1Y88A

Crystal structure of protein of unknown function af1548
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
184
structure length
184
Chain Sequence
NLYFQGHMVARLLEEHGFETKTNVIVQGNCVEQEIDVVAERDGERYMIECKFHNIPVYTGLKEAMYTYARFLDVEKHGFTQPWIFTNTKFSEEAKKYAGCVGIKLTGWSYPEKEGIEVLLESKGLYPITILRIDKEVLDELVRAGLVFCRDVVSAGEEKLREIGLSAKKAREVIAEAKKVIGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of hypothetical protein AF1548 from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AF1548
total genus 59
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2004-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1y88A02
3.40.1350.10 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 1y88A01
1IPIA 8ICJA 2AQ0A 3M9NB 2ZUCA 4UB4A 3PX0A 1X9SA 1HJPA 5D49A 9ICEA 4KLTA 4R66A 4LZDA 4QZCA 4F91B 5DLGA 1BPXA 9ICOA 1NKEA 4F4XA 3RJFA 3SV3A 5EWGA 4O9MA 5L1KA 4YVZA 1HH1A 4EZ6A 5KFBA 3BJYA 4F4WA 4FO6A 4DFPA 2V4RA 1ZQQA 3Q8SB 2BPGA 3QEAZ 5KFPA 9ICKA 2JZBB 7ICJA 5CB1A 5IILA 1EXNA 5DBAA 4F4ZA 3RAXA 4MF8A 4XA5A 3P1YA 3EPIA 4YCXA 4DSFA 5KFJA 1NJZA 4F50A 1HUOA 3LWLA 8ICZA 4TKKA 2V4QA 4R65A 4M9LA 3JPOA 1BGXT 1ZQLA 9ICPA 1R0VA 4G3IA 1U48A 4FBUA 5J0WA 8ICYA 4M9GA 1ZQHA 4B9SA 4O5EA 3FOVA 2IHMA 4I2EA 3MDCA 5KG1A 5BOMA 5KFAA 3BQ0A 2W9BB 4M0AA 3C2MA 2WCWA 2ZUDA 4C8MA 4ECYA 2A1JA 4QZDA 4RPZA 1JIHA 3GILA 1LV5A 4ELUA 2KN7A 4I2FA 2DFLA 9ICUA 3C2KA 3RH4A 2BGWA 3RJIA 1SZPA 4JV2A 3LDAA 3HP6A 4NY8A 2HVHA 1TAQA 4QWEA 1S0VA 1S0MA 4GC7A 3H4DA 2BCUA 1ZQWA 3JPRA 4HYKA 8ICAA 4ECUA 4KLUA 1NOMA 1NK7A 2C2EA 4QWAA 2EO0A 2OWOA 3V7KA 3RH6A 3TAPA 9ICBA 5DQHA 4JK1A 4XQ8A 4YP3A 1XSPA 8ICMA 3Q8MA 5JUMA 3Q8QB 4PGXA 5KFSA 2NRVA 4Z6EA 5KFNA 5J2AA 2MUTA 5KG4A 3FDSA 3TANA 1CEZA 4NLZA 4QWBA 1TVAA 2LYHA 2PFQA 1KEJA 3QE9Y 2ZJ8A 2BCQA 2HHXA 5EOZA 3EW9A 2C2RA 5KG0A 4B9UA 2JEJA 5KT7A 1MC8A 1SL2A 4F4KA 4JWNA 3SYZA 2FLPA 5KFTA 3UPQA 2BQUA 2R8KA 4X5VA 1CUKA 1V9PA 3C1YA 3Q8RB 3T5JA 2AJQA 1S9FA 4RNNA 1L3TA 9ICRA 1Z00A 4YXJA 3RBEA 2ZYZB 5TZVA 3RR7A 1R11A 3C2LA 5KT2A 4DLGA 8ICFA 3H7IA 1T7PA 3ZDEA 5EWEA 3V6KA 3JPPA 4XUSA 5J2BA 4DSLA 8ICXA 3PW7A 4XRHA 2WIWA 4I27A 1K1QA 4QBNA 2J6TA 4YD1A 4C8KA 7ICVA 1S10A 4GXJA 3ZD9A 4IRCA 1WCNA 4YR2A 5KT6A 4F2SA 3GV5B 4ECZA 4C8LA 4F3OA 2INBA 3KHLA 4R8UB 1ZJMA 5KG2A 3PMNA 3PW0A 4B9LA 4TURA 4O3NA 2ALZA 1TK5A 3Q8PB 3PW2A 5CWRA 1ZQNA 2BDPA 5KTQA 2W9CB 4I2GA 2FMPA 5KFFA 2BR0A 2NRWA 4Z6DA 4RT2A 9ICCA 3RR8A 4J9QA 7ICNA 1IM4A 1ZQFA 4QBLA 7ICOA 1SL0A 4I28A 4YG2A 3BQ1A 2W9BA 4UB5A 3RAQA 3RB6A 4UB2A 4NM2A 9ICJA 1JMSA 3TAQA 2UVUA 1JN3A 2ZTEA 7ICQA 1A76A 3KHGA 4NLGA 4EBDA 5KFMA 4QZAA 4RZRA 1ZQZA 1X9WA 4KN4A 5F9NA 7ICMA 2HW3A 8ICNA 4UQGA 4ECSA 1ZQJA 2OSTA 1TFRA 4K4GA 5KG5A 3T5KA 5L1JA 3RRGA 1XSLA 3M9OB 1U45A 8ICKA 8ICWA 5D46A 2RDJA 4DFKA 2C2DA 4GLXA 1XS9D 1ZQEA 3T5LA 1L3VA 2PI5A 3BQ2A 4DS4A 4EYIB 1UA0A 5DLFA 1C7YA 4MF2A 5KFCA 4F92B 4K4HA 4KLHA 4Q43A 4RUAA 3T3FA 8ICCA 2UVRA 4DS5A 4Z6FA 3OSPA 4DL7A 8ICTA 1MQ3A 4UAZA 5J0QA 5CA7A 1K1SA 1NJYA 7ICIA 4EBCA 2XGQA 3GIMA 1KFDA 1UT5A 3G6XA 1D8LA 8ICHA 2J6SA 4I2AA 4ECQA 8ICIA 3M8RA 2IHNA 3ZDBA 5J2EA 3IHQB 5J2JA 3PMLA 4DSEA 4PHPA 2ZJAA 2HHTA 4RQ8A 2KZ3A 4O5CA 3QZ7A 7ICEA 2F1JA 4NXZA 3AUOA 1SKRA 4ED2A 1SL1A 1U9LA 2FPMA 4PH5A 4F5OA 1XMXA 5J0YA 1BPBA 3AU6A 3C5GA 4DSIA 4RQ2A 1JXEA 2ZTCA 2PXIA 2H5XA 5J0OA 5IIMA 3PO5A 4FS1A 4KLEA 1QLNA 2UVVA 4UBBA 3UQ2A 1ZQAA 2FMSA 4ECTA 1ZQPA 4M2YA 2BCSA 2BKEA 4NM1A 4TKDA 2HHVA 2Q0ZX 3PVXA 5DGBA 4ECWA 1WCLA 3C21A 2JEFA 3RB4A 1RZTA 3RH5A 9ICSA 4MFAA 1F1ZA 3H8JA 3RTVA 2HHQA 4UB1A 2R8IA 1T4GA 4F5PA 4KN7A 2XGPA 4PHEA 3UQ0A 4PPXA 5L1LA 4ECRA 2BPFA 4Q8EA 3EWAA 8ICPA 4KLJA 3KTQA 4TUPA 4RQ1A 1ZQIA 3MFHA 4M6WB 1Z3EB 3MR3A 4NLNA 4O5KA 4DL3A 3V6HA 3RBDA 3TFSA 5KFDA 4B9TA 8ICUA 4F8RA 4CCHA 3PR5B 3B0YA 4IQTA 3AU2A 2F1IA 5KFGA 1MQ2A 4ELTA 4ED6A 7ICPA 1JX4A 4RNMA 4YR3A 1NK9A 3HW8A 3EPGA 4RPXA 4IQVA 5J2IA 9ICAA 1LB2B 4YFKA 1ZETA 4QWCA 3TI0A 3NTUA 1KDHA 4GXKA 2FMQA 2KTQA 4DOAA 3E2EA 4YMMA 4YMNA 1RXWA 3RJJA 2JEIA 2GJWA 2GW6A 1KFTA 2IA6A 4Z6CA 4KLLA 1SKSA 1OB9A 4J9NA 7ICKA 4QWDA 2B21A 2BCRA 1ZQYA 4P4OA 4MEXA 4KLMA 2XO7A 4FS2A 4IQUA 4BWMA 5KFXA 4F93B 5J0RA 2FPKA 5DB9A 4DL2A 3OJUA 4ED0A 4DFMA 2FLNA 8ICBA 2XY6A 1DOQA 1L3UA 4KLOA 3AJVA 5DGAA 2NRZA 4TUQA 9ICQA 1ZQTA 2MAXA 5J0SA 4C8OA 4J9RA 5KFEA 5J0UA 1TKDA 3V7LA 4O3QA 4QZGA 1RZNA 5KFZA 4RT3A 3C5FA 5DQIA 7ICFA 3GIJA 2I1QA 1S76D 5BOLA 1QSLA 1AROP 4PGQA 4P4PA 2BPCA 2FLLA 4RQ7A 2W9AA 4J9PA 1S0NA 4ED3A 5DDYA 3UXNA 2XC9A 4IRKA 1Z00B 1ZQSA 4MFCA 5IIJA 5KFRA 3LWMA 1NK8A 1S97A 4MEYA 2AQ4A 4JV1A 2HHUA 9ICVA 3ETLA 2P6UA 4RPYA 3MBYA 5CP2A 4RQ6A 4QZ9A 3RJGA 2Y1IA 4QZHA 2VANA 2ASLA 1H38A 2IBKA 4I2CA 3T5HA 2UVWA 3V6JA 4B9VA 3PX6A 1RYRA 5HHIA 4F4YA 1IXRA 2NRXA 2R8HA 4R63A 3SZ2A 4FBTA 5IIOA 4M04A 4EBEA 3FYHA 2KFZA 3JPNA 4DQPA 1ZQVA 4QW9A 3KHHA 7ICSA 4R64A 3RJEA 4P4MA 4M47A 3PNCA 5J2GA 5DB6A 1ZQBA 4IR9A 3V72A 2AGPA 3GFKB 4DL5A 8ICRA 2PI4A 3THVA 4JUZA 5DQGA 1D8YA 3GIKA 2KZZA 3GV8B 1JXLA 4YQWA 3H8WA 3OSNA 4F2RA 2V9WA 2ZJ5A 4ECXA 1NK6A 4UAYA 3M8SA 2PFNA 3DNXA 3ZDDA 4ZH4A 1BPZA 1BPEA 5HP4A 2P6RA 5KFWA 4YXMA 1Y1OA 4O3PA 1L5UA 1U49A 5KG7A 1HUZA 3PW5A 1BPDA 3ISBA 4DQIA 4PHAA 2XY7A 4ELVA 3OHAA 4KLQA 1D9DA 1T0FA 4IR1A 4EEYA 2C22A 5HNKA 3LK9A 2IMWP 5HMLA 4RQ5A 2VA2A 3PV8A 3PX4A 4YD2A 5IINA 4YR0A 4Q44A 3K4GA 9ICGA 7ICHA 4R8UA 3RB0A 1ZQXA 1ZP7A 3H4BA 4DLEA 4RQ3A 1UA1A 1S77D 1ZQCA 5J2HA 4DL4A 1BVSA 2KFNA 5DG7A 5KFIA 3QEBZ 3ZDAA 2W9CA 4KTQA 5DB7A 3KHRA 3GV7B 1COOA 2PFPA 3P1ZB 4DL6A 3PY8A 1NK0A 4DO9A 5J2DA 4QZFA 4I2IA 5HHHA 3JPTA 1QSSA 2R8JA 4BXOA 3OJSA 3SV4A 8ICOA 4YMOA 3GQCA 2RDIA 3TARA 7ICGA 4ED1A 4TQSA 2VA8A 8ICEA 3PO4A 4B9NA 2MUTB 4O3SA 3ZDCA 5CR0A 3M9MB 4F5NA 1XC9A 2XY5A 1GEFA 5KG3A 4Q45A 1N48A 2ASJA 4DSKA 9ICXA 4QBOA 1SKWA 3QZ8A 1B22A 3MGIA 3JPSA 2VA3A 4KLIA 5KFHA 3JPQA 5HMMA 2I9GA 4IQWA 4RUCA 4RQ4A 2R8GA 1MSWD 3BDPA 9ICWA 4QZEA 2WTFA 1QTMA 7ICLA 2JZBA 2JEGA 1ZQUA 5EWFA 1D9FA 3G6VA 1NK5A 4DQRA 1U4BA 9ICTA 5C5JA 3SI8A 1NK4A 4JWMA 4BGDA 2W8KA 8ICLA 4O3RA 4ED8A 9ICIA 3H8SA 2ASDA 1ZQMA 1A77A 3PW4A 1QSYA 3RJHA 9ICLA 2XCPA 4QW8A 4PHDA 3RB3A 4ECVA 3AJVB 2GWSA 1NJWA 1RYSA 1BPYA 4J9KA 4GXIA 1KFSA 4RQ0A 2C28A 1U47A 1N56A 1KRPA 2WJ0A 4QZ8A 1RLVA 3H40A 1ZJNA 4DF4A 3TQ1A 4BWJA 4UAWA 4E0DA 4DSJA 2ZUBA 9ICMA 1OB8A 4EYHB 3C23A 4QZIA 1S0OA 4J9LA 3Q8KA 5KFKA 3N4MB 2ATLA 4F5RA 3EZ5A 4I2JA 5DBCA 4J9SA 2BCVA 3MABA 4PGYA 1UT8A 4UB3A 4M9JA 9ICFA 1NJXA 1L3SA 2M9NA 2ZTDA 3MR2A 3TFRA 7ICTA 1RPLA 3OHBA 3EYZA 4O3OA 2VLDA 1ZQOA 4I2HA 5DBBA 5DB8A 2FCOA 3GIIA 5CJ7A 4K4IA 1T8EA 5L9XA 5L1IA 2HVIA 4JV0A 1X9MA 2WCZA 3IEYA 1XWLA 4DFJA 1ZYQA 4DEZA 5DKWA 2AU0A 4KMUA 2DPIA 1A79A 3BQTA 4DF8A 2P66A 3PR4A 3IM1A 1XU4A 2WIZA 3UXOA 4KLFA 1X2IA 4IRDA 1B43A 3N97B 2HHWA 4KITB 7ICUA 3MR5A 4I2DA 5DDMA 1TAUA 4GC6A 4P2HA 2CV8A 5J2KA 1DGSA 3ORYA 4M6WA 5CHGA 4QZBA 2DPJA 3ZD8A 3MDAA 4Q8FA 4RU9A 9ICHA 4O0IA 5KFQA 3MGHA 5KT5A 3MR6A 3HWTA 4DOBA 4DQSA 2W8LA 3RJKA 3MFIA 2FPLA 3ISCA 3P1ZA 7ICRA 5KT4A 1T3NA 5KFOA 1ZQGA 1TK8A 3GDXA 1ZQKA 2AGQA 1NKCA 3NGDA 4DOCA 4I2BA 5BPCA 8ICVA 8ICGA 3B0XA 5F9LA 1XSNA 4M9HA 2A1JB 4DWIA 3G6YA 4I29A 1TV9A 2XCAA 5KT3A 1KLNA 2ZYZA 3OGUA 2OKFA 5J2CA 3Q8LA 2BQ3A 4J9OA 4EZ9A 1ZQDA 2J6UA 4M9NA 5IIIA 4BDPA 4MFFA 4KLDA 1ZQRA 4B9MA 4LVSA 5J0PA 3UXPA 9ICNA 5KG6A 2PFOA 5J0XA 2HHSA 2ISOA 3HT3A 2KZMA 5DG9A 4YN4A 4C8NA 3HX0A 3V7JA 5KFLA 4RNOA 1PZNA 4UBCA 5KFYA 3ISDA 2W9MA 2F1HA 1TK0A 4DQQA 2BQRA 3HPOA 4ED7A 5J29A 2NRTA 4KLSA 5FDKA 2BHNA 1KTQA 3C1ZA 5DG8A 5J0TA 5KFVA 4TUSA 2AGOA 1NKBA 1KSPA 1XO1A 2Y1JA 5D4BA 4LZGA 2ISPA 3K75D 4KLGA 8ICQA 3RRHA 5IIKA 1RXVA 5KFUA 4TQRA 5J2FA 4J9MA 4F5QA 4BXOB 8ICSA 1Y88A 4NLKA
chains in the Genus database with same CATH superfamily
