1Y88A

Crystal structure of protein of unknown function af1548
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
184
structure length
184
Chain Sequence
b'NLYFQGHMVARLLEEHGFETKTNVIVQGNCVEQEIDVVAERDGERYMIECKFHNIPVYTGLKEAMYTYARFLDVEKHGFTQPWIFTNTKFSEEAKKYAGCVGIKLTGWSYPEKEGIEVLLESKGLYPITILRIDKEVLDELVRAGLVFCRDVVSAGEEKLREIGLSAKKAREVIAEAKKVIGGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AF1548
molecule tags Structural genomics, unknown function
source organism Archaeoglobus fulgidus
publication title The crystal structure of hypothetical protein AF1548 from Archaeoglobus fulgidus
rcsb
total genus 59
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2004-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1y88A02
3.40.1350.10 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 1y88A01
5DB9A 3LWMA 3H7IA 1ZQCA 5DG7A 5DB7A 8ICFA 7ICTA 2XC9A 4C8OA 3GFKB 2P6UA 3QZ7A 4DQQA 3N4MB 2C2EA 2FMQA 4R66A 3AU2A 4F93B 3BQTA 2HVIA 3BQ2A 2GW6A 1UT5A 3OJUA 4PGYA 1ZQVA 4DFPA 7ICNA 4MFAA 2V4QA 4I2EA 8ICSA 4DOCA 3C2KA 5DLFA 4P4PA 1NK0A 4KLIA 2AQ0A 3JPRA 5DGAA 5KFCA 4NLNA 1V9PA 2AQ4A 4J9KA 1BPXA 4TUQA 4F50A 1AROP 1L3UA 1L3SA 4DWIA 9ICNA 4KN7A 3IHQB 3UPQA 1NJZA 2JEGA 2W9MA 3THVA 1BVSA 4IQTA 2UVUA 4I29A 5KG4A 1Z00A 1S0NA 2R8IA 3V6JA 2IMWP 4Z6EA 3RB3A 2W9AA 2R8GA 1T4GA 4QW9A 3RB6A 3E2EA 4EZ6A 4E0DA 4UBBA 4C8LA 5KG1A 3UQ0A 5J0OA 3N97B 1S0VA 9ICUA 4YFKA 4BXOB 2PFPA 1WCLA 4DFKA 1ZQGA 1ZQKA 1UA1A 4LVSA 7ICRA 3MR6A 4KLGA 2F1HA 3V6HA 4P2HA 2KFZA 2OKFA 4J9QA 4O5CA 3AUOA 2PXIA 1NKBA 1UT8A 5KT2A 3AJVB 4IQUA 4I2JA 1R0VA 4ECQA 7ICLA 1X9WA 5J2FA 3KHRA 5HHIA 2H5XA 4QZCA 5KFKA 4UAYA 3M9NB 3EZ5A 4RT3A 4UAWA 4M0AA 5J0TA 3UXPA 3M8RA 4ED0A 3SI8A 4UB2A 2XY7A 1ZQOA 5J2AA 4DSEA 4I28A 2PI4A 3RR8A 1T7PA 3OSNA 5KFIA 1S9FA 2C2RA 5DB8A 1JIHA 5KFJA 4ED8A 2XY6A 9ICAA 4YP3A 8ICCA 9ICIA 3AU6A 3GILA 2PI5A 1S0MA 1HJPA 1ZQWA 1LV5A 4M9HA 8ICNA 1B43A 2MUTB 2AJQA 1EXNA 4GC7A 4DOBA 4J9LA 4EYIB 3V72A 3RRGA 4I2FA 1SL0A 4MF2A 4Q44A 3V7JA 2RDJA 4ECYA 4DOAA 4KLTA 1ZQBA 3PMLA 3HX0A 1ZQAA 3G6VA 2HHSA 4ED2A 3TAQA 7ICQA 1IM4A 3T5KA 3C5GA 2W8KA 1ZQTA 2FMSA 4I27A 5DGBA 1ZQQA 4QWBA 1T0FA 3B0YA 4M6WB 3KHLA 2P66A 1OB9A 4ECZA 5KFDA 4MEYA 4RNNA 4PHAA 2XCAA 4C8MA 4GXJA 4FS1A 3T5HA 5EWFA 4YCXA 4QW8A 3PO4A 3G6XA 3MFHA 2AGOA 3NTUA 4O0IA 3Q8RB 3Q8QB 8ICPA 1HUOA 1A79A 5HMLA 4LZGA 4NLGA 2ZJAA 5L9XA 4F3OA 9ICVA 2NRTA 4IRCA 2BQRA 4PGXA 4F4XA 2IBKA 2BPGA 4YXJA 2R8JA 4RQ8A 4Z6CA 1ZQLA 4RQ5A 9ICWA 1WCNA 4NLZA 5KT6A 8ICQA 8ICXA 5KFEA 4J9SA 1ZQHA 5D49A 2BPFA 5KG3A 4DL7A 1Z00B 5CHGA 3RH4A 1BPBA 4KN4A 2BCSA 4R8UB 3Q8KA 9ICBA 5DQGA 4G3IA 5KFFA 3KHGA 2IHNA 2VLDA 9ICLA 4F8RA 5HP4A 4ZH4A 3PX0A 4ECXA 4RQ4A 5KFUA 3DNXA 1XWLA 4F92B 3PMNA 4DSLA 4FS2A 4B9LA 5J29A 1ZQFA 3JPSA 2UVVA 4IR1A 4F5OA 1XMXA 8ICBA 2FLNA 3RR7A 3Q8SB 2JEIA 1KSPA 1SKWA 5KFBA 1U9LA 3K4GA 7ICIA 4KLUA 9ICRA 9ICPA 2BHNA 9ICEA 2INBA 4O3OA 3TARA 9ICTA 2NRZA 2XO7A 2V4RA 3RJHA 3SZ2A 4DF8A 4UAZA 4RU9A 3H8SA 3GDXA 3BQ0A 5IILA 4GXIA 1KRPA 4JV1A 2JZBA 4IRDA 4NXZA 5KFQA 3HT3A 7ICJA 7ICHA 2EO0A 5DLGA 4RQ1A 1D9DA 4I2IA 5KT4A 3ISBA 1NK5A 2R8KA 1SL1A 4F2SA 3MABA 3IEYA 3GIKA 5JUMA 4B9NA 5CR0A 3PNCA 8ICJA 5DG9A 3HW8A 8ICTA 5DKWA 2NRXA 5KFAA 3M9OB 1DGSA 3RJKA 4KLHA 2WIWA 4TURA 4XUSA 4ED6A 3PW2A 1KFSA 2HHTA 1QLNA 1U48A 4TQSA 2KN7A 3K75D 3QE9Y 2BCRA 4I2CA 5J0QA 2HHQA 1RZNA 1ZQDA 4C8NA 5L1KA 3RJEA 8ICAA 1ZQRA 5J0RA 3LWLA 1QSYA 2KTQA 5KT7A 2ISOA 4F4WA 4DSKA 4ED3A 5KTQA 2WTFA 1N56A 2HHXA 2ASDA 3PW0A 4QZAA 4YD1A 4R65A 3FDSA 5KFNA 3RAXA 1RYRA 5KT5A 1NK6A 4JWMA 4JV2A 5HNKA 5D4BA 1TKDA 9ICFA 4HYKA 1T8EA 5KFSA 1ZQEA 3ZD9A 2UVRA 4B9UA 1A76A 1H38A 3RJIA 5IIMA 2BR0A 4QZDA 3T3FA 2XGPA 4NLKA 1TK8A 2AGPA 4Q8FA 3ZDCA 4R8UA 4QBNA 1CEZA 4F4YA 4KTQA 3B0XA 1HUZA 4KLFA 3RJJA 4RPZA 4P4MA 8ICEA 2KZMA 2I1QA 3C1ZA 4QZ9A 5CP2A 5J0YA 3MFIA 4KLSA 4O3QA 7ICOA 4EBDA 1NKCA 4O3NA 4DQRA 1ZP7A 2ZUDA 4F4ZA 2A1JB 2WCWA 4C8KA 5KG5A 4UB4A 1ZQPA 9ICSA 2B21A 4BDPA 4Q8EA 1RXVA 2V9WA 4F2RA 4Z6DA 1JN3A 3MR5A 3GV5B 4M9GA 3PO5A 8ICUA 1ZQUA 5BOLA 5KFRA 3PR4A 5DBCA 3BJYA 3IM1A 4EBCA 1KFTA 3PW7A 1N48A 3SV3A 5J2BA 3TAPA 3ZDEA 1SZPA 1RPLA 5CB1A 1S0OA 4F4KA 2I9GA 1XU4A 4QWCA 3JPQA 1PZNA 8ICHA 5TZVA 2PFOA 2BCVA 3V7LA 4IRKA 4DLEA 3RH6A 2HHUA 4QBLA 4JWNA 1A77A 4QZEA 3QZ8A 4ECSA 4DS4A 1Y88A 4DL2A 8ICGA 5IINA 3RB0A 2GJWA 1ZQJA 3C1YA 4K4HA 5DG8A 2ALZA 4QZGA 4RNMA 3TQ1A 3P1ZB 4DQPA 2M9NA 1NJXA 3G6YA 4NM2A 4Q43A 2WJ0A 1KDHA 4RPXA 5DBAA 1BPDA 1C7YA 4JUZA 4PHEA 3M8SA 3GV7B 8ICOA 2Q0ZX 3AJVA 3PX6A 5HHHA 1D8YA 2ZUBA 4O9MA 1S97A 2FMPA 3ZDAA 9ICHA 2ZJ8A 3Q8PB 1ZQYA 3MBYA 5DQIA 4K4GA 4YMNA 4RQ0A 4R64A 2KFNA 3BDPA 5IIJA 4O3RA 1NK4A 4ECWA 1JXLA 4QBOA 5F9LA 1D9FA 3C23A 1ZQNA 4DSIA 1B22A 4XRHA 4IQVA 3GQCA 4LZDA 4MFCA 3LDAA 5DQHA 4ECVA 3ISCA 9ICXA 1JXEA 4ED7A 3PW5A 2VA2A 3UXNA 4RQ2A 4M04A 4F5PA 4O3SA 7ICUA 4KLOA 8ICIA 4TUPA 3HPOA 3T5LA 4ELTA 1IXRA 1ZETA 5J2JA 2FPMA 4GXKA 3PVXA 3KHHA 4ECUA 3RAQA 1CUKA 4EBEA 5IIOA 5L1IA 1TAQA 4DFMA 2GWSA 1QTMA 2BPCA 4DL6A 1L3VA 3Q8MA 2Y1IA 1X9SA 1L3TA 2BDPA 4EEYA 3RRHA 2XY5A 3RB4A 1U49A 4IR9A 1ZQZA 3RTVA 2DFLA 2W9CB 3NGDA 4O3PA 4KLDA 2PFQA 4TUSA 4I2DA 5J0UA 3H8WA 3JPOA 4PHPA 2BCQA 2W9CA 2F1JA 2JEFA 3RH5A 2J6UA 7ICMA 3V7KA 1ZQSA 3QEBZ 3M9MB 4PPXA 4RQ3A 1RYSA 3ZDDA 3HWTA 1X2IA 5HMMA 3FYHA 2FPKA 4M47A 1RXWA 4X5VA 2ZYZB 4M9JA 2DPJA 2ASJA 3T5JA 4TKKA 4P4OA 5BPCA 5KFLA 4YMMA 1UA0A 7ICGA 1KEJA 1NOMA 1OB8A 8ICRA 2VA3A 4ECRA 4R63A 1MC8A 1MSWD 4DFJA 4B9SA 2IA6A 4XQ8A 5KFPA 4YN4A 1D8LA 3LK9A 5J2DA 2BKEA 3RBEA 4JK1A 1U47A 1S76D 1R11A 4RUCA 2FLPA 4NM1A 4F5RA 3OSPA 1MQ3A 3PY8A 2IHMA 7ICEA 8ICZA 1XSLA 1NKEA 4YXMA 1S77D 3C2MA 5CWRA 3GIJA 3TFRA 5DDYA 1LB2B 4RUAA 5J0PA 4Z6FA 4UBCA 4ED1A 3RBDA 3KTQA 4B9VA 4KMUA 2KZZA 1IPIA 3Q8LA 2ZUCA 1BPYA 3JPTA 4QZ8A 3PV8A 2PFNA 2UVWA 4M2YA 4I2HA 1F1ZA 3P1YA 2C22A 2XGQA 2VANA 4DO9A 4TKDA 1COOA 3EPGA 2FPLA 1K1SA 2BCUA 2ZYZA 2ZTDA 2W8LA 4DL5A 5IIIA 5J2HA 1NK9A 1KLNA 4DS5A 3TFSA 5KFGA 2W9BB 4FBUA 1GEFA 1NJWA 2RDIA 2HHVA 9ICQA 4PGQA 5KFXA 4BWJA 1TK5A 2AGQA 4DQIA 9ICJA 8ICKA 5KT3A 4I2GA 4YQWA 2VA8A 3EWAA 4RQ7A 4BWMA 1SKRA 4ECTA 2BQUA 5EOZA 4GLXA 4DLGA 3OGUA 3BQ1A 1TK0A 4MEXA 5KG6A 9ICMA 2WIZA 3ISDA 2C28A 1ZQMA 8ICWA 1RZTA 2P6RA 1TAUA 5J2EA 4QWDA 3ETLA 4XA5A 4KLLA 3V6KA 4DQSA 3GIMA 1XSNA 1QSLA 2KZ3A 4QZIA 3C21A 2XCPA 2ATLA 4YR3A 4DSFA 1U45A 3P1ZA 5CJ7A 5J2IA 1NK8A 4JV0A 4J9RA 5DB6A 2WCZA 1TVAA 4J9PA 4F5QA 4UB3A 1KFDA 4RZRA 4YR0A 1BPEA 9ICKA 2C2DA 2AU0A 2BGWA 1T3NA 1ZYQA 9ICCA 9ICGA 1XSPA 4UB5A 3FOVA 4DEZA 4YD2A 3TI0A 4MFFA 3UXOA 3OJSA 3HP6A 1KTQA 4UQGA 1XO1A 5CA7A 4J9MA 1ZJMA 4KLMA 3TANA 5KFHA 5L1LA 7ICKA 1RLVA 2ZTEA 5KFYA 8ICYA 8ICMA 5KFVA 5J0XA 5J0SA 4J9NA 4DF4A 4BGDA 4F91B 1XC9A 1DOQA 4B9MA 8ICLA 4YG2A 3MDCA 3MGHA 4FBTA 3MDAA 4O5EA 2J6SA 3EPIA 9ICOA 3H8JA 4YVZA 5BOMA 1U4BA 3H4DA 2A1JA 3ORYA 4M6WA 1K1QA 3SV4A 4RNOA 4I2AA 2Y1JA 5EWGA 4RPYA 2HHWA 5KFOA 3MR2A 4Q45A 4RQ6A 3EYZA 3C2LA 5F9NA 5DDMA 3MR3A 4O5KA 1QSSA 4DSJA 2ASLA 3OHBA 4IQWA 3GIIA 1S10A 2DPIA 7ICPA 5J2GA 4F5NA 3EW9A 2W9BA 2MUTA 4QZBA 1Z3EB 3ZD8A 5IIKA 4RT2A 3UQ2A 5KFTA 3RJGA 1SKSA 4ELVA 4EZ9A 4KLJA 8ICVA 3H40A 3RJFA 4M9NA 2ZJ5A 2FLLA 5FDKA 3C5FA 3JPPA 5EWEA 2NRVA 3SYZA 1HH1A 4BXOA 3ZDBA 1BPZA 2LYHA 2ISPA 4I2BA 4ELUA 5KG2A 4QZFA 2JZBB 4GC6A 2HVHA 4QWAA 1JX4A 5J2KA 1ZQXA 3MGIA 5J2CA 4KITB 4DL3A 4KLQA 1TV9A 2R8HA 7ICVA 2OSTA 4FO6A 4TQRA 2ZTCA 5KFWA 4J9OA 1ZQIA 2OWOA 5L1JA 1JMSA 5KG7A 1XS9D 1BGXT 1L5UA 2HW3A 3PR5B 4K4IA 1TFRA 5KFZA 4QWEA 5DBBA 3JPNA 4CCHA 4KLEA 2NRWA 4PH5A 2FCOA 1MQ2A 7ICSA 2J6TA 3GV8B 5C5JA 5KG0A 1NK7A 2BQ3A 2JEJA 5D46A 4DL4A 2CV8A 2F1IA 1ZJNA 3OHAA 4EYHB 4QZHA 7ICFA 4PHDA 1SL2A 1X9MA 4NY8A 4MF8A 5J0WA 3H4BA 3PW4A 4YMOA 5KFMA 2MAXA 1NJYA 4M9LA 3QEAZ 1Y1OA 4B9TA 4YR2A 4UB1A 3PX4A
chains in the Genus database with same CATH superfamily
