4EYIB 1ZQQA 2XY7A 5KFYA 4R63A 4M6WB 4P4OA 1ZQNA 4IRCA 4Q8EA 2KTQA 1BGXT 2BCRA 4TUQA 1MSWD 4QBNA 2Q0ZX 3H4DA 4RQ8A 1N48A 1TAQA 7ICJA 4DF8A 1ZQKA 2AU0A 4BDPA 4F4XA 4ED7A 4MFAA 2FMPA 3TAQA 4YFKA 5DLGA 4UAYA 1S76D 3MABA 1R11A 2GW6A 9ICLA 3FYHA 5KFUA 4DL2A 3P1ZB 5KG4A 2ZUCA 2ZUBA 3FDSA 8ICZA 5KT7A 2ASLA 4KLQA 4QZFA 9ICNA 5KFZA 4JK1A 4NM2A 2XC9A 2W9CA 5L1KA 3TAPA 1T3NA 2F1HA 1D8LA 3C1YA 8ICKA 4J9QA 1RLVA 3JPOA 8ICMA 1ZYQA 1MC8A 5KFTA 3ZD9A 4QWAA 2KZ3A 5KG2A 1RXWA 5L1JA 4ECUA 5DQHA 5J0YA 8ICBA 3RR7A 4J9RA 3RRGA 3H40A 1JX4A 2ZUDA 5IIKA 2B21A 4KLUA 1JMSA 4YP3A 4QZIA 2DPIA 5KFLA 1TKDA 2LYHA 4YXMA 4EBCA 3RB3A 1S0NA 2BCVA 4KLLA 5KFSA 8ICXA 4QBOA 4IQWA 4DL4A 4KLJA 4QZCA 5HP4A 2ASJA 2ZTCA 5KFHA 3RBEA 4KLHA 3N97B 3RJEA 4FO6A 5J0XA 5KFFA 1U45A 3H8JA 4IRKA 2HVHA 5DGBA 1XWLA 4PHEA 2F1IA 2NRVA 3PW2A 4ZH4A 2MAXA 2ZJAA 5F9NA 5IIOA 3JPQA 4O3QA 3V7JA 2AGPA 2DPJA 3OJSA 4M9LA 2OKFA 4E0DA 5J0OA 1BPXA 9ICWA 4C8LA 3OSPA 1XS9D 4DSFA 3PW7A 3RBDA 4DSLA 2BQ3A 1L3VA 2AGQA 3PX0A 1QLNA 4DEZA 3UXPA 3ORYA 9ICPA 2UVWA 3PY8A 3RR8A 4KLGA 4QZGA 2BPGA 2FLPA 1ZQOA 4I2JA 4B9TA 3P1YA 2C22A 3HWTA 1R0VA 4I2IA 4O3NA 2OSTA 4XUSA 4I28A 3HX0A 3PX6A 2VA8A 4FS2A 4IQTA 4QW9A 4ECZA 2UVRA 2JZBB 3MR3A 3UQ2A 1NKCA 2BPCA 2RDIA 1ZQAA 5KG1A 4DF4A 3JPNA 1JIHA 7ICEA 4KLIA 2VANA 2M9NA 4MF2A 4O5CA 3BJYA 4RUCA 4LZDA 3T3FA 4PH5A 2IA6A 3C5FA 5L1IA 2BR0A 3IEYA 3AUOA 5KG0A 4DL7A 2FMSA 1RPLA 5KFEA 5HHHA 2ASDA 4EZ9A 1SL1A 1ZQSA 2ZYZA 3MDCA 1QSSA 3UQ0A 4EEYA 4BXOA 1ZQVA 1KRPA 3KHRA 2JEJA 2WTFA 4JV1A 3H4BA 3V72A 7ICOA 2XGPA 1ZJMA 1SKWA 7ICVA 1IPIA 4O3SA 4BWMA 5KFCA 7ICGA 3ZDAA 7ICTA 1S97A 4F91B 3FOVA 5HNKA 1Y1OA 2PFQA 2AQ4A 2AQ0A 4F5OA 3LK9A 4KLOA 1NKBA 4IR1A 1GEFA 4Z6CA 3QE9Y 1NK6A 8ICQA 4NXZA 2V4QA 2XCPA 4DO9A 4KLTA 3GILA 3RJKA 4P2HA 2HHTA 1Z3EB 8ICWA 3SZ2A 4PHAA 4O5EA 2WCWA 4DQIA 5J2JA 4QWCA 4ELVA 4DSIA 2BCQA 9ICUA 4ECWA 4TURA 2BCSA 5J2FA 2UVVA 2IHNA 1S0MA 4DSEA 3C2KA 2FPLA 5KG5A 5CHGA 5KFBA 2W8LA 1X9MA 4IR9A
chains in the Genus database with same CATH superfamily
1T0FA 1ZQBA 2QB0A 3DDHA 2GLEA 5DB7A 1L8LA 3KZIU 4QZHA 2G5IB 2R8GA 1BNOA 2J6UA 1N63A 1A76A 3PW0A 1ZQ1C 2LMRA 4IL6U 2M0NA 2HOQA 4ECYA 5KFOA 4I2AA 4UAZA 4MEXA 5AKJA 1N62A 2F1JA 1SZHA 3DEEA 2AXTU 5KAIU 5CP2A 1L3TA 3HILA 1B0XA 3NVYA 1J97A 2KEYA 1FEZA 2RLTA 5AKGA 3OSNA 4I29A 3TACB 1ZQHA 1BPEA 3PO5A 3MDAA 1FFVA 2WIZA 3AU6A 1A79A 5DG9A 5L1LA 4U7CA 3MFHA 8ICIA 4DS5A 4JUZA 4Y2TA 3KHGA 4O3RA 1S9FA 4TQRA 4KLEA 2JGAA 2W9AA 1Q46A 1TE2A 1ZQEA 3WK4A 4I2BA 7ICPA 1P7DA 3CNHA 5AK6A 5BPCA 1SV4A 1ZQPA 4M6WA 3OTQA 5KFAA 1RDFA 4YD1A 1XO0A 2A1AA 3C23A 4FZLA 2YY6A 3M9OB 3QEAZ 1JXEA 3T79A 2KG5A 2FI1A 2KICA 4O5KA 5TISU 2BHNA 5T14A 2V9WA 3AJVB 4NLZA 3UMGA 5D46A 3QZ8A 3MR5A 3GV8B 5DBAA 4NLKA 1J2MA 4Y2VA 3LYSA 3RJHA 3UXNA 5ALUA 2F2AB 3K75D 5DB6A 4DFKA 8ICNA 1D9FA 3V7LA 1VDVA 2W7PA 3K4GA 1F1ZA 2FJ6A 4C4RA 5AM5A 2K8AA 4GXIA 5ALFA 1HEKA 4JWMA 3PMLA 2LKYA 3PNCA 2FLNA 8ICGA 5KFPA 2W3RA 4DFJA 4MEYA 3TFSA 1B22A 2CN1A 4R64A 3OGUA 3I76A 4DQRA 4KLFA 3C2LA 3V6JA 1NKEA 1SL2A 5KFJA 4I2HA 2DQNB 4TUPA 2ZG6A 1L7OA 5IIIA 2JJQA 1ZQRA 4NY8A 4RPYA 1HIWA 3NTUA 4RT3A 4B9NA 3C1ZA 5J2CA 3QNMA 1MQ2A 3SI8A 5KFWA 1FIQA 5IIJA 2NO4A 3NVWA 2XI9A 4PZNA 4F93B 5KFGA 1Q3UA 2A1JB 4EELA 3WKBA 2FLLA 3WKDA 1Z4NA 2OCEA 4GC6A 4GC7A 4E6ZA 3IEYB 1KFDA 2W7OA 3RH6A 9ICRA 4BX9C 2UVUA 4CF4A 4UASA 4JV2A 4UBCA 1ZQMA 3G6YA 1CI4A 2JEGA 3T5KA 4J9SA 2R8JA 4GLXA 4YR2A 3SAGA 2C2EA 1KSPA 3JPPA 5KT3A 4YR0A 3LWLA 4F71A 1T3QA 2FDRA 2EZYA 1XNSA 3F2BA 4DWIA 1QH9A 2WB1C 2AH5A 4O0IA 3A0BU 3CW2C 2K60A 3TFRA 1D9DA 5KT2A 3RFAA 3FM9A 4C4SA 2R8HA 3RAQA 5EE3A 5TZVA 4P4MA 5DKWA 3IG8A 2VA2A 4MFFA 1WG8A 4QWEA 3AMZA 2BH2A 2BDPA 5CA7A 3PO4A 4EYHB 3AJVA 3EYZA 4Y2YA 4R8UB 2QKQA 1V38A 1LV5A 3SENA 4R66A 5CEHA 5J2BA 1UWVA 1NK8A 5ALLA 2WFAA 3SV4A 2E8NA 3RJGA 1L3UA 4C8MA 2VLDA 4KN4A 2WAQF 4UB3A 3TARA 2V4RA 3PW4A 2K8CB 5AI4A 3L5KA 3IP4B 3C21A 4DFPA 4NWIA 3VC8A 5AHXA 4EYIB 4IQUA 2I1QA 2KTQA 1X6JA 4TUQA 1N48A 2RHFA 2H3VA 1N61A 4ED7A 3BZKA 2FMPA 4YFKA 2W54A 5DLGA 2KK0A 2QB1A 4FZNA 3AEVA 4UW9A 2K89A 5AI8A 1RQLA 4OJPA 2EAOA 1ZYQA 3ZD9A 5KG2A 4ECUA 5DQHA 1ZXIA 3LVVA 3RR7A 2E8PA 4KLUA 1ZRMA 2LYHA 4KLLA 3RB3A 5KFSA 4IQWA 3NVZA 4KLHA 4G9BA 3N97B 5KFFA 3J81j 3WK5A 4IRKA 2F1IA 2G08A 5IIOA 3JPQA 4M9LA 9ICWA 1XS9D 4DSFA 4DSLA 2BQ3A 1SWVA 1L3VA 4DEZA 5AI9A 2BPGA 3B9JA 5AKHA 4NL9C 4B9TA 4ICAA 4RQNA 5ALZA 4I28A 3HX0A 4QW9A 4WJ3B 4ECZA 2JZBB 1ZQAA 3UQ2A 7ICEA 2DBSA 4KLIA 2M9NA 1Q8KA 3BJYA 4PH5A 2IA6A 3C5FA 2EH9A 1NNLA 3IEYA 2FMSA 2ASDA 3WKEA 5G5GA 1ZQSA 2MU2A 1J2NA 1IV8A 3K1ZA 1V85A 4PJ0U 2E3TA 1ZJMA 4PZOA 1IIPA 2JV3A 1URJA 2PFQA 4BJQA 2YTUA 4NXZA 2XCPA 2HHTA 2XICA 3GILA 4P2HA 3SZ2A 4O5EA 2WCWA 4ELVA 2BCQA 9ICUA 4TURA 4C7YA 2BCSA 4DSEA 5KG5A 5KFBA 3F2DA 5J0PA 2ZJ5A 4ECVA 5B5EU 4P0PB 3S6JA 2JXJA 2BQRA 3HT3A 4ECQA 2WF7A 3QU4A 4RZRA 2K4IA 2F76X 5E79U 4Y2XA 9ICIA 1RYUA 4G3IA 4USAA 4KTQA 4R8UA 2NRXA 7ICQA 2XO7A 4QIWC 2LBOA 2DFLA 4CNQA 3SYZA 1UA1A 3RJJA 2P66A 4US8A 3PX4A 1NOMA 4Y2UA 1L7MA 1X9SA 1BNPA 4ED2A 3N28A 3QUCA 2Z0RA 2FPMA 2EAPA 2LI6A 2PMZC 3ONNA 2KZMA 3D6JA 4DOAA 3N7SC 3ISCA 4DQPA 4M9JA 1ZQYA 1ZP7A 4RPZA 5AKXA 4B9LA 3TADA 5CB1A 2PFPA 2HHWA 2W9MA 3LWMA 4UATA 4F50A 4OD0A 3RH5A 2YMLA 4KLSA 5CWRA 4DSKA 8ICVA 2Y0SF 5ALXA 5KG3A 3F53A 1U48A 4AYBC 3GDXA 2FKHB 2Y9UA 1XSLA 3NVVA 4F3OA 1U4BA 2YB1A 1L3SA 1JROA 4KITB 1TK0A 1WYGA 4KN7A 3RB4A 7ICMA 1T7PA 1FFUA 5ALJA 5KT6A 1IXRA 1ZD3A 4J9KA 9ICXA 4R65A 4O3OA 2W04A 4DL6A 4GXJA 2PI4A 5DQIA 1QQ6A 3TI0A 1O03A 5J8YA 4PHDA 4RQ7A 2EANA 1ZOLA 1NK5A 4JV0A 4B9UA 5J0RA 1N56A 5DBBA 7ICNA 1N60A 1ZQWA 2BDUA 1KFSA 3Q8MA 1SZPA 2DL0A 2JZBA 2H3FA 5KG7A 4KMUA 3QU5A 3PVXA 2JH1A 4FE3A 1VJ5A 2ESEA 1OW5A 3DNXA 5AKEA 5L9XA 1T4GA 5ALWA 2MRLA 2K4PA 3SR6A 2W9CB 2KMDA 5JUMA 4DOBA 4I27A 4F92B 1WCNA 2GOLA 3G6XA 1AROP 2HHUA 3H7IA 2ZIUB 2GWSA 1JUDA 2EDUA 8ICYA 5AKIA 4I2CA 5J29A 2IBKA 3PR5B 2XY6A 1RQNA 1BPDA 5CJ7A 2HHSA 3LDAA 3Q8SB 3RH4A 3BDPA 2MSNA 3HRDD 2KKPA 1ZJNA 1U9LA 1ZQZA 5EE9A 3F2CA 4GFJA 2E8MA 4CE6A 2LM1A 5DDYA 4UB4A 2HW3A 3FC4A 3ETLA 5J2GA 2HHVA 2N1RA 1OUQA 3BQ1A 2AJQA 5DQGA 4P0PA 1SXDA 3GV7B 3KHLA 1S77D 4QW8A 5AK4A 2R8KA 2OYYA 5AKYA 4ED8A 4I2FA 4OJLA 3QU2A 1TVAA 1S0OA 3WU2U 5DG8A 4F5QA 2HHQA 2ZYZB 4RU9A 4AP9A 4BXOB 5DGAA 3B0XA 1TAMA 3ED5A 3V7KA 4FBTA 1T8EA 1BVSA 8ICUA 7ICIA 3SQIA 1DXSA 3ZD8A 2BZFA 3IF0X 4G6VA 3IDWA 2DKZA 5DDMA 2XY5A 4RT2A 2OWOA 4ECXA 3UMCA 3AQEA 1L5UA 1WUDA 3T5HA 1IM4A 3HPOA 3ALRA 1KW4A 3C5GA 2JRZA 2HI0A 4YR3A 5AM4A 2NRWA 5KNIA 3U26A 5ALVA 4YMOA 4Q45A 2W9BB 3EPIA 1SKRA 9ICBA 2ISOA 4F8RA 2INBA 3H8WA 9ICKA 3NASA 2WF9A 1WWVA 4DL3A 4UQGA 1ZQIA 1V9PA 1F0MA 1SL0A 4C7ZA 3ZDBA 4YVZA 5KFRA 3MGIA 3KKAC 2LYAA 9ICEA 9ICHA 1QQ5A 1KKXA 2Y1IA 3Q8QB 4F5RA 7ICFA 4FZMA 5KFIA 1X40A 2QARB 4EX7A 1XSPA 4TKKA 1SWWA 1XU4A 3F5AA 5IILA 2DGZA 3ZDEA 3M8RA 1ZQQA 5KFYA 1KN5A 1MN8A 4P4OA 4IRCA 2BCRA 2Q0ZX 1PUZA 1TAQA 4DF8A 1ZQKA 2AU0A 3QU7A 3PSFA 3TAQA 4UAYA 2CPRA 3P1ZB 5KT7A 2ASLA 1JI7A 2W9CA 2XC9A 5L1KA 3TAPA 1T3NA 3C1YA 3L4PA 8ICKA 1VLBA 3JPOA 5KFTA 4QWAA 5ALHA 1L8OA 5J0YA 2AHOB 2ZUDA 5F3XB 4QZIA 2DPIA 2VJ4A 5AM2A 2MA1A 4EBCA 2BCVA 2LHTA 2FL3A 5KFHA 2Y0SC 3IRUA 3RJEA 2IOFK 4OJ5A 2HVHA 5ALMA 5F9NA 4O3QA 3V7JA 3OJSA 2OKFA 3H0LB 3RBDA 2E1EA 3PX0A 9ICPA 3ORYA 2FLCA 4KLGA 4QZGA 5AM1A 4I2JA 1ZQOA 4DCCA 1R0VA 4O3NA 4DAVA 2R18A 3PX6A 4FS2A 2IOHA 4IQTA 2KP7A 4LZGA 1X6IA 3MR3A 2RQ5A 1NKCA 3JPNA 5ALPA 2VANA 2LPEA 3T3FA 2HOFA 3AUOA 3AQFA 5KFEA 5HHHA 4EZ9A 4U6PA 2ZYZA 1QSSA 3UQ0A 4EEYA 4BXOA 