2FJ6A 2KK0A 2HBMA 2K8CB 5D49A 9ICEA 4QZCA 1BPXA 2KJ5A 3OPXA 5L1KA 2GH1A 2XVTA 5KNIA 3K1ZA 4DFPA 4Y2JA 2DGZA 3QNMA 3LYSA 2IOHA 5CB1A 4C80A 4MF8A 2KVSA 3EPIA 1NJZA 3LWLA 2D8CA 8ICZA 4TKKA 3BQ7A 4G3IA 1PK1B 5J0WA 1ZQHA 4O5EA 2EAMA 3IF0X 2K4PA 2NO5A 4ECYA 2A1JA 4RPZA 3GILA 2DFLA 3RH4A 4JV2A 3LDAA 2F8LA 3HP6A 4NY8A 5H2FU 2ZIXB 1NOMA 2C2EA 2DWQA 2ZIUA 3TAPA 4NLBA 1ZRMA 4Z6EA 5KFNA 5J2AA 2MUTA 5KG4A 3TANA 3D2SA 5AKZA 2ZJ8A 4B9UA 5KG0A 2JEJA 1SL2A 4F4KA 5KFTA 3I1YA 2R8KA 3Q8RB 4PJ0U 3NVZA 2F77X 5AM0A 1S9FA 9ICRA 1Z00A 2LM4A 2ZYZB 5TZVA 2G07A 3RR7A 3C2LA 8ICFA 3ZDEA 3V6KA 4DSLA 4DA2A 4DAVA 4I27A 1Q3VA 4GXJA 1WCNA 4OJ6A 4ECZA 4F3OA 2GLEA 1QH9A 1N5WA 4F71A 4R8UB 2E8NA 1SZHA 2ALZA 4UB8U 5KTQA 2W9CB 4NV0A 2FMPA 2BR0A 9ICCA 2FKCA 3KFUF 1RG6A 7ICNA 2W03A 4BUGA 2WHEA 1SL0A 2KOBA 3BQ1A 5AKKA 4UB5A 9ICJA 1JN3A 3U26A 5KFMA 4QZAA 4RZRA 7ICMA 3NVYA 1ZQJA 2OXOA 5L1JA 1XSLA 4DFKA 2C2DA 3T5LA 1L3VA 3BQ2A 4EYIB 3RFAA 4MF2A 4NWIA 4K4HA 4KLHA 3OSPA 8ICTA 1NJYA 1K1SA 4EBCA 2XGQA 1Z1VA 4ECQA 8ICIA 1KN5A 3M8RA 1N60A 1A0PA 2LYAA 7ICEA 1UPHA 1JI7A 2F1JA 4E6ZA 5FP0A 2WF5A 1U9LA 4DCCA 1FO4A 4F5OA 3AU6A 5J0YA 4PL2A 2PXIA 1J97A 1ZQAA 4NM1A 2Q0ZX 3PVXA 1SV0C 5DGBA 4ECWA 9ICSA 3H8JA 4PPXA 4PHEA 3EWAA 2Z7JA 1N62A 3KTQA 5AKYA 2DF4B 4RQ1A 2WF9A 3NASA 4B9TA 2KV2A 3PR5B 5ALFA 1Q3UA 3B0YA 2W11A 2F1IA 1LKYA 5AM1A 5AK3A 4RPXA 9ICAA 3QXGA 1LB2B 1TE2A 4YFKA 4YMMA 2GW6A 1ZD3A 3QUCA 1SKSA 1UWVA 4J9NA 2B21A 2BCRA 4MEXA 2XO7A 5KFXA 4F93B 5J0RA 1WYGA 3OJUA 8ICBA 3AJVA 2NRZA 1ZQTA 5J0UA 2XI9A 4KX5A 5KFZA 4RT3A 3HRDD 5DQIA 4P4PA 3H0MB 2BPCA 1ZQSA 4MFCA 1NK8A 3SAFA 9ICVA 4QJFB 1DK3A 2P6UA 3MBYA 5CP2A 4RQ6A 2GOLA 2VANA 2ASLA 4I2CA 1URJA 2YMQA 1XNSA 2W3RA 1V85A 4R63A 4EBEA 3FYHA 3KHHA 2B6GA 5AKJA 4IR9A 3V72A 2PMZC 8ICRA 2CN1A 5AKLA 4AP9A 4JUZA 2HOIA 2KZZA 3GV8B 3OSNA 3KOOA 4UAYA 2PFNA 2O6KA 2H3FA 4ZH4A 1BPZA 3UMCA 4O3PA 3IP4B 2Y9UA 5KG7A 5AKXA 3PW5A 4PHAA 4KLQA 3F5EA 1PVQA 1D9DA 2W8MA 5HNKA 2IMWP 5HMLA 2ZG6A 1CRXA 1IG6A 4USAA 2HSZA 4EENA 5IINA 4YD2A 2HOQA 3NRZA 2F76X 2HI0A 4DLEA 1UA1A 4C4RA 1GO3F 5ALUA 5J2HA 3KBBA 1BVSA 5KFIA 2KVCA 3VCBA 4KTQA 1RYUA 3PY8A 1NK0A 2R8JA 4YMOA 3GQCA 3PSIA 1DRGA 2VA8A 2Q4TA 3PO4A 4B9NA 4O3SA 1HIWA 3ZDCA 5CR0A 1XC9A 2XY5A 2I5HA 4Q45A 1SKWA 4KMOB 3GU3A 4IQWA 2R8GA 3BDPA 4Y2TA 1ZQUA 2JR5A 2MU2A 3G6VA 1D8BA 4JWMA 8ICLA 4US8A 3H8SA 2ASDA 1ZQMA 1QSYA 3RJHA 2XCPA 3S6JA 4PHDA 5AHXA 3AJVB 1NJWA 2WJ0A 1OB8A 4EYHB 2WF8A 5AKIA 5KFKA 4F5RA 4FZLA 3EZ5A 4LJXA 2BCVA 2HOFA 1JUDA 4UB3A 4M9JA 1YZ7A 2JH1A 1L3SA 7ICTA 5F3XB 2VLDA 1N61A 2LI6A 1S5LU 3HKZC 2OH2A 5L1IA 4JV0A 1XWLA 3BZCA 5TISU 2AU0A 4KMUA 3BQTA 3IM1A 2WIZA 1YT3A 4IRDA 2HHWA 2KEYA 4C7YA 1TAUA 5J2KA 1DGSA 4M6WA 3ZD8A 4Q8FA 1FFVA 2FPLA 5KFOA 1TK8A 3GDXA 1Z1BA 1ZQKA 2AGQA 1UHUA 8ICVA 1WUDA 1ED1A 2A1JB 4DWIA 1TV9A 2XCAA 2ZYZA 2FKHB 5J2CA 2LKYA 3O0FA 1ZQDA 2W55A 1MA7A 4Y2VA 2H3VA 3AL0B 1XO0A 1PZNA 3A0HU 3E0FA 3QU2A 2KIWA 5FDKA 4TUSA 1NKBA 4LZGA 3HKZF 2FLCA 2Y0SF 3TKAA 1Y88A 2BZFA 2KP7A 8ICJA 2AQ0A 3M9NB 1L7PA 2AHOB 4UB4A 1NNLA 4R66A 4LZDA 9ICOA 2H3IA 3RJFA 3SV3A 4O9MA 1HH1A 4F4WA 4FO6A 3Q8SB 2BPGA 2JXJA 1EXNA 4QNLA 4F50A 3SEIA 4R65A 1R0VA 4FBUA 8ICYA 4B9SA 2OYYA 2IHMA 4I2EA 4C4SA 2WCWA 2ZUDA 4C8MA 4FE3A 1LV5A 2KN7A 4I2FA 2BGWA 3DV9A 2K8BB 1S0VA 1S0MA 2D3DA 2BCUA 1ZQWA 3WKEA 4QWAA 2OWOA 1ZQ1C 9ICBA 4XQ8A 8ICMA 2ES6A 1Q46A 2CPRA 5JUMA 5KFSA 3K1RB 2RLTA 4QWBA 2LYHA 3QE9Y 2HHXA 2QARA 5EOZA 5L1MA 2HDOA 3UPQA 5ALMA 5ALOA 1CUKA 1V9PA 2H3QA 3C1YA 4G6UA 3BS5A 3T5JA 1L3TA 2AJQA 1QQ6A 4YXJA 3RBEA 1R11A 2OM6A 1BNOA 4UB6U 1QQ7A 1X9XA 5J2BA 3JPPA 3PW7A 4XRHA 2WIWA 1K1QA 4C8KA 2KD1A 4U7CA 3ZD9A 1KBUA 4YR2A 3PSPA 5KG2A 3PMNA 1F5SA 3Q8PB 5CWRA 1ZQNA 2VKQA 2NRWA 3RR8A 2EZXA 7ICOA 1VDVA 2Y0SC 2W9BA 3RB6A 4ACOA 4NM2A 1SV4A 3DEEA 3WU2U 4OD0A 4NLGA 3L3FX 2DKXA 2OSTA 2W54A 4K4GA 1L8LA 5KG5A 3RRGA 8ICWA 1U45A 4Y2UA 2R18A 4DS4A 5DLFA 5KFCA 2KNJA 2HBJA 2ESEA 8ICCA 2UVRA 3M1YA 1MQ3A 4UAZA 2ZIVA 2JRZA 1PK1A 1RDFA 4UW9A 5J2JA 3PMLA 4PHPA 2KZ3A 5B5EU 4NXZA 4ED2A 1SL1A 4PH5A 1XMXA 3H8MA 4DSIA 3PO5A 2GO7A 2UVVA 3UQ2A 2FMSA 1V38A 1ZQPA 3WKDA 2RRDA 4C4TA 1RZTA 3RH5A 2HHQA 4UB1A 3WKAA 1T4GA 2XGPA 8ICPA 3UQ0A 1Z3EB 4DL3A 3RBDA 8ICUA 4FZMA 1MQ2A 5KFGA 4ED6A 1JX4A 4RNMA 3N7SC 2QB0A 4IQVA 5J2IA 2KHVA 3TI0A 4GXKA 4DOAA 3E2EA 4YMNA 4OJPA 1RXWA 1KFTA 2E1EA 1JALA 2YMLA 2B0CA 4P4OA 2W3SA 3L5KA 4FS2A 4IQUA 4IRKA 3P1YA 5DB9A 1L3UA 4KLOA 2IXSA 2MAXA 5J0SA 4C8OA 2L5YA 2XIDA 3V7LA 4QZGA 4F72A 2KJ9A 2WB1C 2YTUA 3C5FA 1S76D 5BOLA 1KL9A 4NJ8A 5KL1B 2W7OA 4RQ7A 2W9AA 3IDWA 4J9PA 5DDYA 3UXNA 1Z00B 3AM9A 5IIJA 5KFRA 1S97A 4JV1A 5B66U 2HHUA 3ETLA 4RPYA 3RJGA 2CRXA 2EAOA 2Y1IA 1H38A 4IC9A 4B9VA 2KJ8A 1RYRA 3SD7A 4F4YA 2WF7A 2FDRA 2YMPA 5HHIA 3SZ2A 5IIOA 5ALGA 4DQPA 1NZBA 7ICSA 3RJEA 4P4MA 3PNCA 3KD3A 4DL5A 2VJ5A 3THVA 1D8YA 1QCKA 2W7PA 1JXLA 3H8WA 5ALRA 1NK6A 1AQ6A 1BPEA 4HAIA 5HP4A 5KFWA 5AI8A 2HCFA 1L5UA 2KSOB 1DGJA 2XY7A 2G09A 5ALPA 2C22A 3LK9A 2VA2A 3PV8A 2NO4A 3ETRA 4Q44A 3K4GA 1LVHA 2YX8A 3QU7A 1Q8KA 3H4BA 1ZQCA 2KFNA 3MGVA 3WK8A 3KHRA 2PFPA 3P1ZB 4DL6A 4DO9A 5J2DA 4K4IA 2RDIA 7ICGA 4ED1A 4DFDA 1N5XA 4QIWC 5AIBA 2DBYA 5CEHA 4QBOA 3MGIA 1ZD5A 5KFHA 2I9GA 1MSWD 4RUCA 4RQ4A 9ICWA 2NYVA 1NK5A 1U4BA 3D6JA 3F5AA 4O3RA 4ED8A 4CGZA 3NVWA 1RQLA 2G0AA 9ICLA 4ECVA 2GWSA 3UMGA 1RYSA 4GXIA 2ZXHA 1N56A 3H40A 1ZJNA 4E0DA 4QZIA 4J9LA 3N4MB 5DBCA 4RQMA 2M9NA 3WK9A 3TFRA 5ALIA 1RPLA 3EYZA 4O3OA 5AK6A 2FCOA 5L9XA 3IEYA 2WAQF 3FC4A 1ZYQA 4DFJA 5DKWA 2P66A 3PR4A 2QKQA 4KLFA 1CI4A 7ICUA 4KITB 2K60A 4P2HA 2CV8A 4QZBA 3ORYA 3BZKA 2DPJA 5KFQA 3MFIA 3P1ZA 3QUBA 5KT4A 2K4IA 1T3NA 3SQIA 1ZQGA 4G9BA 5AI9A 4DOCA 3NGDA 2MRLA 2KIVA 5F9LA 3VC8A 4I29A 3I28A 3NUQA 4AYBC 1KLNA 2BQ3A 2J6UA 3AQFA 4LVSA 3UXPA 5T14A 2ISOA 2ZIUB 2KZMA 5DG9A 1PK3A 5KFLA 1TK0A 2YB4A 2WAQC 2AGOA 2QARB 4P0QB 3TADA 3SENA 4KLGA 8ICQA 3RRHA 3J81j 5KFUA 4F5QA 5J2FA 1NZPA 4NLKA 5AICA 1IPIA 2KG5A 3AMZA 3PX0A 1X9SA 1HJPA 5DLGA 2HBLA 4F4XA 1SXEA 2EH9A 2IOFA 5KFBA 3BJYA 2V4RA 1ZQQA 9ICKA 2JZBB 4Y2YA 5IILA 5DBAA 4BJQA 4F4ZA 1C20A 4YCXA 1PVRA 2V4QA 4M9LA 1COKA 9ICPA 1QQ5A 2JJQA 4M9GA 5J8YC 3MDCA 3BQ0A 3QUQA 4M0AA 3C2MA 2LMRA 4QZDA 4O3MA 9ICUA 1WWVA 2HVHA 2FL3A 4EEKA 2EO0A 3ALRA 5DQHA 4JK1A 4YP3A 3Q8MA 3Q8QB 4PGXA 2EDUA 5ALHA 1CEZA 3HILA 4UAVA 1TVAA 1KEJA 3KKAC 4JWNA 1MC8A 3SYZA 2FLPA 1BNPA 5G5HA 1WG8A 4X5VA 3TACB 5KT2A 2G06A 3H7IA 3L4PA 1T7PA 2D6FC 4QBNA 1SB3C 2J6TA 1JROA 3AQEA 4IRCA 4C8LA 1TAMA 3KZXA 2INBA 4WJ3B 1ZJMA 3PW0A 4B9LA 4TURA 4O3NA 5AI5A 1T3QA 5EE0A 1TK5A 4EELA 5AI6A 2JV3A 1ZQFA 4QBLA 4I28A 3LVWA 2LPEA 2UVUA 2ZTEA 7ICQA 1A76A 1ZD4A 1X9WA 1ZQZA 4KN4A 8ICNA 1TFRA 4Y2PA 5GTIU 3M9OB 5D46A 1XS9D 2PI5A 1UA0A 2WF6A 4Q43A 5ALXA 3CNHA 4Z6FA 4DS5A 5J0QA 5CA7A 3I76A 3GIMA 1UT5A 3G6XA 1D8LA 5E79U 4US9A 2JMGA 2IHNA 3ZDBA 3IHQB 1RM6C 4DSEA 2ZJAA 4RQ8A 2CXYA 1SKRA 4P0PB 4C7ZA 1BPBA 3C5GA 1JXEA 2H5XA 5J0OA 1Z4OA 5IIMA 4KLEA 4ECTA 4M2YA 2BKEA 3HJEA 4TKDA 5AKGA 3C21A 1F1ZA 1SXDA 4MFAA 3RTVA 2AXTU 3N28A 2R8IA 1SGGA 4KN7A 4Q8EA 4ECRA 2BPFA 3WK6A 4TUPA 4Y2RA 1F0MA 4M6WB 2ZIWA 4CF4A 3V6HA 3TFSA 4F8RA 3R9KA 1X66A 4ELTA 3CYMA 7ICPA 1NK9A 3HW8A 2KMDA 1ZETA 4QWCA 1KDHA 2FMQA 5ALSA 5JRTA 5ALLA 3RJJA 1Z4NA 2JEIA 1VLBA 4Z6CA 2QLTA 1OB9A 7ICKA 1ZQYA 4DL2A 2FLNA 2FPKA 1DOQA 2G5HB 3F2DA 4PL1A 4TUQA 9ICQA 4J9RA 5KFEA 3KKAA 5ALEA 1FEZA 3NS1A 1B0XA 2I1QA 1QSLA 2XC9A 1RQNA 5ALTA 4MEYA 4QIWF 4OO1J 3IEYB 2E5SA 4QZHA 2E8PA 2IBKA 3T5HA 1IV8A 3V6JA 3PX6A 2G5IB 3PSTA 2NRXA 2R8HA 3ONNA 3JPNA 5JU5A 5AM3A 2LYBA 4M47A 1T94A 4OCZA 2AGPA 3F2BA 1L7MA 4YQWA 4F2RA 2DQNB 4ECXA 3M8SA 3DNXA 1Y1OA 2P6RA 2ZXIA 1U49A 3ISBA 4DQIA 1IIPA 3F53A 5K4LA 4IR1A 3N7PD 4RQ5A 1N63A 1O08A 5AM5A 1K5OA 7ICHA 1ZQXA 1ZP7A 5EE3A 5DG7A 3QEBZ 1OUQA 2W9CA 1X42A 5DB7A 2M0NA 3C28A 4QZFA 4I2IA 2HBKA 1QSSA 3SV4A 8ICOA 2YN4A 4TQSA 8ICEA 2E3TA 3M9MB 4F5NA 4A8EA 1X6JA 2ASJA 4DSKA 3IRUA 5HR7A 3QZ8A 1B22A 4NL9A 3JPSA 2VA3A 4OJ5A 4KLIA 2VJ4A 2VS1A 2QB0B 5HMMA 3JPQA 7ICLA 3F2CA 4CF5A 2JZBA 2JEGA 1D9FA 9ICTA 5C5JA 3SI8A 4BGDA 5ALNA 9ICIA 2F3NA 5ALYA 3SR6A 1P7DA 2K4HA 3RB3A 3FAHA 4J9KA 4RQ0A 4C0ZA 4QZ8A 3TQ1A 4UAWA 2CZRA 2ZUBA 1S0OA 3Q8KA 2ATLA 4I2JA 2MA1A 4NLCA 3MABA 4PGYA 1UT8A 1VJ5A 2BH2A 1NJXA 2ZTDA 3MR2A 3OHBA 4I2HA 2PMZF 3GIIA 5CJ7A 2HVIA 2WCZA 4DEZA 2ZIXA 1ZD2P 3WKCA 4DF8A 1UCVA 3UXOA 2ODGA 1X2IA 1OW5A 5HR6A 3NVVA 3N97B 4U6PA 5DDMA 2FE9A 5CHGA 