3LWMA 3SD7A 3UMGA 3C28A 2W54A 4USAA 3QZ7A 2HVIA 4R66A 4F93B 3BQ2A 2GW6A 2V4QA 3BS7A 1P7DA 1V9PA 1AROP 4DWIA 2FDRA 2WF8A 3IHQB 2JEGA 5EE3A 4I29A 1Z00A 2Z7JA 4PL1A 2W9AA 1T4GA 4QW9A 4EZ6A 4E0DA 2DQNB 2FI1A 4UBBA 3MC1A 4C8LA 4NL9C 1WWVA 3N97B 4BXOB 2GOLA 4DFKA 4LQEA 5AM1A 4AYBF 2KK0A 4P2HA 1S8OA 5KT2A 1ZQ1C 7ICLA 3KHRA 2K4HA 2HBKA 2ZXHA 1OXJA 2ODGA 3KBBA 4RT3A 5J0TA 3M8RA 4ED0A 2CN1A 3KZIU 4I28A 4DSEA 1MA7A 1T7PA 3OSNA 2YMMA 1JIHA 5KFJA 4ED8A 8ICCA 2WF5A 2PI5A 3MGVA 3FC4A 1PVRA 1LV5A 1ZQWA 5A0LA 5CRXA 3D2NA 3IG5A 4Q44A 5C0YA 4ECYA 4KLTA 3I28A 2WB1F 3G6VA 4ED2A 7ICQA 1IM4A 3T5KA 3C5GA 2LKYA 2NYVA 4I27A 2P35A 3B0YA 2P66A 1WUDA 2DWQA 4C8MA 2YX8A 3PO4A 2KJ8A 2AGOA 4O0IA 3Q8QB 2GLEA 9ICVA 1V97A 2BQRA 3KZXA 3SMVA 4RQ8A 1ZQLA 5JTIA 4J9SA 2RQ5A 5KG3A 5CHGA 4AYBC 1BPBA 4R8UB 2FKHB 9ICBA 5DQGA 5KFFA 3KHGA 2IHNA 1JUDA 3F2DA 1QQ6A 3F5EA 3N7RC 3RR7A 2JEIA 3K4GA 2XIDA 4ACOA 9ICRA 2KMDA 9ICEA 2KV2A 2V4RA 4UAZA 4RU9A 3H8SA 3BQ0A 5IILA 4NXZA 2EO0A 5DLGA 2IXSA 3AQEA 3IEYA 2DL0A 5JUMA 3PNCA 3HW8A 5DKWA 1RQNA 4Y2JA 2HHTA 1KFSA 3K75D 4I2CA 2OM6A 1F0MA 5J0QA 8ICAA 4C8NA 1KL9A 2KOBA 4OO1J 4US9A 2WTFA 5KAIU 3RAXA 3FDSA 3WK7A 4JWMA 4F71A 2HDOA 4JB3A 1T8EA 5KFSA 2UVRA 1A76A 1H38A 1QQ7A 1COKA 3T3FA 1TK8A 1RYUA 1DK2A 4R8UA 5AKKA 3RJJA 8ICEA 2KZMA 5J0YA 4NLCA 2F8KA 2WCWA 9ICSA 3BQ7A 4BDPA 4GIBA 4Q8EA 1RXVA 3RF9A 2V9WA 4F2RA 2ZIWB 4M9GA 3PO5A 5BOLA 3PR4A 5DBCA 5J2BA 1RPLA 5E79U 2I9GA 2JGAA 3V7LA 4IRKA 2QB1A 4DLEA 3RH6A 4QBLA 1SZHA 1A77A 4QZEA 4ECSA 4DL2A 3SAHA 1VDVA 3KKAC 2B0CA 3TQ1A 1B0XA 4DQPA 2WJ0A 3G6YA 3F53A 4JUZA 3M8SA 3NRZA 5HHHA 2FMPA 1N60A 3Q8PB 5DQIA 4RQ0A 2D6FC 2KFNA 5IIJA 4O3RA 2K4EA 1JXLA 4EENA 5F9LA 1ZQNA 1SWWA 4OJPA 4MFCA 1PK3A 4ED7A 3PW5A 2YTUA 2VA2A 3UXNA 7ICUA 2D8CA 3HPOA 2ZIVB 3SENA 5ALGA 4OJOA 5IIOA 5AKZA 5L1IA 4Y2VA 4DFMA 5ALUA 2BPCA 4DL6A 3Q8MA 2Y1IA 2XY5A 3RB4A 1U49A 2AHOB 2DFLA 4C0ZA 2K89A 3JPOA 2EZXA 2F1JA 2JEFA 3RH5A 1ZQSA 3M9MB 5H2FU 3FYHA 4M9JA 2DPJA 2ASJA 3T5JA 7ICGA 4YMMA 5BPCA 1NOMA 4R63A 4B9SA 4XQ8A 5KFPA 3CYMA 1D8LA 2BKEA 1ED1A 4O3MA 4NM1A 2LHTA 3IEYB 1MQ3A 1XSLA 4NV0A 5AI9A 1NKEA 2RLTA 2QB0A 2FLCA 5J0PA 4ED1A 3H0MB 2KZZA 2VIXA 4P0QB 2EQYA 2KHQA 4OJ5A 3P1YA 5EE9A 4I2HA 3WK6A 4G6UA 2ZYZA 5IIIA 4DS5A 2W9BB 1Q3UA 4DCCA 2RDIA 2HHVA 2KICA 3I1YA 8ICKA 2ES6A 3IRUA 2KVSA 3OGUA 4DLGA 3WK9A 2WF6A 1ZQMA 8ICWA 4KLLA 5ALXA 4DQSA 1N2XA 3C21A 2ATLA 2ZIUB 5AHXA 5J2IA 2ZIWA 1NK8A 1XO0A 3M6KA 4YR0A 1BPEA 9ICKA 2FL3A 1T3NA 3FOVA 4YD2A 2ZG6A 3UXOA 5ALOA 1KTQA 1XO1A 1QH9A 5KFHA 5L1LA 7ICKA 8ICMA 5J0XA 4B9MA 4O5EA 3MDAA 9ICOA 3ED5A 3H4DA 2A1JA 2Y1JA 5KFOA 4Q45A 4DSJA 3OHBA 3WKAA 3GIIA 2QLTA 5J2GA 3A0BU 4F5NA 5AK4A 3AN1A 2MUTA 5J8YC 3UQ2A 5KFTA 8ICVA 3H40A 2FLLA 3SYZA 2HOFA 4BXOA 3UMBA 4U6PA 1J2MA 5J2CA 2HOQA 4DL3A 7ICVA 1PVQA 4FO6A 1ZQIA 1JMSA 1X40A 5ALEA 2DKZA 3PR5B 1T94A 5KFZA 4CCHA 5DBBA 4UATA 4KLEA 2NRWA 2MRLA 2J6TA 3GV8B 5KG0A 1NK7A 3T79A 2BQ3A 4DL4A 1GO3F 4EYHB 4QZHA 3J81j 1ZD3A 3CRXA 2H3QA 1D8BA 3A0HU 3FAHA 2MAXA 4M9LA 4Y2SA 4YR2A 5AKJA 3H7IA 5DG7A 8ICFA 2XC9A 4C4TA 3N4MB 2FMQA 2C2EA 3AU2A 4MFAA 2LBOA 3QU7A 1FFVA 5DLFA 4P4PA 3PSTA 3JPRA 4FE3A 1BPXA 1L6NA 1L3UA 4F50A 9ICNA 1L3SA 3DV9A 3UPQA 2UVUA 3N7SC 5AK6A 2R8GA 4Z6EA 3RB3A 1Q3VA 3NVZA 4YFKA 2Y0SC 4DA2A 3PSPA 4KLGA 3BT7A 2F1HA 2E8MA 5AICA 4J9QA 2PXIA 1X9WA 2F8LA 2I6XA 1KN5A 4QZCA 1YZ6A 3M9NB 3SI8A 4UB2A 1ZQOA 5J2AA 1S9FA 3SR6A 9ICAA 2XY6A 5ALYA 5JRTA 2JRZA 9ICIA 3GILA 1L7OA 1HJPA 4M9HA 1A0PA 4Y2PA 5AKEA 4I2FA 4J9LA 3V72A 4KX5A 4QNLA 2HOIA 2DKXA 3PMLA 1ZQAA 2HHSA 2G5IB 3TAQA 1B4FA 2W8KA 1ZQTA 2E5SA 1T0FA 4DAVA 3KHLA 2WAQF 1OB9A 5KFDA 4FS1A 3MFHA 5KL8B 8ICPA 1HUOA 4F3OA 2H3ZA 2NRTA 5AI4A 4IRCA 4PGXA 4F4XA 4Z6CA 4RQ5A 9ICWA 1K5OA 2KSOA 1ZQHA 2KKPA 3CNHA 2BPFA 1F44A 3Q8KA 3WKBA 4C4RA 4EX6A 5HP4A 3PX0A 1XWLA 4B9LA 2AH5A 2UVVA 4IR1A 4F5OA 2LYBA 2FLNA 1SKWA 5KFBA 2INBA 4O3OA 9ICTA 3SZ2A 4DF8A 1KRPA 4GXIA 5KFQA 7ICJA 2CXYA 4I2IA 4GFJA 3UMCA 4F2SA 2QARA 8ICTA 2IOFK 4NJ8A 1DGSA 4TURA 4XUSA 1U48A 2BCRA 3QE9Y 3F2BA 1RZNA 1ZQDA 1KQQA 1ZQRA 1QSYA 2KTQA 4QJFB 5KT7A 1RM6C 1UPHA 2ASDA 2KIWA 4QZAA 1L7NA 1RYRA 1NK6A 5KT5A 5HNKA 5AK5A 3ZD9A 2W7OA 4NLKA 4Q8FA 5EE0A 1CEZA 3B0XA 2HI0A 4KLFA 4RPZA 4P4MA 4QZ9A 2HBJA 7ICOA 1BNPA 4DQRA 4C8KA 4UB4A 1ZQPA 2WAQC 3PSFA 4Z6DA 8ICUA 1ZQUA 4UB8U 4EBCA 1KFTA 1PVPA 1DGJA 3SV3A 3TAPA 1SZPA 4F4KA 3BS5B 2PFOA 2BCVA 4JWNA 2DUYA 5IINA 1VJ5A 3C1YA 3QX7A 4BX9C 2ALZA 1WYGA 4PZOA 3P1ZB 4NM2A 5ALSA 1BPDA 2HCFA 1IV8A 4PHEA 3GV7B 3AJVA 2GH1A 2A3VA 1D8YA 4O9MA 1SV0A 2E8NA 1S97A 3ZDAA 9ICHA 1SXDA 4R64A 3BDPA 3M1YA 4ECWA 3C23A 1A6SA 4IQVA 5DQHA 1AQ6A 2KJ9A 3HRDD 3NRWA 4ECVA 9ICXA 4F5PA 4KLOA 4PZNA 3T5LA 4CGZA 2YMPA 3PVXA 3RAQA 2H3FA 1OW5A 1QTMA 2R18A 3OPXA 1ZQZA 4QIWC 4ZOHC 3C29A 4KLDA 5J0UA 4PHPA 2W9CA 2J6UA 3V7KA 3QEBZ 1KW4A 1RYSA 5ALDA 1X2IA 1RXWA 2ZYZB 2MU2A 4P4OA 1UA0A 8ICRA 2VA3A 2W8MA 5J2DA 3ONNA 3RBEA 4JK1A 1U47A 3H0RB 1S76D 3PY8A 8ICZA 4YXMA 1S77D 2ZIXA 3TFRA 5DDYA 1LB2B 2OEHA 4UBCA 4B9VA 4KMUA 5AM2A 1IPIA 2ZUCA 3JPTA 4QZ8A 3PV8A 2PFNA 1F1ZA 5AI5A 2C22A 4U7CA 2VANA 5AM3A 2K8AA 3AEVA 3KOOA 1SB3C 4TKDA 1ZD2P 1K1SA 1NK9A 4FBUA 2Q4TA 2HMXA 3VC8A 9ICQA 1RDFA 5KFXA 4BWJA 9ICJA 4DQIA 2W11A 4RQ7A 5EOZA 2HBLA 4MEXA 2H3VA 5KG6A 1Z1BA 2KE7A 1JI7A 3ISDA 4Y2QA 5J2EA 3ETLA 3GIMA 1XSNA 2AXTU 4DSFA 2O6KA 4CNQA 5DB6A 4F5QA 2ZXIA 2BGWA 1YNMA 9ICGA 1XSPA 2D3DA 3TI0A 3F2CA 2FJ6A 2IOFA 3HP6A 1ZJMA 1F5SA 2YY6A 2EDUA 2VS1A 5KFYA 5KFVA 4F91B 2JHDA 1DOQA 1N62A 3MDCA 5F3XB 4FBTA 3H8JA 5CEHA 5BOMA 1U4BA 2KIVA 3ORYA 4M6WA 1K1QA 1L7PA 3SV4A 5EWGA 4RPYA 4PJ0U 4RQ6A 3EYZA 4O5KA 1S10A 7ICPA 4EZ9A 3QUBA 3RJFA 4WJ3B 1M6YA 3JPPA 2NRVA 2Y9UA 2ISPA 2JZBB 4GC6A 1HEKA 1FEZA 2OXOA 4KLQA 5ALMA 1TV9A 2ZTCA 4J9OA 3PSIA 2HW3A 4K4IA 4QWEA 5AKXA 2CV8A 2F1IA 4NWIA 3OHAA 1SL2A 4NY8A 5KNIA 5J0WA 3H4BA 1N5WA 3PW4A 1UCVA 3QEAZ 1Y1OA 2KNJA 4QIWF 4ZQUA 4J03A 5AI0A 1ZQCA 4C8OA 2YMQA 1UT5A 1JALA 1X6JA 1ZQVA 5J8YA 4I2EA 4EV1A 3C2KA 1NK0A 2WF7A 2AQ0A 2ESEA 5KFCA 4OD0A 4NLNA 2MSNA 4J9KA 2G06A 3NASA 3QU9A 2EZYA 4KN7A 1NJZA 3KFUF 2W9MA 4IQTA 5KG4A 2NO5A 3L5KA 3V6JA 3E2EA 3F5AA 5KG1A 3NVVA 9ICUA 1SXEA 2PFPA 1WCLA 1ZQGA 4LVSA 4O5CA 3AUOA 1NKBA 1R0VA 1CRXA 4BUGA 5J2FA 1VLBA 5ALVA 1ECWA 2XY7A 1TAMA 5K4LA 3D2QA 3RR8A 2BDUA 5AI6A 2W55A 2EAPA 5KL1B 2ZIUA 3AU6A 8ICNA 2XICA 2RRDA 4FZNA 3WU2U 2AJQA 1EXNA 2CZRA 4DOBA 3RRGA 2W04A 1SL0A 4CDGA 2RDJA 4DOAA 1NZPA 4P0PB 2NO4A 5DGBA 1ZQQA 4QWBA 4M6WB 4MEYA 4RNNA 4PHAA 2KD1A 5EWFA 4NL9A 4YCXA 1A79A 5HMLA 2LM1A 2Z0RA 2ZJAA 3E58A 1FIQA 2IBKA 2YMLA 5AKHA 2R8JA 5ALIA 8ICXA 5KT6A 8ICQA 5KFEA 4DL7A 4KN4A 4FFDA 4G3IA 2JH7A 4PL2A 9ICLA 4F8RA 3NUQA 3QXGA 4ECXA 3DNXA 3PMNA 3B9JA 5J29A 2GO7A 1ZQFA 1KSPA 1U9LA 4KLUA 5ALWA 2F76X 3TARA 4G6VA 2NRZA 2XO7A 1Z19A 4HAIA 2PKEA 3HT3A 3KD3A 4RQ1A 1D9DA 5ALZA 5KT4A 1NK5A 2R8KA 2NV3A 3GIKA 4B9NA 5CR0A 5DG9A 3M6ZA 2NRXA 5KFAA 3M9OB 1QLNA 4KX3A 2HHQA 5L1KA 3DDHA 3AM9A 5J0RA 3LWLA 1T3QA 5G5GA 3L4PA 3D6JA 2ISOA 4DSKA 1N56A 1JRPA 3PW0A 4R65A 5D4BA 4EX7A 4B9UA 1ZQEA 3RJIA 2BR0A 4QZDA 5AI8A 3QU2A 2XGPA 5AKLA 1LKYB 2Y9TA 5G5HA 1SGGA 2DBSA 2I1QA 3C1ZA 4O3QA 1NKCA 4ICAA 4F4ZA 5KG5A 2OYYA 2B21A 1LVHA 3GV5B 3QUCA 5B5EU 3BJYA 1J2NA 1N48A 2YN4A 2EAMA 1XU4A 4QWCA 1PZNA 2JR5A 5AM0A 2G09A 3QZ8A 2WFAA 2GJWA 3GU3A 4RNMA 3BZCA 4C80A 4US8A 2OHFA 4RPXA 3DEEA 8ICOA 2KJ5A 2Q0ZX 3L3FX 3TKAA 3WKCA 2YB1A 2ZUBA 3CW2C 3ALRA 2EANA 3MBYA 1BNOA 1NK4A 2OH2A 1ZD4A 4QBOA 2G07A 1B22A 4XRHA 3GQCA 4LZDA 1QCKA 1URJA 3LDAA 1HIWA 3ISCA 4RQ2A 4M04A 8ICIA 4TUPA 1IXRA 5J2JA 2FPMA 3KHHA 4ECUA 3CP8A 3BS5A 1CUKA 2QARB 4FZMA 1TAQA 2GWSA 4UAVA 1L3VA 1O08A 1X9SA 1L3TA 2BDPA 2ZIXB 3RTVA 4TUSA 2L5YA 2HSZA 4I2DA 2K8BB 3H8WA 2BCQA 3NVYA 2RHFA 3U26A 5HMMA 2FPKA 5KFLA 3AMZA 1KEJA 1OB8A 4ECRA 5ALJA 2G08A 1MC8A 2EAOA 5JU5A 3SQIA 3IDWA 5ALNA 3LK9A 2A19A 2OCEA 2YB4A 1V38A 2KSOB 4RUCA 3C2MA 3FM9A 4RUAA 5HR6A 3EUB2 3RBDA 5GTHU 3Q8LA 3SAGA 4UASA 1BPYA 4M2YA 3IV6A 1RG6A 2XGQA 1OUQA 1L7MA 4DO9A 2BCUA 4Y2TA 1KKXA 2W8LA 5J2HA 4DFDA 4OCZA 4G9BA 4PGQA 1TK5A 2AGQA 5KT3A 4I2GA 4YQWA 4BWMA 1SKRA 2BQUA 3BQ1A 1L8OA 2IOHA 2P6RA 1TAUA 4XA5A 2KZ3A 4QZIA 2XCPA 4YR3A 3P1ZA 5CJ7A 4JV0A 1TVAA 4J9PA 2Y0SF 1KFDA 4RZRA 2DGZA 3LVVA 5ALKA 9ICCA 4UB5A 1UHUA 4NLBA 4Y2UA 1ZRNA 4MFFA 3OJSA 4UQGA 5CA7A 4KLMA 3LVWA 3TANA 1RLVA 3WK8A 2ZTEA 4CF5A 8ICYA 5J0SA 4DF4A 4BGDA 1XC9A 1FFUA 4YG2A 3HILA 2JJQA 3EPIA 4YVZA 1Z4NA 3QU5A 2CRXA 4OJLA 4RNOA 4I2AA 2WF9A 4BJQA 3MR2A 3C2LA 3MR3A 2JMGA 4IS7A 1N5XA 3IP4B 1Z3EB 5IIKA 3RJGA 4CE6A 4DAPA 1FO4A 2ZJ5A 3HJEA 5EWEA 1BPZA 4ELUA 4QZFA 3ETRA 1ZQXA 1WWUA 3N28A 4KITB 3K1ZA 1IG6A 4EEKA 2OSTA 2OWOA 5ALFA 