3KFUF 3KHRA 2JEJA 1YZ6A 3BZCA 1SKWA 3TKAA 7ICGA 3ZDAA 7ICTA 1S97A 3M1YA 3ZI4A 5HNKA 1UQVA 1Z1BA 2AQ4A 4KLOA 3O0FA 1NKBA 1GEFA 8ICQA 4KLTA 4Y2RA 4QWCA 4ZQUA 3ETRA 2UVVA 2IHNA 1S0MA 2D6FC 2W8LA 3C28A 5CHGA 2WF5A 5AICA 4IR9A 5ALRA 2G5HB 4YMNA 1JALA 4RQ3A 3G6VA 1C20A 1K5OA 2ODGA 1NK0A 4IS7A 1ZQDA 1EXNA 2W9BA 1DGSA 2GJWA 1X66A 1Z19A 1SKSA 5AM0A 5ALQA 1DRGA 8ICAA 1HJPA 3EWAA 3ZDDA 2P35A 1BPYA 4YXJA 1RXVA 2EO0A 4YCXA 5EWGA 5J2HA 5J2AA 5BOLA 4NLCA 5HHIA 3QUBA 4M9GA 4DSJA 9ICOA 1ZQJA 7ICLA 1K1SA 2BQUA 4XA5A 1WWUA 2QARA 2R8IA 5C5JA 7ICRA 3HKZF 2E8OA 1DOQA 3GV5B 3KTQA 5B66U 8ICSA 2KIWA 2F77X 3I28A 3RB0A 2LYBA 3M9NB 3ZDCA 4F2SA 4QZ8A 1SV0C 4GIBA 1ZQGA 5KG6A 3SAFA 3D2SA 3H0MB 1SXEA 3P1ZA 5ALGA 3SD7A 1KFTA 5K4LA 4J9NA 4PGYA 4B9MA 4YD2A 1A77A 4BGDA 8ICRA 2PXIA 4NL9A 2A1JA 4B9SA 2HBJA 4PL1A 3Q8KA 5F9LA 1KTQA 2HCFA 4J9PA 2MUTB 2KN7A 5J2IA 4QZAA 4QZBA 4PHPA 4LQEA 4KLMA 1OB8A 5HMLA 4FBUA 8ICOA 2KD1A 4DAPA 2IHMA 4EENA 4CF5A 4RQ0A 5J0QA 2KJ9A 9ICCA 3MGVA 4O9MA 2KE7A 4EV1A 1Z1VA 1JXLA 1FO4A 1ZQTA 2D8CA 2VKQA 1UA0A 4C8NA 5DB8A 2ZIWB 1YZ7A 5ALEA 4K4IA 5J0TA 8ICCA 4UB1A 3RRHA 1CRXA 3UPQA 3JPSA 1Y88A 5AIAA 3GIIA 2ZJ8A 1OXJA 4DFDA 2ZTEA 4Q8FA 2HBMA 1S0VA 3HW8A 4M2YA 4J9MA 1ZD4A 4Y2QA 4DFMA 3ISDA 3WKAA 2EZZA 1TK5A 4C8KA 1TAUA 4MFCA 4C8OA 1HH1A 4F4YA 5JRTA 2LM4A 2BCUA 4KX5A 4F5PA 4RQ6A 5KFMA 1ZQXA 1QSYA 4PPXA 5AIBA 2FPKA 3Q8PB 3RTVA 1TV9A 4CRXA 2HBKA 3DV9A 1UHUA 3JPTA 2ES6A 3OHAA 1HUOA 1ZD2P 4ECRA 3AM9A 1AQ6A 3UM9A 8ICLA 8ICTA 3EZ5A 1KBUA 2KJ8A 2BGWA 2KHQA 4QZ9A 1PVQA 5KFVA 5KFNA 2KZZA 4QZDA 1NJXA 1RZNA 4YG2A 2Y1JA 1KL9A 1N5XA 2KIVA 4F4ZA 3OHBA 4MF8A 4YN4A 4TKDA 2NO5A 4J9LA 1C7YA 2P6RA 2KVCA 1H38A 1UT8A 4M9HA 3TQ1A 2FCOA 4NLNA 4OJ6A 1L6NA 3GIJA 5AKLA 4RQMA 2NV3A 4UBBA 3GIKA 1A6SA 4C0ZA 2C2RA 3BS5B 2JHDA 4I2GA 1B43A 3NRZA 5J0SA 3V6KA 2E1FA 2OHFA 1XO1A 4PGXA 2W8MA 1X9XA 2VJ5A 3NUQA 4RNMA 3R9KA 2JMGA 1HUZA 3HP6A 3T5LA 5ALKA 3TANA 3Q8RB 2OH2A 2HMXA 3H8MA 4A8EA 4RNNA 2P6UA 4F5NA 3PZPA 1N2XA 2ZIXB 2K8BB 5DG7A 1PVRA 4RQ5A 1NJYA 1COOA 3MR2A 1K1QA 1X2IA 2O6KA 3QUTA 2AGOA 4OJOA 2EZXA 5D4BA 2WAQC 4XRHA 1DK2A 4DQQA 1U47A 5KFQA 3GFKB 4M0AA 1ZQUA 2MUTA 5J2DA 2IMWP 1NK9A 4P4PA 3ISBA 5J0UA 1PZNA 2VA3A 2XVTA 5J0WA 1UCVA 2W8KA 2CRXA 3AU2A 1ZD5A 3PSTA 9ICVA 2I9GA 4KLDA 4Q43A 3N4MB 3IN5A 1CUKA 3OJUA 2QLTA 1OB9A 4HAIA 3BQ2A 3M6ZA 3CYMA 3PMNA 4RQ1A 4UAVA 4I2DA 4Q8EA 4R63A 1ZQNA 1BGXT 1LKYB 7ICJA 2W03A 1F44A 2ZIWA 4F4XA 2GW6A 3MABA 9ICLA 3F5EA 5KFUA 5KG4A 2ZUCA 5KL8B 3FDSA 8ICZA 5AK3A 4KLQA 9ICNA 4JK1A 1RLVA 1RXWA 1MC8A 3HKZC 2KZ3A 5L1JA 1NZBA 4OCZA 4J9RA 3RRGA 3H40A 1JX4A 1JMSA 2XIDA 3CP8A 4YP3A 1TKDA 4YXMA 4KX3A 4IC9A 8ICXA 3KZXA 3A0HU 3RBEA 5AI0A 5J0XA 2EQYA 4CDGA 3H8JA 3N7RC 4ZH4A 2ZJAA 2AGPA 2DPJA 5ALNA 4E0DA 1BPXA 3C29A 3OSPA 2DBYA 3WK8A 3PW7A 5ALIA 3LVWA 1QLNA 2KJ5A 3H0RB 1O08A 2UVWA 2ZXHA 3PY8A 4JMUA 2YX8A 2FLPA 2C22A 2KOBA 4I2IA 1SB3C 4XUSA 2A19A 2W55A 4OO1J 3UMBA 2RDIA 3IG5A 4O3MA 1JIHA 4MF2A 4O5CA 4RUCA 4LZDA 4PL2A 2BR0A 5AKZA 1V97A 5KG0A 2FKCA 1RPLA 2Z7JA 3IV6A 4EX6A 1KRPA 1ECWA 2WTFA 4JV1A 3H4BA 3L3FX 2XGPA 7ICVA 3GZFA 1IPIA 4O3SA 4F91B 1Y1OA 3BS5A 4Y2SA 4F5OA 3LK9A 3QE9Y 3QU9A 2V4QA 1IG6A 4DO9A 1Z3EB 4MHVA 4PHAA 4DQIA 4ECWA 5AKKA 3AL0B 3KKAA 2FPLA 1X9MA 2GH1A 3GU3A 2YN4A 4FS1A 5AM3A 1S10A 4QZEA 1ED1A 2DWQA 4YQWA 4I2EA 2RDJA 2ZIXA 2Q4TA 4F72A 5J2EA 4F4WA 1QCKA 4DLGA 1MQ3A 2D3DA 4B9VA 5CRXA 4ELUA 4IRDA 3QXGA 2XGQA 2IXSA 4F4KA 1KEJA 3RF9A 3QYPA 2BPFA 5DLFA 4EBEA 2ZTDA 4DOCA 3WKCA 3ICXA 3D2QA 4UB6U 5ALYA 3THVA 2DKXA 5FP0A 5J2KA 2HHXA 4PGQA 1ZRNA 1XMXA 4QIWF 2W11A 2H3IA 5DB9A 1T94A 5AI6A 2ZIUA 4ECSA 2PMZF 3MGHA 4CF3A 2E5SA 2G06A 5KT5A 2DF4B 3KHHA 4P0QB 2B0CA 3QX7A 3RJFA 1LKYA 4M47A 2CZRA 4RQ2A 4QWDA 2KFZA 5ALSA 9ICTA 1ZETA 2JEFA 1NJZA 2F3NA 5EE0A 4TQSA 2F44A 5KFDA 4F2RA 3KOOA 4DLEA 8ICJA 4ED0A 3RJIA 2ATLA 1D8YA 2K4HA 2XCAA 3M9MB 2HDOA 2G07A 4ACOA 5BOMA 3MFIA 1JN3A 1Z00B 2I5HA 4AYBF 2NRTA 3MC1A 4Y2PA 2HOIA 3B0YA 2C28A 3PR4A 3UXOA 3Q8LA 5HR6A 2J6SA 1A0PA 2KVSA 5DBCA 1NK4A 3SMVA 9ICGA 2A3VA 1RZTA 4J9OA 1SGGA 5GTIU 3M6KA 2FE9A 9ICAA 2ZIVB 4ELTA 2FMQA 1KLNA 5EWFA 3E58A 3QZ7A 3GQCA 7ICUA 3N7PD 4QJFB 4NLGA 4EBDA 2C2DA 4LJXA 1ZQFA 1KQQA 4CCHA 2YMQA 4BWJA 2KSOB 2KHVA 3AN1A 4RNOA 4RQ4A 3NS1A 2WJ0A 9ICFA 2NRZA 3E2EA 4O3PA 4ECTA 4NM1A 8ICHA 4C80A 4JB3A 3SV3A 2ZXIA 4DL5A 2W43A 3RAXA 5KFKA 1LB2B 4TUSA 1RYSA 3BS7A 1DGJA 2HVIA 3EPGA 2YQEA 1RM6C 1D8BA 2ALZA 4RPXA 4Z6EA 2L5YA 9ICJA 4M9NA 4Z6DA 3GIMA 3NRWA 4G6UA 2H3QA 4J03A 4ED3A 4ED1A 3BQ0A 1WCLA 3BQTA 2PFNA 4Q44A 8ICPA 1QSLA 2CXYA 9ICMA 5HMMA 5JTIA 4DS4A 3PSIA 4DQSA 8ICEA 2HSZA 8ICFA 4Z6FA 1U49A 2W3SA 5KFXA 1PVPA 4DA2A 3M7DA 3PW5A 5GTHU 2YMPA 1MA7A 4YMMA 5IINA 4ZOHC 5KTQA 9ICSA 4UB8U 1RG6A 2YMMA 2WIWA 1SIJA 1PK1B 2PFOA 1X42A 3V6HA 2OEHA 5CR0A 4GXKA 2NYVA 1TK8A 4RUAA 3D2NA 3IM1A 2J6TA 5ALDA 4UAUA 3JPRA 1BPBA 4QWBA 1SV0A 4K4GA 7ICSA 7ICKA 3MR6A 4XQ8A 1RYRA 5KAFU 2JEIA 1S8OA 5ALOA 3QEBZ 5EOZA 1TFRA 4JWNA 2JH7A 1L7NA 5KT4A 2F8KA 4UAWA 4NV0A 1NZPA 4NLBA 4EEKA 4M04A 3RB6A 4IQVA 3K1RB 1BPZA 1QQ7A 2DUYA 5D49A 4UARA 4P0QA 1CEZA 1YNMA 2QB0B 2KFNA 3PV8A 5EWEA 5FDKA 2WCZA 1XSNA 2OXOA 4UB5A 7ICHA 3OPXA 1Q3VA 3NGDA 1QTMA 4EZ6A 1NJWA 1Z4OA 3PSPA 2KKVA 1ZQLA 2KNJA 2F8LA 1UT5A 9ICQA 4US9A 3T5JA 1L7PA 2YB4A 4ED6A 2ISPA 3BQ7A 2RRDA 4HYKA 1Z00A 3H8SA 1ZQCA 3WK9A 1KDHA 1F5SA 4UB2A 3WK7A 5ALTA 2B6GA 2BKEA 5AK5A 3IHQB 3MBYA 1NK7A 2OM6A 2PI5A 4NJ8A 4K4HA 1XC9A 5H2FU 4X5VA 5L1MA 3M8SA 3C2MA 3EW9A 4LVSA 3SAHA 2ZIVA 4QBLA 2CV8A 5IIMA 1X9WA 2H5XA 2XY7A 4M6WB 1N5WA 1MSWD 4QBNA 3H4DA 4RQ8A 2KSOA 3VCBA 4BDPA 2WF8A 4MFAA 5C0YA 1S76D 1R11A 2VIXA 3FYHA 4DL2A 3WK6A 2ZUBA 3HJEA 4QZFA 1LVHA 2G09A 2VS1A 1PK3A 5KFZA 4KMOB 4NM2A 2WF6A 2F1HA 1D8LA 4J9QA 8ICMA 1UPHA 2I6XA 8ICBA 4BUGA 5IIKA 2B21A 1M6YA 5KFLA 3TADC 4C4TA 1S0NA 4QBOA 2HBLA 4DL4A 4KLJA 4QZCA 5HP4A 2ASJA 2ZTCA 4FO6A 1U45A 5A0LA 1XWLA 5DGBA 4PHEA 1DK3A 2NRVA 3PW2A 2MAXA 2EAMA 5J0OA 4C8LA 3EUB2 1NI3A 2AGQA 3UXPA 5G5HA 5AI5A 3RR8A 1B4FA 3I1YA 4Y2JA 3P1YA 3HWTA 4CGZA 2OSTA 2VA8A 2UVRA 1PK1A 1GO3F 2BPCA 5KG1A 4B6JA 4DF4A 2H3ZA 2RP5A 3FAHA 5L1IA 2K4EA 3KD3A 4DL7A 2WB1F 1SL1A 3MDCA 2JR5A 2PKEA 5HR7A 3SEIA 5KL1B 1ZQVA 5J8YC 5JU5A 3BT7A 3V72A 7ICOA 1COKA 2KV2A 2GO7A 4BWMA 3QUQA 4QNLA 5KFCA 3FOVA 5EE1A 2AQ0A 3KBBA 4IR1A 2Y9TA 4Z6CA 1NK6A 2WHEA 3RJKA 8ICWA 4FFDA 3E0FA 1YT3A 5J2JA 2IOFA 4DSIA 5J2FA 1S5LU 3C2KA 1JRPA 2G0AA 3CRXA
chains in the Genus database with same CATH topology