3E58A 3HWTA 4DQSA 2JH7A 2W8LA 3IV6A 7ICRA 3WK4A 3PSFA 4IS7A 1NKCA 3QX7A 5AIAA 4Y2QA 4I2BA 3BT7A 5BPCA 2OHFA 1PUZA 1XSNA 4M9HA 4BX9C 3G6YA 4UATA 1DK2A 5AM2A 4CDGA 2OKFA 3SMVA 3Q8LA 4J9OA 4EZ9A 2EQYA 4MFFA 4BDPA 1ZQRA 4B9MA 9ICNA 4OJLA 1MN8A 2KHQA 4YN4A 4UAUA 4C8NA 3HX0A 4MHVA 3ISDA 2W9MA 2F1HA 2DUYA 1L7NA 3HPOA 4ED7A 3H0LB 5J29A 2NRTA 2BHNA 2KICA 5J0TA 5KFVA 1XO1A 5D4BA 2E1FA 3K75D 5IIKA 4BXOB 4J9MA 8ICSA 1L8OA 1OXJA 3ICXA 1S8OA 5AI4A 2ZUCA 3BS5B 1M6YA 2LHTA 1FIQA 2IOFK 4KLTA 4F91B 1NKEA 5EWGA 4YVZA 3EUB2 2NV3A 4EZ6A 1X6IA 4JB3A 3QEAZ 1PVPA 3OTQA 5KFPA 7ICJA 3RAXA 4XA5A 4P0PA 4DSFA 5KFJA 1HUOA 4J03A 3JPOA 1BGXT 1UQVA 3KZIU 2E8OA 1ZQLA 1U48A 3FOVA 1YZ6A 2K89A 4NL9C 5KG1A 5BOMA 2P35A 5EE1A 5KFAA 1KKXA 2W9BB 1X40A 3N7RC 5ALDA 1JIHA 4ELUA 3WK5A 3C2KA 1SIJA 1SZPA 4CE6A 3RJIA 1TAQA 4QWEA 4GFJA 4GC7A 2EZZA 3H4DA 3JPRA 2I6XA 4HYKA 8ICAA 4ECUA 2K4EA 2EAPA 5AK4A 1NK7A 4KLUA 3V7KA 3RH6A 2XICA 1XSPA 3D2NA 3MC1A 4RQNA 4KX3A 2NRVA 3TADC 3FDSA 4NLZA 5ALZA 4IL6U 2PFQA 2BCQA 5ALVA 5AKEA 3DDHA 3EW9A 2C2RA 5KT7A 1Z19A 5JTIA 2BQUA 3QU4A 1DXSA 4RNNA 4DLGA 2A19A 5EWEA 2RQ5A 4XUSA 3UM9A 8ICXA 4YD1A 7ICVA 1S10A 4CNQA 5KT6A 4F2SA 3GV5B 2F8KA 3AEVA 5KL8B 2Y9TA 3KHLA 3UMBA 1F44A 3CW2C 2VIXA 3PW2A 2PKEA 3T79A 2BDPA 4I2GA 2HMXA 1YNMA 5KFFA 2KE7A 1L7OA 4Z6DA 4RT2A 4G6VA 4PZNA 4J9QA 1IM4A 4YG2A 1JRPA 3RAQA 4UB2A 1JMSA 2DBSA 3TAQA 2WB1F 3KHGA 4EBDA 2KSOA 1GEFA 5F9NA 2HW3A 4UQGA 4ECSA 3T5KA 5AKHA 8ICKA 2RDJA 4GLXA 1ZQEA 1V97A 4CF3A 1SWWA 1C7YA 4F92B 4RUAA 3T3FA 2RP5A 4EX6A 4DL7A 7ICIA 3QYPA 1KFDA 8ICHA 2J6SA 2FI1A 4I2AA 3A0BU 5J2EA 2JHDA 2HHTA 3WKBA 4O5CA 3QZ7A 4Y2XA 3AUOA 2FPMA 4ICAA 4RQ2A 2ZTCA 2LBOA 1HEKA 5C0YA 4FS1A 4UBBA 2BCSA 2HHVA 3WK7A 1WCLA 1ZXIA 2JEFA 2H3ZA 3RB4A 5A0LA 2G08A 2DL0A 1NI3A 4F5PA 5J8YA 1QLNA 5L1LA 2YMMA 4KLJA 1ZQIA 4O5KA 3MFHA 3MR3A 4NLNA 5KFDA 4CCHA 4IQTA 3AU2A 3GZFA 1N2XA 4YR3A 5G5GA 3EPGA 5AK5A 3CP8A 3NTUA 1B4FA 2KTQA 2GJWA 2IA6A 3M6KA 4KLLA 4JMUA 4QWDA 4KLMA 3IG8A 3H0RB 4BWMA 2W04A 4ED0A 4DFMA 2XY6A 5DGAA 3M7DA 4DAPA 3ED5A 1TKDA 2K8AA 4O3QA 1FFUA 1RZNA 7ICFA 3GIJA 2W43A 1AROP 4PGQA 2FLLA 1S0NA 4ED3A 3LWMA 5KAIU 2AQ4A 5CRXA 4QZ9A 2UVWA 2OEHA 1IXRA 1J2MA 4FBTA 4M04A 3IN5A 2KFZA 2YQEA 1ZQVA 4QW9A 4CRXA 4R64A 1SV0A 4FZNA 5J2GA 5DB6A 1ZQBA 1KW4A 3GFKB 2PI4A 5DQGA 3GIKA 2BDUA 2AH5A 3SAHA 2V9WA 2ZJ5A 5AI0A 3ZDDA 4YXMA 1HUZA 4P0QA 1ECWA 1SWVA 1BPDA 4ELVA 3OHAA 2WFAA 3D2QA 1T0FA 4EEYA 4PZOA 2QB1A 4EX7A 3PX4A 3B9JA 4YR0A 4B6JA 3RF9A 5AM4A 2OCEA 9ICGA 3IG5A 4R8UA 3RB0A 3LVVA 4RQ3A 1S77D 4DL4A 3CRXA 3ZDAA 2YY6A 2A3VA 3GV7B 1COOA 3JPTA 4BXOA 5HHHA 3OJSA 3TARA 3C29A 4UASA 2MUTB 2A1AA 4FFDA 5KG3A 1N48A 9ICXA 5GTHU 5ALQA 4LQEA 3QU5A 4QZEA 2WTFA 1QTMA 2KKVA 5EWFA 4DQRA 1NK4A 3NRWA 2W8KA 3FM9A 3QU9A 1A77A 3PW4A 4QW8A 2ZIWB 1BPYA 2E8MA 1KFSA 2C28A 1U47A 1KRPA 2JGAA 1J2NA 2EZYA 1RLVA 1LKYB 2DKZA 4DF4A 4BWJA 4DSJA 9ICMA 3C23A 2KKPA 4J9SA 2N1RA 2F44A 9ICFA 1ZRNA 2MSNA 1ZQOA 5DBBA 5DB8A 2RHFA 4Y2SA 4UARA 1T8EA 1X9MA 4EV1A 1ZOLA 5ALWA 2DPIA 1A79A 1XU4A 1B43A 3ZI4A 3MR5A 2LM1A 4I2DA 3BS7A 3SAGA 4GC6A 2Z0RA 3MDAA 9ICHA 4RU9A 3PZPA 4O0IA 3MGHA 3RJKA 5KT5A 3MR6A 4DOBA 3ISCA 4OJOA 1KQQA 5ALJA 4AYBF 1A6SA 5EE9A 8ICGA 3B0XA 2ZIVB 4ZOHC 5ALKA 5KT3A 3OGUA 4GIBA 5KAFU 4M9NA 5IIIA 4KLDA 5J0PA 5KG6A 2PFOA 5J0XA 2HHSA 3HT3A 1WWUA 1O03A 3V7JA 4RNOA 4UBCA 5KFYA 4DQQA 2BQRA 3QUTA 4KLSA 1L6NA 5DG8A 1KTQA 3C1ZA 1KSPA 2Y1JA 2EANA 2ISPA 3AN1A 1RXVA 4TQRA 2F2AB 4ZQUA 2YB1A 3M6ZA
chains in the Genus database with same CATH topology
1IPIA 8ICJA 2AQ0A 3M9NB 2ZUCA 4UB4A 3PX0A 1X9SA 1HJPA 5D49A 9ICEA 4KLTA 4R66A 4LZDA 4QZCA 4F91B 5DLGA 1BPXA 9ICOA 1NKEA 4F4XA 3RJFA 3SV3A 5EWGA 4O9MA 5L1KA 4YVZA 1HH1A 4EZ6A 5KFBA 3BJYA 4F4WA 4FO6A 4DFPA 2V4RA 1ZQQA 3Q8SB 2BPGA 3QEAZ 5KFPA 9ICKA 2JZBB 7ICJA 5CB1A 5IILA 1EXNA 5DBAA 4F4ZA 3RAXA 4MF8A 4XA5A 3P1YA 3EPIA 4YCXA 4DSFA 5KFJA 1NJZA 4F50A 1HUOA 3LWLA 8ICZA 4TKKA 2V4QA 4R65A 4M9LA 3JPOA 1BGXT 1ZQLA 9ICPA 1R0VA 4G3IA 1U48A 4FBUA 5J0WA 8ICYA 4M9GA 2JJQA 1ZQHA 4B9SA 4O5EA 3FOVA 2IHMA 4I2EA 3MDCA 5KG1A 5BOMA 5KFAA 3BQ0A 2W9BB 4M0AA 3C2MA 2WCWA 3IF0X 2ZUDA 4C8MA 4ECYA 2A1JA 4QZDA 4RPZA 1JIHA 3GILA 1LV5A 4ELUA 2KN7A 4I2FA 2DFLA 9ICUA 3C2KA 3RH4A 2BGWA 3RJIA 1SZPA 4JV2A 3LDAA 3HP6A 4NY8A 2HVHA 1TAQA 4QWEA 1S0VA 1S0MA 4GC7A 3H4DA 2BCUA 1ZQWA 3JPRA 2FL3A 4HYKA 8ICAA 4ECUA 4KLUA 1NOMA 1NK7A 2C2EA 4QWAA 2EO0A 2OWOA 3V7KA 3RH6A 3TAPA 9ICBA 5DQHA 4JK1A 4XQ8A 4YP3A 1XSPA 8ICMA 3Q8MA 5JUMA 3Q8QB 4PGXA 5KFSA 2NRVA 4Z6EA 5KFNA 5J2AA 2MUTA 5KG4A 3FDSA 3TANA 1CEZA 4NLZA 4QWBA 1TVAA 2LYHA 2PFQA 1KEJA 3QE9Y 2ZJ8A 2BCQA 2HHXA 5EOZA 3EW9A 2C2RA 5KG0A 4B9UA 2JEJA 5KT7A 1MC8A 1SL2A 4F4KA 4JWNA 3SYZA 2FLPA 5KFTA 3UPQA 2BQUA 2R8KA 4X5VA 1CUKA 1V9PA 3C1YA 3Q8RB 4G6UA 3T5JA 2AJQA 1S9FA 4RNNA 1L3TA 9ICRA 1Z00A 4YXJA 3RBEA 2ZYZB 5TZVA 3RR7A 1R11A 3C2LA 5KT2A 4DLGA 8ICFA 3H7IA 1T7PA 3ZDEA 5EWEA 3V6KA 3JPPA 4XUSA 5J2BA 4DSLA 8ICXA 3PW7A 4XRHA 4DA2A 4I27A 4DAVA 1K1QA 4QBNA 2WIWA 2J6TA 4YD1A 4C8KA 7ICVA 1S10A 4GXJA 3ZD9A 4IRCA 1WCNA 4YR2A 5KT6A 4F2SA 3GV5B 4ECZA 4C8LA 4F3OA 2INBA 3KHLA 4R8UB 1ZJMA 5KG2A 3PMNA 3PW0A 4B9LA 4TURA 4O3NA 2ALZA 1TK5A 3Q8PB 3PW2A 5CWRA 1ZQNA 2BDPA 5KTQA 2W9CB 4I2GA 1YNMA 2FMPA 5KFFA 2BR0A 2NRWA 4Z6DA 4RT2A 9ICCA 4G6VA 2FKCA 3RR8A 4J9QA 7ICNA 1IM4A 1ZQFA 4QBLA 7ICOA 1SL0A 4I28A 4YG2A 3BQ1A 2W9BA 4UB5A 3RAQA 3RB6A 4UB2A 4NM2A 9ICJA 1JMSA 2DBSA 3TAQA 2UVUA 1JN3A 2ZTEA 7ICQA 1A76A 3KHGA 4NLGA 4EBDA 5KFMA 4QZAA 4RZRA 1ZQZA 1X9WA 4KN4A 5F9NA 7ICMA 2HW3A 8ICNA 4UQGA 4ECSA 1ZQJA 2OSTA 1TFRA 4K4GA 5KG5A 3T5KA 5L1JA 3RRGA 1XSLA 3M9OB 1U45A 8ICKA 8ICWA 5D46A 2RDJA 4DFKA 2C2DA 4GLXA 1XS9D 1ZQEA 3T5LA 1L3VA 2PI5A 3BQ2A 4DS4A 4EYIB 1UA0A 5DLFA 1C7YA 4MF2A 5KFCA 4F92B 4K4HA 4KLHA 4Q43A 4RUAA 3T3FA 8ICCA 2UVRA 4DS5A 4Z6FA 3OSPA 4DL7A 8ICTA 1MQ3A 4UAZA 5J0QA 5CA7A 1K1SA 1NJYA 7ICIA 4EBCA 2XGQA 3GIMA 1KFDA 1UT5A 3G6XA 1D8LA 8ICHA 2J6SA 4I2AA 4ECQA 8ICIA 3M8RA 2IHNA 3ZDBA 5J2EA 3IHQB 5J2JA 3PMLA 4DSEA 4PHPA 2ZJAA 2HHTA 4RQ8A 2KZ3A 4O5CA 3QZ7A 7ICEA 2F1JA 4E6ZA 4NXZA 3AUOA 1SKRA 4ED2A 1SL1A 1U9LA 2FPMA 4PH5A 4F5OA 1XMXA 5J0YA 1BPBA 3AU6A 3C5GA 4DSIA 4RQ2A 1JXEA 2ZTCA 2PXIA 2H5XA 5J0OA 5IIMA 3PO5A 4FS1A 4KLEA 1QLNA 2UVVA 4UBBA 3UQ2A 1ZQAA 2FMSA 4ECTA 1ZQPA 4M2YA 2BCSA 2BKEA 4NM1A 4TKDA 2HHVA 2Q0ZX 3PVXA 5DGBA 4ECWA 1WCLA 3C21A 2JEFA 3RB4A 1RZTA 3RH5A 9ICSA 4MFAA 1F1ZA 3H8JA 3RTVA 2HHQA 4UB1A 2R8IA 1T4GA 4F5PA 4KN7A 2XGPA 4PHEA 3UQ0A 4PPXA 5L1LA 4ECRA 2BPFA 4Q8EA 3EWAA 8ICPA 4KLJA 3KTQA 4TUPA 2VS1A 4RQ1A 1ZQIA 3MFHA 4M6WB 1Z3EB 3MR3A 4NLNA 4O5KA 4DL3A 3V6HA 3RBDA 3TFSA 5KFDA 4B9TA 8ICUA 4F8RA 4CCHA 3PR5B 3B0YA 4IQTA 3AU2A 2F1IA 5KFGA 1MQ2A 4ELTA 4ED6A 7ICPA 1JX4A 4RNMA 4YR3A 1NK9A 3HW8A 3EPGA 4RPXA 4IQVA 5J2IA 9ICAA 1LB2B 4YFKA 1ZETA 4QWCA 3TI0A 3NTUA 1KDHA 4GXKA 2FMQA 2KTQA 4DOAA 3E2EA 4YMMA 4YMNA 1RXWA 3RJJA 2JEIA 2GJWA 2GW6A 1KFTA 2IA6A 4Z6CA 4KLLA 1SKSA 1OB9A 1UWVA 4J9NA 7ICKA 4QWDA 2B21A 2BCRA 1ZQYA 4P4OA 4MEXA 4KLMA 2XO7A 4FS2A 4IQUA 4BWMA 5KFXA 4F93B 5J0RA 2FPKA 5DB9A 4DL2A 3OJUA 4ED0A 4DFMA 2FLNA 8ICBA 2XY6A 1DOQA 1L3UA 4KLOA 3AJVA 5DGAA 2NRZA 2IXSA 4TUQA 9ICQA 4DAPA 1ZQTA 2MAXA 5J0SA 4C8OA 4J9RA 5KFEA 5J0UA 1TKDA 3V7LA 4O3QA 4QZGA 1RZNA 5KFZA 4RT3A 3C5FA 5DQIA 7ICFA 3GIJA 2I1QA 1S76D 5BOLA 1QSLA 1AROP 4PGQA 4P4PA 2BPCA 2FLLA 4RQ7A 2W9AA 4J9PA 1S0NA 4ED3A 5DDYA 3UXNA 2XC9A 4IRKA 1Z00B 1ZQSA 4MFCA 5IIJA 5KFRA 3LWMA 1NK8A 1S97A 4MEYA 2AQ4A 4JV1A 2HHUA 9ICVA 3ETLA 2P6UA 4RPYA 3MBYA 5CP2A 4RQ6A 3IEYB 4QZ9A 3RJGA 2Y1IA 4QZHA 2VANA 2ASLA 1H38A 2IBKA 4I2CA 3T5HA 2UVWA 3V6JA 4B9VA 3PX6A 1RYRA 5HHIA 4F4YA 1IXRA 2NRXA 2R8HA 4R63A 3SZ2A 4FBTA 5IIOA 4M04A 4EBEA 3FYHA 2KFZA 3JPNA 4DQPA 1ZQVA 4QW9A 3KHHA 7ICSA 4R64A 3RJEA 4P4MA 4M47A 3PNCA 5J2GA 5DB6A 1ZQBA 4IR9A 3V72A 2AGPA 3GFKB 4DL5A 8ICRA 2PI4A 3THVA 4JUZA 5DQGA 1D8YA 3GIKA 2KZZA 3GV8B 1JXLA 4YQWA 3H8WA 3OSNA 4F2RA 2V9WA 2ZJ5A 4ECXA 1NK6A 4UAYA 3M8SA 2PFNA 3DNXA 3ZDDA 4ZH4A 1BPZA 1BPEA 5HP4A 2P6RA 5KFWA 4YXMA 1Y1OA 4O3PA 1L5UA 1U49A 5KG7A 1HUZA 