3JPNA 1X6IA 4PH5A 2FCOA 2WB1C 7ICSA 2K8CB 2W03A 5D46A 2ZIVA 1ZJNA 5ALTA 7ICFA 4PHDA 3NS1A 5KFMA 1SV4A 4B9TA 4O3SA 7ICHA 5DB9A 2KKVA 1YT3A 3SAFA 5DB7A 7ICTA 3GFKB 2P6UA 4DQQA 3QNMA 3BQTA 1C20A 3OJUA 4PGYA 5AK3A 4DFPA 7ICNA 8ICSA 4DOCA 1KBUA 4KLIA 1J97A 5DGAA 4UW9A 4EELA 2AQ4A 2CPRA 2H3IA 4TUQA 1PK1B 2LYAA 3E0FA 4C7YA 3THVA 1BVSA 2DF4B 1S0NA 2R8IA 2IMWP 4B6JA 3RB6A 2W7PA 4CF4A 2LM4A 2B6GA 2EH9A 2JXJA 2G0AA 3UQ0A 5J0OA 1S0VA 1RQLA 1ZQKA 1UA1A 3QUQA 7ICRA 3MR6A 3V6HA 2KFZA 2OKFA 1UT8A 3AJVB 4IQUA 4I2JA 1N61A 3ZI4A 4ECQA 5HHIA 2H5XA 5KFKA 2XVTA 4UAYA 3WK4A 3EZ5A 4M0AA 4UAWA 3HKZC 3UXPA 2PI4A 2PMZC 2VJ5A 5KFIA 2C2RA 5DB8A 4YP3A 2G5HB 1S0MA 5ALLA 1B43A 2BH2A 3PZPA 2MUTB 4GC7A 1ZOLA 4EYIB 2A1AA 1V85A 4MF2A 3V7JA 1ZQBA 1TE2A 3HX0A 3M7DA 5ALRA 2FMSA 5EE1A 4MHVA 5ALHA 2XCAA 4GXJA 4ECZA 3T5HA 4QW8A 3G6XA 4UB6U 3NTUA 3Q8RB 2FKCA 4LZGA 4NLGA 4P0QA 2E8OA 5L9XA 3TADA 2BPGA 4YXJA 2E1FA 2W43A 1UWVA 1WCNA 4NLZA 3HKZF 2VJ4A 1XNSA 5D49A 1Z00B 3RH4A 5AM5A 2BCSA 5HR7A 5FP0A 5GTIU 2JV3A 2VLDA 4ZH4A 4RQ4A 5KFUA 4F92B 4DSLA 4FS2A 3H0LB 3JPSA 1XMXA 8ICBA 3Q8SB 3RFAA 5AIAA 7ICIA 9ICPA 1ZD5A 2BHNA 1S5LU 1X42A 3RJHA 2DBYA 3GDXA 3UM9A 4JV1A 2JZBA 4IRDA 3OTQA 2HBMA 3SEIA 3ISBA 1PK1A 3NVWA 1SL1A 3MABA 8ICJA 2MA1A 3RJKA 4KLHA 2WIWA 4ED6A 2FE9A 3PW2A 4TQSA 2KN7A 2F3NA 3RJEA 2XI9A 4F4WA 3I76A 4ED3A 5KTQA 1X66A 1DXSA 2HHXA 2K60A 2YQEA 4YD1A 5KFNA 3KKAA 4JV2A 1TKDA 4AP9A 9ICFA 4HYKA 5IIMA 3GZFA 3QUTA 5T14A 5ALPA 2AGPA 3WKEA 4Y2RA 1O03A 3ZDCA 3AQFA 4QBNA 1YZ7A 4F4YA 4KTQA 1HUZA 1Z1VA 3MFIA 3IF0X 4KLSA 5CP2A 3BZKA 4RQMA 4EBDA 1CI4A 4O3NA 1ZP7A 2ZUDA 2A1JB 4Y2YA 3QYPA 2KP7A 3O0FA 1UQVA 1JN3A 3MR5A 5KFRA 3IM1A 3PW7A 2I5HA 3ZDEA 5CB1A 1S0OA 2WHEA 8ICHA 3JPQA 5TZVA 5TISU 2HHUA 2KHVA 4DS4A 1Y88A 8ICGA 2E8PA 3RB0A 2KEYA 3R9KA 1ZQJA 4K4HA 5DG8A 4QZGA 2PMZF 2M9NA 1NJXA 4Q43A 1KDHA 4Y2XA 5DBAA 1C7YA 3PX6A 2F44A 2E3TA 2ZJ8A 1ZQYA 4JMUA 4K4GA 4YMNA 4UARA 1NNLA 3K1RB 1D9FA 4DSIA 3LYSA 2EZZA 4P0PA 1JXEA 5KAFU 2BZFA 4ELTA 2RP5A 4LJXA 5L1MA 1ZETA 4GXKA 4EBEA 2F77X 1MSWD 4EEYA 3RRHA 4IR9A 2W9CB 3NGDA 4O3PA 2PFQA 4KMOB 7ICMA 4PPXA 2W3SA 4RQ3A 3AL0B 3WK5A 3HWTA 3ZDDA 3VCBA 4M47A 4X5VA 4TKKA 1Z4OA 4IC9A 1SV0C 4DFJA 2IA6A 4YN4A 1IIPA 1R11A 3D2SA 2FLPA 7ICEA 4F5RA 3OSPA 4F72A 2IHMA 5CWRA 3GIJA 1DK3A 4CRXA 3S6JA 4Z6FA 3KTQA 3N7PD 2UVWA 2KVCA 1SIJA 1X9XA 1SWVA 1COOA 3EPGA 2FPLA 2ZTDA 4DL5A 1KLNA 3TFSA 1GEFA 5KFGA 3TADC 1NJWA 5AM4A 2VA8A 3EWAA 1ZXIA 4ECTA 4GLXA 1TK0A 3H8MA 2N1RA 9ICMA 2WIZA 5AIBA 2LMRA 2C28A 1N63A 1MN8A 1RZTA 4QWDA 1ZRMA 3V6KA 2LPEA 1QSLA 3IG8A 1U45A 4J9RA 1PUZA 2WCZA 4UB3A 1JROA 2AU0A 2C2DA 1ZYQA 5ALQA 4DEZA 1L8LA 1WG8A 4J9MA 2W3RA 4CF3A 5B66U 2K4IA 1NZBA 4J9NA 5AKGA 8ICLA 1Q8KA 2K4PA 3MGHA 3QU4A 2J6SA 1QQ5A 5AKIA 2LI6A 4OJ6A 2E1EA 2HHWA 4A8EA 5F9NA 5DDMA 1QSSA 2ASLA 4IQWA 2DPIA 2QKQA 3EW9A 2W9BA 4QZBA 3ZD8A 1DRGA 4RT2A 1SKSA 4ELVA 4E6ZA 4KLJA 4M9NA 5FDKA 3C5FA 3ICXA 1HH1A 3ZDBA 4I2BA 2LYHA 5KG2A 4C7ZA 2JH1A 3WKDA 4QWAA 1JX4A 2HVHA 5J2KA 3MGIA 2M0NA 2R8HA 2KG5A 4TQRA 5KFWA 2F2AB 5L1JA 5KG7A 1XS9D 1Q46A 5AKYA 1BGXT 1L5UA 2QB0B 1TFRA 4RQNA 1MQ2A 5C5JA 2VKQA 3TACB 4C4SA 1LKYA 3IN5A 2JEJA 4FZLA 4IL6U 1X9MA 4MF8A 4UAUA 4YMOA 1NI3A 1NJYA 4UB1A 3PX4A
chains in the Genus database with same CATH topology
5DB9A 4ZQUA 3LWMA 3H7IA 1ZQCA 5DG7A 5DB7A 8ICFA 7ICTA 2XC9A 4C8OA 3GFKB 2P6UA 3QZ7A 4DQQA 3N4MB 2C2EA 2FMQA 4R66A 3AU2A 4F93B 3BQTA 2HVIA 3BQ2A 2GW6A 1UT5A 3OJUA 4PGYA 1ZQVA 4DFPA 7ICNA 4MFAA 2V4QA 4I2EA 8ICSA 4EV1A 4DOCA 3C2KA 5DLFA 4P4PA 1NK0A 4KLIA 2AQ0A 3JPRA 5DGAA 5KFCA 4NLNA 1V9PA 2AQ4A 4J9KA 1BPXA 4TUQA 4F50A 1AROP 1L3UA 1L3SA 4DWIA 9ICNA 4KN7A 3IHQB 3UPQA 1NJZA 2JEGA 2W9MA 3THVA 1BVSA 4IQTA 2UVUA 4I29A 5KG4A 1Z00A 1S0NA 2R8IA 3V6JA 2IMWP 4Z6EA 3RB3A 2W9AA 2R8GA 1T4GA 4QW9A 3RB6A 3E2EA 4EZ6A 4E0DA 4UBBA 4C8LA 5KG1A 3UQ0A 5J0OA 3N97B 1S0VA 9ICUA 4YFKA 4BXOB 2PFPA 1WCLA 4DFKA 1ZQGA 1ZQKA 1UA1A 4LQEA 4DA2A 4LVSA 7ICRA 3MR6A 4KLGA 3BT7A 2F1HA 3V6HA 4P2HA 2KFZA 2OKFA 4J9QA 4O5CA 3AUOA 2PXIA 1NKBA 1UT8A 5KT2A 3AJVB 4IQUA 4I2JA 1R0VA 4ECQA 7ICLA 1X9WA 5J2FA 3KHRA 5HHIA 2H5XA 4QZCA 5KFKA 4UAYA 3M9NB 3EZ5A 4RT3A 4UAWA 4M0AA 5J0TA 3UXPA 3M8RA 4ED0A 3SI8A 4UB2A 2XY7A 1ZQOA 5J2AA 4DSEA 4I28A 2PI4A 3RR8A 1T7PA 3OSNA 5KFIA 1S9FA 2C2RA 5DB8A 1JIHA 5KFJA 4ED8A 2XY6A 9ICAA 4YP3A 8ICCA 9ICIA 3AU6A 3GILA 2PI5A 1S0MA 1HJPA 1ZQWA 1LV5A 4M9HA 8ICNA 1B43A 2BH2A 2MUTB 2AJQA 1EXNA 4GC7A 4DOBA 4J9LA 4EYIB 3V72A 3RRGA 4I2FA 2CZRA 1SL0A 4MF2A 4Q44A 3V7JA 2RDJA 4ECYA 4DOAA 4KLTA 1ZQBA 3PMLA 3HX0A 1ZQAA 3G6VA 2HHSA 4ED2A 3TAQA 7ICQA 1IM4A 3T5KA 3C5GA 2W8KA 1ZQTA 2FMSA 4I27A 5DGBA 1ZQQA 4QWBA 1T0FA 3B0YA 4M6WB 3KHLA 2P66A 1OB9A 4DAVA 4ECZA 5KFDA 4MEYA 4RNNA 4PHAA 2XCAA 4C8MA 4GXJA 4FS1A 3T5HA 5EWFA 4YCXA 4QW8A 3PO4A 3G6XA 3MFHA 2AGOA 3NTUA 4O0IA 3Q8RB 3Q8QB 8ICPA 1HUOA 1A79A 5HMLA 2FKCA 4LZGA 4NLGA 2Z0RA 2ZJAA 5L9XA 4F3OA 9ICVA 2NRTA 4IRCA 2BQRA 4PGXA 4F4XA 2IBKA 2BPGA 4YXJA 2R8JA 4RQ8A 4Z6CA 1ZQLA 4RQ5A 9ICWA 1WCNA 4NLZA 5KT6A 8ICQA 8ICXA 1UWVA 5KFEA 4J9SA 1ZQHA 5D49A 2BPFA 5KG3A 4DL7A 1Z00B 5CHGA 3RH4A 1BPBA 4KN4A 2BCSA 4R8UB 3Q8KA 2FKHB 9ICBA 5DQGA 4G3IA 5KFFA 3KHGA 2IHNA 2VLDA 9ICLA 4F8RA 5HP4A 4ZH4A 3PX0A 4ECXA 4RQ4A 5KFUA 3DNXA 1XWLA 4F92B 3PMNA 4DSLA 4FS2A 4B9LA 5J29A 1ZQFA 3JPSA 2UVVA 4IR1A 4F5OA 1XMXA 8ICBA 2FLNA 3RR7A 3Q8SB 2JEIA 1KSPA 1SKWA 5KFBA 1U9LA 3K4GA 7ICIA 4KLUA 9ICRA 9ICPA 2BHNA 9ICEA 2INBA 4O3OA 3TARA 9ICTA 2NRZA 2XO7A 4G6VA 2V4RA 3RJHA 3SZ2A 4DF8A 4UAZA 4RU9A 3H8SA 3GDXA 3BQ0A 5IILA 4GXIA 1KRPA 4JV1A 2JZBA 4IRDA 4NXZA 5KFQA 3HT3A 7ICJA 7ICHA 2EO0A 5DLGA 4RQ1A 1D9DA 2IXSA 4I2IA 5KT4A 3ISBA 1NK5A 2R8KA 1SL1A 4F2SA 3MABA 3IEYA 3GIKA 5JUMA 4B9NA 5CR0A 3PNCA 8ICJA 5DG9A 3HW8A 8ICTA 5DKWA 2NRXA 5KFAA 3M9OB 1DGSA 3RJKA 4KLHA 2WIWA 4TURA 4XUSA 4ED6A 3PW2A 1KFSA 2HHTA 1QLNA 1U48A 4TQSA 2KN7A 3K75D 3QE9Y 2BCRA 4I2CA 5J0QA 2HHQA 1RZNA 1ZQDA 4C8NA 5L1KA 3RJEA 8ICAA 1ZQRA 5J0RA 3LWLA 1QSYA 2KTQA 5KT7A 2ISOA 4F4WA 4DSKA 4ED3A 5KTQA 2WTFA 1N56A 2HHXA 2ASDA 3PW0A 4QZAA 4YD1A 4R65A 3FDSA 5KFNA 3RAXA 1RYRA 5KT5A 1NK6A 4JWMA 4JV2A 5HNKA 5D4BA 1TKDA 9ICFA 4HYKA 1T8EA 5KFSA 1ZQEA 3ZD9A 2UVRA 4B9UA 1A76A 1H38A 3RJIA 5IIMA 2BR0A 4QZDA 3T3FA 2XGPA 4NLKA 1TK8A 2AGPA 4Q8FA 3ZDCA 4R8UA 4QBNA 1CEZA 4F4YA 4KTQA 3B0XA 1HUZA 4KLFA 3RJJA 4RPZA 4P4MA 8ICEA 2KZMA 2DBSA 2I1QA 3C1ZA 4QZ9A 5CP2A 5J0YA 3MFIA 4KLSA 4O3QA 7ICOA 3IF0X 4EBDA 1NKCA 4O3NA 4DQRA 1ZP7A 2ZUDA 4F4ZA 2A1JB 2WCWA 4C8KA 5KG5A 4UB4A 1ZQPA 9ICSA 2B21A 4BDPA 4Q8EA 1RXVA 2V9WA 4F2RA 4Z6DA 1JN3A 3MR5A 3GV5B 4M9GA 3PO5A 8ICUA 1ZQUA 5BOLA 5KFRA 3PR4A 5DBCA 3BJYA 3IM1A 4EBCA 1KFTA 3PW7A 1N48A 3SV3A 5J2BA 3TAPA 3ZDEA 1SZPA 1RPLA 5CB1A 1S0OA 4F4KA 2I9GA 1XU4A 4QWCA 3JPQA 1PZNA 8ICHA 5TZVA 2PFOA 2BCVA 3V7LA 4IRKA 4DLEA 3RH6A 2HHUA 4QBLA 4JWNA 1A77A 4QZEA 3QZ8A 4ECSA 4DS4A 1Y88A 4DL2A 8ICGA 5IINA 3RB0A 2GJWA 1ZQJA 3C1YA 4K4HA 5DG8A 2ALZA 4QZGA 4RNMA 3TQ1A 3P1ZB 4DQPA 2M9NA 1NJXA 3G6YA 4NM2A 4Q43A 2WJ0A 1KDHA 4RPXA 5DBAA 1BPDA 1C7YA 4JUZA 4PHEA 3M8SA 3GV7B 8ICOA 2Q0ZX 3AJVA 3PX6A 5HHHA 1D8YA 2ZUBA 4O9MA 1S97A 2FMPA 3ZDAA 9ICHA 2ZJ8A 3Q8PB 1ZQYA 3MBYA 5DQIA 4K4GA 4YMNA 4RQ0A 4R64A 2KFNA 3BDPA 5IIJA 4O3RA 1NK4A 4ECWA 1JXLA 4QBOA 5F9LA 1D9FA 3C23A 1ZQNA 4DSIA 1B22A 4XRHA 4IQVA 3GQCA 4LZDA 4MFCA 3LDAA 5DQHA 4ECVA 3ISCA 9ICXA 1JXEA 4ED7A 3PW5A 2VA2A 3UXNA 4RQ2A 4M04A 4F5PA 4O3SA 7ICUA 4KLOA 8ICIA 4TUPA 3HPOA 3T5LA 4ELTA 1IXRA 1ZETA 5J2JA 2FPMA 4GXKA 3PVXA 3KHHA 4ECUA 3RAQA 1CUKA 4EBEA 5IIOA 5L1IA 1TAQA 4DFMA 2GWSA 1QTMA 2BPCA 4DL6A 1L3VA 3Q8MA 2Y1IA 1X9SA 1L3TA 2BDPA 4EEYA 3RRHA 2XY5A 3RB4A 1U49A 4IR9A 1ZQZA 3RTVA 2DFLA 2W9CB 3NGDA 4O3PA 4KLDA 2PFQA 4TUSA 4I2DA 5J0UA 3H8WA 3JPOA 4PHPA 2BCQA 2W9CA 2F1JA 2JEFA 3RH5A 2J6UA 7ICMA 3V7KA 1ZQSA 3QEBZ 3M9MB 4PPXA 4RQ3A 1RYSA 3ZDDA 3HWTA 1X2IA 5HMMA 3FYHA 2FPKA 4M47A 1RXWA 4X5VA 2ZYZB 4M9JA 2DPJA 2ASJA 3T5JA 4TKKA 4P4OA 5BPCA 5KFLA 4YMMA 1UA0A 7ICGA 1KEJA 1NOMA 1OB8A 8ICRA 2VA3A 4ECRA 2W8MA 4R63A 1MC8A 1MSWD 4DFJA 4B9SA 2IA6A 4XQ8A 5KFPA 4YN4A 1D8LA 3LK9A 5J2DA 2BKEA 3RBEA 4JK1A 1U47A 1S76D 1R11A 4RUCA 2FLPA 4NM1A 4F5RA 3OSPA 1MQ3A 3PY8A 2IHMA 7ICEA 8ICZA 3IEYB 1XSLA 1NKEA 4YXMA 1S77D 3C2MA 5CWRA 3GIJA 2FLCA 3TFRA 5DDYA 1LB2B 4RUAA 5J0PA 4Z6FA 4UBCA 4ED1A 3RBDA 3KTQA 4B9VA 4KMUA 2KZZA 1IPIA 3Q8LA 2ZUCA 1BPYA 3JPTA 4QZ8A 3PV8A 2PFNA 2UVWA 4M2YA 4I2HA 1F1ZA 3P1YA 2C22A 2XGQA 2VANA 4DO9A 4TKDA 1COOA 3EPGA 4G6UA 2FPLA 1K1SA 2BCUA 2ZYZA 2ZTDA 2W8LA 4DL5A 5IIIA 5J2HA 1NK9A 1KLNA 4DS5A 3TFSA 5KFGA 2W9BB 4FBUA 1GEFA 1NJWA 2RDIA 2HHVA 9ICQA 4PGQA 5KFXA 4BWJA 1TK5A 2AGQA 4DQIA 9ICJA 8ICKA 5KT3A 4I2GA 4YQWA 2VA8A 3EWAA 4RQ7A 4BWMA 1SKRA 4ECTA 2BQUA 5EOZA 4GLXA 4DLGA 3OGUA 3BQ1A 1TK0A 4MEXA 5KG6A 9ICMA 2WIZA 3ISDA 2C28A 1ZQMA 8ICWA 1RZTA 2P6RA 1TAUA 5J2EA 4QWDA 3ETLA 4XA5A 4KLLA 3V6KA 4DQSA 3GIMA 1XSNA 1QSLA 2KZ3A 4QZIA 3C21A 2XCPA 2ATLA 4YR3A 4DSFA 1U45A 3P1ZA 5CJ7A 5J2IA 1NK8A 4JV0A 4J9RA 5DB6A 2WCZA 1TVAA 4J9PA 4F5QA 4UB3A 1KFDA 4RZRA 4YR0A 1BPEA 9ICKA 2C2DA 2AU0A 2BGWA 2FL3A 1T3NA 1ZYQA 9ICCA 1YNMA 9ICGA 1XSPA 4UB5A 3FOVA 4DEZA 4YD2A 3TI0A 4MFFA 3UXOA 3OJSA 3HP6A 1KTQA 4UQGA 1XO1A 5CA7A 4J9MA 1ZJMA 4KLMA 3TANA 5KFHA 5L1LA 7ICKA 1RLVA 2VS1A 2ZTEA 5KFYA 8ICYA 8ICMA 5KFVA 5J0XA 5J0SA 4J9NA 4DF4A 4BGDA 4F91B 1XC9A 1DOQA 4B9MA 8ICLA 4YG2A 3MDCA 3MGHA 4FBTA 3MDAA 4O5EA 2JJQA 2J6SA 3EPIA 9ICOA 3H8JA 4YVZA 5BOMA 1U4BA 3H4DA 2A1JA 3ORYA 4M6WA 1K1QA 3SV4A 4RNOA 4I2AA 2Y1JA 5EWGA 4RPYA 2HHWA 5KFOA 3MR2A 4Q45A 4RQ6A 3EYZA 3C2LA 5F9NA 5DDMA 3MR3A 4O5KA 1QSSA 4DSJA 2ASLA 3OHBA 4IQWA 3GIIA 1S10A 2DPIA 7ICPA 5J2GA 4F5NA 3EW9A 2W9BA 2MUTA 4QZBA 1Z3EB 3ZD8A 5IIKA 4RT2A 3UQ2A 5KFTA 3RJGA 1SKSA 4ELVA 4EZ9A 4KLJA 8ICVA 3H40A 4E6ZA 3RJFA 4DAPA 4M9NA 2ZJ5A 2FLLA 5FDKA 3C5FA 3JPPA 5EWEA 2NRVA 3SYZA 1HH1A 4BXOA 3ZDBA 1BPZA 2LYHA 2ISPA 4I2BA 4ELUA 5KG2A 4QZFA 2JZBB 4GC6A 2HVHA 4QWAA 1JX4A 5J2KA 1ZQXA 3MGIA 5J2CA 4KITB 4DL3A 4KLQA 1TV9A 2R8HA 7ICVA 2OSTA 4FO6A 4TQRA 2ZTCA 5KFWA 4J9OA 1ZQIA 2OWOA 5L1JA 1JMSA 5KG7A 1XS9D 1BGXT 1L5UA 2HW3A 3PR5B 4K4IA 1TFRA 5KFZA 4QWEA 5DBBA 3JPNA 4CCHA 4KLEA 2NRWA 4PH5A 2FCOA 1MQ2A 7ICSA 2J6TA 3GV8B 5C5JA 5KG0A 1NK7A 2BQ3A 2JEJA 5D46A 4DL4A 2CV8A 2F1IA 1ZJNA 3OHAA 4EYHB 4QZHA 7ICFA 4PHDA 1SL2A 1X9MA 4NY8A 4MF8A 5J0WA 3H4BA 3PW4A 4YMOA 5KFMA 2MAXA 1NJYA 4M9LA 3QEAZ 1Y1OA 4B9TA 4YR2A 4UB1A 3PX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DB9 A;  3LWM A;  3H7I A;  1ZQC A;  5DG7 A;  5DB7 A;  8ICF A;  7ICT A;  2XC9 A;  4C8O A;  3GFK B;  2P6U A;  3QZ7 A;  4DQQ A;  3N4M B;  2C2E A;  2FMQ A;  4R66 A;  3AU2 A;  4F93 B;  3BQT A;  2HVI A;  3BQ2 A;  2GW6 A;  1UT5 A;  3OJU A;  4PGY A;  1ZQV A;  4DFP A;  7ICN A;  4MFA A;  2V4Q A;  4I2E A;  8ICS A;  4DOC A;  3C2K A;  5DLF A;  4P4P A;  1NK0 A;  4KLI A;  2AQ0 A;  3JPR A;  5DGA A;  5KFC A;  4NLN A;  1V9P A;  2AQ4 A;  4J9K A;  1BPX A;  4TUQ A;  4F50 A;  1ARO P;  1L3U A;  1L3S A;  4DWI A;  9ICN A;  4KN7 A;  3IHQ B;  3UPQ A;  1NJZ A;  2JEG A;  2W9M A;  3THV A;  1BVS A;  4IQT A;  2UVU A;  4I29 A;  5KG4 A;  1Z00 A;  1S0N A;  2R8I A;  3V6J A;  2IMW P;  4Z6E A;  3RB3 A;  2W9A A;  2R8G A;  1T4G A;  4QW9 A;  3RB6 A;  3E2E A;  4EZ6 A;  4E0D A;  4UBB A;  4C8L A;  5KG1 A;  3UQ0 A;  5J0O A;  3N97 B;  1S0V A;  9ICU A;  4YFK A;  4BXO B;  2PFP A;  1WCL A;  4DFK A;  1ZQG A;  1ZQK A;  1UA1 A;  4LVS A;  7ICR A;  3MR6 A;  4KLG A;  2F1H A;  3V6H A;  4P2H A;  2KFZ A;  2OKF A;  4J9Q A;  4O5C A;  3AUO A;  2PXI A;  1NKB A;  1UT8 A;  5KT2 A;  3AJV B;  4IQU A;  4I2J A;  1R0V A;  4ECQ A;  7ICL A;  1X9W A;  5J2F A;  3KHR A;  5HHI A;  2H5X A;  4QZC A;  5KFK A;  4UAY A;  3M9N B;  3EZ5 A;  4RT3 A;  4UAW A;  4M0A A;  5J0T A;  3UXP A;  3M8R A;  4ED0 A;  3SI8 A;  4UB2 A;  2XY7 A;  1ZQO A;  5J2A A;  4DSE A;  4I28 A;  2PI4 A;  3RR8 A;  1T7P A;  3OSN A;  5KFI A;  1S9F A;  2C2R A;  5DB8 A;  1JIH A;  5KFJ A;  4ED8 A;  2XY6 A;  9ICA A;  4YP3 A;  8ICC A;  9ICI A;  3AU6 A;  3GIL A;  2PI5 A;  1S0M A;  1HJP A;  1ZQW A;  1LV5 A;  4M9H A;  8ICN A;  1B43 A;  2MUT B;  2AJQ A;  1EXN A;  4GC7 A;  4DOB A;  4J9L A;  4EYI B;  3V72 A;  3RRG A;  4I2F A;  1SL0 A;  4MF2 A;  4Q44 A;  3V7J A;  2RDJ A;  4ECY A;  4DOA A;  4KLT A;  1ZQB A;  3PML A;  3HX0 A;  1ZQA A;  3G6V A;  2HHS A;  4ED2 A;  3TAQ A;  7ICQ A;  1IM4 A;  3T5K A;  3C5G A;  2W8K A;  1ZQT A;  2FMS A;  4I27 A;  5DGB A;  1ZQQ A;  4QWB A;  1T0F A;  3B0Y A;  4M6W B;  3KHL A;  2P66 A;  1OB9 A;  4ECZ A;  5KFD A;  4MEY A;  4RNN A;  4PHA A;  2XCA A;  4C8M A;  4GXJ A;  4FS1 A;  3T5H A;  5EWF A;  4YCX A;  4QW8 A;  3PO4 A;  3G6X A;  3MFH A;  2AGO A;  3NTU A;  4O0I A;  3Q8R B;  3Q8Q B;  8ICP A;  1HUO A;  1A79 A;  5HML A;  4LZG A;  4NLG A;  2ZJA A;  5L9X A;  4F3O A;  9ICV A;  2NRT A;  4IRC A;  2BQR A;  4PGX A;  4F4X A;  2IBK A;  2BPG A;  4YXJ A;  2R8J A;  4RQ8 A;  4Z6C A;  1ZQL A;  4RQ5 A;  9ICW A;  1WCN A;  4NLZ A;  5KT6 A;  8ICQ A;  8ICX A;  5KFE A;  4J9S A;  1ZQH A;  5D49 A;  2BPF A;  5KG3 A;  4DL7 A;  1Z00 B;  5CHG A;  3RH4 A;  1BPB A;  4KN4 A;  2BCS A;  4R8U B;  3Q8K A;  9ICB A;  5DQG A;  4G3I A;  5KFF A;  3KHG A;  2IHN A;  2VLD A;  9ICL A;  4F8R A;  5HP4 A;  4ZH4 A;  3PX0 A;  4ECX A;  4RQ4 A;  5KFU A;  3DNX A;  1XWL A;  4F92 B;  3PMN A;  4DSL A;  4FS2 A;  4B9L A;  5J29 A;  1ZQF A;  3JPS A;  2UVV A;  4IR1 A;  4F5O A;  1XMX A;  8ICB A;  2FLN A;  3RR7 A;  3Q8S B;  2JEI A;  1KSP A;  1SKW A;  5KFB A;  1U9L A;  3K4G A;  7ICI A;  4KLU A;  9ICR A;  9ICP A;  2BHN A;  9ICE A;  2INB A;  4O3O A;  3TAR A;  9ICT A;  2NRZ A;  2XO7 A;  2V4R A;  3RJH A;  3SZ2 A;  4DF8 A;  4UAZ A;  4RU9 A;  3H8S A;  3GDX A;  3BQ0 A;  5IIL A;  4GXI A;  1KRP A;  4JV1 A;  2JZB A;  4IRD A;  4NXZ A;  5KFQ A;  3HT3 A;  7ICJ A;  7ICH A;  2EO0 A;  5DLG A;  4RQ1 A;  1D9D A;  4I2I A;  5KT4 A;  3ISB A;  1NK5 A;  2R8K A;  1SL1 A;  4F2S A;  3MAB A;  3IEY A;  3GIK A;  5JUM A;  4B9N A;  5CR0 A;  3PNC A;  8ICJ A;  5DG9 A;  3HW8 A;  8ICT A;  5DKW A;  2NRX A;  5KFA A;  3M9O B;  1DGS A;  3RJK A;  4KLH A;  2WIW A;  4TUR A;  4XUS A;  4ED6 A;  3PW2 A;  1KFS A;  2HHT A;  1QLN A;  1U48 A;  4TQS A;  2KN7 A;  3K75 D;  3QE9 Y;  2BCR A;  4I2C A;  5J0Q A;  2HHQ A;  1RZN A;  1ZQD A;  4C8N A;  5L1K A;  3RJE A;  8ICA A;  1ZQR A;  5J0R A;  3LWL A;  1QSY A;  2KTQ A;  5KT7 A;  2ISO A;  4F4W A;  4DSK A;  4ED3 A;  5KTQ A;  2WTF A;  1N56 A;  2HHX A;  2ASD A;  3PW0 A;  4QZA A;  4YD1 A;  4R65 A;  3FDS A;  5KFN A;  3RAX A;  1RYR A;  5KT5 A;  1NK6 A;  4JWM A;  4JV2 A;  5HNK A;  5D4B A;  1TKD A;  9ICF A;  4HYK A;  1T8E A;  5KFS A;  1ZQE A;  3ZD9 A;  2UVR A;  4B9U A;  1A76 A;  1H38 A;  3RJI A;  5IIM A;  2BR0 A;  4QZD A;  3T3F A;  2XGP A;  4NLK A;  1TK8 A;  2AGP A;  4Q8F A;  3ZDC A;  4R8U A;  4QBN A;  1CEZ A;  4F4Y A;  4KTQ A;  3B0X A;  1HUZ A;  4KLF A;  3RJJ A;  4RPZ A;  4P4M A;  8ICE A;  2KZM A;  2I1Q A;  3C1Z A;  4QZ9 A;  5CP2 A;  5J0Y A;  3MFI A;  4KLS A;  4O3Q A;  7ICO A;  4EBD A;  1NKC A;  4O3N A;  4DQR A;  1ZP7 A;  2ZUD A;  4F4Z A;  2A1J B;  2WCW A;  4C8K A;  5KG5 A;  4UB4 A;  1ZQP A;  9ICS A;  2B21 A;  4BDP A;  4Q8E A;  1RXV A;  2V9W A;  4F2R A;  4Z6D A;  1JN3 A;  3MR5 A;  3GV5 B;  4M9G A;  3PO5 A;  8ICU A;  1ZQU A;  5BOL A;  5KFR A;  3PR4 A;  5DBC A;  3BJY A;  3IM1 A;  4EBC A;  1KFT A;  3PW7 A;  1N48 A;  3SV3 A;  5J2B A;  3TAP A;  3ZDE A;  1SZP A;  1RPL A;  5CB1 A;  1S0O A;  4F4K A;  2I9G A;  1XU4 A;  4QWC A;  3JPQ A;  1PZN A;  8ICH A;  5TZV A;  2PFO A;  2BCV A;  3V7L A;  4IRK A;  4DLE A;  3RH6 A;  2HHU A;  4QBL A;  4JWN A;  1A77 A;  4QZE A;  3QZ8 A;  4ECS A;  4DS4 A;  1Y88 A;  4DL2 A;  8ICG A;  5IIN A;  3RB0 A;  2GJW A;  1ZQJ A;  3C1Y A;  4K4H A;  5DG8 A;  2ALZ A;  4QZG A;  4RNM A;  3TQ1 A;  3P1Z B;  4DQP A;  2M9N A;  1NJX A;  3G6Y A;  4NM2 A;  4Q43 A;  2WJ0 A;  1KDH A;  4RPX A;  5DBA A;  1BPD A;  1C7Y A;  4JUZ A;  4PHE A;  3M8S A;  3GV7 B;  8ICO A;  2Q0Z X;  3AJV A;  3PX6 A;  5HHH A;  1D8Y A;  2ZUB A;  4O9M A;  1S97 A;  2FMP A;  3ZDA A;  9ICH A;  2ZJ8 A;  3Q8P B;  1ZQY A;  3MBY A;  5DQI A;  4K4G A;  4YMN A;  4RQ0 A;  4R64 A;  2KFN A;  3BDP A;  5IIJ A;  4O3R A;  1NK4 A;  4ECW A;  1JXL A;  4QBO A;  5F9L A;  1D9F A;  3C23 A;  1ZQN A;  4DSI A;  1B22 A;  4XRH A;  4IQV A;  3GQC A;  4LZD A;  4MFC A;  3LDA A;  5DQH A;  4ECV A;  3ISC A;  9ICX A;  1JXE A;  4ED7 A;  3PW5 A;  2VA2 A;  3UXN A;  4RQ2 A;  4M04 A;  4F5P A;  4O3S A;  7ICU A;  4KLO A;  8ICI A;  4TUP A;  3HPO