4FS1A 1T0FA 5J0PA 2ZJ5A 4ECVA 1ZQBA 4YMNA 1S10A 4QZEA 2BQRA 5DB7A 4RQ3A 3HT3A 3G6VA 4ECQA 4YQWA 4I2EA 4QZHA 2RDJA 1NK0A 2R8GA 4RZRA 2J6UA 1A76A 3PW0A 1ZQDA 1EXNA 4ECYA 5J2EA 4F4WA 5KFOA 2W9BA 4I2AA 9ICIA 4DLGA 1MQ3A 4UAZA 1DGSA 4MEXA 4B9VA 4ELUA 4IRDA 2GJWA 4G3IA 2XGQA 2IXSA 2F1JA 4F4KA 1KEJA 4KTQA 4R8UA 2NRXA 1SKSA 2XO7A 5CP2A 7ICQA 1L3TA 2DFLA 3SYZA 8ICAA 1HJPA 3EWAA 1UA1A 2BPFA 3RJJA 5DLFA 2P66A 4EBEA 2ZTDA 3PX4A 3ZDDA 1NOMA 4DOCA 1X9SA 3OSNA 4I29A 1ZQHA 1BPYA 4YXJA 1BPEA 4ED2A 3PO5A 2Z0RA 1RXVA 2EO0A 2FPMA 4YCXA 5EWGA 3THVA 5J2KA 5J2HA 2KZMA 5J2AA 5BOLA 3MDAA 2HHXA 4PGQA 1XMXA 5HHIA 2WIZA 4M9GA 4DSJA 3AU6A 1A79A 5DG9A 9ICOA 5L1LA 4DOAA 3MFHA 1ZQJA 3ISCA 8ICIA 4DQPA 4DS5A 5DB9A 7ICLA 1K1SA 2BQUA 4JUZA 4M9JA 4XA5A 3KHGA 1ZQYA 4O3RA 1ZP7A 4RPZA 1S9FA 4B9LA 2R8IA 4TQRA 5CB1A 5C5JA 2PFPA 4ECSA 2W9AA 4KLEA 3MGHA 7ICRA 2HHWA 1DOQA 1ZQEA 2W9MA 3GV5B 4I2BA 3LWMA 3KTQA 7ICPA 5KT5A 3KHHA 5BPCA 4F50A 8ICSA 1ZQPA 4M6WA 5KFAA 3RH5A 3RJFA 3RB0A 4YD1A 3M9NB 3ZDCA 4F2SA 4M47A 4KLSA 2CZRA 4RQ2A 4QZ8A 4QWDA 2KFZA 5CWRA 4DSKA 9ICTA 1ZETA 8ICVA 2JEFA 1ZQGA 3C23A 5KG3A 5KG6A 1NJZA 4TQSA 3M9OB 1U48A 3QEAZ 1JXEA 5KFDA 3GDXA 2FKHB 3P1ZA 4O5KA 4F2RA 1KFTA 4J9NA 4PGYA 1XSLA 4B9MA 2BHNA 4YD2A 4DLEA 4F3OA 1A77A 4BGDA 4ED0A 8ICRA 8ICJA 1U4BA 3RJIA 2V9WA 2PXIA 3AJVB 2A1JA 1L3SA 4B9SA 2ATLA 1D8YA 2XCAA 3M9MB 4KITB 1TK0A 4NLZA 5BOMA 5D46A 3MFIA 3QZ8A 1JN3A 3MR5A 1Z00B 4KN7A 3RB4A 3Q8KA 2NRTA 1KTQA 5F9LA 4J9PA 2MUTB 2KN7A 3B0YA 3GV8B 2C28A 7ICMA 5DBAA 3PR4A 5J2IA 1T7PA 3UXOA 3Q8LA 2J6SA 5KT6A 4QZAA 1IXRA 4QZBA 4J9KA 4NLKA 4PHPA 9ICXA 5DBCA 4LQEA 4KLMA 1NK4A 1OB8A 4R65A 3RJHA 5HMLA 9ICGA 4O3OA 3UXNA 4FBUA 8ICOA 4DL6A 4GXJA 2PI4A 3K75D 5DQIA 5DB6A 4DFKA 3TI0A 1RZTA 4J9OA 4DAPA 4PHDA 8ICNA 9ICAA 1D9FA 2IHMA 4RQ7A 3V7LA 2FMQA 1KLNA 4RQ0A 4ELTA 5EWFA 3QZ7A 5J0QA 3GQCA 7ICUA 1NK5A 4JV0A 4B9UA 9ICCA 4O9MA 5J0RA 1N56A 4NLGA 4EBDA 3K4GA 5DBBA 2C2DA 7ICNA 1ZQWA 1ZQFA 1F1ZA 4CCHA 1KFSA 4EV1A 1JXLA 3Q8MA 1ZQTA 4BWJA 4GXIA 4RNOA 1UA0A 1SZPA 4C8NA 5DB8A 4RQ4A 4JWMA 2WJ0A 9ICFA 2NRZA 3E2EA 2JZBA 4O3PA 3PMLA 5KG7A 4ECTA 4NM1A 4KMUA 3PNCA 2FLNA 8ICHA 4K4IA 5J0TA 3PVXA 8ICGA 8ICCA 4UB1A 3SV3A 3DNXA 4DL5A 3RRHA 3UPQA 3JPSA 5KFPA 5L9XA 1T4GA 1Y88A 3RAXA 3GIIA 2ZJ8A 5KFKA 1LB2B 4TUSA 1RYSA 2W9CB 2ZTEA 4Q8FA 1S0VA 4DFJA 2HVIA 5JUMA 3HW8A 3EPGA 4J9MA 4DOBA 4M2YA 4I27A 4DFMA 4MEYA 3ISDA 3TFSA 4F92B 2ALZA 1B22A 4RPXA 4R64A 3OGUA 4DQRA 4KLFA 4Z6EA 1WCNA 3C2LA 3V6JA 1TK5A 4C8KA 9ICJA 1NKEA 1SL2A 4M9NA 4Z6DA 3G6XA 5KFJA 1TAUA 4MFCA 4I2HA 3GIMA 1AROP 4TUPA 4C8OA 4G6UA 1HH1A 4ED3A 5IIIA 4F4YA 2HHUA 3H7IA 2GWSA 4ED1A 2JJQA 1ZQRA 4NY8A 8ICYA 4RPYA 3BQ0A 1WCLA 4I2CA 3BQTA 5J29A 2BCUA 2PFNA 3NTUA 4RT3A 4Q44A 4RQ6A 4F5PA 5KFMA 1ZQXA 1QSLA 2IBKA 8ICPA 1QSYA 4B9NA 3PR5B 2XY6A 5CJ7A 1BPDA 4PPXA 2HHSA 2FPKA 9ICMA 3LDAA 5HMMA 3Q8SB 3RH4A 3BDPA 3Q8PB 4DS4A 8ICEA 4DQSA 3RTVA 3C1ZA 1ZJNA 8ICFA 4LZGA 5J2CA 4Z6FA 1TV9A 1U9LA 1U49A 1MQ2A 1ZQZA 5KFXA 5KFWA 3SI8A 4DA2A 3JPTA 5IIJA 3OHAA 3PW5A 5DDYA 4UB4A 1HUOA 2HW3A 4ECRA 4YMMA 3ETLA 5J2GA 5IINA 2HHVA 4F93B 5KTQA 3EZ5A 8ICLA 8ICTA 5KFGA 9ICSA 2WIWA 2BGWA 3BQ1A 2AJQA 5DQGA 2PFOA 3V6HA 3GV7B 2A1JB 5CR0A 4QZ9A 3KHLA 1S77D 4QW8A 5KFVA 4GXKA 5KFNA 2R8KA 2KZZA 2FLLA 4QZDA 1NJXA 1RZNA 4GC6A 4YG2A 4GC7A 1TK8A 2Y1JA 4E6ZA 4RUAA 4ED8A 3IEYB 4I2FA 1KFDA 9ICRA 3RH6A 4F4ZA 3IM1A 3OHBA 2J6TA 1TVAA 1S0OA 2UVUA 4MF8A 4YN4A 4TKDA 3JPRA 5DG8A 4J9LA 1BPBA 4F5QA 1C7YA 2P6RA 4JV2A 2HHQA 4RU9A 4UBCA 1ZQMA 3G6YA 1H38A 1UT8A 4M9HA 2JEGA 4BXOB 4QWBA 5DGAA 3TQ1A 3B0XA 3T5KA 4K4GA 7ICSA 4J9SA 3V7KA 4FBTA 7ICKA 2FCOA 4NLNA 3GIJA 3MR6A 1T8EA 1BVSA 2R8JA 4XQ8A 4UBBA 1RYRA 4GLXA 4YR2A 8ICUA 2JEIA 2C2EA 3GIKA 1KSPA 3QEBZ 5EOZA 3JPPA 7ICIA 2C2RA 1TFRA 5KT3A 4YR0A 4JWNA 3ZD8A 4I2GA 3LWLA 1B43A 3IF0X 5KT4A 4G6VA 5J0SA 4UAWA 3V6KA 5DDMA 2XY5A 4M04A 1XO1A 4PGXA 2W8MA 3RB6A 4DWIA 4RT2A 4IQVA 4O0IA 2OWOA 4ECXA 1L5UA 1BPZA 3T5HA 4RNMA 1IM4A 3HPOA 5D49A 2ZYZB 1HUZA 3TFRA 3HP6A 5KT2A 3C5GA 3T5LA 1D9DA 1CEZA 1YNMA 3TANA 2KFNA 3Q8RB 4YR3A 5EWEA 3PV8A 2NRWA 1XSNA 2R8HA 2WCZA 5FDKA 3RAQA 4UB5A 5TZVA 4P4MA 7ICHA 4RNNA 2P6UA 4F5NA 5DKWA 2VA2A 4MFFA 3NGDA 5DG7A 1QTMA 4EZ6A 1NJWA 4YMOA 4RQ5A 4QWEA 4Q45A 2W9BB 1NJYA 1ZQLA 2BDPA 3EPIA 2BH2A 5CA7A 1SKRA 3PO4A 1COOA 4EYHB 3MR2A 2ISOA 1UT5A 9ICBA 9ICQA 3AJVA 3EYZA 1X2IA 1K1QA 4ED6A 3T5JA 2ISPA 4R8UB 2AGOA 4F8RA 2INBA 3H8WA 9ICKA 5D4BA 1LV5A 4XRHA 4R66A 5J2BA 4HYKA 4DQQA 1U47A 5KFQA 1Z00A 3H8SA 3GFKB 4DL3A 1KDHA 1ZQUA 1ZQCA 2MUTA 4M0AA 1UWVA 5J2DA 4UQGA 1NK9A 4P4PA 1ZQIA 2IMWP 1V9PA 3ISBA 1NK8A 4UB2A 1SL0A 5J0UA 3SV4A 1PZNA 2BKEA 5J0WA 2VA3A 3ZDBA 4YVZA 3IHQB 5KFRA 3MBYA 3MGIA 1NK7A 2W8KA 3RJGA 1L3UA 2PI5A 4C8MA 3AU2A 4K4HA 9ICEA 9ICHA 1XC9A 2VLDA 4X5VA 4KN4A 9ICVA 2I9GA 2Y1IA 4UB3A 3TARA 4KLDA 4Q43A 3Q8QB 3M8SA 3C2MA 4F5RA 3EW9A 3N4MB 7ICFA 2V4RA 1CUKA 4LVSA 3OJUA 3PW4A 5KFIA 4TKKA 1XSPA 4QBLA 1OB9A 2CV8A 3C21A 4DFPA 3BQ2A 5IIMA 1XU4A 1X9WA 2H5XA 3PMNA 5IILA 3ZDEA 4RQ1A 3M8RA 4I2DA 4IQUA 2I1QA 4EYIB 1ZQQA 2XY7A 5KFYA 4R63A 4M6WB 4P4OA 1ZQNA 4IRCA 4Q8EA 2KTQA 1BGXT 2BCRA 4TUQA 1MSWD 4QBNA 2Q0ZX 3H4DA 4RQ8A 1N48A 1TAQA 7ICJA 4DF8A 1ZQKA 2AU0A 4BDPA 4F4XA 4ED7A 4MFAA 2FMPA 3TAQA 4YFKA 5DLGA 4UAYA 1S76D 3MABA 1R11A 2GW6A 9ICLA 3FYHA 5KFUA 4DL2A 3P1ZB 5KG4A 2ZUCA 2ZUBA 3FDSA 8ICZA 5KT7A 2ASLA 4KLQA 4QZFA 2VS1A 9ICNA 5KFZA 4JK1A 4NM2A 2XC9A 2W9CA 5L1KA 3TAPA 1T3NA 2F1HA 1D8LA 3C1YA 8ICKA 4J9QA 1RLVA 3JPOA 8ICMA 1ZYQA 1MC8A 5KFTA 3ZD9A 4QWAA 2KZ3A 5KG2A 1RXWA 5L1JA 4ECUA 5DQHA 5J0YA 8ICBA 3RR7A 4J9RA 3RRGA 3H40A 1JX4A 2ZUDA 5IIKA 2B21A 4KLUA 1JMSA 4YP3A 4QZIA 2DPIA 5KFLA 1TKDA 2LYHA 4YXMA 4EBCA 3RB3A 1S0NA 2BCVA 4KLLA 5KFSA 8ICXA 2FL3A 4QBOA 4IQWA 4DL4A 4KLJA 4QZCA 5HP4A 2ASJA 2ZTCA 5KFHA 3RBEA 4KLHA 3N97B 3RJEA 4FO6A 5J0XA 5KFFA 1U45A 3H8JA 4IRKA 2HVHA 5DGBA 1XWLA 4PHEA 2F1IA 2NRVA 3PW2A 4ZH4A 2MAXA 2ZJAA 5F9NA 5IIOA 3JPQA 4O3QA 3V7JA 2AGPA 2DPJA 3OJSA 4M9LA 2OKFA 4E0DA 5J0OA 1BPXA 9ICWA 4C8LA 3OSPA 1XS9D 4DSFA 3PW7A 3RBDA 4DSLA 2BQ3A 1L3VA 2AGQA 3PX0A 1QLNA 4DEZA 3UXPA 3ORYA 9ICPA 2FLCA 2UVWA 3PY8A 3RR8A 4KLGA 4QZGA 2BPGA 2FLPA 1ZQOA 4I2JA 4B9TA 3P1YA 2C22A 3HWTA 1R0VA 4I2IA 4O3NA 2OSTA 4DAVA 4XUSA 4I28A 3HX0A 3PX6A 2VA8A 4FS2A 4IQTA 4QW9A 4ECZA 2UVRA 2JZBB 3MR3A 3UQ2A 1NKCA 2BPCA 2RDIA 1ZQAA 5KG1A 4DF4A 3JPNA 1JIHA 7ICEA 2DBSA 4KLIA 2VANA 2M9NA 4MF2A 4O5CA 3BJYA 4RUCA 4LZDA 3T3FA 4PH5A 2IA6A 3C5FA 5L1IA 2BR0A 3IEYA 3AUOA 5KG0A 4DL7A 2FKCA 2FMSA 1RPLA 5KFEA 5HHHA 2ASDA 4EZ9A 1SL1A 1ZQSA 2ZYZA 3MDCA 1QSSA 3UQ0A 4EEYA 4BXOA 1ZQVA 1KRPA 3KHRA 2JEJA 2WTFA 4JV1A 3H4BA 3BT7A 3V72A 7ICOA 2XGPA 1ZJMA 1SKWA 7ICVA 1IPIA 4O3SA 4BWMA 5KFCA 7ICGA 3ZDAA 7ICTA 1S97A 4F91B 3FOVA 5HNKA 1Y1OA 2PFQA 2AQ4A 2AQ0A 4F5OA 3LK9A 4KLOA 1NKBA 4IR1A 1GEFA 4Z6CA 3QE9Y 1NK6A 8ICQA 4NXZA 2V4QA 2XCPA 4DO9A 4KLTA 3GILA 3RJKA 4P2HA 2HHTA 1Z3EB 8ICWA 3SZ2A 4PHAA 4O5EA 2WCWA 4DQIA 5J2JA 4QWCA 4ELVA 4ZQUA 4DSIA 2BCQA 9ICUA 4ECWA 4TURA 2BCSA 5J2FA 2UVVA 2IHNA 1S0MA 4DSEA 3C2KA 2FPLA 5KG5A 5CHGA 5KFBA 2W8LA 1X9MA 4IR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FS1 A;  1T0F A;  5J0P A;  2ZJ5 A;  4ECV A;  1ZQB A;  4YMN A;  1S10 A;  4QZE A;  2BQR A;  5DB7 A;  4RQ3 A;  3HT3 A;  3G6V A;  4ECQ A;  4YQW A;  4I2E A;  4QZH A;  2RDJ A;  1NK0 A;  2R8G A;  4RZR A;  2J6U A;  1A76 A;  3PW0 A;  1ZQD A;  1EXN A;  4ECY A;  5J2E A;  4F4W A;  5KFO A;  2W9B A;  4I2A A;  9ICI A;  4DLG A;  1MQ3 A;  4UAZ A;  1DGS A;  4MEX A;  4B9V A;  4ELU A;  4IRD A;  2GJW A;  4G3I A;  2XGQ A;  2F1J A;  4F4K A;  1KEJ A;  4KTQ A;  4R8U A;  2NRX A;  1SKS A;  2XO7 A;  5CP2 A;  7ICQ A;  1L3T A;  2DFL A;  3SYZ A;  8ICA A;  1HJP A;  3EWA A;  1UA1 A;  2BPF A;  3RJJ A;  5DLF A;  2P66 A;  4EBE A;  2ZTD A;  3PX4 A;  3ZDD A;  1NOM A;  4DOC A;  1X9S A;  3OSN A;  4I29 A;  1ZQH A;  1BPY A;  4YXJ A;  1BPE A;  4ED2 A;  3PO5 A;  1RXV A;  2EO0 A;  2FPM A;  4YCX A;  5EWG A;  3THV A;  5J2K A;  5J2H A;  2KZM A;  5J2A A;  5BOL A;  3MDA A;  2HHX A;  4PGQ A;  1XMX A;  5HHI A;  2WIZ A;  4M9G A;  4DSJ A;  3AU6 A;  1A79 A;  5DG9 A;  9ICO A;  5L1L A;  4DOA A;  3MFH A;  1ZQJ A;  3ISC A;  8ICI A;  4DQP A;  4DS5 A;  5DB9 A;  7ICL A;  1K1S A;  2BQU A;  4JUZ A;  4M9J A;  4XA5 A;  3KHG A;  1ZQY A;  4O3R A;  1ZP7 A;  4RPZ A;  1S9F A;  4B9L A;  2R8I A;  4TQR A;  5CB1 A;  5C5J A;  2PFP A;  4ECS A;  2W9A A;  4KLE A;  3MGH A;  7ICR A;  2HHW A;  1DOQ A;  1ZQE A;  2W9M A;  3GV5 B;  4I2B A;  3LWM A;  3KTQ A;  7ICP A;  5KT5 A;  3KHH A;  5BPC A;  4F50 A;  