3PW5A 1BPDA 3ISBA 4DQIA 4PHAA 2XY7A 4ELVA 3OHAA 4KLQA 1D9DA 1T0FA 4IR1A 4EEYA 2W8MA 2C22A 5HNKA 3LK9A 2IMWP 5HMLA 4RQ5A 2VA2A 3PV8A 3PX4A 4YD2A 5IINA 4YR0A 4Q44A 3K4GA 9ICGA 7ICHA 4R8UA 3RB0A 1ZQXA 1ZP7A 3H4BA 4DLEA 4RQ3A 1UA1A 1S77D 1ZQCA 5J2HA 4DL4A 1BVSA 2KFNA 5DG7A 5KFIA 3QEBZ 3ZDAA 2W9CA 4KTQA 5DB7A 3KHRA 3GV7B 1COOA 2PFPA 3P1ZB 4DL6A 3PY8A 1NK0A 4DO9A 5J2DA 4QZFA 4I2IA 5HHHA 3JPTA 1QSSA 2R8JA 4BXOA 3OJSA 3SV4A 8ICOA 4YMOA 3GQCA 2RDIA 3TARA 7ICGA 4ED1A 4TQSA 2VA8A 8ICEA 3PO4A 4B9NA 2MUTB 4O3SA 3ZDCA 5CR0A 3M9MB 4F5NA 1XC9A 2XY5A 1GEFA 5KG3A 4Q45A 1N48A 2ASJA 4DSKA 9ICXA 4QBOA 1SKWA 3QZ8A 1B22A 3MGIA 3JPSA 2VA3A 4LQEA 4KLIA 5KFHA 3JPQA 5HMMA 2I9GA 4IQWA 4RUCA 4RQ4A 2R8GA 1MSWD 3BDPA 9ICWA 4QZEA 2WTFA 1QTMA 7ICLA 2JZBA 2JEGA 1ZQUA 5EWFA 1D9FA 3G6VA 1NK5A 4DQRA 1U4BA 9ICTA 5C5JA 3SI8A 1NK4A 4JWMA 4BGDA 2W8KA 8ICLA 4O3RA 4ED8A 9ICIA 3H8SA 2ASDA 1ZQMA 1A77A 3PW4A 1QSYA 3RJHA 9ICLA 2XCPA 4QW8A 4PHDA 3RB3A 4ECVA 3AJVB 2GWSA 1NJWA 1RYSA 1BPYA 4J9KA 4GXIA 1KFSA 4RQ0A 2C28A 1U47A 1N56A 1KRPA 2WJ0A 4QZ8A 1RLVA 3H40A 1ZJNA 4DF4A 3TQ1A 4BWJA 4UAWA 4E0DA 4DSJA 2ZUBA 9ICMA 1OB8A 2CZRA 4EYHB 3C23A 4QZIA 1S0OA 4J9LA 3Q8KA 5KFKA 3N4MB 2ATLA 4F5RA 3EZ5A 4I2JA 5DBCA 4J9SA 2BCVA 3MABA 4PGYA 1UT8A 4UB3A 4M9JA 9ICFA 1NJXA 2BH2A 1L3SA 2M9NA 2ZTDA 3MR2A 3TFRA 7ICTA 1RPLA 3OHBA 3EYZA 4O3OA 2VLDA 1ZQOA 4I2HA 5DBBA 5DB8A 2FCOA 3GIIA 5CJ7A 4K4IA 1T8EA 5L9XA 5L1IA 2HVIA 4JV0A 1X9MA 2WCZA 3IEYA 4EV1A 1XWLA 4DFJA 1ZYQA 4DEZA 5DKWA 2AU0A 4KMUA 2DPIA 1A79A 3BQTA 4DF8A 2P66A 3PR4A 3IM1A 1XU4A 2WIZA 3UXOA 4KLFA 1X2IA 4IRDA 1B43A 3N97B 2HHWA 4KITB 7ICUA 3MR5A 4I2DA 5DDMA 1TAUA 4GC6A 2Z0RA 4P2HA 2CV8A 5J2KA 1DGSA 3ORYA 4M6WA 5CHGA 4QZBA 2DPJA 3ZD8A 3MDAA 4Q8FA 4RU9A 9ICHA 4O0IA 5KFQA 3MGHA 5KT5A 3MR6A 3HWTA 4DOBA 4DQSA 2W8LA 3RJKA 3MFIA 2FPLA 3ISCA 3P1ZA 7ICRA 5KT4A 1T3NA 5KFOA 1ZQGA 1TK8A 3GDXA 1ZQKA 2AGQA 1NKCA 3NGDA 4DOCA 4I2BA 3BT7A 5BPCA 8ICVA 8ICGA 3B0XA 5F9LA 1XSNA 4M9HA 2A1JB 4DWIA 3G6YA 4I29A 1TV9A 2XCAA 5KT3A 1KLNA 2ZYZA 3OGUA 2OKFA 2FKHB 5J2CA 3Q8LA 2BQ3A 4J9OA 4EZ9A 1ZQDA 2J6UA 4M9NA 5IIIA 4BDPA 4MFFA 4KLDA 1ZQRA 4B9MA 4LVSA 5J0PA 3UXPA 9ICNA 5KG6A 2PFOA 5J0XA 2HHSA 2ISOA 3HT3A 2KZMA 5DG9A 4YN4A 4C8NA 3HX0A 3V7JA 5KFLA 4RNOA 1PZNA 4UBCA 5KFYA 3ISDA 2W9MA 2F1HA 1TK0A 4DQQA 2BQRA 3HPOA 4ED7A 5J29A 2NRTA 4KLSA 5FDKA 2BHNA 1KTQA 3C1ZA 5DG8A 5J0TA 5KFVA 4TUSA 2AGOA 1NKBA 1KSPA 1XO1A 2Y1JA 5D4BA 4LZGA 2ISPA 3K75D 4KLGA 8ICQA 2FLCA 3RRHA 5IIKA 1RXVA 5KFUA 4TQRA 5J2FA 4J9MA 4F5QA 4BXOB 8ICSA 4ZQUA 1Y88A 4NLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IPI A;  8ICJ A;  2AQ0 A;  3M9N B;  2ZUC A;  4UB4 A;  3PX0 A;  1X9S A;  1HJP A;  5D49 A;  9ICE A;  4KLT A;  4R66 A;  4LZD A;  4QZC A;  4F91 B;  5DLG A;  1BPX A;  9ICO A;  1NKE A;  4F4X A;  3RJF A;  3SV3 A;  5EWG A;  4O9M A;  5L1K A;  4YVZ A;  1HH1 A;  4EZ6 A;  5KFB A;  3BJY A;  4F4W A;  4FO6 A;  4DFP A;  2V4R A;  1ZQQ A;  3Q8S B;  2BPG A;  3QEA Z;  5KFP A;  9ICK A;  2JZB B;  7ICJ A;  5CB1 A;  5IIL A;  1EXN A;  5DBA A;  4F4Z A;  3RAX A;  4MF8 A;  4XA5 A;  3P1Y A;  3EPI A;  4YCX A;  4DSF A;  5KFJ A;  1NJZ A;  4F50 A;  1HUO A;  3LWL A;  8ICZ A;  4TKK A;  2V4Q A;  4R65 A;  4M9L A;  3JPO A;  1BGX T;  1ZQL A;  9ICP A;  1R0V A;  4G3I A;  1U48 A;  4FBU A;  5J0W A;  8ICY A;  4M9G A;  1ZQH A;  4B9S A;  4O5E A;  3FOV A;  2IHM A;  4I2E A;  3MDC A;  5KG1 A;  5BOM A;  5KFA A;  3BQ0 A;  2W9B B;  4M0A A;  3C2M A;  2WCW A;  2ZUD A;  4C8M A;  4ECY A;  2A1J A;  4QZD A;  4RPZ A;  1JIH A;  3GIL A;  1LV5 A;  4ELU A;  2KN7 A;  4I2F A;  2DFL A;  9ICU A;  3C2K A;  3RH4 A;  2BGW A;  3RJI A;  1SZP A;  4JV2 A;  3LDA A;  3HP6 A;  4NY8 A;  2HVH A;  1TAQ A;  4QWE A;  1S0V A;  1S0M A;  4GC7 A;  3H4D A;  2BCU A;  1ZQW A;  3JPR A;  4HYK A;  8ICA A;  4ECU A;  4KLU A;  1NOM A;  1NK7 A;  2C2E A;  4QWA A;  2EO0 A;  2OWO A;  3V7K A;  3RH6 A;  3TAP A;  9ICB A;  5DQH A;  4JK1 A;  4XQ8 A;  4YP3 A;  1XSP A;  8ICM A;  3Q8M A;  5JUM A;  3Q8Q B;  4PGX A;  5KFS A;  2NRV A;  4Z6E A;  5KFN A;  5J2A A;  2MUT A;  5KG4 A;  3FDS A;  3TAN A;  1CEZ A;  4NLZ A;  4QWB A;  1TVA A;  2LYH A;  2PFQ A;  1KEJ A;  3QE9 Y;  2ZJ8 A;  2BCQ A;  2HHX A;  5EOZ A;  3EW9 A;  2C2R A;  5KG0 A;  4B9U A;  2JEJ A;  5KT7 A;  1MC8 A;  1SL2 A;  4F4K A;  4JWN A;  3SYZ A;  2FLP A;  5KFT A;  3UPQ A;  2BQU A;  2R8K A;  4X5V A;  1CUK A;  1V9P A;  3C1Y A;  3Q8R B;  3T5J A;  2AJQ A;  1S9F A;  4RNN A;  1L3T A;  9ICR A;  1Z00 A;  4YXJ A;  3RBE A;  2ZYZ B;  5TZV A;  3RR7 A;  1R11 A;  3C2L A;  5KT2 A;  4DLG A;  8ICF A;  3H7I A;  1T7P A;  3ZDE A;  5EWE A;  3V6K A;  3JPP A;  4XUS A;  5J2B A;  4DSL A;  8ICX A;  3PW7 A;  4XRH A;  2WIW A;  4I27 A;  1K1Q A;  4QBN A;  2J6T A;  4YD1 A;  4C8K A;  7ICV A;  1S10 A;  4GXJ A;  3ZD9 A;  4IRC A;  1WCN A;  4YR2 A;  5KT6 A;  4F2S A;  3GV5 B;  4ECZ A;  4C8L A;  4F3O A;  2INB A;  3KHL A;  4R8U B;  1ZJM A;  5KG2 A;  3PMN A;  3PW0 A;  4B9L A;  4TUR A;  4O3N A;  2ALZ A;  1TK5 A;  3Q8P B;  3PW2 A;  5CWR A;  1ZQN A;  2BDP A;  5KTQ A;  2W9C B;  4I2G A;  2FMP A;  5KFF A;  2BR0 A;  2NRW A;  4Z6D A;  4RT2 A;  9ICC A;  3RR8 A;  4J9Q A;  7ICN A;  1IM4 A;  1ZQF A;  4QBL A;  7ICO A;  1SL0 A;  4I28 A;  4YG2 A;  3BQ1 A;  2W9B A;  4UB5 A;  3RAQ A;  3RB6 A;  4UB2 A;  4NM2 A;  9ICJ A;  1JMS A;  3TAQ A;  2UVU A;  1JN3 A;  2ZTE A;  7ICQ A;  1A76 A;  3KHG A;  4NLG A;  4EBD A;  5KFM A;  4QZA A;  4RZR A;  1ZQZ A;  1X9W A;  4KN4 A;  5F9N A;  7ICM A;  2HW3 A;  8ICN A;  4UQG A;  4ECS A;  1ZQJ A;  2OST A;  1TFR A;  4K4G A;  5KG5 A;  3T5K A;  5L1J A;  3RRG A;  1XSL A;  3M9O B;  1U45 A;  8ICK A;  8ICW A;  5D46 A;  2RDJ A;  4DFK A;  2C2D A;  4GLX A;  1XS9 D;  1ZQE A;  3T5L A;  1L3V A;  2PI5 A;  3BQ2 A;  4DS4 A;  4EYI B;  1UA0 A;  5DLF A;  1C7Y A;  4MF2 A;  5KFC A;  4F92 B;  4K4H A;  4KLH A;  4Q43 A;  4RUA A;  3T3F A;  8ICC A;  2UVR A;  4DS5 A;  4Z6F A;  3OSP A;  4DL7 A;  8ICT A;  1MQ3 A;  4UAZ A;  5J0Q A;  5CA7 A;  1K1S A;  1NJY A;  7ICI A;  4EBC A;  2XGQ A;  3GIM A;  1KFD A;  1UT5 A;  3G6X A;  1D8L A;  8ICH A;  2J6S A;  4I2A A;  4ECQ A;  8ICI A;  3M8R A;  2IHN A;  3ZDB A;  5J2E A;  3IHQ B;  5J2J A;  3PML A;  4DSE A;  4PHP A;  2ZJA A;  2HHT A;  4RQ8 A;  2KZ3 A;  4O5C A;  3QZ7 A;  7ICE A;  2F1J A;  4NXZ A;  3AUO A;  1SKR A;  4ED2 A;  1SL1 A;  1U9L A;  2FPM A;  4PH5 A;  4F5O A;  1XMX A;  5J0Y A;  1BPB A;  3AU6 A;  3C5G A;  4DSI A;  4RQ2 A;  1JXE A;  2ZTC A;  2PXI A;  2H5X A;  5J0O A;  5IIM A;  3PO5 A;  4FS1 A;  4KLE A;  1QLN A;  2UVV A;  4UBB A;  3UQ2 A;  1ZQA A;  2FMS A;  4ECT A;  1ZQP A;  4M2Y A;  2BCS A;  2BKE A;  4NM1 A;  4TKD A;  2HHV A;  2Q0Z X;  3PVX A;  5DGB A;  4ECW A;  1WCL A;  3C21 A;  2JEF A;  3RB4 A;  1RZT A;  3RH5 A;  9ICS A;  4MFA A;  1F1Z A;  3H8J A;  3RTV A;  2HHQ A;  4UB1 A;  2R8I A;  1T4G A;  4F5P A;  4KN7 A;  2XGP A;  4PHE A;  3UQ0 A;  4PPX A;  5L1L A;  4ECR A;  2BPF A;  4Q8E A;  3EWA A;  8ICP A;  4KLJ A;  3KTQ A;  4TUP A;  4RQ1 A;  1ZQI A;  3MFH A;  4M6W B;  1Z3E B;  3MR3 A;  4NLN A;  4O5K A;  4DL3 A;  3V6H A;  3RBD A;  3TFS A;  5KFD A;  4B9T A;  8ICU A;  4F8R A;  4CCH A;  3PR5 B;  3B0Y A;  4IQT A;  3AU2 A;  2F1I A;  5KFG A;  1MQ2 A;  4ELT A;  4ED6 A;  7ICP A;  1JX4 A;  4RNM A;  4YR3 A;  1NK9 A;  3HW8 A;  3EPG A;  4RPX A;  4IQV A;  5J2I A;  9ICA A;  1LB2 B;  4YFK A;  1ZET A;  4QWC A;  3TI0 A;  3NTU A;  1KDH A;  4GXK A;  2FMQ A;  2KTQ A;  4DOA A;  3E2E A;  4YMM A;  4YMN A;  1RXW A;  3RJJ A;  2JEI A;  2GJW A;  2GW6 A;  1KFT A;  2IA6 A;  4Z6C A;  4KLL A;  1SKS A;  1OB9 A;  4J9N A;  7ICK A;  4QWD A;  2B21 A;  2BCR A;  1ZQY A;  4P4O A;  4MEX A;  4KLM A;  2XO7 A;  4FS2 A;  4IQU A;  4BWM A;  5KFX A;  4F93 B;  5J0R A;  2FPK A;  5DB9 A;  4DL2 A;  3OJU A;  4ED0 A;  4DFM A;  2FLN A;  8ICB A;  2XY6 A;  1DOQ A;  1L3U A;  4KLO A;  3AJV A;  5DGA A;  2NRZ A;  4TUQ A;  9ICQ A;  1ZQT A;  2MAX A;  5J0S A;  4C8O A;  4J9R A;  5KFE A;  5J0U A;  1TKD A;  3V7L A;  4O3Q A;  4QZG A;  1RZN A;  5KFZ A;  4RT3 A;  3C5F