A;  3T5L A;  4ELT A;  1IXR A;  1ZET A;  5J2J A;  2FPM A;  4GXK A;  3PVX A;  3KHH A;  4ECU A;  3RAQ A;  1CUK A;  4EBE A;  5IIO A;  5L1I A;  1TAQ A;  4DFM A;  2GWS A;  1QTM A;  2BPC A;  4DL6 A;  1L3V A;  3Q8M A;  2Y1I A;  1X9S A;  1L3T A;  2BDP A;  4EEY A;  3RRH A;  2XY5 A;  3RB4 A;  1U49 A;  4IR9 A;  1ZQZ A;  3RTV A;  2DFL A;  2W9C B;  3NGD A;  4O3P A;  4KLD A;  2PFQ A;  4TUS A;  4I2D A;  5J0U A;  3H8W A;  3JPO A;  4PHP A;  2BCQ A;  2W9C A;  2F1J A;  2JEF A;  3RH5 A;  2J6U A;  7ICM A;  3V7K A;  1ZQS A;  3QEB Z;  3M9M B;  4PPX A;  4RQ3 A;  1RYS A;  3ZDD A;  3HWT A;  1X2I A;  5HMM A;  3FYH A;  2FPK A;  4M47 A;  1RXW A;  4X5V A;  2ZYZ B;  4M9J A;  2DPJ A;  2ASJ A;  3T5J A;  4TKK A;  4P4O A;  5BPC A;  5KFL A;  4YMM A;  1UA0 A;  7ICG A;  1KEJ A;  1NOM A;  1OB8 A;  8ICR A;  2VA3 A;  4ECR A;  4R63 A;  1MC8 A;  1MSW D;  4DFJ A;  4B9S A;  2IA6 A;  4XQ8 A;  5KFP A;  4YN4 A;  1D8L A;  3LK9 A;  5J2D A;  2BKE A;  3RBE A;  4JK1 A;  1U47 A;  1S76 D;  1R11 A;  4RUC A;  2FLP A;  4NM1 A;  4F5R A;  3OSP A;  1MQ3 A;  3PY8 A;  2IHM A;  7ICE A;  8ICZ A;  1XSL A;  1NKE A;  4YXM A;  1S77 D;  3C2M A;  5CWR A;  3GIJ A;  3TFR A;  5DDY A;  1LB2 B;  4RUA A;  5J0P A;  4Z6F A;  4UBC A;  4ED1 A;  3RBD A;  3KTQ A;  4B9V A;  4KMU A;  2KZZ A;  1IPI A;  3Q8L A;  2ZUC A;  1BPY A;  3JPT A;  4QZ8 A;  3PV8 A;  2PFN A;  2UVW A;  4M2Y A;  4I2H A;  1F1Z A;  3P1Y A;  2C22 A;  2XGQ A;  2VAN A;  4DO9 A;  4TKD A;  1COO A;  3EPG A;  2FPL A;  1K1S A;  2BCU A;  2ZYZ A;  2ZTD A;  2W8L A;  4DL5 A;  5III A;  5J2H A;  1NK9 A;  1KLN A;  4DS5 A;  3TFS A;  5KFG A;  2W9B B;  4FBU A;  1GEF A;  1NJW A;  2RDI A;  2HHV A;  9ICQ A;  4PGQ A;  5KFX A;  4BWJ A;  1TK5 A;  2AGQ A;  4DQI A;  9ICJ A;  8ICK A;  5KT3 A;  4I2G A;  4YQW A;  2VA8 A;  3EWA A;  4RQ7 A;  4BWM A;  1SKR A;  4ECT A;  2BQU A;  5EOZ A;  4GLX A;  4DLG A;  3OGU A;  3BQ1 A;  1TK0 A;  4MEX A;  5KG6 A;  9ICM A;  2WIZ A;  3ISD A;  2C28 A;  1ZQM A;  8ICW A;  1RZT A;  2P6R A;  1TAU A;  5J2E A;  4QWD A;  3ETL A;  4XA5 A;  4KLL A;  3V6K A;  4DQS A;  3GIM A;  1XSN A;  1QSL A;  2KZ3 A;  4QZI A;  3C21 A;  2XCP A;  2ATL A;  4YR3 A;  4DSF A;  1U45 A;  3P1Z A;  5CJ7 A;  5J2I A;  1NK8 A;  4JV0 A;  4J9R A;  5DB6 A;  2WCZ A;  1TVA A;  4J9P A;  4F5Q A;  4UB3 A;  1KFD A;  4RZR A;  4YR0 A;  1BPE A;  9ICK A;  2C2D A;  2AU0 A;  2BGW A;  1T3N A;  1ZYQ A;  9ICC A;  9ICG A;  1XSP A;  4UB5 A;  3FOV A;  4DEZ A;  4YD2 A;  3TI0 A;  4MFF A;  3UXO A;  3OJS A;  3HP6 A;  1KTQ A;  4UQG A;  1XO1 A;  5CA7 A;  4J9M A;  1ZJM A;  4KLM A;  3TAN A;  5KFH A;  5L1L A;  7ICK A;  1RLV A;  2ZTE A;  5KFY A;  8ICY A;  8ICM A;  5KFV A;  5J0X A;  5J0S A;  4J9N A;  4DF4 A;  4BGD A;  4F91 B;  1XC9 A;  1DOQ A;  4B9M A;  8ICL A;  4YG2 A;  3MDC A;  3MGH A;  4FBT A;  3MDA A;  4O5E A;  2J6S A;  3EPI A;  9ICO A;  3H8J A;  4YVZ A;  5BOM A;  1U4B A;  3H4D A;  2A1J A;  3ORY A;  4M6W A;  1K1Q A;  3SV4 A;  4RNO A;  4I2A A;  2Y1J A;  5EWG A;  4RPY A;  2HHW A;  5KFO A;  3MR2 A;  4Q45 A;  4RQ6 A;  3EYZ A;  3C2L A;  5F9N A;  5DDM A;  3MR3 A;  4O5K A;  1QSS A;  4DSJ A;  2ASL A;  3OHB A;  4IQW A;  3GII A;  1S10 A;  2DPI A;  7ICP A;  5J2G A;  4F5N A;  3EW9 A;  2W9B A;  2MUT A;  4QZB A;  1Z3E B;  3ZD8 A;  5IIK A;  4RT2 A;  3UQ2 A;  5KFT A;  3RJG A;  1SKS A;  4ELV A;  4EZ9 A;  4KLJ A;  8ICV A;  3H40 A;  3RJF A;  4M9N A;  2ZJ5 A;  2FLL A;  5FDK A;  3C5F A;  3JPP A;  5EWE A;  2NRV A;  3SYZ A;  1HH1 A;  4BXO A;  3ZDB A;  1BPZ A;  2LYH A;  2ISP A;  4I2B A;  4ELU A;  5KG2 A;  4QZF A;  2JZB B;  4GC6 A;  2HVH A;  4QWA A;  1JX4 A;  5J2K A;  1ZQX A;  3MGI A;  5J2C A;  4KIT B;  4DL3 A;  4KLQ A;  1TV9 A;  2R8H A;  7ICV A;  2OST A;  4FO6 A;  4TQR A;  2ZTC A;  5KFW A;  4J9O A;  1ZQI A;  2OWO A;  5L1J A;  1JMS A;  5KG7 A;  1XS9 D;  1BGX T;  1L5U A;  2HW3 A;  3PR5 B;  4K4I A;  1TFR A;  5KFZ A;  4QWE A;  5DBB A;  3JPN A;  4CCH A;  4KLE A;  2NRW A;  4PH5 A;  2FCO A;  1MQ2 A;  7ICS A;  2J6T A;  3GV8 B;  5C5J A;  5KG0 A;  1NK7 A;  2BQ3 A;  2JEJ A;  5D46 A;  4DL4 A;  2CV8 A;  2F1I A;  1ZJN A;  3OHA A;  4EYH B;  4QZH A;  7ICF A;  4PHD A;  1SL2 A;  1X9M A;  4NY8 A;  4MF8 A;  5J0W A;  3H4B A;  3PW4 A;  4YMO A;  5KFM A;  2MAX A;  1NJY A;  4M9L A;  3QEA Z;  1Y1O A;  4B9T A;  4YR2 A;  4UB1 A;  3PX4 A; 
#chains in the Genus database with same CATH topology
 3LWM A;  3SD7 A;  3UMG A;  3C28 A;  2W54 A;  4USA A;  3QZ7 A;  2HVI A;  4R66 A;  4F93 B;  3BQ2 A;  2GW6 A;  2V4Q A;  3BS7 A;  1P7D A;  1V9P A;  1ARO P;  4DWI A;  2FDR A;  2WF8 A;  3IHQ B;  2JEG A;  5EE3 A;  4I29 A;  1Z00 A;  2Z7J A;  4PL1 A;  2W9A A;  1T4G A;  4QW9 A;  4EZ6 A;  4E0D A;  2DQN B;  2FI1 A;  4UBB A;  3MC1 A;  4C8L A;  4NL9 C;  1WWV A;  3N97 B;  4BXO B;  2GOL A;  4DFK A;  4LQE A;  5AM1 A;  4AYB F;  2KK0 A;  4P2H A;  1S8O A;  5KT2 A;  1ZQ1 C;  7ICL A;  3KHR A;  2K4H A;  2HBK A;  2ZXH A;  1OXJ A;  2ODG A;  3KBB A;  4RT3 A;  5J0T A;  3M8R A;  4ED0 A;  2CN1 A;  3KZI U;  4I28 A;  4DSE A;  1MA7 A;  1T7P A;  3OSN A;  2YMM A;  1JIH A;  5KFJ A;  4ED8 A;  8ICC A;  2WF5 A;  2PI5 A;  3MGV A;  3FC4 A;  1PVR A;  1LV5 A;  1ZQW A;  5A0L A;  5CRX A;  3D2N A;  3IG5 A;  4Q44 A;  5C0Y A;  4ECY A;  4KLT A;  3I28 A;  2WB1 F;  3G6V A;  4ED2 A;  7ICQ A;  1IM4 A;  3T5K A;  3C5G A;  2LKY A;  2NYV A;  4I27 A;  2P35 A;  3B0Y A;  2P66 A;  1WUD A;  2DWQ A;  4C8M A;  2YX8 A;  3PO4 A;  2KJ8 A;  2AGO A;  4O0I A;  3Q8Q B;  2GLE A;  9ICV A;  1V97 A;  2BQR A;  3KZX A;  3SMV A;  4RQ8 A;  1ZQL A;  5JTI A;  4J9S A;  2RQ5 A;  5KG3 A;  5CHG A;  4AYB C;  1BPB A;  4R8U B;  2FKH B;  9ICB A;  5DQG A;  5KFF A;  3KHG A;  2IHN A;  1JUD A;  3F2D A;  1QQ6 A;  3F5E A;  3N7R C;  3RR7 A;  2JEI A;  3K4G A;  2XID A;  4ACO A;  9ICR A;  2KMD A;  9ICE A;  2KV2 A;  2V4R A;  4UAZ A;  4RU9 A;  3H8S A;  3BQ0 A;  5IIL A;  4NXZ A;  2EO0 A;  5DLG A;  2IXS A;  3AQE A;  3IEY A;  2DL0 A;  5JUM A;  3PNC A;  3HW8 A;  5DKW A;  1RQN A;  4Y2J A;  2HHT A;  1KFS A;  3K75 D;  4I2C A;  2OM6 A;  1F0M A;  5J0Q A;  8ICA A;  4C8N A;  1KL9 A;  2KOB A;  4OO1 J;  4US9 A;  2WTF A;  5KAI U;  3RAX A;  3FDS A;  3WK7 A;  4JWM A;  4F71 A;  2HDO A;  4JB3 A;  1T8E A;  5KFS A;  2UVR A;  1A76 A;  1H38 A;  1QQ7 A;  1COK A;  3T3F A;  1TK8 A;  1RYU A;  1DK2 A;  4R8U A;  5AKK A;  3RJJ A;  8ICE A;  2KZM A;  5J0Y A;  4NLC A;  2F8K A;  2WCW A;  9ICS A;  3BQ7 A;  4BDP A;  4GIB A;  4Q8E A;  1RXV A;  3RF9 A;  2V9W A;  4F2R A;  2ZIW B;  4M9G A;  3PO5 A;  5BOL A;  3PR4 A;  5DBC A;  5J2B A;  1RPL A;  5E79 U;  2I9G A;  2JGA A;  3V7L A;  4IRK A;  2QB1 A;  4DLE A;  3RH6 A;  4QBL A;  1SZH A;  1A77 A;  4QZE A;  4ECS A;  4DL2 A;  3SAH A;  1VDV A;  3KKA C;  2B0C A;  3TQ1 A;  1B0X A;  4DQP A;  2WJ0 A;  3G6Y A;  3F53 A;  4JUZ A;  3M8S A;  3NRZ A;  5HHH A;  2FMP A;  1N60 A;  3Q8P B;  5DQI A;  4RQ0 A;  2D6F C;  2KFN A;  5IIJ A;  4O3R A;  2K4E A;  1JXL A;  4EEN A;  5F9L A;  1ZQN A;  1SWW A;  4OJP A;  4MFC A;  1PK3 A;  4ED7 A;  3PW5 A;  2YTU A;  2VA2 A;  3UXN A;  7ICU A;  2D8C A;  3HPO A;  2ZIV B;  3SEN A;  5ALG A;  4OJO A;  5IIO A;  5AKZ A;  5L1I A;  4Y2V A;  4DFM A;  5ALU A;  2BPC A;  4DL6 A;  3Q8M A;  2Y1I A;  2XY5 A;  3RB4 A;  1U49 A;  2AHO B;  2DFL A;  4C0Z A;  2K89 A;  3JPO A;  2EZX A;  2F1J A;  2JEF A;  3RH5 A;  1ZQS A;  3M9M B;  5H2F U;  3FYH A;  4M9J A;  2DPJ A;  2ASJ A;  3T5J A;  7ICG A;  4YMM A;  5BPC A;  1NOM A;  4R63 A;  4B9S A;  4XQ8 A;  5KFP A;  3CYM A;  1D8L A;  2BKE A;  1ED1 A;  4O3M A;  4NM1 A;  2LHT A;  3IEY B;  1MQ3 A;  1XSL A;  4NV0 A;  5AI9 A;  1NKE A;  2RLT A;  2QB0 A;  2FLC A;  5J0P A;  4ED1 A;  3H0M B;  2KZZ A;  2VIX A;  4P0Q B;  2EQY A;  2KHQ A;  4OJ5 A;  3P1Y A;  5EE9 A;  4I2H A;  3WK6 A;  4G6U A;  2ZYZ A;  5III A;  4DS5 A;  2W9B B;  1Q3U A;  4DCC A;  2RDI A;  2HHV A;  2KIC A;  3I1Y A;  8ICK A;  2ES6 A;  3IRU A;  2KVS A;  3OGU A;  4DLG A;  3WK9 A;  2WF6 A;  1ZQM A;  8ICW A;  4KLL A;  5ALX A;  4DQS A;  1N2X A;  3C21 A;  2ATL A;  2ZIU B;  5AHX A;  5J2I A;  2ZIW A;  1NK8 A;  1XO0 A;  3M6K A;  4YR0 A;  1BPE A;  9ICK A;  2FL3 A;  1T3N A;  3FOV A;  4YD2 A;  2ZG6 A;  3UXO A;  5ALO A;  1KTQ A;  1XO1 A;  1QH9 A;  5KFH A;  5L1L A;  7ICK A;  8ICM A;  