8ICS A;  1ZQP A;  4M6W A;  5KFA A;  3RH5 A;  3RJF A;  3RB0 A;  4YD1 A;  3M9N B;  3ZDC A;  4F2S A;  4M47 A;  4KLS A;  4RQ2 A;  4QZ8 A;  4QWD A;  2KFZ A;  5CWR A;  4DSK A;  9ICT A;  1ZET A;  8ICV A;  2JEF A;  1ZQG A;  3C23 A;  5KG3 A;  5KG6 A;  1NJZ A;  4TQS A;  3M9O B;  1U48 A;  3QEA Z;  1JXE A;  5KFD A;  3GDX A;  3P1Z A;  4O5K A;  4F2R A;  1KFT A;  4J9N A;  4PGY A;  1XSL A;  4B9M A;  2BHN A;  4YD2 A;  4DLE A;  4F3O A;  1A77 A;  4BGD A;  4ED0 A;  8ICR A;  8ICJ A;  1U4B A;  3RJI A;  2V9W A;  2PXI A;  3AJV B;  2A1J A;  1L3S A;  4B9S A;  2ATL A;  1D8Y A;  2XCA A;  3M9M B;  4KIT B;  1TK0 A;  4NLZ A;  5BOM A;  5D46 A;  3MFI A;  3QZ8 A;  1JN3 A;  3MR5 A;  1Z00 B;  4KN7 A;  3RB4 A;  3Q8K A;  2NRT A;  1KTQ A;  5F9L A;  4J9P A;  2MUT B;  2KN7 A;  3B0Y A;  3GV8 B;  2C28 A;  7ICM A;  5DBA A;  3PR4 A;  5J2I A;  1T7P A;  3UXO A;  3Q8L A;  2J6S A;  5KT6 A;  4QZA A;  1IXR A;  4QZB A;  4J9K A;  4NLK A;  4PHP A;  9ICX A;  5DBC A;  4KLM A;  1NK4 A;  1OB8 A;  4R65 A;  3RJH A;  5HML A;  9ICG A;  4O3O A;  3UXN A;  4FBU A;  8ICO A;  4DL6 A;  4GXJ A;  2PI4 A;  3K75 D;  5DQI A;  5DB6 A;  4DFK A;  3TI0 A;  1RZT A;  4J9O A;  4PHD A;  8ICN A;  9ICA A;  1D9F A;  2IHM A;  4RQ7 A;  3V7L A;  2FMQ A;  1KLN A;  4RQ0 A;  4ELT A;  5EWF A;  3QZ7 A;  5J0Q A;  3GQC A;  7ICU A;  1NK5 A;  4JV0 A;  4B9U A;  9ICC A;  4O9M A;  5J0R A;  1N56 A;  4NLG A;  4EBD A;  3K4G A;  5DBB A;  2C2D A;  7ICN A;  1ZQW A;  1ZQF A;  1F1Z A;  4CCH A;  1KFS A;  1JXL A;  3Q8M A;  1ZQT A;  4BWJ A;  4GXI A;  4RNO A;  1UA0 A;  1SZP A;  4C8N A;  5DB8 A;  4RQ4 A;  4JWM A;  2WJ0 A;  9ICF A;  2NRZ A;  3E2E A;  2JZB A;  4O3P A;  3PML A;  5KG7 A;  4ECT A;  4NM1 A;  4KMU A;  3PNC A;  2FLN A;  8ICH A;  4K4I A;  5J0T A;  3PVX A;  8ICG A;  8ICC A;  4UB1 A;  3SV3 A;  3DNX A;  4DL5 A;  3RRH A;  3UPQ A;  3JPS A;  5KFP A;  5L9X A;  1T4G A;  1Y88 A;  3RAX A;  3GII A;  2ZJ8 A;  5KFK A;  1LB2 B;  4TUS A;  1RYS A;  2W9C B;  2ZTE A;  4Q8F A;  1S0V A;  4DFJ A;  2HVI A;  5JUM A;  3HW8 A;  3EPG A;  4J9M A;  4DOB A;  4M2Y A;  4I27 A;  4DFM A;  4MEY A;  3ISD A;  3TFS A;  4F92 B;  2ALZ A;  1B22 A;  4RPX A;  4R64 A;  3OGU A;  4DQR A;  4KLF A;  4Z6E A;  1WCN A;  3C2L A;  3V6J A;  1TK5 A;  4C8K A;  9ICJ A;  1NKE A;  1SL2 A;  4M9N A;  4Z6D A;  3G6X A;  5KFJ A;  1TAU A;  4MFC A;  4I2H A;  3GIM A;  1ARO P;  4TUP A;  4C8O A;  1HH1 A;  4ED3 A;  5III A;  4F4Y A;  2HHU A;  3H7I A;  2GWS A;  4ED1 A;  1ZQR A;  4NY8 A;  8ICY A;  4RPY A;  3BQ0 A;  1WCL A;  4I2C A;  3BQT A;  5J29 A;  2BCU A;  2PFN A;  3NTU A;  4RT3 A;  4Q44 A;  4RQ6 A;  4F5P A;  5KFM A;  1ZQX A;  1QSL A;  2IBK A;  8ICP A;  1QSY A;  4B9N A;  3PR5 B;  2XY6 A;  5CJ7 A;  1BPD A;  4PPX A;  2HHS A;  2FPK A;  9ICM A;  3LDA A;  5HMM A;  3Q8S B;  3RH4 A;  3BDP A;  3Q8P B;  4DS4 A;  8ICE A;  4DQS A;  3RTV A;  3C1Z A;  1ZJN A;  8ICF A;  4LZG A;  5J2C A;  4Z6F A;  1TV9 A;  1U9L A;  1U49 A;  1MQ2 A;  1ZQZ A;  5KFX A;  5KFW A;  3SI8 A;  3JPT A;  5IIJ A;  3OHA A;  3PW5 A;  5DDY A;  4UB4 A;  1HUO A;  2HW3 A;  4ECR A;  4YMM A;  3ETL A;  5J2G A;  5IIN A;  2HHV A;  4F93 B;  5KTQ A;  3EZ5 A;  8ICL A;  8ICT A;  5KFG A;  9ICS A;  2WIW A;  2BGW A;  3BQ1 A;  2AJQ A;  5DQG A;  2PFO A;  3V6H A;  3GV7 B;  2A1J B;  5CR0 A;  4QZ9 A;  3KHL A;  1S77 D;  4QW8 A;  5KFV A;  4GXK A;  5KFN A;  2R8K A;  2KZZ A;  2FLL A;  4QZD A;  1NJX A;  1RZN A;  4GC6 A;  4YG2 A;  4GC7 A;  1TK8 A;  2Y1J A;  4RUA A;  4ED8 A;  4I2F A;  1KFD A;  9ICR A;  3RH6 A;  4F4Z A;  3IM1 A;  3OHB A;  2J6T A;  1TVA A;  1S0O A;  2UVU A;  4MF8 A;  4YN4 A;  4TKD A;  3JPR A;  5DG8 A;  4J9L A;  1BPB A;  4F5Q A;  1C7Y A;  2P6R A;  4JV2 A;  2HHQ A;  4RU9 A;  4UBC A;  1ZQM A;  3G6Y A;  1H38 A;  1UT8 A;  4M9H A;  2JEG A;  4BXO B;  4QWB A;  5DGA A;  3TQ1 A;  3B0X A;  3T5K A;  4K4G A;  7ICS A;  4J9S A;  3V7K A;  4FBT A;  7ICK A;  2FCO A;  4NLN A;  3GIJ A;  3MR6 A;  1T8E A;  1BVS A;  2R8J A;  4XQ8 A;  4UBB A;  1RYR A;  4GLX A;  4YR2 A;  8ICU A;  2JEI A;  2C2E A;  3GIK A;  1KSP A;  3QEB Z;  5EOZ A;  3JPP A;  7ICI A;  2C2R A;  1TFR A;  5KT3 A;  4YR0 A;  4JWN A;  3ZD8 A;  4I2G A;  3LWL A;  1B43 A;  5KT4 A;  5J0S A;  4UAW A;  3V6K A;  5DDM A;  2XY5 A;  4M04 A;  1XO1 A;  4PGX A;  3RB6 A;  4DWI A;  4RT2 A;  4IQV A;  4O0I A;  2OWO A;  4ECX A;  1L5U A;  1BPZ A;  3T5H A;  4RNM A;  1IM4 A;  3HPO A;  5D49 A;  2ZYZ B;  1HUZ A;  3TFR A;  3HP6 A;  5KT2 A;  3C5G A;  3T5L A;  1D9D A;  1CEZ A;  3TAN A;  2KFN A;  3Q8R B;  4YR3 A;  5EWE A;  3PV8 A;  2NRW A;  1XSN A;  2R8H A;  2WCZ A;  5FDK A;  3RAQ A;  4UB5 A;  5TZV A;  4P4M A;  7ICH A;  4RNN A;  2P6U A;  4F5N A;  5DKW A;  2VA2 A;  4MFF A;  3NGD A;  5DG7 A;  1QTM A;  4EZ6 A;  1NJW A;  4YMO A;  4RQ5 A;  4QWE A;  4Q45 A;  2W9B B;  1NJY A;  1ZQL A;  2BDP A;  3EPI A;  5CA7 A;  1SKR A;  3PO4 A;  1COO A;  4EYH B;  3MR2 A;  2ISO A;  1UT5 A;  9ICB A;  9ICQ A;  3AJV A;  3EYZ A;  1X2I A;  1K1Q A;  4ED6 A;  3T5J A;  2ISP A;  4R8U B;  2AGO A;  4F8R A;  2INB A;  3H8W A;  9ICK A;  5D4B A;  1LV5 A;  4XRH A;  4R66 A;  5J2B A;  4HYK A;  4DQQ A;  1U47 A;  5KFQ A;  1Z00 A;  3H8S A;  3GFK B;  4DL3 A;  1KDH A;  1ZQU A;  1ZQC A;  2MUT A;  4M0A A;  5J2D A;  4UQG A;  1NK9 A;  4P4P A;  1ZQI A;  2IMW P;  1V9P A;  3ISB A;  1NK8 A;  4UB2 A;  1SL0 A;  5J0U A;  3SV4 A;  1PZN A;  2BKE A;  5J0W A;  2VA3 A;  3ZDB A;  4YVZ A;  3IHQ B;  5KFR A;  3MBY A;  3MGI A;  1NK7 A;  2W8K A;  3RJG A;  1L3U A;  2PI5 A;  4C8M A;  3AU2 A;  4K4H A;  9ICE A;  9ICH A;  1XC9 A;  2VLD A;  4X5V A;  4KN4 A;  9ICV A;  2I9G A;  2Y1I A;  4UB3 A;  3TAR A;  4KLD A;  4Q43 A;  3Q8Q B;  3M8S A;  3C2M A;  4F5R A;  3EW9 A;  3N4M B;  7ICF A;  2V4R A;  1CUK A;  4LVS A;  3OJU A;  3PW4 A;  5KFI A;  4TKK A;  1XSP A;  4QBL A;  1OB9 A;  2CV8 A;  3C21 A;  4DFP A;  3BQ2 A;  5IIM A;  1XU4 A;  1X9W A;  2H5X A;  3PMN A;  5IIL A;  3ZDE A;  4RQ1 A;  3M8R A;  4I2D A;  4IQU A;  2I1Q A;  4EYI B;  1ZQQ A;  2XY7 A;  5KFY A;  4R63 A;  4M6W B;  4P4O A;  1ZQN A;  4IRC A;  4Q8E A;  2KTQ A;  1BGX T;  2BCR A;  4TUQ A;  1MSW D;  4QBN A;  2Q0Z X;  3H4D A;  4RQ8 A;  1N48 A;  1TAQ A;  7ICJ A;  4DF8 A;  1ZQK A;  2AU0 A;  4BDP A;  4F4X A;  4ED7 A;  4MFA A;  2FMP A;  3TAQ A;  4YFK A;  5DLG A;  4UAY A;  1S76 D;  3MAB A;  1R11 A;  2GW6 A;  9ICL A;  3FYH A;  5KFU A;  4DL2 A;  3P1Z B;  5KG4 A;  2ZUC A;  2ZUB A;  3FDS A;  8ICZ A;  5KT7 A;  2ASL A;  4KLQ A;  4QZF A;  9ICN A;  5KFZ A;  4JK1 A;  4NM2 A;  2XC9 A;  2W9C A;  5L1K A;  3TAP A;  1T3N A;  2F1H A;  1D8L A;  3C1Y A;  8ICK A;  4J9Q A;  1RLV A;  3JPO A;  8ICM A;  1ZYQ A;  1MC8 A;  5KFT A;  3ZD9 A;  4QWA A;  2KZ3 A;  5KG2 A;  1RXW A;  5L1J A;  4ECU A;  5DQH A;  5J0Y A;  8ICB A;  3RR7 A;  4J9R A;  3RRG A;  3H40 A;  1JX4 A;  2ZUD A;  5IIK A;  2B21 A;  4KLU A;  1JMS A;  4YP3 A;  4QZI A;  2DPI A;  5KFL A;  1TKD A;  2LYH A;  4YXM A;  4EBC A;  3RB3 A;  1S0N A;  2BCV A;  4KLL A;  5KFS A;  8ICX A;  4QBO A;  4IQW A;  4DL4 A;  4KLJ A;  4QZC A;  5HP4 A;  2ASJ A;  2ZTC A;  5KFH A;  3RBE A;  4KLH A;  3N97 B;  3RJE A;  4FO6 A;  5J0X A;  5KFF A;  1U45 A;  3H8J A;  4IRK A;  2HVH A;  5DGB A;  1XWL A;  4PHE A;  2F1I A;  2NRV A;  3PW2 A;  4ZH4 A;  2MAX A;  2ZJA A;  5F9N A;  5IIO A;  3JPQ A;  4O3Q A;  3V7J A;  2AGP A;  2DPJ A;  3OJS A;  4M9L A;  2OKF A;  4E0D A;  5J0O A;  1BPX A;  9ICW A;  4C8L A;  3OSP A;  1XS9 D;  4DSF A;  3PW7 A;  3RBD A;  4DSL A;  2BQ3 A;  1L3V A;  2AGQ A;  3PX0 A;  1QLN A;  4DEZ A;  3UXP A;  3ORY A;  9ICP A;  2UVW A;  3PY8 A;  3RR8 A;  4KLG A;  4QZG A;  2BPG A;  2FLP A;  1ZQO A;  4I2J A;  4B9T A;  3P1Y A;  2C22 A;  3HWT A;  1R0V A;  4I2I A;  4O3N A;  2OST A;  4XUS A;  4I28 A;  3HX0 A;  3PX6 A;  2VA8 A;  4FS2 A;  4IQT A;  4QW9 A;  4ECZ A;  2UVR A;  2JZB B;  3MR3 A;  3UQ2 A;  1NKC A;  2BPC A;  2RDI A;  1ZQA A;  5KG1 A;  4DF4 A;  3JPN A;  1JIH A;  7ICE A;  4KLI A;  2VAN A;  2M9N A;  4MF2 A;  4O5C A;  3BJY A;  4RUC A;  4LZD A;  3T3F A;  4PH5 A;  2IA6 A;  3C5F A;  5L1I A;  2BR0 A;  3IEY A;  3AUO A;  5KG0 A;  4DL7 A;  2FMS A;  1RPL A;  5KFE A;  5HHH A;  2ASD A;  4EZ9 A;  1SL1 A;  1ZQS A;  2ZYZ A;  3MDC A;  1QSS A;  3UQ0 A;  4EEY A;  4BXO A;  1ZQV A;  1KRP A;  3KHR A;  2JEJ A;  2WTF A;  4JV1 A;  3H4B A;  3V72 A;  7ICO A;  2XGP A;  1ZJM A;  1SKW A;  7ICV A;  1IPI A;  4O3S A;  4BWM A;  5KFC A;  7ICG A;  3ZDA A;  7ICT A;  1S97 A;  4F91 B;  3FOV A;  5HNK A;  1Y1O A;  2PFQ A;  2AQ4 A;  2AQ0 A;  4F5O A;  3LK9 A;  4KLO A;  1NKB A;  4IR1 A;  1GEF A;  4Z6C A;  3QE9 Y;  1NK6 A;  8ICQ A;  4NXZ A;  2V4Q A;  2XCP A;  4DO9 A;  4KLT A;  3GIL A;  3RJK A;  4P2H A;  2HHT A;  1Z3E B;  8ICW A;  3SZ2 A;  4PHA A;  4O5E A;  2WCW A;  4DQI A;  5J2J A;  4QWC A;  4ELV A;  4DSI A;  2BCQ A;  9ICU A;  4ECW A;  4TUR A;  2BCS A;  5J2F A;  2UVV A;  2IHN A;  1S0M A;  4DSE A;  3C2K A;  2FPL A;  5KG5 A;  5CHG A;  5KFB A;  2W8L A;  1X9M A;  4IR9 A; 
#chains in the Genus database with same CATH topology
 1T0F A;  1ZQB A;  2QB0 A;  3DDH A;  2GLE A;  5DB7 A;  1L8L A;  3KZI U;  4QZH A;  2G5I B;  2R8G A;  1BNO A;  2J6U A;  1N63 A;  1A76 A;  3PW0 A;  1ZQ1 C;  2LMR A;  4IL6 U;  2M0N A;  2HOQ A;  4ECY A;  5KFO A;  4I2A A;  4UAZ A;  4MEX A;  5AKJ A;  1N62 A;  2F1J A;  1SZH A;  3DEE A;  2AXT U;  5KAI U;  5CP2 A;  1L3T A;  3HIL A;  1B0X A;  3NVY A;  1J97 A;  2KEY A;  1FEZ A;  2RLT A;  5AKG A;  3OSN A;  4I29 A;  3TAC B;  1ZQH A;  1BPE A;  3PO5 A;  3MDA A;  1FFV A;  2WIZ A;  3AU6 A;  1A79 A;  5DG9 A;  5L1L A;  4U7C A;  3MFH A;  8ICI A;  4DS5 A;  4JUZ A;  4Y2T A;  3KHG A;  4O3R A;  1S9F A;  4TQR A;  4KLE A;  2JGA A;  2W9A A;  1Q46 A;  1TE2 A;  1ZQE A;  3WK4 A;  4I2B A;  7ICP A;  1P7D A;  3CNH A;  5AK6 A;  5BPC A;  1SV4 A;  1ZQP A;  4M6W A;  3OTQ A;  5KFA A;  1RDF A;  4YD1 A;  1XO0 A;  2A1A A;  3C23 A;  4FZL A;  2YY6 A;  3M9O B;  3QEA Z;  1JXE A;  3T79 A;  2KG5 A;  2FI1 A;  2KIC A;  4O5K A;  5TIS U;  2BHN A;  5T14 A;  2V9W A;  3AJV B;  4NLZ A;  3UMG A;  5D46 A;  3QZ8 A;  3MR5 A;  3GV8 B;  5DBA A;  4NLK A;  1J2M A;  4Y2V A;  3LYS A;  3RJH A;  3UXN A;  5ALU A;  2F2A B;  3K75 D;  5DB6 A;  4DFK A;  8ICN A;  1D9F A;  3V7L A;  1VDV A;  2W7P A;  3K4G A;  1F1Z A;  2FJ6 A;  4C4R A;  5AM5 A;  2K8A A;  4GXI A;  5ALF A;  1HEK A;  4JWM A;  3PML A;  2LKY A;  3PNC A;  2FLN A;  8ICG A;  5KFP A;  2W3R A;  4DFJ A;  4MEY A;  3TFS A;  1B22 A;  2CN1 A;  4R64 A;  3OGU A;  3I76 A;  4DQR A;  4KLF A;  3C2L A;  3V6J A;  1NKE A;  1SL2 A;  5KFJ A;  4I2H A;  2DQN B;  4TUP A;  2ZG6 A;  1L7O A;  5III A;  2JJQ A;  1ZQR A;  4NY8 A;  4RPY A;  1HIW A;  3NTU A;  4RT3 A;  4B9N A;  3C1Z A;  5J2C A;  3QNM A;  1MQ2 A;  3SI8 A;  5KFW A;  1FIQ A;  5IIJ A;  2NO4 A;  3NVW A;  2XI9 A;  4PZN A;  4F93 B;  5KFG A;  1Q3U A;  2A1J B;  4EEL A;  3WKB A;  2FLL A;  3WKD A;  1Z4N A;  2OCE A;  4GC6 A;  4GC7 A;  4E6Z A;  3IEY B;  1KFD A;  2W7O A;  3RH6 A;  9ICR A;  4BX9 C;  2UVU A;  4CF4 A;  4UAS A;  4JV2 A;  4UBC A;  1ZQM A;  3G6Y A;  1CI4 A;  2JEG A;  3T5K A;  4J9S A;  2R8J A;  4GLX A;  4YR2 A;  3SAG A;  2C2E A;  1KSP A;  3JPP A;  5KT3 A;  4YR0 A;  3LWL A;  4F71 A;  1T3Q A;  2FDR A;  2EZY A;  1XNS A;  3F2B A;  4DWI A;  1QH9 A;  2WB1 C;  2AH5 A;  4O0I A;  3A0B U;  3CW2 C;  2K60 A;  3TFR A;  1D9D A;  5KT2 A;  3RFA A;  3FM9 A;  4C4S A;  2R8H A;  3RAQ A;  5EE3 A;  5TZV A;  4P4M A;  5DKW A;  3IG8 A;  2VA2 A;  4MFF A;  1WG8 A;  4QWE A;  3AMZ A;  2BH2 A;  2BDP A;  5CA7 A;  3PO4 A;  4EYH B;  3AJV A;  3EYZ A;  4Y2Y A;  4R8U B;  2QKQ A;  1V38 A;  1LV5 A;  3SEN A;  4R66 A;  5CEH A;  5J2B A;  1UWV A;  1NK8 A;  5ALL A;  2WFA A;  3SV4 A;  2E8N A;  3RJG A;  1L3U A;  4C8M A;  2VLD A;  4KN4 A;  2WAQ F;  4UB3 A;  3TAR A;  2V4R A;  3PW4 A;  2K8C B;  5AI4 A;  3L5K A;  3IP4 B;  3C21 A;  4DFP A;  4NWI A;  3VC8 A;  5AHX A;  4EYI B;  4IQU A;  2I1Q A;  2KTQ A;  1X6J A;  4TUQ A;  1N48 A;  2RHF A;  2H3V A;  1N61 A;  4ED7 A;  3BZK A;  2FMP A;  4YFK A;  2W54 A;  5DLG A;  2KK0 A;  2QB1 A;  4FZN A;  3AEV A;  4UW9 A;  2K89 A;  5AI8 A;  1RQL A;  4OJP A;  2EAO A;  1ZYQ A;  3ZD9 A;  5KG2 A;  4ECU A;  5DQH A;  1ZXI A;  3LVV A;  3RR7 A;  2E8P A;  4KLU A;  1ZRM A;  2LYH A;  4KLL A;  3RB3 A;  5KFS A;  4IQW A;  3NVZ A;  4KLH A;  4G9B A;  3N97 B;  5KFF A;  3J81 j;  3WK5 A;  4IRK A;  2F1I A;  2G08 A;  5IIO A;  3JPQ A;  4M9L A;  9ICW A;  1XS9 D;  4DSF A;  4DSL A;  2BQ3 A;  1SWV A;  1L3V A;  4DEZ A;  5AI9 A;  2BPG A;  3B9J A;  5AKH A;  4NL9 C;  4B9T A;  4ICA A;  4RQN A;  5ALZ A;  4I28 A;  3HX0 A;  4QW9 A;  4WJ3 B;  4ECZ A;  2JZB B;  1ZQA A;  3UQ2 A;  7ICE A;  2DBS A;  4KLI A;  2M9N A;  1Q8K A;  3BJY A;  4PH5 A;  2IA6 A;  3C5F A;  2EH9 A;  1NNL A;  3IEY A;  2FMS A;  2ASD A;  3WKE A;  5G5G A;  1ZQS A;  2MU2 A;  1J2N A;  1IV8 A;  3K1Z A;  1V85 A;  4PJ0 U;  2E3T A;  1ZJM A;  4PZO A;  1IIP A;  2JV3 A;  1URJ A;  2PFQ A;  4BJQ A;  2YTU A;  4NXZ A;  2XCP A;  2HHT A;  2XIC A;  3GIL A;  4P2H A;  3SZ2 A;  4O5E A;  2WCW A;  4ELV A;  2BCQ A;  9ICU A;  4TUR A;  4C7Y A;  2BCS A;  4DSE A;  5KG5 A;  5KFB A;  3F2D A;  5J0P A;  2ZJ5 A;  4ECV A;  5B5E U;  4P0P B;  3S6J A;  2JXJ A;  2BQR A;  3HT3 A;  4ECQ A;  2WF7 A;  3QU4 A;  4RZR A;  2K4I A;  2F76 X;  5E79 U;  4Y2X A;  9ICI A;  1RYU A;  4G3I A;  4USA A;  4KTQ A;  4R8U A;  2NRX A;  7ICQ A;  2XO7 A;  4QIW C;  2LBO A;  2DFL A;  4CNQ A;  3SYZ A;  1UA1 A;  3RJJ A;  2P66 A;  4US8 A;  3PX4 A;  1NOM A;  4Y2U A;  1L7M A;  1X9S A;  1BNP A;  4ED2 A;  3N28 A;  3QUC A;  2Z0R A;  2FPM A;  2EAP A;  2LI6 A;  2PMZ C;  3ONN A;  2KZM A;  3D6J A;  4DOA A;  3N7S C;  3ISC A;  4DQP A;  4M9J A;  1ZQY A;  1ZP7 A;  4RPZ A;  5AKX A;  4B9L A;  3TAD A;  5CB1 A;  2PFP A;  2HHW A;  2W9M A;  3LWM A;  4UAT A;  4F50 A;  4OD0 A;  3RH5 A;  2YML A;  4KLS A;  5CWR A;  4DSK A;  8ICV A;  2Y0S F;  5ALX A;  5KG3 A;  3F53 A;  1U48 A;  4AYB C;  3GDX A;  2FKH B;  2Y9U A;  1XSL A;  3NVV A;  4F3O A;  1U4B A;  2YB1 A;  1L3S A;  1JRO A;  4KIT B;  1TK0 A;  1WYG A;  4KN7 A;  3RB4 A;  7ICM A;  1T7P A;  1FFU A;  5ALJ A;  5KT6 A;  1IXR A;  1ZD3 A;  4J9K A;  9ICX A;  4R65 A;  4O3O A;  2W04 A;  4DL6 A;  4GXJ A;  2PI4 A;  5DQI A;  1QQ6 A;  3TI0 A;  1O03 A;  5J8Y A;  4PHD A;  4RQ7 A;  2EAN A;  1ZOL A;  1NK5 A;  4JV0 A;  4B9U A;  5J0R A;  1N56 A;  5DBB A;  7ICN A;  1N60 A;  1ZQW A;  2BDU A;  1KFS A;  3Q8M A;  1SZP A;  2DL0 A;  2JZB A;  2H3F A;  5KG7 A;  4KMU A;  3QU5 A;  3PVX A;  2JH1 A;  4FE3 A;  1VJ5 A;  2ESE A;  1OW5 A;  3DNX A;  5AKE A;  5L9X A;  1T4G A;  5ALW A;  2MRL A;  2K4P A;  3SR6 A;  2W9C B;  2KMD A;  5JUM A;  4DOB A;  4I27 A;  4F92 B;  1WCN A;  2GOL A;  3G6X A;  1ARO P;  2HHU A;  3H7I A;  2ZIU B;  2GWS A;  1JUD A;  2EDU A;  8ICY A;  5AKI A;  4I2C A;  5J29 A;  2IBK A;  3PR5 B;  2XY6 A;  1RQN A;  1BPD A;  5CJ7 A;  2HHS A;  3LDA A;  3Q8S B;  3RH4 A;  3BDP A;  2MSN A;  3HRD D;  2KKP A;  1ZJN A;  1U9L A;  1ZQZ A;  5EE9 A;  3F2C A;  4GFJ A;  2E8M A;  4CE6 A;  2LM1 A;  5DDY A;  4UB4 A;  2HW3 A;  