A;  5DQI A;  7ICF A;  3GIJ A;  2I1Q A;  1S76 D;  5BOL A;  1QSL A;  1ARO P;  4PGQ A;  4P4P A;  2BPC A;  2FLL A;  4RQ7 A;  2W9A A;  4J9P A;  1S0N A;  4ED3 A;  5DDY A;  3UXN A;  2XC9 A;  4IRK A;  1Z00 B;  1ZQS A;  4MFC A;  5IIJ A;  5KFR A;  3LWM A;  1NK8 A;  1S97 A;  4MEY A;  2AQ4 A;  4JV1 A;  2HHU A;  9ICV A;  3ETL A;  2P6U A;  4RPY A;  3MBY A;  5CP2 A;  4RQ6 A;  4QZ9 A;  3RJG A;  2Y1I A;  4QZH A;  2VAN A;  2ASL A;  1H38 A;  2IBK A;  4I2C A;  3T5H A;  2UVW A;  3V6J A;  4B9V A;  3PX6 A;  1RYR A;  5HHI A;  4F4Y A;  1IXR A;  2NRX A;  2R8H A;  4R63 A;  3SZ2 A;  4FBT A;  5IIO A;  4M04 A;  4EBE A;  3FYH A;  2KFZ A;  3JPN A;  4DQP A;  1ZQV A;  4QW9 A;  3KHH A;  7ICS A;  4R64 A;  3RJE A;  4P4M A;  4M47 A;  3PNC A;  5J2G A;  5DB6 A;  1ZQB A;  4IR9 A;  3V72 A;  2AGP A;  3GFK B;  4DL5 A;  8ICR A;  2PI4 A;  3THV A;  4JUZ A;  5DQG A;  1D8Y A;  3GIK A;  2KZZ A;  3GV8 B;  1JXL A;  4YQW A;  3H8W A;  3OSN A;  4F2R A;  2V9W A;  2ZJ5 A;  4ECX A;  1NK6 A;  4UAY A;  3M8S A;  2PFN A;  3DNX A;  3ZDD A;  4ZH4 A;  1BPZ A;  1BPE A;  5HP4 A;  2P6R A;  5KFW A;  4YXM A;  1Y1O A;  4O3P A;  1L5U A;  1U49 A;  5KG7 A;  1HUZ A;  3PW5 A;  1BPD A;  3ISB A;  4DQI A;  4PHA A;  2XY7 A;  4ELV A;  3OHA A;  4KLQ A;  1D9D A;  1T0F A;  4IR1 A;  4EEY A;  2C22 A;  5HNK A;  3LK9 A;  2IMW P;  5HML A;  4RQ5 A;  2VA2 A;  3PV8 A;  3PX4 A;  4YD2 A;  5IIN A;  4YR0 A;  4Q44 A;  3K4G A;  9ICG A;  7ICH A;  4R8U A;  3RB0 A;  1ZQX A;  1ZP7 A;  3H4B A;  4DLE A;  4RQ3 A;  1UA1 A;  1S77 D;  1ZQC A;  5J2H A;  4DL4 A;  1BVS A;  2KFN A;  5DG7 A;  5KFI A;  3QEB Z;  3ZDA A;  2W9C A;  4KTQ A;  5DB7 A;  3KHR A;  3GV7 B;  1COO A;  2PFP A;  3P1Z B;  4DL6 A;  3PY8 A;  1NK0 A;  4DO9 A;  5J2D A;  4QZF A;  4I2I A;  5HHH A;  3JPT A;  1QSS A;  2R8J A;  4BXO A;  3OJS A;  3SV4 A;  8ICO A;  4YMO A;  3GQC A;  2RDI A;  3TAR A;  7ICG A;  4ED1 A;  4TQS A;  2VA8 A;  8ICE A;  3PO4 A;  4B9N A;  2MUT B;  4O3S A;  3ZDC A;  5CR0 A;  3M9M B;  4F5N A;  1XC9 A;  2XY5 A;  1GEF A;  5KG3 A;  4Q45 A;  1N48 A;  2ASJ A;  4DSK A;  9ICX A;  4QBO A;  1SKW A;  3QZ8 A;  1B22 A;  3MGI A;  3JPS A;  2VA3 A;  4KLI A;  5KFH A;  3JPQ A;  5HMM A;  2I9G A;  4IQW A;  4RUC A;  4RQ4 A;  2R8G A;  1MSW D;  3BDP A;  9ICW A;  4QZE A;  2WTF A;  1QTM A;  7ICL A;  2JZB A;  2JEG A;  1ZQU A;  5EWF A;  1D9F A;  3G6V A;  1NK5 A;  4DQR A;  1U4B A;  9ICT A;  5C5J A;  3SI8 A;  1NK4 A;  4JWM A;  4BGD A;  2W8K A;  8ICL A;  4O3R A;  4ED8 A;  9ICI A;  3H8S A;  2ASD A;  1ZQM A;  1A77 A;  3PW4 A;  1QSY A;  3RJH A;  9ICL A;  2XCP A;  4QW8 A;  4PHD A;  3RB3 A;  4ECV A;  3AJV B;  2GWS A;  1NJW A;  1RYS A;  1BPY A;  4J9K A;  4GXI A;  1KFS A;  4RQ0 A;  2C28 A;  1U47 A;  1N56 A;  1KRP A;  2WJ0 A;  4QZ8 A;  1RLV A;  3H40 A;  1ZJN A;  4DF4 A;  3TQ1 A;  4BWJ A;  4UAW A;  4E0D A;  4DSJ A;  2ZUB A;  9ICM A;  1OB8 A;  4EYH B;  3C23 A;  4QZI A;  1S0O A;  4J9L A;  3Q8K A;  5KFK A;  3N4M B;  2ATL A;  4F5R A;  3EZ5 A;  4I2J A;  5DBC A;  4J9S A;  2BCV A;  3MAB A;  4PGY A;  1UT8 A;  4UB3 A;  4M9J A;  9ICF A;  1NJX A;  1L3S A;  2M9N A;  2ZTD A;  3MR2 A;  3TFR A;  7ICT A;  1RPL A;  3OHB A;  3EYZ A;  4O3O A;  2VLD A;  1ZQO A;  4I2H A;  5DBB A;  5DB8 A;  2FCO A;  3GII A;  5CJ7 A;  4K4I A;  1T8E A;  5L9X A;  5L1I A;  2HVI A;  4JV0 A;  1X9M A;  2WCZ A;  3IEY A;  1XWL A;  4DFJ A;  1ZYQ A;  4DEZ A;  5DKW A;  2AU0 A;  4KMU A;  2DPI A;  1A79 A;  3BQT A;  4DF8 A;  2P66 A;  3PR4 A;  3IM1 A;  1XU4 A;  2WIZ A;  3UXO A;  4KLF A;  1X2I A;  4IRD A;  1B43 A;  3N97 B;  2HHW A;  4KIT B;  7ICU A;  3MR5 A;  4I2D A;  5DDM A;  1TAU A;  4GC6 A;  4P2H A;  2CV8 A;  5J2K A;  1DGS A;  3ORY A;  4M6W A;  5CHG A;  4QZB A;  2DPJ A;  3ZD8 A;  3MDA A;  4Q8F A;  4RU9 A;  9ICH A;  4O0I A;  5KFQ A;  3MGH A;  5KT5 A;  3MR6 A;  3HWT A;  4DOB A;  4DQS A;  2W8L A;  3RJK A;  3MFI A;  2FPL A;  3ISC A;  3P1Z A;  7ICR A;  5KT4 A;  1T3N A;  5KFO A;  1ZQG A;  1TK8 A;  3GDX A;  1ZQK A;  2AGQ A;  1NKC A;  3NGD A;  4DOC A;  4I2B A;  5BPC A;  8ICV A;  8ICG A;  3B0X A;  5F9L A;  1XSN A;  4M9H A;  2A1J B;  4DWI A;  3G6Y A;  4I29 A;  1TV9 A;  2XCA A;  5KT3 A;  1KLN A;  2ZYZ A;  3OGU A;  2OKF A;  5J2C A;  3Q8L A;  2BQ3 A;  4J9O A;  4EZ9 A;  1ZQD A;  2J6U A;  4M9N A;  5III A;  4BDP A;  4MFF A;  4KLD A;  1ZQR A;  4B9M A;  4LVS A;  5J0P A;  3UXP A;  9ICN A;  5KG6 A;  2PFO A;  5J0X A;  2HHS A;  2ISO A;  3HT3 A;  2KZM A;  5DG9 A;  4YN4 A;  4C8N A;  3HX0 A;  3V7J A;  5KFL A;  4RNO A;  1PZN A;  4UBC A;  5KFY A;  3ISD A;  2W9M A;  2F1H A;  1TK0 A;  4DQQ A;  2BQR A;  3HPO A;  4ED7 A;  5J29 A;  2NRT A;  4KLS A;  5FDK A;  2BHN A;  1KTQ A;  3C1Z A;  5DG8 A;  5J0T A;  5KFV A;  4TUS A;  2AGO A;  1NKB A;  1KSP A;  1XO1 A;  2Y1J A;  5D4B A;  4LZG A;  2ISP A;  3K75 D;  4KLG A;  8ICQ A;  3RRH A;  5IIK A;  1RXV A;  5KFU A;  4TQR A;  5J2F A;  4J9M A;  4F5Q A;  4BXO B;  8ICS A;  1Y88 A;  4NLK A; 
#chains in the Genus database with same CATH topology
 2FJ6 A;  2KK0 A;  2HBM A;  2K8C B;  5D49 A;  9ICE A;  4QZC A;  1BPX A;  2KJ5 A;  3OPX A;  5L1K A;  2GH1 A;  2XVT A;  5KNI A;  3K1Z A;  4DFP A;  4Y2J A;  2DGZ A;  3QNM A;  3LYS A;  2IOH A;  5CB1 A;  4C80 A;  4MF8 A;  2KVS A;  3EPI A;  1NJZ A;  3LWL A;  2D8C A;  8ICZ A;  4TKK A;  3BQ7 A;  4G3I A;  1PK1 B;  5J0W A;  1ZQH A;  4O5E A;  2EAM A;  3IF0 X;  2K4P A;  2NO5 A;  4ECY A;  2A1J A;  4RPZ A;  3GIL A;  2DFL A;  3RH4 A;  4JV2 A;  3LDA A;  2F8L A;  3HP6 A;  4NY8 A;  5H2F U;  2ZIX B;  1NOM A;  2C2E A;  2DWQ A;  2ZIU A;  3TAP A;  4NLB A;  1ZRM A;  4Z6E A;  5KFN A;  5J2A A;  2MUT A;  5KG4 A;  3TAN A;  3D2S A;  5AKZ A;  2ZJ8 A;  4B9U A;  5KG0 A;  2JEJ A;  1SL2 A;  4F4K A;  5KFT A;  3I1Y A;  2R8K A;  3Q8R B;  4PJ0 U;  3NVZ A;  2F77 X;  5AM0 A;  1S9F A;  9ICR A;  1Z00 A;  2LM4 A;  2ZYZ B;  5TZV A;  2G07 A;  3RR7 A;  3C2L A;  8ICF A;  3ZDE A;  3V6K A;  4DSL A;  4DA2 A;  4DAV A;  4I27 A;  1Q3V A;  4GXJ A;  1WCN A;  4OJ6 A;  4ECZ A;  4F3O A;  2GLE A;  1QH9 A;  1N5W A;  4F71 A;  4R8U B;  2E8N A;  1SZH A;  2ALZ A;  4UB8 U;  5KTQ A;  2W9C B;  4NV0 A;  2FMP A;  2BR0 A;  9ICC A;  2FKC A;  3KFU F;  1RG6 A;  7ICN A;  2W03 A;  4BUG A;  2WHE A;  1SL0 A;  2KOB A;  3BQ1 A;  5AKK A;  4UB5 A;  9ICJ A;  1JN3 A;  3U26 A;  5KFM A;  4QZA A;  4RZR A;  7ICM A;  3NVY A;  1ZQJ A;  2OXO A;  5L1J A;  1XSL A;  4DFK A;  2C2D A;  3T5L A;  1L3V A;  3BQ2 A;  4EYI B;  3RFA A;  4MF2 A;  4NWI A;  4K4H A;  4KLH A;  3OSP A;  8ICT A;  1NJY A;  1K1S A;  4EBC A;  2XGQ A;  1Z1V A;  4ECQ A;  8ICI A;  1KN5 A;  3M8R A;  1N60 A;  1A0P A;  2LYA A;  7ICE A;  1UPH A;  1JI7 A;  2F1J A;  4E6Z A;  5FP0 A;  2WF5 A;  1U9L A;  4DCC A;  1FO4 A;  4F5O A;  3AU6 A;  5J0Y A;  4PL2 A;  2PXI A;  1J97 A;  1ZQA A;  4NM1 A;  2Q0Z X;  3PVX A;  1SV0 C;  5DGB A;  4ECW A;  9ICS A;  3H8J A;  4PPX A;  4PHE A;  3EWA A;  2Z7J A;  1N62 A;  3KTQ A;  5AKY A;  2DF4 B;  4RQ1 A;  2WF9 A;  3NAS A;  4B9T A;  2KV2 A;  3PR5 B;  5ALF A;  1Q3U A;  3B0Y A;  2W11 A;  2F1I A;  1LKY A;  5AM1 A;  5AK3 A;  4RPX A;  9ICA A;  3QXG A;  1LB2 B;  1TE2 A;  4YFK A;  4YMM A;  2GW6 A;  1ZD3 A;  3QUC A;  1SKS A;  1UWV A;  4J9N A;  2B21 A;  2BCR A;  4MEX A;  2XO7 A;  5KFX A;  4F93 B;  5J0R A;  1WYG A;  3OJU A;  8ICB A;  3AJV A;  2NRZ A;  1ZQT A;  5J0U A;  2XI9 A;  4KX5 A;  5KFZ A;  4RT3 A;  3HRD D;  5DQI A;  4P4P A;  3H0M B;  2BPC A;  1ZQS A;  4MFC A;  1NK8 A;  3SAF A;  9ICV A;  4QJF B;  1DK3 A;  2P6U A;  3MBY A;  5CP2 A;  4RQ6 A;  2GOL A;  2VAN A;  2ASL A;  4I2C A;  1URJ A;  2YMQ A;  1XNS A;  2W3R A;  1V85 A;  4R63 A;  4EBE A;  3FYH A;  3KHH A;  2B6G A;  5AKJ A;  4IR9 A;  3V72 A;  2PMZ C;  8ICR A;  2CN1 A;  5AKL A;  4AP9 A;  4JUZ A;  2HOI A;  2KZZ A;  3GV8 B;  3OSN A;  3KOO A;  4UAY A;  2PFN A;  2O6K A;  2H3F A;  4ZH4 A;  1BPZ A;  3UMC A;  4O3P A;  3IP4 B;  2Y9U A;  5KG7 A;  5AKX A;  3PW5 A;  4PHA A;  4KLQ A;  3F5E A;  1PVQ A;  1D9D A;  2W8M A;  5HNK A;  2IMW P;  5HML A;  2ZG6 A;  1CRX A;  1IG6 A;  4USA A;  2HSZ A;  4EEN A;  5IIN