5J0X A;  4B9M A;  4O5E A;  3MDA A;  9ICO A;  3ED5 A;  3H4D A;  2A1J A;  2Y1J A;  5KFO A;  4Q45 A;  4DSJ A;  3OHB A;  3WKA A;  3GII A;  2QLT A;  5J2G A;  3A0B U;  4F5N A;  5AK4 A;  3AN1 A;  2MUT A;  5J8Y C;  3UQ2 A;  5KFT A;  8ICV A;  3H40 A;  2FLL A;  3SYZ A;  2HOF A;  4BXO A;  3UMB A;  4U6P A;  1J2M A;  5J2C A;  2HOQ A;  4DL3 A;  7ICV A;  1PVQ A;  4FO6 A;  1ZQI A;  1JMS A;  1X40 A;  5ALE A;  2DKZ A;  3PR5 B;  1T94 A;  5KFZ A;  4CCH A;  5DBB A;  4UAT A;  4KLE A;  2NRW A;  2MRL A;  2J6T A;  3GV8 B;  5KG0 A;  1NK7 A;  3T79 A;  2BQ3 A;  4DL4 A;  1GO3 F;  4EYH B;  4QZH A;  3J81 j;  1ZD3 A;  3CRX A;  2H3Q A;  1D8B A;  3A0H U;  3FAH A;  2MAX A;  4M9L A;  4Y2S A;  4YR2 A;  5AKJ A;  3H7I A;  5DG7 A;  8ICF A;  2XC9 A;  4C4T A;  3N4M B;  2FMQ A;  2C2E A;  3AU2 A;  4MFA A;  2LBO A;  3QU7 A;  1FFV A;  5DLF A;  4P4P A;  3PST A;  3JPR A;  4FE3 A;  1BPX A;  1L6N A;  1L3U A;  4F50 A;  9ICN A;  1L3S A;  3DV9 A;  3UPQ A;  2UVU A;  3N7S C;  5AK6 A;  2R8G A;  4Z6E A;  3RB3 A;  1Q3V A;  3NVZ A;  4YFK A;  2Y0S C;  4DA2 A;  3PSP A;  4KLG A;  3BT7 A;  2F1H A;  2E8M A;  5AIC A;  4J9Q A;  2PXI A;  1X9W A;  2F8L A;  2I6X A;  1KN5 A;  4QZC A;  1YZ6 A;  3M9N B;  3SI8 A;  4UB2 A;  1ZQO A;  5J2A A;  1S9F A;  3SR6 A;  9ICA A;  2XY6 A;  5ALY A;  5JRT A;  2JRZ A;  9ICI A;  3GIL A;  1L7O A;  1HJP A;  4M9H A;  1A0P A;  4Y2P A;  5AKE A;  4I2F A;  4J9L A;  3V72 A;  4KX5 A;  4QNL A;  2HOI A;  2DKX A;  3PML A;  1ZQA A;  2HHS A;  2G5I B;  3TAQ A;  1B4F A;  2W8K A;  1ZQT A;  2E5S A;  1T0F A;  4DAV A;  3KHL A;  2WAQ F;  1OB9 A;  5KFD A;  4FS1 A;  3MFH A;  5KL8 B;  8ICP A;  1HUO A;  4F3O A;  2H3Z A;  2NRT A;  5AI4 A;  4IRC A;  4PGX A;  4F4X A;  4Z6C A;  4RQ5 A;  9ICW A;  1K5O A;  2KSO A;  1ZQH A;  2KKP A;  3CNH A;  2BPF A;  1F44 A;  3Q8K A;  3WKB A;  4C4R A;  4EX6 A;  5HP4 A;  3PX0 A;  1XWL A;  4B9L A;  2AH5 A;  2UVV A;  4IR1 A;  4F5O A;  2LYB A;  2FLN A;  1SKW A;  5KFB A;  2INB A;  4O3O A;  9ICT A;  3SZ2 A;  4DF8 A;  1KRP A;  4GXI A;  5KFQ A;  7ICJ A;  2CXY A;  4I2I A;  4GFJ A;  3UMC A;  4F2S A;  2QAR A;  8ICT A;  2IOF K;  4NJ8 A;  1DGS A;  4TUR A;  4XUS A;  1U48 A;  2BCR A;  3QE9 Y;  3F2B A;  1RZN A;  1ZQD A;  1KQQ A;  1ZQR A;  1QSY A;  2KTQ A;  4QJF B;  5KT7 A;  1RM6 C;  1UPH A;  2ASD A;  2KIW A;  4QZA A;  1L7N A;  1RYR A;  1NK6 A;  5KT5 A;  5HNK A;  5AK5 A;  3ZD9 A;  2W7O A;  4NLK A;  4Q8F A;  5EE0 A;  1CEZ A;  3B0X A;  2HI0 A;  4KLF A;  4RPZ A;  4P4M A;  4QZ9 A;  2HBJ A;  7ICO A;  1BNP A;  4DQR A;  4C8K A;  4UB4 A;  1ZQP A;  2WAQ C;  3PSF A;  4Z6D A;  8ICU A;  1ZQU A;  4UB8 U;  4EBC A;  1KFT A;  1PVP A;  1DGJ A;  3SV3 A;  3TAP A;  1SZP A;  4F4K A;  3BS5 B;  2PFO A;  2BCV A;  4JWN A;  2DUY A;  5IIN A;  1VJ5 A;  3C1Y A;  3QX7 A;  4BX9 C;  2ALZ A;  1WYG A;  4PZO A;  3P1Z B;  4NM2 A;  5ALS A;  1BPD A;  2HCF A;  1IV8 A;  4PHE A;  3GV7 B;  3AJV A;  2GH1 A;  2A3V A;  1D8Y A;  4O9M A;  1SV0 A;  2E8N A;  1S97 A;  3ZDA A;  9ICH A;  1SXD A;  4R64 A;  3BDP A;  3M1Y A;  4ECW A;  3C23 A;  1A6S A;  4IQV A;  5DQH A;  1AQ6 A;  2KJ9 A;  3HRD D;  3NRW A;  4ECV A;  9ICX A;  4F5P A;  4KLO A;  4PZN A;  3T5L A;  4CGZ A;  2YMP A;  3PVX A;  3RAQ A;  2H3F A;  1OW5 A;  1QTM A;  2R18 A;  3OPX A;  1ZQZ A;  4QIW C;  4ZOH C;  3C29 A;  4KLD A;  5J0U A;  4PHP A;  2W9C A;  2J6U A;  3V7K A;  3QEB Z;  1KW4 A;  1RYS A;  5ALD A;  1X2I A;  1RXW A;  2ZYZ B;  2MU2 A;  4P4O A;  1UA0 A;  8ICR A;  2VA3 A;  2W8M A;  5J2D A;  3ONN A;  3RBE A;  4JK1 A;  1U47 A;  3H0R B;  1S76 D;  3PY8 A;  8ICZ A;  4YXM A;  1S77 D;  2ZIX A;  3TFR A;  5DDY A;  1LB2 B;  2OEH A;  4UBC A;  4B9V A;  4KMU A;  5AM2 A;  1IPI A;  2ZUC A;  3JPT A;  4QZ8 A;  3PV8 A;  2PFN A;  1F1Z A;  5AI5 A;  2C22 A;  4U7C A;  2VAN A;  5AM3 A;  2K8A A;  3AEV A;  3KOO A;  1SB3 C;  4TKD A;  1ZD2 P;  1K1S A;  1NK9 A;  4FBU A;  2Q4T A;  2HMX A;  3VC8 A;  9ICQ A;  1RDF A;  5KFX A;  4BWJ A;  9ICJ A;  4DQI A;  2W11 A;  4RQ7 A;  5EOZ A;  2HBL A;  4MEX A;  2H3V A;  5KG6 A;  1Z1B A;  2KE7 A;  1JI7 A;  3ISD A;  4Y2Q A;  5J2E A;  3ETL A;  3GIM A;  1XSN A;  2AXT U;  4DSF A;  2O6K A;  4CNQ A;  5DB6 A;  4F5Q A;  2ZXI A;  2BGW A;  1YNM A;  9ICG A;  1XSP A;  2D3D A;  3TI0 A;  3F2C A;  2FJ6 A;  2IOF A;  3HP6 A;  1ZJM A;  1F5S A;  2YY6 A;  2EDU A;  2VS1 A;  5KFY A;  5KFV A;  4F91 B;  2JHD A;  1DOQ A;  1N62 A;  3MDC A;  5F3X B;  4FBT A;  3H8J A;  5CEH A;  5BOM A;  1U4B A;  2KIV A;  3ORY A;  4M6W A;  1K1Q A;  1L7P A;  3SV4 A;  5EWG A;  4RPY A;  4PJ0 U;  4RQ6 A;  3EYZ A;  4O5K A;  1S10 A;  7ICP A;  4EZ9 A;  3QUB A;  3RJF A;  4WJ3 B;  1M6Y A;  3JPP A;  2NRV A;  2Y9U A;  2ISP A;  2JZB B;  4GC6 A;  1HEK A;  1FEZ A;  2OXO A;  4KLQ A;  5ALM A;  1TV9 A;  2ZTC A;  4J9O A;  3PSI A;  2HW3 A;  4K4I A;  4QWE A;  5AKX A;  2CV8 A;  2F1I A;  4NWI A;  3OHA A;  1SL2 A;  4NY8 A;  5KNI A;  5J0W A;  3H4B A;  1N5W A;  3PW4 A;  1UCV A;  3QEA Z;  1Y1O A;  2KNJ A;  4QIW F;  4ZQU A;  4J03 A;  5AI0 A;  1ZQC A;  4C8O A;  2YMQ A;  1UT5 A;  1JAL A;  1X6J A;  1ZQV A;  5J8Y A;  4I2E A;  4EV1 A;  3C2K A;  1NK0 A;  2WF7 A;  2AQ0 A;  2ESE A;  5KFC A;  4OD0 A;  4NLN A;  2MSN A;  4J9K A;  2G06 A;  3NAS A;  3QU9 A;  2EZY A;  4KN7 A;  1NJZ A;  3KFU F;  2W9M A;  4IQT A;  5KG4 A;  2NO5 A;  3L5K A;  3V6J A;  3E2E A;  3F5A A;  5KG1 A;  3NVV A;  9ICU A;  1SXE A;  2PFP A;  1WCL A;  1ZQG A;  4LVS A;  4O5C A;  3AUO A;  1NKB A;  1R0V A;  1CRX A;  4BUG A;  5J2F A;  1VLB A;  5ALV A;  1ECW A;  2XY7 A;  1TAM A;  5K4L A;  3D2Q A;  3RR8 A;  2BDU A;  5AI6 A;  2W55 A;  2EAP A;  5KL1 B;  2ZIU A;  3AU6 A;  8ICN A;  2XIC A;  2RRD A;  4FZN A;  3WU2 U;  2AJQ A;  1EXN A;  2CZR A;  4DOB A;  3RRG A;  2W04 A;  1SL0 A;  4CDG A;  2RDJ A;  4DOA A;  1NZP A;  4P0P B;  2NO4 A;  5DGB A;  1ZQQ A;  4QWB A;  4M6W B;  4MEY A;  4RNN A;  4PHA A;  2KD1 A;  5EWF A;  4NL9 A;  4YCX A;  1A79 A;  5HML A;  2LM1 A;  2Z0R A;  2ZJA A;  3E58 A;  1FIQ A;  2IBK A;  2YML A;  5AKH A;  2R8J A;  5ALI A;  8ICX A;  5KT6 A;  8ICQ A;  5KFE A;  4DL7 A;  4KN4 A;  4FFD A;  4G3I A;  2JH7 A;  4PL2 A;  9ICL A;  4F8R A;  3NUQ A;  3QXG A;  4ECX A;  3DNX A;  3PMN A;  3B9J A;  5J29 A;  2GO7 A;  1ZQF A;  1KSP A;  1U9L A;  4KLU A;  5ALW A;  2F76 X;  3TAR A;  4G6V A;  2NRZ A;  2XO7 A;  1Z19 A;  4HAI A;  2PKE A;  3HT3 A;  3KD3 A;  4RQ1 A;  1D9D A;  5ALZ A;  5KT4 A;  1NK5 A;  2R8K A;  2NV3 A;  3GIK A;  4B9N A;  5CR0 A;  5DG9 A;  3M6Z A;  2NRX A;  5KFA A;  3M9O B;  1QLN A;  4KX3 A;  2HHQ A;  5L1K A;  3DDH A;  3AM9 A;  5J0R A;  3LWL A;  1T3Q A;  5G5G A;  3L4P A;  3D6J A;  2ISO A;  4DSK A;  1N56 A;  1JRP A;  3PW0 A;  4R65 A;  5D4B A;  4EX7 A;  4B9U A;  1ZQE A;  3RJI A;  2BR0 A;  4QZD A;  5AI8 A;  3QU2 A;  2XGP A;  5AKL A;  1LKY B;  2Y9T A;  5G5H A;  1SGG A;  2DBS A;  2I1Q A;  3C1Z A;  4O3Q A;  1NKC A;  4ICA A;  4F4Z A;  5KG5 A;  2OYY A;  2B21 A;  1LVH A;  3GV5 B;  3QUC A;  5B5E U;  3BJY A;  1J2N A;  1N48 A;  2YN4 A;  2EAM A;  1XU4 A;  4QWC A;  1PZN A;  2JR5 A;  5AM0 A;  2G09 A;  3QZ8 A;  2WFA A;  2GJW A;  3GU3 A;  4RNM A;  3BZC A;  4C80 A;  4US8 A;  2OHF A;  4RPX A;  3DEE A;  8ICO A;  2KJ5 A;  2Q0Z X;  3L3F X;  3TKA A;  3WKC A;  2YB1 A;  2ZUB A;  3CW2 C;  3ALR A;  2EAN A;  3MBY A;  1BNO A;  1NK4 A;  2OH2 A;  1ZD4 A;  4QBO A;  2G07 A;  1B22 A;  4XRH A;  3GQC A;  4LZD A;  1QCK A;  1URJ A;  3LDA A;  1HIW A;  3ISC A;  4RQ2 A;  4M04 A;  8ICI A;  4TUP A;  1IXR A;  5J2J A;  2FPM A;  3KHH A;  4ECU A;  3CP8 A;  3BS5 A;  1CUK A;  2QAR B;  4FZM A;  1TAQ A;  2GWS A;  4UAV A;  1L3V A;  1O08 A;  1X9S A;  1L3T A;  2BDP A;  2ZIX B;  3RTV A;  4TUS A;  2L5Y A;  2HSZ A;  4I2D A;  2K8B B;  3H8W A;  2BCQ A;  3NVY A;  2RHF A;  3U26 A;  5HMM A;  2FPK A;  5KFL A;  3AMZ A;  1KEJ A;  1OB8 A;  4ECR A;  5ALJ A;  2G08 A;  1MC8 A;  2EAO A;  5JU5 A;  3SQI A;  3IDW A;  5ALN A;  3LK9 A;  2A19 A;  2OCE A;  2YB4 A;  1V38 A;  2KSO B;  4RUC A;  3C2M A;  3FM9 A;  4RUA A;  5HR6 A;  3EUB 2;  3RBD A;  5GTH U;  3Q8L A;  3SAG A;  4UAS A;  1BPY A;  4M2Y A;  3IV6 A;  1RG6 A;  2XGQ A;  1OUQ A;  1L7M A;  4DO9 A;  2BCU A;  4Y2T A;  1KKX A;  2W8L A;  5J2H A;  4DFD A;  4OCZ A;  4G9B A;  4PGQ A;  1TK5 A;  2AGQ A;  5KT3 A;  