3FC4 A;  3ETL A;  5J2G A;  2HHV A;  2N1R A;  1OUQ A;  3BQ1 A;  2AJQ A;  5DQG A;  4P0P A;  1SXD A;  3GV7 B;  3KHL A;  1S77 D;  4QW8 A;  5AK4 A;  2R8K A;  2OYY A;  5AKY A;  4ED8 A;  4I2F A;  4OJL A;  3QU2 A;  1TVA A;  1S0O A;  3WU2 U;  5DG8 A;  4F5Q A;  2HHQ A;  2ZYZ B;  4RU9 A;  4AP9 A;  4BXO B;  5DGA A;  3B0X A;  1TAM A;  3ED5 A;  3V7K A;  4FBT A;  1T8E A;  1BVS A;  8ICU A;  7ICI A;  3SQI A;  1DXS A;  3ZD8 A;  2BZF A;  3IF0 X;  4G6V A;  3IDW A;  2DKZ A;  5DDM A;  2XY5 A;  4RT2 A;  2OWO A;  4ECX A;  3UMC A;  3AQE A;  1L5U A;  1WUD A;  3T5H A;  1IM4 A;  3HPO A;  3ALR A;  1KW4 A;  3C5G A;  2JRZ A;  2HI0 A;  4YR3 A;  5AM4 A;  2NRW A;  5KNI A;  3U26 A;  5ALV A;  4YMO A;  4Q45 A;  2W9B B;  3EPI A;  1SKR A;  9ICB A;  2ISO A;  4F8R A;  2INB A;  3H8W A;  9ICK A;  3NAS A;  2WF9 A;  1WWV A;  4DL3 A;  4UQG A;  1ZQI A;  1V9P A;  1F0M A;  1SL0 A;  4C7Z A;  3ZDB A;  4YVZ A;  5KFR A;  3MGI A;  3KKA C;  2LYA A;  9ICE A;  9ICH A;  1QQ5 A;  1KKX A;  2Y1I A;  3Q8Q B;  4F5R A;  7ICF A;  4FZM A;  5KFI A;  1X40 A;  2QAR B;  4EX7 A;  1XSP A;  4TKK A;  1SWW A;  1XU4 A;  3F5A A;  5IIL A;  2DGZ A;  3ZDE A;  3M8R A;  1ZQQ A;  5KFY A;  1KN5 A;  1MN8 A;  4P4O A;  4IRC A;  2BCR A;  2Q0Z X;  1PUZ A;  1TAQ A;  4DF8 A;  1ZQK A;  2AU0 A;  3QU7 A;  3PSF A;  3TAQ A;  4UAY A;  2CPR A;  3P1Z B;  5KT7 A;  2ASL A;  1JI7 A;  2W9C A;  2XC9 A;  5L1K A;  3TAP A;  1T3N A;  3C1Y A;  3L4P A;  8ICK A;  1VLB A;  3JPO A;  5KFT A;  4QWA A;  5ALH A;  1L8O A;  5J0Y A;  2AHO B;  2ZUD A;  5F3X B;  4QZI A;  2DPI A;  2VJ4 A;  5AM2 A;  2MA1 A;  4EBC A;  2BCV A;  2LHT A;  2FL3 A;  5KFH A;  2Y0S C;  3IRU A;  3RJE A;  2IOF K;  4OJ5 A;  2HVH A;  5ALM A;  5F9N A;  4O3Q A;  3V7J A;  3OJS A;  2OKF A;  3H0L B;  3RBD A;  2E1E A;  3PX0 A;  9ICP A;  3ORY A;  2FLC A;  4KLG A;  4QZG A;  5AM1 A;  4I2J A;  1ZQO A;  4DCC A;  1R0V A;  4O3N A;  4DAV A;  2R18 A;  3PX6 A;  4FS2 A;  2IOH A;  4IQT A;  2KP7 A;  4LZG A;  1X6I A;  3MR3 A;  2RQ5 A;  1NKC A;  3JPN A;  5ALP A;  2VAN A;  2LPE A;  3T3F A;  2HOF A;  3AUO A;  3AQF A;  5KFE A;  5HHH A;  4EZ9 A;  4U6P A;  2ZYZ A;  1QSS A;  3UQ0 A;  4EEY A;  4BXO A;  3KFU F;  3KHR A;  2JEJ A;  1YZ6 A;  3BZC A;  1SKW A;  3TKA A;  7ICG A;  3ZDA A;  7ICT A;  1S97 A;  3M1Y A;  3ZI4 A;  5HNK A;  1UQV A;  1Z1B A;  2AQ4 A;  4KLO A;  3O0F A;  1NKB A;  1GEF A;  8ICQ A;  4KLT A;  4Y2R A;  4QWC A;  4ZQU A;  3ETR A;  2UVV A;  2IHN A;  1S0M A;  2D6F C;  2W8L A;  3C28 A;  5CHG A;  2WF5 A;  5AIC A;  4IR9 A;  5ALR A;  2G5H B;  4YMN A;  1JAL A;  4RQ3 A;  3G6V A;  1C20 A;  1K5O A;  2ODG A;  1NK0 A;  4IS7 A;  1ZQD A;  1EXN A;  2W9B A;  1DGS A;  2GJW A;  1X66 A;  1Z19 A;  1SKS A;  5AM0 A;  5ALQ A;  1DRG A;  8ICA A;  1HJP A;  3EWA A;  3ZDD A;  2P35 A;  1BPY A;  4YXJ A;  1RXV A;  2EO0 A;  4YCX A;  5EWG A;  5J2H A;  5J2A A;  5BOL A;  4NLC A;  5HHI A;  3QUB A;  4M9G A;  4DSJ A;  9ICO A;  1ZQJ A;  7ICL A;  1K1S A;  2BQU A;  4XA5 A;  1WWU A;  2QAR A;  2R8I A;  5C5J A;  7ICR A;  3HKZ F;  2E8O A;  1DOQ A;  3GV5 B;  3KTQ A;  5B66 U;  8ICS A;  2KIW A;  2F77 X;  3I28 A;  3RB0 A;  2LYB A;  3M9N B;  3ZDC A;  4F2S A;  4QZ8 A;  1SV0 C;  4GIB A;  1ZQG A;  5KG6 A;  3SAF A;  3D2S A;  3H0M B;  1SXE A;  3P1Z A;  5ALG A;  3SD7 A;  1KFT A;  5K4L A;  4J9N A;  4PGY A;  4B9M A;  4YD2 A;  1A77 A;  4BGD A;  8ICR A;  2PXI A;  4NL9 A;  2A1J A;  4B9S A;  2HBJ A;  4PL1 A;  3Q8K A;  5F9L A;  1KTQ A;  2HCF A;  4J9P A;  2MUT B;  2KN7 A;  5J2I A;  4QZA A;  4QZB A;  4PHP A;  4LQE A;  4KLM A;  1OB8 A;  5HML A;  4FBU A;  8ICO A;  2KD1 A;  4DAP A;  2IHM A;  4EEN A;  4CF5 A;  4RQ0 A;  5J0Q A;  2KJ9 A;  9ICC A;  3MGV A;  4O9M A;  2KE7 A;  4EV1 A;  1Z1V A;  1JXL A;  1FO4 A;  1ZQT A;  2D8C A;  2VKQ A;  1UA0 A;  4C8N A;  5DB8 A;  2ZIW B;  1YZ7 A;  5ALE A;  4K4I A;  5J0T A;  8ICC A;  4UB1 A;  3RRH A;  1CRX A;  3UPQ A;  3JPS A;  1Y88 A;  5AIA A;  3GII A;  2ZJ8 A;  1OXJ A;  4DFD A;  2ZTE A;  4Q8F A;  2HBM A;  1S0V A;  3HW8 A;  4M2Y A;  4J9M A;  1ZD4 A;  4Y2Q A;  4DFM A;  3ISD A;  3WKA A;  2EZZ A;  1TK5 A;  4C8K A;  1TAU A;  4MFC A;  4C8O A;  1HH1 A;  4F4Y A;  5JRT A;  2LM4 A;  2BCU A;  4KX5 A;  4F5P A;  4RQ6 A;  5KFM A;  1ZQX A;  1QSY A;  4PPX A;  5AIB A;  2FPK A;  3Q8P B;  3RTV A;  1TV9 A;  4CRX A;  2HBK A;  3DV9 A;  1UHU A;  3JPT A;  2ES6 A;  3OHA A;  1HUO A;  1ZD2 P;  4ECR A;  3AM9 A;  1AQ6 A;  3UM9 A;  8ICL A;  8ICT A;  3EZ5 A;  1KBU A;  2KJ8 A;  2BGW A;  2KHQ A;  4QZ9 A;  1PVQ A;  5KFV A;  5KFN A;  2KZZ A;  4QZD A;  1NJX A;  1RZN A;  4YG2 A;  2Y1J A;  1KL9 A;  1N5X A;  2KIV A;  4F4Z A;  3OHB A;  4MF8 A;  4YN4 A;  4TKD A;  2NO5 A;  4J9L A;  1C7Y A;  2P6R A;  2KVC A;  1H38 A;  1UT8 A;  4M9H A;  3TQ1 A;  2FCO A;  4NLN A;  4OJ6 A;  1L6N A;  3GIJ A;  5AKL A;  4RQM A;  2NV3 A;  4UBB A;  3GIK A;  1A6S A;  4C0Z A;  2C2R A;  3BS5 B;  2JHD A;  4I2G A;  1B43 A;  3NRZ A;  5J0S A;  3V6K A;  2E1F A;  2OHF A;  1XO1 A;  4PGX A;  2W8M A;  1X9X A;  2VJ5 A;  3NUQ A;  4RNM A;  3R9K A;  2JMG A;  1HUZ A;  3HP6 A;  3T5L A;  5ALK A;  3TAN A;  3Q8R B;  2OH2 A;  2HMX A;  3H8M A;  4A8E A;  4RNN A;  2P6U A;  4F5N A;  3PZP A;  1N2X A;  2ZIX B;  2K8B B;  5DG7 A;  1PVR A;  4RQ5 A;  1NJY A;  1COO A;  3MR2 A;  1K1Q A;  1X2I A;  2O6K A;  3QUT A;  2AGO A;  4OJO A;  2EZX A;  5D4B A;  2WAQ C;  4XRH A;  1DK2 A;  4DQQ A;  1U47 A;  5KFQ A;  3GFK B;  4M0A A;  1ZQU A;  2MUT A;  5J2D A;  2IMW P;  1NK9 A;  4P4P A;  3ISB A;  5J0U A;  1PZN A;  2VA3 A;  2XVT A;  5J0W A;  1UCV A;  2W8K A;  2CRX A;  3AU2 A;  1ZD5 A;  3PST A;  9ICV A;  2I9G A;  4KLD A;  4Q43 A;  3N4M B;  3IN5 A;  1CUK A;  3OJU A;  2QLT A;  1OB9 A;  4HAI A;  3BQ2 A;  3M6Z A;  3CYM A;  3PMN A;  4RQ1 A;  4UAV A;  4I2D A;  4Q8E A;  4R63 A;  1ZQN A;  1BGX T;  1LKY B;  7ICJ A;  2W03 A;  1F44 A;  2ZIW A;  4F4X A;  2GW6 A;  3MAB A;  9ICL A;  3F5E A;  5KFU A;  5KG4 A;  2ZUC A;  5KL8 B;  3FDS A;  8ICZ A;  5AK3 A;  4KLQ A;  9ICN A;  4JK1 A;  1RLV A;  1RXW A;  1MC8 A;  3HKZ C;  2KZ3 A;  5L1J A;  1NZB A;  4OCZ A;  4J9R A;  3RRG A;  3H40 A;  1JX4 A;  1JMS A;  2XID A;  3CP8 A;  4YP3 A;  1TKD A;  4YXM A;  4KX3 A;  4IC9 A;  8ICX A;  3KZX A;  3A0H U;  3RBE A;  5AI0 A;  5J0X A;  2EQY A;  4CDG A;  3H8J A;  3N7R C;  4ZH4 A;  2ZJA A;  2AGP A;  2DPJ A;  5ALN A;  4E0D A;  1BPX A;  3C29 A;  3OSP A;  2DBY A;  3WK8 A;  3PW7 A;  5ALI A;  3LVW A;  1QLN A;  2KJ5 A;  3H0R B;  1O08 A;  2UVW A;  2ZXH A;  3PY8 A;  4JMU A;  2YX8 A;  2FLP A;  2C22 A;  2KOB A;  4I2I A;  1SB3 C;  4XUS A;  2A19 A;  2W55 A;  4OO1 J;  3UMB A;  2RDI A;  3IG5 A;  4O3M A;  1JIH A;  4MF2 A;  4O5C A;  4RUC A;  4LZD A;  4PL2 A;  2BR0 A;  5AKZ A;  1V97 A;  5KG0 A;  2FKC A;  1RPL A;  2Z7J A;  3IV6 A;  4EX6 A;  1KRP A;  1ECW A;  2WTF A;  4JV1 A;  3H4B A;  3L3F X;  2XGP A;  7ICV A;  3GZF A;  1IPI A;  4O3S A;  4F91 B;  1Y1O A;  3BS5 A;  4Y2S A;  4F5O A;  3LK9 A;  3QE9 Y;  3QU9 A;  2V4Q A;  1IG6 A;  4DO9 A;  1Z3E B;  4MHV A;  4PHA A;  4DQI A;  4ECW A;  5AKK A;  3AL0 B;  3KKA A;  2FPL A;  1X9M A;  2GH1 A;  3GU3 A;  2YN4 A;  4FS1 A;  5AM3 A;  1S10 A;  4QZE A;  1ED1 A;  2DWQ A;  4YQW A;  4I2E A;  2RDJ A;  2ZIX A;  2Q4T A;  4F72 A;  5J2E A;  4F4W A;  1QCK A;  4DLG A;  1MQ3 A;  2D3D A;  4B9V A;  5CRX A;  4ELU A;  4IRD A;  3QXG A;  2XGQ A;  2IXS A;  4F4K A;  1KEJ A;  3RF9 A;  3QYP A;  2BPF A;  5DLF A;  4EBE A;  2ZTD A;  4DOC A;  3WKC A;  3ICX A;  3D2Q A;  4UB6 U;  5ALY A;  3THV A;  2DKX A;  5FP0 A;  5J2K