A;  4YD2 A;  2HOQ A;  3NRZ A;  2F76 X;  2HI0 A;  4DLE A;  1UA1 A;  4C4R A;  1GO3 F;  5ALU A;  5J2H A;  3KBB A;  1BVS A;  5KFI A;  2KVC A;  3VCB A;  4KTQ A;  1RYU A;  3PY8 A;  1NK0 A;  2R8J A;  4YMO A;  3GQC A;  3PSI A;  1DRG A;  2VA8 A;  2Q4T A;  3PO4 A;  4B9N A;  4O3S A;  1HIW A;  3ZDC A;  5CR0 A;  1XC9 A;  2XY5 A;  2I5H A;  4Q45 A;  1SKW A;  4KMO B;  3GU3 A;  4IQW A;  2R8G A;  3BDP A;  4Y2T A;  1ZQU A;  2JR5 A;  2MU2 A;  3G6V A;  1D8B A;  4JWM A;  8ICL A;  4US8 A;  3H8S A;  2ASD A;  1ZQM A;  1QSY A;  3RJH A;  2XCP A;  3S6J A;  4PHD A;  5AHX A;  3AJV B;  1NJW A;  2WJ0 A;  1OB8 A;  4EYH B;  2WF8 A;  5AKI A;  5KFK A;  4F5R A;  4FZL A;  3EZ5 A;  4LJX A;  2BCV A;  2HOF A;  1JUD A;  4UB3 A;  4M9J A;  1YZ7 A;  2JH1 A;  1L3S A;  7ICT A;  5F3X B;  2VLD A;  1N61 A;  2LI6 A;  1S5L U;  3HKZ C;  2OH2 A;  5L1I A;  4JV0 A;  1XWL A;  3BZC A;  5TIS U;  2AU0 A;  4KMU A;  3BQT A;  3IM1 A;  2WIZ A;  1YT3 A;  4IRD A;  2HHW A;  2KEY A;  4C7Y A;  1TAU A;  5J2K A;  1DGS A;  4M6W A;  3ZD8 A;  4Q8F A;  1FFV A;  2FPL A;  5KFO A;  1TK8 A;  3GDX A;  1Z1B A;  1ZQK A;  2AGQ A;  1UHU A;  8ICV A;  1WUD A;  1ED1 A;  2A1J B;  4DWI A;  1TV9 A;  2XCA A;  2ZYZ A;  2FKH B;  5J2C A;  2LKY A;  3O0F A;  1ZQD A;  2W55 A;  1MA7 A;  4Y2V A;  2H3V A;  3AL0 B;  1XO0 A;  1PZN A;  3A0H U;  3E0F A;  3QU2 A;  2KIW A;  5FDK A;  4TUS A;  1NKB A;  4LZG A;  3HKZ F;  2FLC A;  2Y0S F;  3TKA A;  1Y88 A;  2BZF A;  2KP7 A;  8ICJ A;  2AQ0 A;  3M9N B;  1L7P A;  2AHO B;  4UB4 A;  1NNL A;  4R66 A;  4LZD A;  9ICO A;  2H3I A;  3RJF A;  3SV3 A;  4O9M A;  1HH1 A;  4F4W A;  4FO6 A;  3Q8S B;  2BPG A;  2JXJ A;  1EXN A;  4QNL A;  4F50 A;  3SEI A;  4R65 A;  1R0V A;  4FBU A;  8ICY A;  4B9S A;  2OYY A;  2IHM A;  4I2E A;  4C4S A;  2WCW A;  2ZUD A;  4C8M A;  4FE3 A;  1LV5 A;  2KN7 A;  4I2F A;  2BGW A;  3DV9 A;  2K8B B;  1S0V A;  1S0M A;  2D3D A;  2BCU A;  1ZQW A;  3WKE A;  4QWA A;  2OWO A;  1ZQ1 C;  9ICB A;  4XQ8 A;  8ICM A;  2ES6 A;  1Q46 A;  2CPR A;  5JUM A;  5KFS A;  3K1R B;  2RLT A;  4QWB A;  2LYH A;  3QE9 Y;  2HHX A;  2QAR A;  5EOZ A;  5L1M A;  2HDO A;  3UPQ A;  5ALM A;  5ALO A;  1CUK A;  1V9P A;  2H3Q A;  3C1Y A;  4G6U A;  3BS5 A;  3T5J A;  1L3T A;  2AJQ A;  1QQ6 A;  4YXJ A;  3RBE A;  1R11 A;  2OM6 A;  1BNO A;  4UB6 U;  1QQ7 A;  1X9X A;  5J2B A;  3JPP A;  3PW7 A;  4XRH A;  2WIW A;  1K1Q A;  4C8K A;  2KD1 A;  4U7C A;  3ZD9 A;  1KBU A;  4YR2 A;  3PSP A;  5KG2 A;  3PMN A;  1F5S A;  3Q8P B;  5CWR A;  1ZQN A;  2VKQ A;  2NRW A;  3RR8 A;  2EZX A;  7ICO A;  1VDV A;  2Y0S C;  2W9B A;  3RB6 A;  4ACO A;  4NM2 A;  1SV4 A;  3DEE A;  3WU2 U;  4OD0 A;  4NLG A;  3L3F X;  2DKX A;  2OST A;  2W54 A;  4K4G A;  1L8L A;  5KG5 A;  3RRG A;  8ICW A;  1U45 A;  4Y2U A;  2R18 A;  4DS4 A;  5DLF A;  5KFC A;  2KNJ A;  2HBJ A;  2ESE A;  8ICC A;  2UVR A;  3M1Y A;  1MQ3 A;  4UAZ A;  2ZIV A;  2JRZ A;  1PK1 A;  1RDF A;  4UW9 A;  5J2J A;  3PML A;  4PHP A;  2KZ3 A;  5B5E U;  4NXZ A;  4ED2 A;  1SL1 A;  4PH5 A;  1XMX A;  3H8M A;  4DSI A;  3PO5 A;  2GO7 A;  2UVV A;  3UQ2 A;  2FMS A;  1V38 A;  1ZQP A;  3WKD A;  2RRD A;  4C4T A;  1RZT A;  3RH5 A;  2HHQ A;  4UB1 A;  3WKA A;  1T4G A;  2XGP A;  8ICP A;  3UQ0 A;  1Z3E B;  4DL3 A;  3RBD A;  8ICU A;  4FZM A;  1MQ2 A;  5KFG A;  4ED6 A;  1JX4 A;  4RNM A;  3N7S C;  2QB0 A;  4IQV A;  5J2I A;  2KHV A;  3TI0 A;  4GXK A;  4DOA A;  3E2E A;  4YMN A;  4OJP A;  1RXW A;  1KFT A;  2E1E A;  1JAL A;  2YML A;  2B0C A;  4P4O A;  2W3S A;  3L5K A;  4FS2 A;  4IQU A;  4IRK A;  3P1Y A;  5DB9 A;  1L3U A;  4KLO A;  2IXS A;  2MAX A;  5J0S A;  4C8O A;  2L5Y A;  2XID A;  3V7L A;  4QZG A;  4F72 A;  2KJ9 A;  2WB1 C;  2YTU A;  3C5F A;  1S76 D;  5BOL A;  1KL9 A;  4NJ8 A;  5KL1 B;  2W7O A;  4RQ7 A;  2W9A A;  3IDW A;  4J9P A;  5DDY A;  3UXN A;  1Z00 B;  3AM9 A;  5IIJ A;  5KFR A;  1S97 A;  4JV1 A;  5B66 U;  2HHU A;  3ETL A;  4RPY A;  3RJG A;  2CRX A;  2EAO A;  2Y1I A;  1H38 A;  4IC9 A;  4B9V A;  2KJ8 A;  1RYR A;  3SD7 A;  4F4Y A;  2WF7 A;  2FDR A;  2YMP A;  5HHI A;  3SZ2 A;  5IIO A;  5ALG A;  4DQP A;  1NZB A;  7ICS A;  3RJE A;  4P4M A;  3PNC A;  3KD3 A;  4DL5 A;  2VJ5 A;  3THV A;  1D8Y A;  1QCK A;  2W7P A;  1JXL A;  3H8W A;  5ALR A;  1NK6 A;  1AQ6 A;  1BPE A;  4HAI A;  5HP4 A;  5KFW A;  5AI8 A;  2HCF A;  1L5U A;  2KSO B;  1DGJ A;  2XY7 A;  2G09 A;  5ALP A;  2C22 A;  3LK9 A;  2VA2 A;  3PV8 A;  2NO4 A;  3ETR A;  4Q44 A;  3K4G A;  1LVH A;  2YX8 A;  3QU7 A;  1Q8K A;  3H4B A;  1ZQC A;  2KFN A;  3MGV A;  3WK8 A;  3KHR A;  2PFP A;  3P1Z B;  4DL6 A;  4DO9 A;  5J2D A;  4K4I A;  2RDI A;  7ICG A;  4ED1 A;  4DFD A;  1N5X A;  4QIW C;  5AIB A;  2DBY A;  5CEH A;  4QBO A;  3MGI A;  1ZD5 A;  5KFH A;  2I9G A;  1MSW D;  4RUC A;  4RQ4 A;  9ICW A;  2NYV A;  1NK5 A;  1U4B A;  3D6J A;  3F5A A;  4O3R A;  4ED8 A;  4CGZ A;  3NVW A;  1RQL A;  2G0A A;  9ICL A;  4ECV A;  2GWS A;  3UMG A;  1RYS A;  4GXI A;  2ZXH A;  1N56 A;  3H40 A;  1ZJN A;  4E0D A;  4QZI A;  4J9L A;  3N4M B;  5DBC A;  4RQM A;  2M9N A;  3WK9 A;  3TFR A;  5ALI A;  1RPL A;  3EYZ A;  4O3O A;  5AK6 A;  2FCO A;  5L9X A;  3IEY A;  2WAQ F;  3FC4 A;  1ZYQ A;  4DFJ A;  5DKW A;  2P66 A;  3PR4 A;  2QKQ A;  4KLF A;  1CI4 A;  7ICU A;  4KIT B;  2K60 A;  4P2H A;  2CV8 A;  4QZB A;  3ORY A;  3BZK A;  2DPJ A;  5KFQ A;  3MFI A;  3P1Z A;  3QUB A;  5KT4 A;  2K4I A;  1T3N A;  3SQI A;  1ZQG A;  4G9B A;  5AI9 A;  4DOC A;  3NGD A;  2MRL A;  2KIV A;  5F9L A;  3VC8 A;  4I29 A;  3I28 A;  3NUQ A;  4AYB C;  1KLN A;  2BQ3 A;  2J6U A;  3AQF A;  4LVS A;  3UXP A;  5T14 A;  2ISO A;  2ZIU B;  2KZM A;  5DG9 A;  1PK3 A;  5KFL A;  1TK0 A;  2YB4 A;  2WAQ C;  2AGO A;  2QAR B;  4P0Q B;  3TAD A;  3SEN A;  4KLG A;  8ICQ A;  3RRH A;  3J81 j;  5KFU A;  4F5Q A;  5J2F A;  1NZP A;  4NLK A;  5AIC A;  1IPI A;  2KG5 A;  3AMZ A;  3PX0 A;  1X9S A;  1HJP A;  5DLG A;  2HBL A;  4F4X A;  1SXE A;  2EH9 A;  2IOF A;  5KFB A;  3BJY A;  2V4R A;  1ZQQ A;  9ICK A;  2JZB B;  4Y2Y A;  5IIL A;  5DBA A;  4BJQ A;  4F4Z A;  1C20 A;  4YCX A;  1PVR A;  2V4Q A;  4M9L A;  1COK A;  9ICP A;  1QQ5 A;  2JJQ A;  4M9G A;  5J8Y C;  3MDC A;  3BQ0 A;  3QUQ A;  4M0A A;  3C2M A;  2LMR A;  4QZD A;  4O3M A;  9ICU A;  1WWV A;  2HVH A;  2FL3 A;  4EEK A;  2EO0 A;  3ALR A;  5DQH A;  4JK1 A;  4YP3 A;  3Q8M A;  3Q8Q B;  4PGX A;  2EDU A;  5ALH A;  1CEZ A;  3HIL A;  4UAV A;  1TVA A;  1KEJ A;  3KKA C;  4JWN A;  1MC8 A;  3SYZ A;  2FLP A;  1BNP A;  5G5H A;  1WG8 A;  4X5V A;  3TAC B;  5KT2 A;  2G06 A;  3H7I A;  3L4P A;  1T7P A;  2D6F C;  4QBN A;  1SB3 C;  2J6T A;  1JRO A;  3AQE A;  4IRC A;  4C8L A;  1TAM A;  3KZX A;  2INB A;  4WJ3 B;  1ZJM A;  3PW0 A;  4B9L A;  4TUR A;  4O3N A;  5AI5 A;  1T3Q A;  5EE0 A;  1TK5 A;  4EEL A;  5AI6 A;  2JV3 A;  1ZQF A;  4QBL A;  4I28 A;  3LVW A;  2LPE A;  2UVU A;  2ZTE A;  7ICQ A;  1A76 A;  1ZD4 A;  1X9W A;  1ZQZ A;  4KN4 A;  8ICN A;  1TFR A;  4Y2P A;  5GTI U;  3M9O B;  5D46 A;  1XS9 D;  2PI5 A;  1UA0 A;  2WF6 A;  4Q43 A;  5ALX A;  3CNH A;  4Z6F A;  4DS5 A;  5J0Q A;  5CA7 A;  3I76 A;  3GIM A;  1UT5 A;  3G6X A;  1D8L A;  5E79 U;  4US9 A;  2JMG A;  2IHN A;  3ZDB A;  3IHQ B;  1RM6 C;  4DSE A;  2ZJA A;  4RQ8 A;  2CXY A;  1SKR A;  4P0P B;  4C7Z A;  1BPB A;  3C5G A;  1JXE A;  2H5X A;  5J0O A;  1Z4O A;  5IIM A;  4KLE A;  4ECT A;  4M2Y A;  2BKE A;  3HJE A;  4TKD A;  5AKG A;  3C21 A;  1F1Z A;  1SXD A;  4MFA A;  3RTV A;  2AXT U;  3N28 A;  2R8I A;  1SGG A;  4KN7 A;  4Q8E A;  4ECR A;  2BPF A;  3WK6 A;  4TUP A;  4Y2R A;  1F0M A;  4M6W B;  2ZIW A;  4CF4 A;  3V6H A;  3TFS A;  4F8R A;  3R9K A;  1X66 A;  4ELT A;  3CYM A;  7ICP A;  1NK9 A;  3HW8 A;  2KMD A;  1ZET A;  4QWC A;  1KDH A;  2FMQ A;  5ALS A;  5JRT A;  5ALL A;  3RJJ A;  1Z4N A;  2JEI A;  1VLB A;  4Z6C A;  2QLT A;  1OB9 A;  7ICK A;  1ZQY A;  4DL2 A;  2FLN A;  2FPK A;  1DOQ A;  2G5H B;  3F2D A;  4PL1 A;  4TUQ A;  9ICQ A;  4J9R A;  5KFE A;  3KKA A;  5ALE A;  1FEZ A;  3NS1 A;  1B0X A;  2I1Q A;  1QSL A;  2XC9 A;  1RQN A;  5ALT A;  4MEY