4I2G A;  4YQW A;  4BWM A;  1SKR A;  2BQU A;  3BQ1 A;  1L8O A;  2IOH A;  2P6R A;  1TAU A;  4XA5 A;  2KZ3 A;  4QZI A;  2XCP A;  4YR3 A;  3P1Z A;  5CJ7 A;  4JV0 A;  1TVA A;  4J9P A;  2Y0S F;  1KFD A;  4RZR A;  2DGZ A;  3LVV A;  5ALK A;  9ICC A;  4UB5 A;  1UHU A;  4NLB A;  4Y2U A;  1ZRN A;  4MFF A;  3OJS A;  4UQG A;  5CA7 A;  4KLM A;  3LVW A;  3TAN A;  1RLV A;  3WK8 A;  2ZTE A;  4CF5 A;  8ICY A;  5J0S A;  4DF4 A;  4BGD A;  1XC9 A;  1FFU A;  4YG2 A;  3HIL A;  2JJQ A;  3EPI A;  4YVZ A;  1Z4N A;  3QU5 A;  2CRX A;  4OJL A;  4RNO A;  4I2A A;  2WF9 A;  4BJQ A;  3MR2 A;  3C2L A;  3MR3 A;  2JMG A;  4IS7 A;  1N5X A;  3IP4 B;  1Z3E B;  5IIK A;  3RJG A;  4CE6 A;  4DAP A;  1FO4 A;  2ZJ5 A;  3HJE A;  5EWE A;  1BPZ A;  4ELU A;  4QZF A;  3ETR A;  1ZQX A;  1WWU A;  3N28 A;  4KIT B;  3K1Z A;  1IG6 A;  4EEK A;  2OST A;  2OWO A;  5ALF A;  3JPN A;  1X6I A;  4PH5 A;  2FCO A;  2WB1 C;  7ICS A;  2K8C B;  2W03 A;  5D46 A;  2ZIV A;  1ZJN A;  5ALT A;  7ICF A;  4PHD A;  3NS1 A;  5KFM A;  1SV4 A;  4B9T A;  4O3S A;  7ICH A;  5DB9 A;  2KKV A;  1YT3 A;  3SAF A;  5DB7 A;  7ICT A;  3GFK B;  2P6U A;  4DQQ A;  3QNM A;  3BQT A;  1C20 A;  3OJU A;  4PGY A;  5AK3 A;  4DFP A;  7ICN A;  8ICS A;  4DOC A;  1KBU A;  4KLI A;  1J97 A;  5DGA A;  4UW9 A;  4EEL A;  2AQ4 A;  2CPR A;  2H3I A;  4TUQ A;  1PK1 B;  2LYA A;  3E0F A;  4C7Y A;  3THV A;  1BVS A;  2DF4 B;  1S0N A;  2R8I A;  2IMW P;  4B6J A;  3RB6 A;  2W7P A;  4CF4 A;  2LM4 A;  2B6G A;  2EH9 A;  2JXJ A;  2G0A A;  3UQ0 A;  5J0O A;  1S0V A;  1RQL A;  1ZQK A;  1UA1 A;  3QUQ A;  7ICR A;  3MR6 A;  3V6H A;  2KFZ A;  2OKF A;  1UT8 A;  3AJV B;  4IQU A;  4I2J A;  1N61 A;  3ZI4 A;  4ECQ A;  5HHI A;  2H5X A;  5KFK A;  2XVT A;  4UAY A;  3WK4 A;  3EZ5 A;  4M0A A;  4UAW A;  3HKZ C;  3UXP A;  2PI4 A;  2PMZ C;  2VJ5 A;  5KFI A;  2C2R A;  5DB8 A;  4YP3 A;  2G5H B;  1S0M A;  5ALL A;  1B43 A;  2BH2 A;  3PZP A;  2MUT B;  4GC7 A;  1ZOL A;  4EYI B;  2A1A A;  1V85 A;  4MF2 A;  3V7J A;  1ZQB A;  1TE2 A;  3HX0 A;  3M7D A;  5ALR A;  2FMS A;  5EE1 A;  4MHV A;  5ALH A;  2XCA A;  4GXJ A;  4ECZ A;  3T5H A;  4QW8 A;  3G6X A;  4UB6 U;  3NTU A;  3Q8R B;  2FKC A;  4LZG A;  4NLG A;  4P0Q A;  2E8O A;  5L9X A;  3TAD A;  2BPG A;  4YXJ A;  2E1F A;  2W43 A;  1UWV A;  1WCN A;  4NLZ A;  3HKZ F;  2VJ4 A;  1XNS A;  5D49 A;  1Z00 B;  3RH4 A;  5AM5 A;  2BCS A;  5HR7 A;  5FP0 A;  5GTI U;  2JV3 A;  2VLD A;  4ZH4 A;  4RQ4 A;  5KFU A;  4F92 B;  4DSL A;  4FS2 A;  3H0L B;  3JPS A;  1XMX A;  8ICB A;  3Q8S B;  3RFA A;  5AIA A;  7ICI A;  9ICP A;  1ZD5 A;  2BHN A;  1S5L U;  1X42 A;  3RJH A;  2DBY A;  3GDX A;  3UM9 A;  4JV1 A;  2JZB A;  4IRD A;  3OTQ A;  2HBM A;  3SEI A;  3ISB A;  1PK1 A;  3NVW A;  1SL1 A;  3MAB A;  8ICJ A;  2MA1 A;  3RJK A;  4KLH A;  2WIW A;  4ED6 A;  2FE9 A;  3PW2 A;  4TQS A;  2KN7 A;  2F3N A;  3RJE A;  2XI9 A;  4F4W A;  3I76 A;  4ED3 A;  5KTQ A;  1X66 A;  1DXS A;  2HHX A;  2K60 A;  2YQE A;  4YD1 A;  5KFN A;  3KKA A;  4JV2 A;  1TKD A;  4AP9 A;  9ICF A;  4HYK A;  5IIM A;  3GZF A;  3QUT A;  5T14 A;  5ALP A;  2AGP A;  3WKE A;  4Y2R A;  1O03 A;  3ZDC A;  3AQF A;  4QBN A;  1YZ7 A;  4F4Y A;  4KTQ A;  1HUZ A;  1Z1V A;  3MFI A;  3IF0 X;  4KLS A;  5CP2 A;  3BZK A;  4RQM A;  4EBD A;  1CI4 A;  4O3N A;  1ZP7 A;  2ZUD A;  2A1J B;  4Y2Y A;  3QYP A;  2KP7 A;  3O0F A;  1UQV A;  1JN3 A;  3MR5 A;  5KFR A;  3IM1 A;  3PW7 A;  2I5H A;  3ZDE A;  5CB1 A;  1S0O A;  2WHE A;  8ICH A;  3JPQ A;  5TZV A;  5TIS U;  2HHU A;  2KHV A;  4DS4 A;  1Y88 A;  8ICG A;  2E8P A;  3RB0 A;  2KEY A;  3R9K A;  1ZQJ A;  4K4H A;  5DG8 A;  4QZG A;  2PMZ F;  2M9N A;  1NJX A;  4Q43 A;  1KDH A;  4Y2X A;  5DBA A;  1C7Y A;  3PX6 A;  2F44 A;  2E3T A;  2ZJ8 A;  1ZQY A;  4JMU A;  4K4G A;  4YMN A;  4UAR A;  1NNL A;  3K1R B;  1D9F A;  4DSI A;  3LYS A;  2EZZ A;  4P0P A;  1JXE A;  5KAF U;  2BZF A;  4ELT A;  2RP5 A;  4LJX A;  5L1M A;  1ZET A;  4GXK A;  4EBE A;  2F77 X;  1MSW D;  4EEY A;  3RRH A;  4IR9 A;  2W9C B;  3NGD A;  4O3P A;  2PFQ A;  4KMO B;  7ICM A;  4PPX A;  2W3S A;  4RQ3 A;  3AL0 B;  3WK5 A;  3HWT A;  3ZDD A;  3VCB A;  4M47 A;  4X5V A;  4TKK A;  1Z4O A;  4IC9 A;  1SV0 C;  4DFJ A;  2IA6 A;  4YN4 A;  1IIP A;  1R11 A;  3D2S A;  2FLP A;  7ICE A;  4F5R A;  3OSP A;  4F72 A;  2IHM A;  5CWR A;  3GIJ A;  1DK3 A;  4CRX A;  3S6J A;  4Z6F A;  3KTQ A;  3N7P D;  2UVW A;  2KVC A;  1SIJ A;  1X9X A;  1SWV A;  1COO A;  3EPG A;  2FPL A;  2ZTD A;  4DL5 A;  1KLN A;  3TFS A;  1GEF A;  5KFG A;  3TAD C;  1NJW A;  5AM4 A;  2VA8 A;  3EWA A;  1ZXI A;  4ECT A;  4GLX A;  1TK0 A;  3H8M A;  2N1R A;  9ICM A;  2WIZ A;  5AIB A;  2LMR A;  2C28 A;  1N63 A;  1MN8 A;  1RZT A;  4QWD A;  1ZRM A;  3V6K A;  2LPE A;  1QSL A;  3IG8 A;  1U45 A;  4J9R A;  1PUZ A;  2WCZ A;  4UB3 A;  1JRO A;  2AU0 A;  2C2D A;  1ZYQ A;  5ALQ A;  4DEZ A;  1L8L A;  1WG8 A;  4J9M A;  2W3R A;  4CF3 A;  5B66 U;  2K4I A;  1NZB A;  4J9N A;  5AKG A;  8ICL A;  1Q8K A;  2K4P A;  3MGH A;  3QU4 A;  2J6S A;  1QQ5 A;  5AKI A;  2LI6 A;  4OJ6 A;  2E1E A;  2HHW A;  4A8E A;  5F9N A;  5DDM A;  1QSS A;  2ASL A;  4IQW A;  2DPI A;  2QKQ A;  3EW9 A;  2W9B A;  4QZB A;  3ZD8 A;  1DRG A;  4RT2 A;  1SKS A;  4ELV A;  4E6Z A;  4KLJ A;  4M9N A;  5FDK A;  3C5F A;  3ICX A;  1HH1 A;  3ZDB A;  4I2B A;  2LYH A;  5KG2 A;  4C7Z A;  2JH1 A;  3WKD A;  4QWA A;  1JX4 A;  2HVH A;  5J2K A;  3MGI A;  2M0N A;  2R8H A;  2KG5 A;  4TQR A;  5KFW A;  2F2A B;  5L1J A;  5KG7 A;  1XS9 D;  1Q46 A;  5AKY A;  1BGX T;  1L5U A;  2QB0 B;  1TFR A;  4RQN A;  1MQ2 A;  5C5J A;  2VKQ A;  3TAC B;  4C4S A;  1LKY A;  3IN5 A;  2JEJ A;  4FZL A;  4IL6 U;  1X9M A;  4MF8 A;  4UAU A;  4YMO A;  1NI3 A;  1NJY A;  4UB1 A;  3PX4 A; 
#chains in the Genus database with same CATH homology
 5DB9 A;  4ZQU A;  3LWM A;  3H7I A;  1ZQC A;  5DG7 A;  5DB7 A;  8ICF A;  7ICT A;  2XC9 A;  4C8O A;  3GFK B;  2P6U A;  3QZ7 A;  4DQQ A;  3N4M B;  2C2E A;  2FMQ A;  4R66 A;  3AU2 A;  4F93 B;  3BQT A;  2HVI A;  3BQ2 A;  2GW6 A;  1UT5 A;  3OJU A;  4PGY A;  1ZQV A;  4DFP A;  7ICN A;  4MFA A;  2V4Q A;  4I2E A;  8ICS A;  4EV1 A;  4DOC A;  3C2K A;  5DLF A;  4P4P A;  1NK0 A;  4KLI A;  2AQ0 A;  3JPR A;  5DGA A;  5KFC A;  4NLN A;  1V9P A;  2AQ4 A;  4J9K A;  1BPX A;  4TUQ A;  4F50 A;  1ARO P;  1L3U A;  1L3S A;  4DWI A;  9ICN A;  4KN7 A;  3IHQ B;  3UPQ A;  1NJZ A;  2JEG A;  2W9M A;  3THV A;  1BVS A;  4IQT A;  2UVU A;  4I29 A;  5KG4 A;  1Z00 A;  1S0N A;  2R8I A;  3V6J A;  2IMW P;  4Z6E A;  3RB3 A;  2W9A A;  2R8G A;  1T4G A;  4QW9 A;  3RB6 A;  3E2E A;  4EZ6 A;  4E0D A;  4UBB A;  4C8L A;  5KG1 A;  3UQ0 A;  5J0O A;  3N97 B;  1S0V A;  9ICU A;  4YFK A;  4BXO B;  2PFP A;  1WCL A;  4DFK A;  1ZQG A;  1ZQK A;  1UA1 A;  4LQE A;  4DA2 A;  4LVS A;  7ICR A;  3MR6 A;  4KLG A;  3BT7 A;  2F1H A;  3V6H A;  4P2H A;  2KFZ A;  2OKF A;  4J9Q A;  4O5C A;  3AUO A;  2PXI A;  1NKB A;  1UT8 A;  5KT2 A;  3AJV B;  4IQU A;  4I2J A;  1R0V A;  4ECQ A;  7ICL A;  1X9W A;  5J2F A;  3KHR A;  5HHI A;  2H5X A;  4QZC A;  5KFK A;  4UAY A;  3M9N B;  3EZ5 A;  4RT3 A;  4UAW A;  4M0A A;  5J0T A;  3UXP A;  3M8R A;  4ED0 A;  3SI8 A;  4UB2 A;  2XY7 A;  1ZQO A;  5J2A A;  4DSE A;  4I28 A;  2PI4 A;  3RR8 A;  1T7P A;  3OSN A;  5KFI A;  1S9F A;  2C2R A;  5DB8 A;  1JIH A;  5KFJ A;  4ED8 A;  2XY6 A;  9ICA A;  4YP3 A;  8ICC A;  9ICI A;  3AU6 A;  3GIL A;  2PI5 A;  1S0M A;  1HJP A;  1ZQW A;  1LV5 A;  4M9H A;  8ICN A;  1B43 A;  2BH2 A;  2MUT B;  2AJQ A;  1EXN A;  4GC7 A;  4DOB A;  4J9L A;  4EYI B;  3V72 A;  3RRG A;  4I2F A;  2CZR A;  1SL0 A;  4MF2 A;  4Q44 A;  3V7J A;  2RDJ A;  4ECY A;  4DOA A;  4KLT A;  1ZQB A;  3PML A;  3HX0 A;  1ZQA A;  3G6V A;  2HHS A;  4ED2 A;  3TAQ A;  7ICQ A;  1IM4 A;  3T5K A;  3C5G A;  2W8K A;  1ZQT A;  2FMS A;  4I27 A;  5DGB A;  1ZQQ A;  4QWB A;  1T0F A;  3B0Y A;  4M6W B;  3KHL A;  2P66 A;  1OB9 A;  4DAV A;  4ECZ A;  5KFD A;  4MEY A;  4RNN A;  4PHA A;  2XCA A;  4C8M A;  4GXJ A;  4FS1 A;  3T5H A;  5EWF A;  4YCX A;  4QW8 A;  3PO4 A;  3G6X A;  3MFH A;  2AGO A;  3NTU A;  4O0I A;  3Q8R B;  3Q8Q B;  8ICP A;  1HUO A;  1A79 A;  5HML A;  2FKC A;  4LZG A;  4NLG A;  2Z0R A;  2ZJA A;  5L9X A;  4F3O A;  9ICV A;  