A;  2HHX A;  4PGQ A;  1ZRN A;  1XMX A;  4QIW F;  2W11 A;  2H3I A;  5DB9 A;  1T94 A;  5AI6 A;  2ZIU A;  4ECS A;  2PMZ F;  3MGH A;  4CF3 A;  2E5S A;  2G06 A;  5KT5 A;  2DF4 B;  3KHH A;  4P0Q B;  2B0C A;  3QX7 A;  3RJF A;  1LKY A;  4M47 A;  2CZR A;  4RQ2 A;  4QWD A;  2KFZ A;  5ALS A;  9ICT A;  1ZET A;  2JEF A;  1NJZ A;  2F3N A;  5EE0 A;  4TQS A;  2F44 A;  5KFD A;  4F2R A;  3KOO A;  4DLE A;  8ICJ A;  4ED0 A;  3RJI A;  2ATL A;  1D8Y A;  2K4H A;  2XCA A;  3M9M B;  2HDO A;  2G07 A;  4ACO A;  5BOM A;  3MFI A;  1JN3 A;  1Z00 B;  2I5H A;  4AYB F;  2NRT A;  3MC1 A;  4Y2P A;  2HOI A;  3B0Y A;  2C28 A;  3PR4 A;  3UXO A;  3Q8L A;  5HR6 A;  2J6S A;  1A0P A;  2KVS A;  5DBC A;  1NK4 A;  3SMV A;  9ICG A;  2A3V A;  1RZT A;  4J9O A;  1SGG A;  5GTI U;  3M6K A;  2FE9 A;  9ICA A;  2ZIV B;  4ELT A;  2FMQ A;  1KLN A;  5EWF A;  3E58 A;  3QZ7 A;  3GQC A;  7ICU A;  3N7P D;  4QJF B;  4NLG A;  4EBD A;  2C2D A;  4LJX A;  1ZQF A;  1KQQ A;  4CCH A;  2YMQ A;  4BWJ A;  2KSO B;  2KHV A;  3AN1 A;  4RNO A;  4RQ4 A;  3NS1 A;  2WJ0 A;  9ICF A;  2NRZ A;  3E2E A;  4O3P A;  4ECT A;  4NM1 A;  8ICH A;  4C80 A;  4JB3 A;  3SV3 A;  2ZXI A;  4DL5 A;  2W43 A;  3RAX A;  5KFK A;  1LB2 B;  4TUS A;  1RYS A;  3BS7 A;  1DGJ A;  2HVI A;  3EPG A;  2YQE A;  1RM6 C;  1D8B A;  2ALZ A;  4RPX A;  4Z6E A;  2L5Y A;  9ICJ A;  4M9N A;  4Z6D A;  3GIM A;  3NRW A;  4G6U A;  2H3Q A;  4J03 A;  4ED3 A;  4ED1 A;  3BQ0 A;  1WCL A;  3BQT A;  2PFN A;  4Q44 A;  8ICP A;  1QSL A;  2CXY A;  9ICM A;  5HMM A;  5JTI A;  4DS4 A;  3PSI A;  4DQS A;  8ICE A;  2HSZ A;  8ICF A;  4Z6F A;  1U49 A;  2W3S A;  5KFX A;  1PVP A;  4DA2 A;  3M7D A;  3PW5 A;  5GTH U;  2YMP A;  1MA7 A;  4YMM A;  5IIN A;  4ZOH C;  5KTQ A;  9ICS A;  4UB8 U;  1RG6 A;  2YMM A;  2WIW A;  1SIJ A;  1PK1 B;  2PFO A;  1X42 A;  3V6H A;  2OEH A;  5CR0 A;  4GXK A;  2NYV A;  1TK8 A;  4RUA A;  3D2N A;  3IM1 A;  2J6T A;  5ALD A;  4UAU A;  3JPR A;  1BPB A;  4QWB A;  1SV0 A;  4K4G A;  7ICS A;  7ICK A;  3MR6 A;  4XQ8 A;  1RYR A;  5KAF U;  2JEI A;  1S8O A;  5ALO A;  3QEB Z;  5EOZ A;  1TFR A;  4JWN A;  2JH7 A;  1L7N A;  5KT4 A;  2F8K A;  4UAW A;  4NV0 A;  1NZP A;  4NLB A;  4EEK A;  4M04 A;  3RB6 A;  4IQV A;  3K1R B;  1BPZ A;  1QQ7 A;  2DUY A;  5D49 A;  4UAR A;  4P0Q A;  1CEZ A;  1YNM A;  2QB0 B;  2KFN A;  3PV8 A;  5EWE A;  5FDK A;  2WCZ A;  1XSN A;  2OXO A;  4UB5 A;  7ICH A;  3OPX A;  1Q3V A;  3NGD A;  1QTM A;  4EZ6 A;  1NJW A;  1Z4O A;  3PSP A;  2KKV A;  1ZQL A;  2KNJ A;  2F8L A;  1UT5 A;  9ICQ A;  4US9 A;  3T5J A;  1L7P A;  2YB4 A;  4ED6 A;  2ISP A;  3BQ7 A;  2RRD A;  4HYK A;  1Z00 A;  3H8S A;  1ZQC A;  3WK9 A;  1KDH A;  1F5S A;  4UB2 A;  3WK7 A;  5ALT A;  2B6G A;  2BKE A;  5AK5 A;  3IHQ B;  3MBY A;  1NK7 A;  2OM6 A;  2PI5 A;  4NJ8 A;  4K4H A;  1XC9 A;  5H2F U;  4X5V A;  5L1M A;  3M8S A;  3C2M A;  3EW9 A;  4LVS A;  3SAH A;  2ZIV A;  4QBL A;  2CV8 A;  5IIM A;  1X9W A;  2H5X A;  2XY7 A;  4M6W B;  1N5W A;  1MSW D;  4QBN A;  3H4D A;  4RQ8 A;  2KSO A;  3VCB A;  4BDP A;  2WF8 A;  4MFA A;  5C0Y A;  1S76 D;  1R11 A;  2VIX A;  3FYH A;  4DL2 A;  3WK6 A;  2ZUB A;  3HJE A;  4QZF A;  1LVH A;  2G09 A;  2VS1 A;  1PK3 A;  5KFZ A;  4KMO B;  4NM2 A;  2WF6 A;  2F1H A;  1D8L A;  4J9Q A;  8ICM A;  1UPH A;  2I6X A;  8ICB A;  4BUG A;  5IIK A;  2B21 A;  1M6Y A;  5KFL A;  3TAD C;  4C4T A;  1S0N A;  4QBO A;  2HBL A;  4DL4 A;  4KLJ A;  4QZC A;  5HP4 A;  2ASJ A;  2ZTC A;  4FO6 A;  1U45 A;  5A0L A;  1XWL A;  5DGB A;  4PHE A;  1DK3 A;  2NRV A;  3PW2 A;  2MAX A;  2EAM A;  5J0O A;  4C8L A;  3EUB 2;  1NI3 A;  2AGQ A;  3UXP A;  5G5H A;  5AI5 A;  3RR8 A;  1B4F A;  3I1Y A;  4Y2J A;  3P1Y A;  3HWT A;  4CGZ A;  2OST A;  2VA8 A;  2UVR A;  1PK1 A;  1GO3 F;  2BPC A;  5KG1 A;  4B6J A;  4DF4 A;  2H3Z A;  2RP5 A;  3FAH A;  5L1I A;  2K4E A;  3KD3 A;  4DL7 A;  2WB1 F;  1SL1 A;  3MDC A;  2JR5 A;  2PKE A;  5HR7 A;  3SEI A;  5KL1 B;  1ZQV A;  5J8Y C;  5JU5 A;  3BT7 A;  3V72 A;  7ICO A;  1COK A;  2KV2 A;  2GO7 A;  4BWM A;  3QUQ A;  4QNL A;  5KFC A;  3FOV A;  5EE1 A;  2AQ0 A;  3KBB A;  4IR1 A;  2Y9T A;  4Z6C A;  1NK6 A;  2WHE A;  3RJK A;  8ICW A;  4FFD A;  3E0F A;  1YT3 A;  5J2J A;  2IOF A;  4DSI A;  5J2F A;  1S5L U;  3C2K A;  1JRP A;  2G0A A;  3CRX A; 
#chains in the Genus database with same CATH homology
 4FS1 A;  1T0F A;  5J0P A;  2ZJ5 A;  4ECV A;  1ZQB A;  4YMN A;  1S10 A;  4QZE A;  2BQR A;  5DB7 A;  4RQ3 A;  3HT3 A;  3G6V A;  4ECQ A;  4YQW A;  4I2E A;  4QZH A;  2RDJ A;  1NK0 A;  2R8G A;  4RZR A;  2J6U A;  1A76 A;  3PW0 A;  1ZQD A;  1EXN A;  4ECY A;  5J2E A;  4F4W A;  5KFO A;  2W9B A;  4I2A A;  9ICI A;  4DLG A;  1MQ3 A;  4UAZ A;  1DGS A;  4MEX A;  4B9V A;  4ELU A;  4IRD A;  2GJW A;  4G3I A;  2XGQ A;  2IXS A;  2F1J A;  4F4K A;  1KEJ A;  4KTQ A;  4R8U A;  2NRX A;  1SKS A;  2XO7 A;  5CP2 A;  7ICQ A;  1L3T A;  2DFL A;  3SYZ A;  8ICA A;  1HJP A;  3EWA A;  1UA1 A;  2BPF A;  3RJJ A;  5DLF A;  2P66 A;  4EBE A;  2ZTD A;  3PX4 A;  3ZDD A;  1NOM A;  4DOC A;  1X9S A;  3OSN A;  4I29 A;  1ZQH A;  1BPY A;  4YXJ A;  1BPE A;  4ED2 A;  3PO5 A;  2Z0R A;  1RXV A;  2EO0 A;  2FPM A;  4YCX A;  5EWG A;  3THV A;  5J2K A;  5J2H A;  2KZM A;  5J2A A;  5BOL A;  3MDA A;  2HHX A;  4PGQ A;  1XMX A;  5HHI A;  2WIZ A;  4M9G A;  4DSJ A;  3AU6 A;  1A79 A;  5DG9 A;  9ICO A;  5L1L A;  4DOA A;  3MFH A;  1ZQJ A;  3ISC A;  8ICI A;  4DQP A;  4DS5 A;  5DB9 A;  7ICL A;  1K1S A;  2BQU A;  4JUZ A;  4M9J A;  4XA5 A;  3KHG A;  1ZQY A;  4O3R A;  1ZP7 A;  4RPZ A;  1S9F A;  4B9L A;  2R8I A;  4TQR A;  5CB1 A;  5C5J A;  2PFP A;  4ECS A;  2W9A A;  4KLE A;  3MGH A;  7ICR A;  2HHW A;  1DOQ A;  1ZQE A;  2W9M A;  3GV5 B;  4I2B A;  3LWM A;  3KTQ A;  7ICP A;  5KT5 A;  3KHH A;  5BPC A;  4F50 A;  8ICS A;  1ZQP A;  4M6W A;  5KFA A;  3RH5 A;  3RJF A;  3RB0 A;  4YD1 A;  3M9N B;  3ZDC A;  4F2S A;  4M47 A;  4KLS A;  2CZR A;  4RQ2 A;  4QZ8 A;  4QWD A;  2KFZ A;  5CWR A;  4DSK A;  9ICT A;  1ZET A;  8ICV A;  2JEF A;  1ZQG A;  3C23 A;  5KG3 A;  5KG6 A;  1NJZ A;  4TQS A;  3M9O B;  1U48 A;  3QEA Z;  1JXE A;  5KFD A;  3GDX A;  2FKH B;  3P1Z A;  4O5K A;  4F2R A;  1KFT A;  4J9N A;  4PGY A;  1XSL A;  4B9M A;  2BHN A;  4YD2 A;  4DLE A;  4F3O A;  1A77 A;  4BGD A;  4ED0 A;  8ICR A;  8ICJ A;  1U4B A;  3RJI A;  2V9W A;  2PXI A;  3AJV B;  2A1J A;  1L3S A;  4B9S A;  2ATL A;  1D8Y A;  2XCA A;  3M9M B;  4KIT B;  1TK0 A;  4NLZ A;  5BOM A;  5D46 A;  3MFI A;  3QZ8 A;  1JN3 A;  3MR5 A;  1Z00 B;  4KN7 A;  3RB4 A;  3Q8K A;  2NRT A;  1KTQ A;  5F9L A;  4J9P A;  2MUT B;  2KN7 A;  3B0Y A;  3GV8 B;  2C28 A;  7ICM A;  5DBA A;  3PR4 A;  5J2I A;  1T7P A;  3UXO A;  3Q8L A;  2J6S A;  5KT6 A;  4QZA A;  1IXR A;  4QZB A;  4J9K A;  4NLK A;  4PHP A;  9ICX A;  5DBC A;  4LQE A;  4KLM A;  1NK4 A;  1OB8 A;  4R65 A;  3RJH A;  5HML A;  9ICG A;  4O3O A;  3UXN A;  4FBU A;  8ICO A;  4DL6 A;  4GXJ A;  2PI4 A;  3K75 D;  5DQI A;  5DB6 A;  4DFK A;  3TI0 A;  1RZT A;  4J9O A;  4DAP A;  4PHD A;  8ICN A;  9ICA A;  1D9F A;  2IHM A;  4RQ7 A;  3V7L A;  2FMQ A;  1KLN A;  4RQ0 A;  4ELT A;  5EWF A;  3QZ7 A;  5J0Q A;  3GQC A;  7ICU A;  1NK5 A;  4JV0 A;  4B9U A;  9ICC A;  4O9M A;  5J0R A;  1N56 A;  4NLG A;  4EBD A;  3K4G A;  5DBB A;  2C2D A;  7ICN A;  1ZQW A;  1ZQF A;  1F1Z A;  4CCH A;  1KFS A;  4EV1 A;  1JXL A;  3Q8M A;  1ZQT A;  4BWJ A;  4GXI A;  4RNO A;  1UA0 A;  1SZP A;  4C8N A;  5DB8 A;  4RQ4 A;  4JWM A;  2WJ0 A;  9ICF A;  2NRZ A;  3E2E A;  2JZB A;  