A;  4QIW F;  4OO1 J;  3IEY B;  2E5S A;  4QZH A;  2E8P A;  2IBK A;  3T5H A;  1IV8 A;  3V6J A;  3PX6 A;  2G5I B;  3PST A;  2NRX A;  2R8H A;  3ONN A;  3JPN A;  5JU5 A;  5AM3 A;  2LYB A;  4M47 A;  1T94 A;  4OCZ A;  2AGP A;  3F2B A;  1L7M A;  4YQW A;  4F2R A;  2DQN B;  4ECX A;  3M8S A;  3DNX A;  1Y1O A;  2P6R A;  2ZXI A;  1U49 A;  3ISB A;  4DQI A;  1IIP A;  3F53 A;  5K4L A;  4IR1 A;  3N7P D;  4RQ5 A;  1N63 A;  1O08 A;  5AM5 A;  1K5O A;  7ICH A;  1ZQX A;  1ZP7 A;  5EE3 A;  5DG7 A;  3QEB Z;  1OUQ A;  2W9C A;  1X42 A;  5DB7 A;  2M0N A;  3C28 A;  4QZF A;  4I2I A;  2HBK A;  1QSS A;  3SV4 A;  8ICO A;  2YN4 A;  4TQS A;  8ICE A;  2E3T A;  3M9M B;  4F5N A;  4A8E A;  1X6J A;  2ASJ A;  4DSK A;  3IRU A;  5HR7 A;  3QZ8 A;  1B22 A;  4NL9 A;  3JPS A;  2VA3 A;  4OJ5 A;  4KLI A;  2VJ4 A;  2VS1 A;  2QB0 B;  5HMM A;  3JPQ A;  7ICL A;  3F2C A;  4CF5 A;  2JZB A;  2JEG A;  1D9F A;  9ICT A;  5C5J A;  3SI8 A;  4BGD A;  5ALN A;  9ICI A;  2F3N A;  5ALY A;  3SR6 A;  1P7D A;  2K4H A;  3RB3 A;  3FAH A;  4J9K A;  4RQ0 A;  4C0Z A;  4QZ8 A;  3TQ1 A;  4UAW A;  2CZR A;  2ZUB A;  1S0O A;  3Q8K A;  2ATL A;  4I2J A;  2MA1 A;  4NLC A;  3MAB A;  4PGY A;  1UT8 A;  1VJ5 A;  2BH2 A;  1NJX A;  2ZTD A;  3MR2 A;  3OHB A;  4I2H A;  2PMZ F;  3GII A;  5CJ7 A;  2HVI A;  2WCZ A;  4DEZ A;  2ZIX A;  1ZD2 P;  3WKC A;  4DF8 A;  1UCV A;  3UXO A;  2ODG A;  1X2I A;  1OW5 A;  5HR6 A;  3NVV A;  3N97 B;  4U6P A;  5DDM A;  2FE9 A;  5CHG A;  3E58 A;  3HWT A;  4DQS A;  2JH7 A;  2W8L A;  3IV6 A;  7ICR A;  3WK4 A;  3PSF A;  4IS7 A;  1NKC A;  3QX7 A;  5AIA A;  4Y2Q A;  4I2B A;  3BT7 A;  5BPC A;  2OHF A;  1PUZ A;  1XSN A;  4M9H A;  4BX9 C;  3G6Y A;  4UAT A;  1DK2 A;  5AM2 A;  4CDG A;  2OKF A;  3SMV A;  3Q8L A;  4J9O A;  4EZ9 A;  2EQY A;  4MFF A;  4BDP A;  1ZQR A;  4B9M A;  9ICN A;  4OJL A;  1MN8 A;  2KHQ A;  4YN4 A;  4UAU A;  4C8N A;  3HX0 A;  4MHV A;  3ISD A;  2W9M A;  2F1H A;  2DUY A;  1L7N A;  3HPO A;  4ED7 A;  3H0L B;  5J29 A;  2NRT A;  2BHN A;  2KIC A;  5J0T A;  5KFV A;  1XO1 A;  5D4B A;  2E1F A;  3K75 D;  5IIK A;  4BXO B;  4J9M A;  8ICS A;  1L8O A;  1OXJ A;  3ICX A;  1S8O A;  5AI4 A;  2ZUC A;  3BS5 B;  1M6Y A;  2LHT A;  1FIQ A;  2IOF K;  4KLT A;  4F91 B;  1NKE A;  5EWG A;  4YVZ A;  3EUB 2;  2NV3 A;  4EZ6 A;  1X6I A;  4JB3 A;  3QEA Z;  1PVP A;  3OTQ A;  5KFP A;  7ICJ A;  3RAX A;  4XA5 A;  4P0P A;  4DSF A;  5KFJ A;  1HUO A;  4J03 A;  3JPO A;  1BGX T;  1UQV A;  3KZI U;  2E8O A;  1ZQL A;  1U48 A;  3FOV A;  1YZ6 A;  2K89 A;  4NL9 C;  5KG1 A;  5BOM A;  2P35 A;  5EE1 A;  5KFA A;  1KKX A;  2W9B B;  1X40 A;  3N7R C;  5ALD A;  1JIH A;  4ELU A;  3WK5 A;  3C2K A;  1SIJ A;  1SZP A;  4CE6 A;  3RJI A;  1TAQ A;  4QWE A;  4GFJ A;  4GC7 A;  2EZZ A;  3H4D A;  3JPR A;  2I6X A;  4HYK A;  8ICA A;  4ECU A;  2K4E A;  2EAP A;  5AK4 A;  1NK7 A;  4KLU A;  3V7K A;  3RH6 A;  2XIC A;  1XSP A;  3D2N A;  3MC1 A;  4RQN A;  4KX3 A;  2NRV A;  3TAD C;  3FDS A;  4NLZ A;  5ALZ A;  4IL6 U;  2PFQ A;  2BCQ A;  5ALV A;  5AKE A;  3DDH A;  3EW9 A;  2C2R A;  5KT7 A;  1Z19 A;  5JTI A;  2BQU A;  3QU4 A;  1DXS A;  4RNN A;  4DLG A;  2A19 A;  5EWE A;  2RQ5 A;  4XUS A;  3UM9 A;  8ICX A;  4YD1 A;  7ICV A;  1S10 A;  4CNQ A;  5KT6 A;  4F2S A;  3GV5 B;  2F8K A;  3AEV A;  5KL8 B;  2Y9T A;  3KHL A;  3UMB A;  1F44 A;  3CW2 C;  2VIX A;  3PW2 A;  2PKE A;  3T79 A;  2BDP A;  4I2G A;  2HMX A;  1YNM A;  5KFF A;  2KE7 A;  1L7O A;  4Z6D A;  4RT2 A;  4G6V A;  4PZN A;  4J9Q A;  1IM4 A;  4YG2 A;  1JRP A;  3RAQ A;  4UB2 A;  1JMS A;  2DBS A;  3TAQ A;  2WB1 F;  3KHG A;  4EBD A;  2KSO A;  1GEF A;  5F9N A;  2HW3 A;  4UQG A;  4ECS A;  3T5K A;  5AKH A;  8ICK A;  2RDJ A;  4GLX A;  1ZQE A;  1V97 A;  4CF3 A;  1SWW A;  1C7Y A;  4F92 B;  4RUA A;  3T3F A;  2RP5 A;  4EX6 A;  4DL7 A;  7ICI A;  3QYP A;  1KFD A;  8ICH A;  2J6S A;  2FI1 A;  4I2A A;  3A0B U;  5J2E A;  2JHD A;  2HHT A;  3WKB A;  4O5C A;  3QZ7 A;  4Y2X A;  3AUO A;  2FPM A;  4ICA A;  4RQ2 A;  2ZTC A;  2LBO A;  1HEK A;  5C0Y A;  4FS1 A;  4UBB A;  2BCS A;  2HHV A;  3WK7 A;  1WCL A;  1ZXI A;  2JEF A;  2H3Z A;  3RB4 A;  5A0L A;  2G08 A;  2DL0 A;  1NI3 A;  4F5P A;  5J8Y A;  1QLN A;  5L1L A;  2YMM A;  4KLJ A;  1ZQI A;  4O5K A;  3MFH A;  3MR3 A;  4NLN A;  5KFD A;  4CCH A;  4IQT A;  3AU2 A;  3GZF A;  1N2X A;  4YR3 A;  5G5G A;  3EPG A;  5AK5 A;  3CP8 A;  3NTU A;  1B4F A;  2KTQ A;  2GJW A;  2IA6 A;  3M6K A;  4KLL A;  4JMU A;  4QWD A;  4KLM A;  3IG8 A;  3H0R B;  4BWM A;  2W04 A;  4ED0 A;  4DFM A;  2XY6 A;  5DGA A;  3M7D A;  4DAP A;  3ED5 A;  1TKD A;  2K8A A;  4O3Q A;  1FFU A;  1RZN A;  7ICF A;  3GIJ A;  2W43 A;  1ARO P;  4PGQ A;  2FLL A;  1S0N A;  4ED3 A;  3LWM A;  5KAI U;  2AQ4 A;  5CRX A;  4QZ9 A;  2UVW A;  2OEH A;  1IXR A;  1J2M A;  4FBT A;  4M04 A;  3IN5 A;  2KFZ A;  2YQE A;  1ZQV A;  4QW9 A;  4CRX A;  4R64 A;  1SV0 A;  4FZN A;  5J2G A;  5DB6 A;  1ZQB A;  1KW4 A;  3GFK B;  2PI4 A;  5DQG A;  3GIK A;  2BDU A;  2AH5 A;  3SAH A;  2V9W A;  2ZJ5 A;  5AI0 A;  3ZDD A;  4YXM A;  1HUZ A;  4P0Q A;  1ECW A;  1SWV A;  1BPD A;  4ELV A;  3OHA A;  2WFA A;  3D2Q A;  1T0F A;  4EEY A;  4PZO A;  2QB1 A;  4EX7 A;  3PX4 A;  3B9J A;  4YR0 A;  4B6J A;  3RF9 A;  5AM4 A;  2OCE A;  9ICG A;  3IG5 A;  4R8U A;  3RB0 A;  3LVV A;  4RQ3 A;  1S77 D;  4DL4 A;  3CRX A;  3ZDA A;  2YY6 A;  2A3V A;  3GV7 B;  1COO A;  3JPT A;  4BXO A;  5HHH A;  3OJS A;  3TAR A;  3C29 A;  4UAS A;  2MUT B;  2A1A A;  4FFD A;  5KG3 A;  1N48 A;  9ICX A;  5GTH U;  5ALQ A;  4LQE A;  3QU5 A;  4QZE A;  2WTF A;  1QTM A;  2KKV A;  5EWF A;  4DQR A;  1NK4 A;  3NRW A;  2W8K A;  3FM9 A;  3QU9 A;  1A77 A;  3PW4 A;  4QW8 A;  2ZIW B;  1BPY A;  2E8M A;  1KFS A;  2C28 A;  1U47 A;  1KRP A;  2JGA A;  1J2N A;  2EZY A;  1RLV A;  1LKY B;  2DKZ A;  4DF4 A;  4BWJ A;  4DSJ A;  9ICM A;  3C23 A;  2KKP A;  4J9S A;  2N1R A;  2F44 A;  9ICF A;  1ZRN A;  2MSN A;  1ZQO A;  5DBB A;  5DB8 A;  2RHF A;  4Y2S A;  4UAR A;  1T8E A;  1X9M A;  4EV1 A;  1ZOL A;  5ALW A;  2DPI A;  1A79 A;  1XU4 A;  1B43 A;  3ZI4 A;  3MR5 A;  2LM1 A;  4I2D A;  3BS7 A;  3SAG A;  4GC6 A;  2Z0R A;  3MDA A;  9ICH A;  4RU9 A;  3PZP A;  4O0I A;  3MGH A;  3RJK A;  5KT5 A;  3MR6 A;  4DOB A;  3ISC A;  4OJO A;  1KQQ A;  5ALJ A;  4AYB F;  1A6S A;  5EE9 A;  8ICG A;  3B0X A;  2ZIV B;  4ZOH C;  5ALK A;  5KT3 A;  3OGU A;  4GIB A;  5KAF U;  4M9N A;  5III A;  4KLD A;  5J0P A;  5KG6 A;  2PFO A;  5J0X A;  2HHS A;  3HT3 A;  1WWU A;  1O03 A;  3V7J A;  4RNO A;  4UBC A;  5KFY A;  4DQQ A;  2BQR A;  3QUT A;  4KLS A;  1L6N A;  5DG8 A;  1KTQ A;  3C1Z A;  1KSP A;  2Y1J A;  2EAN A;  2ISP A;  3AN1 A;  1RXV A;  4TQR A;  2F2A B;  4ZQU A;  2YB1 A;  3M6Z A; 
#chains in the Genus database with same CATH homology
 1IPI A;  8ICJ A;  2AQ0 A;  3M9N B;  2ZUC A;  4UB4 A;  3PX0 A;  1X9S A;  1HJP A;  5D49 A;  9ICE A;  4KLT A;  4R66 A;  4LZD A;  4QZC A;  4F91 B;  5DLG A;  1BPX A;  9ICO A;  1NKE A;  4F4X A;  3RJF A;  3SV3 A;  5EWG A;  4O9M A;  5L1K A;  4YVZ A;  1HH1 A;  4EZ6 A;  5KFB A;  3BJY A;  4F4W A;  4FO6 A;  4DFP A;  2V4R A;  1ZQQ A;  3Q8S B;  2BPG A;  3QEA Z;  5KFP A;  9ICK A;  2JZB B;  7ICJ A;  5CB1 A;  5IIL A;  1EXN A;  5DBA A;  4F4Z A;  3RAX A;  4MF8 A;  4XA5 A;  3P1Y A;  3EPI A;  4YCX A;  4DSF A;  5KFJ A;  1NJZ A;  4F50 A;  1HUO A;  3LWL A;  8ICZ A;  4TKK A;  2V4Q A;  4R65 A;  4M9L A;  3JPO A;  1BGX T;  1ZQL A;  9ICP A;  1R0V A;  4G3I A;  1U48 A;  4FBU A;  5J0W A;  8ICY A;  4M9G A;  2JJQ A;  1ZQH A;  4B9S A;  4O5E A;  3FOV A;  2IHM A;  4I2E A;  3MDC A;  5KG1 A;  5BOM A;  5KFA A;  3BQ0 A;  2W9B B;  4M0A A;  3C2M A;  2WCW A;  3IF0 X;  2ZUD A;  4C8M A;  4ECY A;  2A1J A;  4QZD A;  4RPZ A;  1JIH A;  3GIL A;  1LV5 A;  4ELU A;  2KN7 A;  4I2F A;  2DFL A;  9ICU A;  3C2K A;  3RH4 A;  2BGW A;  3RJI A;  1SZP A;  4JV2 A;  3LDA A;  3HP6 A;  4NY8 A;  2HVH A;  1TAQ A;  4QWE A;  1S0V A;  1S0M A;  4GC7 A;  3H4D A;  2BCU A;  1ZQW A;  3JPR A;  2FL3 A;  4HYK A;  8ICA A;  4ECU A;  4KLU A;  1NOM A;  1NK7 A;  2C2E A;  