2NRT A;  4IRC A;  2BQR A;  4PGX A;  4F4X A;  2IBK A;  2BPG A;  4YXJ A;  2R8J A;  4RQ8 A;  4Z6C A;  1ZQL A;  4RQ5 A;  9ICW A;  1WCN A;  4NLZ A;  5KT6 A;  8ICQ A;  8ICX A;  1UWV A;  5KFE A;  4J9S A;  1ZQH A;  5D49 A;  2BPF A;  5KG3 A;  4DL7 A;  1Z00 B;  5CHG A;  3RH4 A;  1BPB A;  4KN4 A;  2BCS A;  4R8U B;  3Q8K A;  2FKH B;  9ICB A;  5DQG A;  4G3I A;  5KFF A;  3KHG A;  2IHN A;  2VLD A;  9ICL A;  4F8R A;  5HP4 A;  4ZH4 A;  3PX0 A;  4ECX A;  4RQ4 A;  5KFU A;  3DNX A;  1XWL A;  4F92 B;  3PMN A;  4DSL A;  4FS2 A;  4B9L A;  5J29 A;  1ZQF A;  3JPS A;  2UVV A;  4IR1 A;  4F5O A;  1XMX A;  8ICB A;  2FLN A;  3RR7 A;  3Q8S B;  2JEI A;  1KSP A;  1SKW A;  5KFB A;  1U9L A;  3K4G A;  7ICI A;  4KLU A;  9ICR A;  9ICP A;  2BHN A;  9ICE A;  2INB A;  4O3O A;  3TAR A;  9ICT A;  2NRZ A;  2XO7 A;  4G6V A;  2V4R A;  3RJH A;  3SZ2 A;  4DF8 A;  4UAZ A;  4RU9 A;  3H8S A;  3GDX A;  3BQ0 A;  5IIL A;  4GXI A;  1KRP A;  4JV1 A;  2JZB A;  4IRD A;  4NXZ A;  5KFQ A;  3HT3 A;  7ICJ A;  7ICH A;  2EO0 A;  5DLG A;  4RQ1 A;  1D9D A;  2IXS A;  4I2I A;  5KT4 A;  3ISB A;  1NK5 A;  2R8K A;  1SL1 A;  4F2S A;  3MAB A;  3IEY A;  3GIK A;  5JUM A;  4B9N A;  5CR0 A;  3PNC A;  8ICJ A;  5DG9 A;  3HW8 A;  8ICT A;  5DKW A;  2NRX A;  5KFA A;  3M9O B;  1DGS A;  3RJK A;  4KLH A;  2WIW A;  4TUR A;  4XUS A;  4ED6 A;  3PW2 A;  1KFS A;  2HHT A;  1QLN A;  1U48 A;  4TQS A;  2KN7 A;  3K75 D;  3QE9 Y;  2BCR A;  4I2C A;  5J0Q A;  2HHQ A;  1RZN A;  1ZQD A;  4C8N A;  5L1K A;  3RJE A;  8ICA A;  1ZQR A;  5J0R A;  3LWL A;  1QSY A;  2KTQ A;  5KT7 A;  2ISO A;  4F4W A;  4DSK A;  4ED3 A;  5KTQ A;  2WTF A;  1N56 A;  2HHX A;  2ASD A;  3PW0 A;  4QZA A;  4YD1 A;  4R65 A;  3FDS A;  5KFN A;  3RAX A;  1RYR A;  5KT5 A;  1NK6 A;  4JWM A;  4JV2 A;  5HNK A;  5D4B A;  1TKD A;  9ICF A;  4HYK A;  1T8E A;  5KFS A;  1ZQE A;  3ZD9 A;  2UVR A;  4B9U A;  1A76 A;  1H38 A;  3RJI A;  5IIM A;  2BR0 A;  4QZD A;  3T3F A;  2XGP A;  4NLK A;  1TK8 A;  2AGP A;  4Q8F A;  3ZDC A;  4R8U A;  4QBN A;  1CEZ A;  4F4Y A;  4KTQ A;  3B0X A;  1HUZ A;  4KLF A;  3RJJ A;  4RPZ A;  4P4M A;  8ICE A;  2KZM A;  2DBS A;  2I1Q A;  3C1Z A;  4QZ9 A;  5CP2 A;  5J0Y A;  3MFI A;  4KLS A;  4O3Q A;  7ICO A;  3IF0 X;  4EBD A;  1NKC A;  4O3N A;  4DQR A;  1ZP7 A;  2ZUD A;  4F4Z A;  2A1J B;  2WCW A;  4C8K A;  5KG5 A;  4UB4 A;  1ZQP A;  9ICS A;  2B21 A;  4BDP A;  4Q8E A;  1RXV A;  2V9W A;  4F2R A;  4Z6D A;  1JN3 A;  3MR5 A;  3GV5 B;  4M9G A;  3PO5 A;  8ICU A;  1ZQU A;  5BOL A;  5KFR A;  3PR4 A;  5DBC A;  3BJY A;  3IM1 A;  4EBC A;  1KFT A;  3PW7 A;  1N48 A;  3SV3 A;  5J2B A;  3TAP A;  3ZDE A;  1SZP A;  1RPL A;  5CB1 A;  1S0O A;  4F4K A;  2I9G A;  1XU4 A;  4QWC A;  3JPQ A;  1PZN A;  8ICH A;  5TZV A;  2PFO A;  2BCV A;  3V7L A;  4IRK A;  4DLE A;  3RH6 A;  2HHU A;  4QBL A;  4JWN A;  1A77 A;  4QZE A;  3QZ8 A;  4ECS A;  4DS4 A;  1Y88 A;  4DL2 A;  8ICG A;  5IIN A;  3RB0 A;  2GJW A;  1ZQJ A;  3C1Y A;  4K4H A;  5DG8 A;  2ALZ A;  4QZG A;  4RNM A;  3TQ1 A;  3P1Z B;  4DQP A;  2M9N A;  1NJX A;  3G6Y A;  4NM2 A;  4Q43 A;  2WJ0 A;  1KDH A;  4RPX A;  5DBA A;  1BPD A;  1C7Y A;  4JUZ A;  4PHE A;  3M8S A;  3GV7 B;  8ICO A;  2Q0Z X;  3AJV A;  3PX6 A;  5HHH A;  1D8Y A;  2ZUB A;  4O9M A;  1S97 A;  2FMP A;  3ZDA A;  9ICH A;  2ZJ8 A;  3Q8P B;  1ZQY A;  3MBY A;  5DQI A;  4K4G A;  4YMN A;  4RQ0 A;  4R64 A;  2KFN A;  3BDP A;  5IIJ A;  4O3R A;  1NK4 A;  4ECW A;  1JXL A;  4QBO A;  5F9L A;  1D9F A;  3C23 A;  1ZQN A;  4DSI A;  1B22 A;  4XRH A;  4IQV A;  3GQC A;  4LZD A;  4MFC A;  3LDA A;  5DQH A;  4ECV A;  3ISC A;  9ICX A;  1JXE A;  4ED7 A;  3PW5 A;  2VA2 A;  3UXN A;  4RQ2 A;  4M04 A;  4F5P A;  4O3S A;  7ICU A;  4KLO A;  8ICI A;  4TUP A;  3HPO A;  3T5L A;  4ELT A;  1IXR A;  1ZET A;  5J2J A;  2FPM A;  4GXK A;  3PVX A;  3KHH A;  4ECU A;  3RAQ A;  1CUK A;  4EBE A;  5IIO A;  5L1I A;  1TAQ A;  4DFM A;  2GWS A;  1QTM A;  2BPC A;  4DL6 A;  1L3V A;  3Q8M A;  2Y1I A;  1X9S A;  1L3T A;  2BDP A;  4EEY A;  3RRH A;  2XY5 A;  3RB4 A;  1U49 A;  4IR9 A;  1ZQZ A;  3RTV A;  2DFL A;  2W9C B;  3NGD A;  4O3P A;  4KLD A;  2PFQ A;  4TUS A;  4I2D A;  5J0U A;  3H8W A;  3JPO A;  4PHP A;  2BCQ A;  2W9C A;  2F1J A;  2JEF A;  3RH5 A;  2J6U A;  7ICM A;  3V7K A;  1ZQS A;  3QEB Z;  3M9M B;  4PPX A;  4RQ3 A;  1RYS A;  3ZDD A;  3HWT A;  1X2I A;  5HMM A;  3FYH A;  2FPK A;  4M47 A;  1RXW A;  4X5V A;  2ZYZ B;  4M9J A;  2DPJ A;  2ASJ A;  3T5J A;  4TKK A;  4P4O A;  5BPC A;  5KFL A;  4YMM A;  1UA0 A;  7ICG A;  1KEJ A;  1NOM A;  1OB8 A;  8ICR A;  2VA3 A;  4ECR A;  2W8M A;  4R63 A;  1MC8 A;  1MSW D;  4DFJ A;  4B9S A;  2IA6 A;  4XQ8 A;  5KFP A;  4YN4 A;  1D8L A;  3LK9 A;  5J2D A;  2BKE A;  3RBE A;  4JK1 A;  1U47 A;  1S76 D;  1R11 A;  4RUC A;  2FLP A;  4NM1 A;  4F5R A;  3OSP A;  1MQ3 A;  3PY8 A;  2IHM A;  7ICE A;  8ICZ A;  3IEY B;  1XSL A;  1NKE A;  4YXM A;  1S77 D;  3C2M A;  5CWR A;  3GIJ A;  2FLC A;  3TFR A;  5DDY A;  1LB2 B;  4RUA A;  5J0P A;  4Z6F A;  4UBC A;  4ED1 A;  3RBD A;  3KTQ A;  4B9V A;  4KMU A;  2KZZ A;  1IPI A;  3Q8L A;  2ZUC A;  1BPY A;  3JPT A;  4QZ8 A;  3PV8 A;  2PFN A;  2UVW A;  4M2Y A;  4I2H A;  1F1Z A;  3P1Y A;  2C22 A;  2XGQ A;  2VAN A;  4DO9 A;  4TKD A;  1COO A;  3EPG A;  4G6U A;  2FPL A;  1K1S A;  2BCU A;  2ZYZ A;  2ZTD A;  2W8L A;  4DL5 A;  5III A;  5J2H A;  1NK9 A;  1KLN A;  4DS5 A;  3TFS A;  5KFG A;  2W9B B;  4FBU A;  1GEF A;  1NJW A;  2RDI A;  2HHV A;  9ICQ A;  4PGQ A;  5KFX A;  4BWJ A;  1TK5 A;  2AGQ A;  4DQI A;  9ICJ A;  8ICK A;  5KT3 A;  4I2G A;  4YQW A;  2VA8 A;  3EWA A;  4RQ7 A;  4BWM A;  1SKR A;  4ECT A;  2BQU A;  5EOZ A;  4GLX A;  4DLG A;  3OGU A;  3BQ1 A;  1TK0 A;  4MEX A;  5KG6 A;  9ICM A;  2WIZ A;  3ISD A;  2C28 A;  1ZQM A;  8ICW A;  1RZT A;  2P6R A;  1TAU A;  5J2E A;  4QWD A;  3ETL A;  4XA5 A;  4KLL A;  3V6K A;  4DQS A;  3GIM A;  1XSN A;  1QSL A;  2KZ3 A;  4QZI A;  3C21 A;  2XCP A;  2ATL A;  4YR3 A;  4DSF A;  1U45 A;  3P1Z A;  5CJ7 A;  5J2I A;  1NK8 A;  4JV0 A;  4J9R A;  5DB6 A;  2WCZ A;  1TVA A;  4J9P A;  4F5Q A;  4UB3 A;  1KFD A;  4RZR A;  4YR0 A;  1BPE A;  9ICK A;  2C2D A;  2AU0 A;  2BGW A;  2FL3 A;  1T3N A;  1ZYQ A;  9ICC A;  1YNM A;  9ICG A;  1XSP A;  4UB5 A;  3FOV A;  4DEZ A;  4YD2 A;  3TI0 A;  4MFF A;  3UXO A;  3OJS A;  3HP6 A;  1KTQ A;  4UQG A;  1XO1 A;  5CA7 A;  4J9M A;  1ZJM A;  4KLM A;  3TAN A;  5KFH A;  5L1L A;  7ICK A;  1RLV A;  2VS1 A;  2ZTE A;  5KFY A;  8ICY A;  8ICM A;  5KFV A;  5J0X A;  5J0S A;  4J9N A;  4DF4 A;  4BGD A;  4F91 B;  1XC9 A;  1DOQ A;  4B9M A;  8ICL A;  4YG2 A;  3MDC A;  3MGH A;  4FBT A;  3MDA A;  4O5E A;  2JJQ A;  2J6S A;  3EPI A;  9ICO A;  3H8J A;  4YVZ A;  5BOM A;  1U4B A;  3H4D A;  2A1J A;  3ORY A;  4M6W A;  1K1Q A;  3SV4 A;  4RNO A;  4I2A A;  2Y1J A;  5EWG A;  4RPY A;  2HHW A;  5KFO A;  3MR2 A;  4Q45 A;  4RQ6 A;  3EYZ A;  3C2L A;  5F9N A;  5DDM A;  3MR3 A;  4O5K A;  1QSS A;  4DSJ A;  2ASL A;  3OHB A;  4IQW A;  3GII A;  1S10 A;  2DPI A;  7ICP A;  5J2G A;  4F5N A;  3EW9 A;  2W9B A;  2MUT A;  4QZB A;  1Z3E B;  3ZD8 A;  5IIK A;  4RT2 A;  3UQ2 A;  5KFT A;  3RJG A;  1SKS A;  4ELV A;  4EZ9 A;  4KLJ A;  8ICV A;  3H40 A;  4E6Z A;  3RJF A;  4DAP A;  4M9N A;  2ZJ5 A;  2FLL A;  5FDK A;  3C5F A;  3JPP A;  5EWE A;  2NRV A;  3SYZ A;  1HH1 A;  4BXO A;  3ZDB A;  1BPZ A;  2LYH A;  2ISP A;  4I2B A;  4ELU A;  5KG2 A;  4QZF A;  2JZB B;  4GC6 A;  2HVH A;  4QWA A;  1JX4 A;  5J2K A;  1ZQX A;  3MGI A;  5J2C A;  4KIT B;  4DL3 A;  4KLQ A;  1TV9 A;  2R8H A;  7ICV A;  2OST A;  4FO6 A;  4TQR A;  2ZTC A;  5KFW A;  4J9O A;  1ZQI A;  2OWO A;  5L1J A;  1JMS A;  5KG7 A;  1XS9 D;  1BGX T;  1L5U A;  2HW3 A;  3PR5 B;  4K4I A;  1TFR A;  5KFZ A;  4QWE A;  5DBB A;  3JPN A;  4CCH A;  4KLE A;  2NRW A;  4PH5 A;  2FCO A;  1MQ2 A;  7ICS A;  2J6T A;  3GV8 B;  5C5J A;  5KG0 A;  1NK7 A;  2BQ3 A;  2JEJ A;  5D46 A;  4DL4 A;  2CV8 A;  2F1I A;  1ZJN A;  3OHA A;  4EYH B;  4QZH A;  7ICF A;  4PHD A;  1SL2 A;  1X9M A;  4NY8 A;  4MF8 A;  5J0W A;  3H4B A;  3PW4 A;  4YMO A;  5KFM A;  2MAX A;  1NJY A;  4M9L A;  3QEA Z;  1Y1O A;  4B9T A;  4YR2 A;  4UB1 A;  3PX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...