4O3P A;  3PML A;  5KG7 A;  4ECT A;  4NM1 A;  4KMU A;  3PNC A;  2FLN A;  8ICH A;  4K4I A;  5J0T A;  3PVX A;  8ICG A;  8ICC A;  4UB1 A;  3SV3 A;  3DNX A;  4DL5 A;  3RRH A;  3UPQ A;  3JPS A;  5KFP A;  5L9X A;  1T4G A;  1Y88 A;  3RAX A;  3GII A;  2ZJ8 A;  5KFK A;  1LB2 B;  4TUS A;  1RYS A;  2W9C B;  2ZTE A;  4Q8F A;  1S0V A;  4DFJ A;  2HVI A;  5JUM A;  3HW8 A;  3EPG A;  4J9M A;  4DOB A;  4M2Y A;  4I27 A;  4DFM A;  4MEY A;  3ISD A;  3TFS A;  4F92 B;  2ALZ A;  1B22 A;  4RPX A;  4R64 A;  3OGU A;  4DQR A;  4KLF A;  4Z6E A;  1WCN A;  3C2L A;  3V6J A;  1TK5 A;  4C8K A;  9ICJ A;  1NKE A;  1SL2 A;  4M9N A;  4Z6D A;  3G6X A;  5KFJ A;  1TAU A;  4MFC A;  4I2H A;  3GIM A;  1ARO P;  4TUP A;  4C8O A;  4G6U A;  1HH1 A;  4ED3 A;  5III A;  4F4Y A;  2HHU A;  3H7I A;  2GWS A;  4ED1 A;  2JJQ A;  1ZQR A;  4NY8 A;  8ICY A;  4RPY A;  3BQ0 A;  1WCL A;  4I2C A;  3BQT A;  5J29 A;  2BCU A;  2PFN A;  3NTU A;  4RT3 A;  4Q44 A;  4RQ6 A;  4F5P A;  5KFM A;  1ZQX A;  1QSL A;  2IBK A;  8ICP A;  1QSY A;  4B9N A;  3PR5 B;  2XY6 A;  5CJ7 A;  1BPD A;  4PPX A;  2HHS A;  2FPK A;  9ICM A;  3LDA A;  5HMM A;  3Q8S B;  3RH4 A;  3BDP A;  3Q8P B;  4DS4 A;  8ICE A;  4DQS A;  3RTV A;  3C1Z A;  1ZJN A;  8ICF A;  4LZG A;  5J2C A;  4Z6F A;  1TV9 A;  1U9L A;  1U49 A;  1MQ2 A;  1ZQZ A;  5KFX A;  5KFW A;  3SI8 A;  4DA2 A;  3JPT A;  5IIJ A;  3OHA A;  3PW5 A;  5DDY A;  4UB4 A;  1HUO A;  2HW3 A;  4ECR A;  4YMM A;  3ETL A;  5J2G A;  5IIN A;  2HHV A;  4F93 B;  5KTQ A;  3EZ5 A;  8ICL A;  8ICT A;  5KFG A;  9ICS A;  2WIW A;  2BGW A;  3BQ1 A;  2AJQ A;  5DQG A;  2PFO A;  3V6H A;  3GV7 B;  2A1J B;  5CR0 A;  4QZ9 A;  3KHL A;  1S77 D;  4QW8 A;  5KFV A;  4GXK A;  5KFN A;  2R8K A;  2KZZ A;  2FLL A;  4QZD A;  1NJX A;  1RZN A;  4GC6 A;  4YG2 A;  4GC7 A;  1TK8 A;  2Y1J A;  4E6Z A;  4RUA A;  4ED8 A;  3IEY B;  4I2F A;  1KFD A;  9ICR A;  3RH6 A;  4F4Z A;  3IM1 A;  3OHB A;  2J6T A;  1TVA A;  1S0O A;  2UVU A;  4MF8 A;  4YN4 A;  4TKD A;  3JPR A;  5DG8 A;  4J9L A;  1BPB A;  4F5Q A;  1C7Y A;  2P6R A;  4JV2 A;  2HHQ A;  4RU9 A;  4UBC A;  1ZQM A;  3G6Y A;  1H38 A;  1UT8 A;  4M9H A;  2JEG A;  4BXO B;  4QWB A;  5DGA A;  3TQ1 A;  3B0X A;  3T5K A;  4K4G A;  7ICS A;  4J9S A;  3V7K A;  4FBT A;  7ICK A;  2FCO A;  4NLN A;  3GIJ A;  3MR6 A;  1T8E A;  1BVS A;  2R8J A;  4XQ8 A;  4UBB A;  1RYR A;  4GLX A;  4YR2 A;  8ICU A;  2JEI A;  2C2E A;  3GIK A;  1KSP A;  3QEB Z;  5EOZ A;  3JPP A;  7ICI A;  2C2R A;  1TFR A;  5KT3 A;  4YR0 A;  4JWN A;  3ZD8 A;  4I2G A;  3LWL A;  1B43 A;  3IF0 X;  5KT4 A;  4G6V A;  5J0S A;  4UAW A;  3V6K A;  5DDM A;  2XY5 A;  4M04 A;  1XO1 A;  4PGX A;  2W8M A;  3RB6 A;  4DWI A;  4RT2 A;  4IQV A;  4O0I A;  2OWO A;  4ECX A;  1L5U A;  1BPZ A;  3T5H A;  4RNM A;  1IM4 A;  3HPO A;  5D49 A;  2ZYZ B;  1HUZ A;  3TFR A;  3HP6 A;  5KT2 A;  3C5G A;  3T5L A;  1D9D A;  1CEZ A;  1YNM A;  3TAN A;  2KFN A;  3Q8R B;  4YR3 A;  5EWE A;  3PV8 A;  2NRW A;  1XSN A;  2R8H A;  2WCZ A;  5FDK A;  3RAQ A;  4UB5 A;  5TZV A;  4P4M A;  7ICH A;  4RNN A;  2P6U A;  4F5N A;  5DKW A;  2VA2 A;  4MFF A;  3NGD A;  5DG7 A;  1QTM A;  4EZ6 A;  1NJW A;  4YMO A;  4RQ5 A;  4QWE A;  4Q45 A;  2W9B B;  1NJY A;  1ZQL A;  2BDP A;  3EPI A;  2BH2 A;  5CA7 A;  1SKR A;  3PO4 A;  1COO A;  4EYH B;  3MR2 A;  2ISO A;  1UT5 A;  9ICB A;  9ICQ A;  3AJV A;  3EYZ A;  1X2I A;  1K1Q A;  4ED6 A;  3T5J A;  2ISP A;  4R8U B;  2AGO A;  4F8R A;  2INB A;  3H8W A;  9ICK A;  5D4B A;  1LV5 A;  4XRH A;  4R66 A;  5J2B A;  4HYK A;  4DQQ A;  1U47 A;  5KFQ A;  1Z00 A;  3H8S A;  3GFK B;  4DL3 A;  1KDH A;  1ZQU A;  1ZQC A;  2MUT A;  4M0A A;  1UWV A;  5J2D A;  4UQG A;  1NK9 A;  4P4P A;  1ZQI A;  2IMW P;  1V9P A;  3ISB A;  1NK8 A;  4UB2 A;  1SL0 A;  5J0U A;  3SV4 A;  1PZN A;  2BKE A;  5J0W A;  2VA3 A;  3ZDB A;  4YVZ A;  3IHQ B;  5KFR A;  3MBY A;  3MGI A;  1NK7 A;  2W8K A;  3RJG A;  1L3U A;  2PI5 A;  4C8M A;  3AU2 A;  4K4H A;  9ICE A;  9ICH A;  1XC9 A;  2VLD A;  4X5V A;  4KN4 A;  9ICV A;  2I9G A;  2Y1I A;  4UB3 A;  3TAR A;  4KLD A;  4Q43 A;  3Q8Q B;  3M8S A;  3C2M A;  4F5R A;  3EW9 A;  3N4M B;  7ICF A;  2V4R A;  1CUK A;  4LVS A;  3OJU A;  3PW4 A;  5KFI A;  4TKK A;  1XSP A;  4QBL A;  1OB9 A;  2CV8 A;  3C21 A;  4DFP A;  3BQ2 A;  5IIM A;  1XU4 A;  1X9W A;  2H5X A;  3PMN A;  5IIL A;  3ZDE A;  4RQ1 A;  3M8R A;  4I2D A;  4IQU A;  2I1Q A;  4EYI B;  1ZQQ A;  2XY7 A;  5KFY A;  4R63 A;  4M6W B;  4P4O A;  1ZQN A;  4IRC A;  4Q8E A;  2KTQ A;  1BGX T;  2BCR A;  4TUQ A;  1MSW D;  4QBN A;  2Q0Z X;  3H4D A;  4RQ8 A;  1N48 A;  1TAQ A;  7ICJ A;  4DF8 A;  1ZQK A;  2AU0 A;  4BDP A;  4F4X A;  4ED7 A;  4MFA A;  2FMP A;  3TAQ A;  4YFK A;  5DLG A;  4UAY A;  1S76 D;  3MAB A;  1R11 A;  2GW6 A;  9ICL A;  3FYH A;  5KFU A;  4DL2 A;  3P1Z B;  5KG4 A;  2ZUC A;  2ZUB A;  3FDS A;  8ICZ A;  5KT7 A;  2ASL A;  4KLQ A;  4QZF A;  2VS1 A;  9ICN A;  5KFZ A;  4JK1 A;  4NM2 A;  2XC9 A;  2W9C A;  5L1K A;  3TAP A;  1T3N A;  2F1H A;  1D8L A;  3C1Y A;  8ICK A;  4J9Q A;  1RLV A;  3JPO A;  8ICM A;  1ZYQ A;  1MC8 A;  5KFT A;  3ZD9 A;  4QWA A;  2KZ3 A;  5KG2 A;  1RXW A;  5L1J A;  4ECU A;  5DQH A;  5J0Y A;  8ICB A;  3RR7 A;  4J9R A;  3RRG A;  3H40 A;  1JX4 A;  2ZUD A;  5IIK A;  2B21 A;  4KLU A;  1JMS A;  4YP3 A;  4QZI A;  2DPI A;  5KFL A;  1TKD A;  2LYH A;  4YXM A;  4EBC A;  3RB3 A;  1S0N A;  2BCV A;  4KLL A;  5KFS A;  8ICX A;  2FL3 A;  4QBO A;  4IQW A;  4DL4 A;  4KLJ A;  4QZC A;  5HP4 A;  2ASJ A;  2ZTC A;  5KFH A;  3RBE A;  4KLH A;  3N97 B;  3RJE A;  4FO6 A;  5J0X A;  5KFF A;  1U45 A;  3H8J A;  4IRK A;  2HVH A;  5DGB A;  1XWL A;  4PHE A;  2F1I A;  2NRV A;  3PW2 A;  4ZH4 A;  2MAX A;  2ZJA A;  5F9N A;  5IIO A;  3JPQ A;  4O3Q A;  3V7J A;  2AGP A;  2DPJ A;  3OJS A;  4M9L A;  2OKF A;  4E0D A;  5J0O A;  1BPX A;  9ICW A;  4C8L A;  3OSP A;  1XS9 D;  4DSF A;  3PW7 A;  3RBD A;  4DSL A;  2BQ3 A;  1L3V A;  2AGQ A;  3PX0 A;  1QLN A;  4DEZ A;  3UXP A;  3ORY A;  9ICP A;  2FLC A;  2UVW A;  3PY8 A;  3RR8 A;  4KLG A;  4QZG A;  2BPG A;  2FLP A;  1ZQO A;  4I2J A;  4B9T A;  3P1Y A;  2C22 A;  3HWT A;  1R0V A;  4I2I A;  4O3N A;  2OST A;  4DAV A;  4XUS A;  4I28 A;  3HX0 A;  3PX6 A;  2VA8 A;  4FS2 A;  4IQT A;  4QW9 A;  4ECZ A;  2UVR A;  2JZB B;  3MR3 A;  3UQ2 A;  1NKC A;  2BPC A;  2RDI A;  1ZQA A;  5KG1 A;  4DF4 A;  3JPN A;  1JIH A;  7ICE A;  2DBS A;  4KLI A;  2VAN A;  2M9N A;  4MF2 A;  4O5C A;  3BJY A;  4RUC A;  4LZD A;  3T3F A;  4PH5 A;  2IA6 A;  3C5F A;  5L1I A;  2BR0 A;  3IEY A;  3AUO A;  5KG0 A;  4DL7 A;  2FKC A;  2FMS A;  1RPL A;  5KFE A;  5HHH A;  2ASD A;  4EZ9 A;  1SL1 A;  1ZQS A;  2ZYZ A;  3MDC A;  1QSS A;  3UQ0 A;  4EEY A;  4BXO A;  1ZQV A;  1KRP A;  3KHR A;  2JEJ A;  2WTF A;  4JV1 A;  3H4B A;  3BT7 A;  3V72 A;  7ICO A;  2XGP A;  1ZJM A;  1SKW A;  7ICV A;  1IPI A;  4O3S A;  4BWM A;  5KFC A;  7ICG A;  3ZDA A;  7ICT A;  1S97 A;  4F91 B;  3FOV A;  5HNK A;  1Y1O A;  2PFQ A;  2AQ4 A;  2AQ0 A;  4F5O A;  3LK9 A;  4KLO A;  1NKB A;  4IR1 A;  1GEF A;  4Z6C A;  3QE9 Y;  1NK6 A;  8ICQ A;  4NXZ A;  2V4Q A;  2XCP A;  4DO9 A;  4KLT A;  3GIL A;  3RJK A;  4P2H A;  2HHT A;  1Z3E B;  8ICW A;  3SZ2 A;  4PHA A;  4O5E A;  2WCW A;  4DQI A;  5J2J A;  4QWC A;  4ELV A;  4ZQU A;  4DSI A;  2BCQ A;  9ICU A;  4ECW A;  4TUR A;  2BCS A;  5J2F A;  2UVV A;  2IHN A;  1S0M A;  4DSE A;  3C2K A;  2FPL A;  5KG5 A;  5CHG A;  5KFB A;  2W8L A;  1X9M A;  4IR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...