4QWA A;  2EO0 A;  2OWO A;  3V7K A;  3RH6 A;  3TAP A;  9ICB A;  5DQH A;  4JK1 A;  4XQ8 A;  4YP3 A;  1XSP A;  8ICM A;  3Q8M A;  5JUM A;  3Q8Q B;  4PGX A;  5KFS A;  2NRV A;  4Z6E A;  5KFN A;  5J2A A;  2MUT A;  5KG4 A;  3FDS A;  3TAN A;  1CEZ A;  4NLZ A;  4QWB A;  1TVA A;  2LYH A;  2PFQ A;  1KEJ A;  3QE9 Y;  2ZJ8 A;  2BCQ A;  2HHX A;  5EOZ A;  3EW9 A;  2C2R A;  5KG0 A;  4B9U A;  2JEJ A;  5KT7 A;  1MC8 A;  1SL2 A;  4F4K A;  4JWN A;  3SYZ A;  2FLP A;  5KFT A;  3UPQ A;  2BQU A;  2R8K A;  4X5V A;  1CUK A;  1V9P A;  3C1Y A;  3Q8R B;  4G6U A;  3T5J A;  2AJQ A;  1S9F A;  4RNN A;  1L3T A;  9ICR A;  1Z00 A;  4YXJ A;  3RBE A;  2ZYZ B;  5TZV A;  3RR7 A;  1R11 A;  3C2L A;  5KT2 A;  4DLG A;  8ICF A;  3H7I A;  1T7P A;  3ZDE A;  5EWE A;  3V6K A;  3JPP A;  4XUS A;  5J2B A;  4DSL A;  8ICX A;  3PW7 A;  4XRH A;  4DA2 A;  4I27 A;  4DAV A;  1K1Q A;  4QBN A;  2WIW A;  2J6T A;  4YD1 A;  4C8K A;  7ICV A;  1S10 A;  4GXJ A;  3ZD9 A;  4IRC A;  1WCN A;  4YR2 A;  5KT6 A;  4F2S A;  3GV5 B;  4ECZ A;  4C8L A;  4F3O A;  2INB A;  3KHL A;  4R8U B;  1ZJM A;  5KG2 A;  3PMN A;  3PW0 A;  4B9L A;  4TUR A;  4O3N A;  2ALZ A;  1TK5 A;  3Q8P B;  3PW2 A;  5CWR A;  1ZQN A;  2BDP A;  5KTQ A;  2W9C B;  4I2G A;  1YNM A;  2FMP A;  5KFF A;  2BR0 A;  2NRW A;  4Z6D A;  4RT2 A;  9ICC A;  4G6V A;  2FKC A;  3RR8 A;  4J9Q A;  7ICN A;  1IM4 A;  1ZQF A;  4QBL A;  7ICO A;  1SL0 A;  4I28 A;  4YG2 A;  3BQ1 A;  2W9B A;  4UB5 A;  3RAQ A;  3RB6 A;  4UB2 A;  4NM2 A;  9ICJ A;  1JMS A;  2DBS A;  3TAQ A;  2UVU A;  1JN3 A;  2ZTE A;  7ICQ A;  1A76 A;  3KHG A;  4NLG A;  4EBD A;  5KFM A;  4QZA A;  4RZR A;  1ZQZ A;  1X9W A;  4KN4 A;  5F9N A;  7ICM A;  2HW3 A;  8ICN A;  4UQG A;  4ECS A;  1ZQJ A;  2OST A;  1TFR A;  4K4G A;  5KG5 A;  3T5K A;  5L1J A;  3RRG A;  1XSL A;  3M9O B;  1U45 A;  8ICK A;  8ICW A;  5D46 A;  2RDJ A;  4DFK A;  2C2D A;  4GLX A;  1XS9 D;  1ZQE A;  3T5L A;  1L3V A;  2PI5 A;  3BQ2 A;  4DS4 A;  4EYI B;  1UA0 A;  5DLF A;  1C7Y A;  4MF2 A;  5KFC A;  4F92 B;  4K4H A;  4KLH A;  4Q43 A;  4RUA A;  3T3F A;  8ICC A;  2UVR A;  4DS5 A;  4Z6F A;  3OSP A;  4DL7 A;  8ICT A;  1MQ3 A;  4UAZ A;  5J0Q A;  5CA7 A;  1K1S A;  1NJY A;  7ICI A;  4EBC A;  2XGQ A;  3GIM A;  1KFD A;  1UT5 A;  3G6X A;  1D8L A;  8ICH A;  2J6S A;  4I2A A;  4ECQ A;  8ICI A;  3M8R A;  2IHN A;  3ZDB A;  5J2E A;  3IHQ B;  5J2J A;  3PML A;  4DSE A;  4PHP A;  2ZJA A;  2HHT A;  4RQ8 A;  2KZ3 A;  4O5C A;  3QZ7 A;  7ICE A;  2F1J A;  4E6Z A;  4NXZ A;  3AUO A;  1SKR A;  4ED2 A;  1SL1 A;  1U9L A;  2FPM A;  4PH5 A;  4F5O A;  1XMX A;  5J0Y A;  1BPB A;  3AU6 A;  3C5G A;  4DSI A;  4RQ2 A;  1JXE A;  2ZTC A;  2PXI A;  2H5X A;  5J0O A;  5IIM A;  3PO5 A;  4FS1 A;  4KLE A;  1QLN A;  2UVV A;  4UBB A;  3UQ2 A;  1ZQA A;  2FMS A;  4ECT A;  1ZQP A;  4M2Y A;  2BCS A;  2BKE A;  4NM1 A;  4TKD A;  2HHV A;  2Q0Z X;  3PVX A;  5DGB A;  4ECW A;  1WCL A;  3C21 A;  2JEF A;  3RB4 A;  1RZT A;  3RH5 A;  9ICS A;  4MFA A;  1F1Z A;  3H8J A;  3RTV A;  2HHQ A;  4UB1 A;  2R8I A;  1T4G A;  4F5P A;  4KN7 A;  2XGP A;  4PHE A;  3UQ0 A;  4PPX A;  5L1L A;  4ECR A;  2BPF A;  4Q8E A;  3EWA A;  8ICP A;  4KLJ A;  3KTQ A;  4TUP A;  2VS1 A;  4RQ1 A;  1ZQI A;  3MFH A;  4M6W B;  1Z3E B;  3MR3 A;  4NLN A;  4O5K A;  4DL3 A;  3V6H A;  3RBD A;  3TFS A;  5KFD A;  4B9T A;  8ICU A;  4F8R A;  4CCH A;  3PR5 B;  3B0Y A;  4IQT A;  3AU2 A;  2F1I A;  5KFG A;  1MQ2 A;  4ELT A;  4ED6 A;  7ICP A;  1JX4 A;  4RNM A;  4YR3 A;  1NK9 A;  3HW8 A;  3EPG A;  4RPX A;  4IQV A;  5J2I A;  9ICA A;  1LB2 B;  4YFK A;  1ZET A;  4QWC A;  3TI0 A;  3NTU A;  1KDH A;  4GXK A;  2FMQ A;  2KTQ A;  4DOA A;  3E2E A;  4YMM A;  4YMN A;  1RXW A;  3RJJ A;  2JEI A;  2GJW A;  2GW6 A;  1KFT A;  2IA6 A;  4Z6C A;  4KLL A;  1SKS A;  1OB9 A;  1UWV A;  4J9N A;  7ICK A;  4QWD A;  2B21 A;  2BCR A;  1ZQY A;  4P4O A;  4MEX A;  4KLM A;  2XO7 A;  4FS2 A;  4IQU A;  4BWM A;  5KFX A;  4F93 B;  5J0R A;  2FPK A;  5DB9 A;  4DL2 A;  3OJU A;  4ED0 A;  4DFM A;  2FLN A;  8ICB A;  2XY6 A;  1DOQ A;  1L3U A;  4KLO A;  3AJV A;  5DGA A;  2NRZ A;  2IXS A;  4TUQ A;  9ICQ A;  4DAP A;  1ZQT A;  2MAX A;  5J0S A;  4C8O A;  4J9R A;  5KFE A;  5J0U A;  1TKD A;  3V7L A;  4O3Q A;  4QZG A;  1RZN A;  5KFZ A;  4RT3 A;  3C5F A;  5DQI A;  7ICF A;  3GIJ A;  2I1Q A;  1S76 D;  5BOL A;  1QSL A;  1ARO P;  4PGQ A;  4P4P A;  2BPC A;  2FLL A;  4RQ7 A;  2W9A A;  4J9P A;  1S0N A;  4ED3 A;  5DDY A;  3UXN A;  2XC9 A;  4IRK A;  1Z00 B;  1ZQS A;  4MFC A;  5IIJ A;  5KFR A;  3LWM A;  1NK8 A;  1S97 A;  4MEY A;  2AQ4 A;  4JV1 A;  2HHU A;  9ICV A;  3ETL A;  2P6U A;  4RPY A;  3MBY A;  5CP2 A;  4RQ6 A;  3IEY B;  4QZ9 A;  3RJG A;  2Y1I A;  4QZH A;  2VAN A;  2ASL A;  1H38 A;  2IBK A;  4I2C A;  3T5H A;  2UVW A;  3V6J A;  4B9V A;  3PX6 A;  1RYR A;  5HHI A;  4F4Y A;  1IXR A;  2NRX A;  2R8H A;  4R63 A;  3SZ2 A;  4FBT A;  5IIO A;  4M04 A;  4EBE A;  3FYH A;  2KFZ A;  3JPN A;  4DQP A;  1ZQV A;  4QW9 A;  3KHH A;  7ICS A;  4R64 A;  3RJE A;  4P4M A;  4M47 A;  3PNC A;  5J2G A;  5DB6 A;  1ZQB A;  4IR9 A;  3V72 A;  2AGP A;  3GFK B;  4DL5 A;  8ICR A;  2PI4 A;  3THV A;  4JUZ A;  5DQG A;  1D8Y A;  3GIK A;  2KZZ A;  3GV8 B;  1JXL A;  4YQW A;  3H8W A;  3OSN A;  4F2R A;  2V9W A;  2ZJ5 A;  4ECX A;  1NK6 A;  4UAY A;  3M8S A;  2PFN A;  3DNX A;  3ZDD A;  4ZH4 A;  1BPZ A;  1BPE A;  5HP4 A;  2P6R A;  5KFW A;  4YXM A;  1Y1O A;  4O3P A;  1L5U A;  1U49 A;  5KG7 A;  1HUZ A;  3PW5 A;  1BPD A;  3ISB A;  4DQI A;  4PHA A;  2XY7 A;  4ELV A;  3OHA A;  4KLQ A;  1D9D A;  1T0F A;  4IR1 A;  4EEY A;  2W8M A;  2C22 A;  5HNK A;  3LK9 A;  2IMW P;  5HML A;  4RQ5 A;  2VA2 A;  3PV8 A;  3PX4 A;  4YD2 A;  5IIN A;  4YR0 A;  4Q44 A;  3K4G A;  9ICG A;  7ICH A;  4R8U A;  3RB0 A;  1ZQX A;  1ZP7 A;  3H4B A;  4DLE A;  4RQ3 A;  1UA1 A;  1S77 D;  1ZQC A;  5J2H A;  4DL4 A;  1BVS A;  2KFN A;  5DG7 A;  5KFI A;  3QEB Z;  3ZDA A;  2W9C A;  4KTQ A;  5DB7 A;  3KHR A;  3GV7 B;  1COO A;  2PFP A;  3P1Z B;  4DL6 A;  3PY8 A;  1NK0 A;  4DO9 A;  5J2D A;  4QZF A;  4I2I A;  5HHH A;  3JPT A;  1QSS A;  2R8J A;  4BXO A;  3OJS A;  3SV4 A;  8ICO A;  4YMO A;  3GQC A;  2RDI A;  3TAR A;  7ICG A;  4ED1 A;  4TQS A;  2VA8 A;  8ICE A;  3PO4 A;  4B9N A;  2MUT B;  4O3S A;  3ZDC A;  5CR0 A;  3M9M B;  4F5N A;  1XC9 A;  2XY5 A;  1GEF A;  5KG3 A;  4Q45 A;  1N48 A;  2ASJ A;  4DSK A;  9ICX A;  4QBO A;  1SKW A;  3QZ8 A;  1B22 A;  3MGI A;  3JPS A;  2VA3 A;  4LQE A;  4KLI A;  5KFH A;  3JPQ A;  5HMM A;  2I9G A;  4IQW A;  4RUC A;  4RQ4 A;  2R8G A;  1MSW D;  3BDP A;  9ICW A;  4QZE A;  2WTF A;  1QTM A;  7ICL A;  2JZB A;  2JEG A;  1ZQU A;  5EWF A;  1D9F A;  3G6V A;  1NK5 A;  4DQR A;  1U4B A;  9ICT A;  5C5J A;  3SI8 A;  1NK4 A;  4JWM A;  4BGD A;  2W8K A;  8ICL A;  4O3R A;  4ED8 A;  9ICI A;  3H8S A;  2ASD A;  1ZQM A;  1A77 A;  3PW4 A;  1QSY A;  3RJH A;  9ICL A;  2XCP A;  4QW8 A;  4PHD A;  3RB3 A;  4ECV A;  3AJV B;  2GWS A;  1NJW A;  1RYS A;  1BPY A;  4J9K A;  4GXI A;  1KFS A;  4RQ0 A;  2C28 A;  1U47 A;  1N56 A;  1KRP A;  2WJ0 A;  4QZ8 A;  1RLV A;  3H40 A;  1ZJN A;  4DF4 A;  3TQ1 A;  4BWJ A;  4UAW A;  4E0D A;  4DSJ A;  2ZUB A;  9ICM A;  1OB8 A;  2CZR A;  4EYH B;  3C23 A;  4QZI A;  1S0O A;  4J9L A;  3Q8K A;  5KFK A;  3N4M B;  2ATL A;  4F5R A;  3EZ5 A;  4I2J A;  5DBC A;  4J9S A;  2BCV A;  3MAB A;  4PGY A;  1UT8 A;  4UB3 A;  4M9J A;  9ICF A;  1NJX A;  2BH2 A;  1L3S A;  2M9N A;  2ZTD A;  3MR2 A;  3TFR A;  7ICT A;  1RPL A;  3OHB A;  3EYZ A;  4O3O A;  2VLD A;  1ZQO A;  4I2H A;  5DBB A;  5DB8 A;  2FCO A;  3GII A;  5CJ7 A;  4K4I A;  1T8E A;  5L9X A;  5L1I A;  2HVI A;  4JV0 A;  1X9M A;  2WCZ A;  3IEY A;  4EV1 A;  1XWL A;  4DFJ A;  1ZYQ A;  4DEZ A;  5DKW A;  2AU0 A;  4KMU A;  2DPI A;  1A79 A;  3BQT A;  4DF8 A;  2P66 A;  3PR4 A;  3IM1 A;  1XU4 A;  2WIZ A;  3UXO A;  4KLF A;  1X2I A;  4IRD A;  1B43 A;  3N97 B;  2HHW A;  4KIT B;  7ICU A;  3MR5 A;  4I2D A;  5DDM A;  1TAU A;  4GC6 A;  2Z0R A;  4P2H A;  2CV8 A;  5J2K A;  1DGS A;  3ORY A;  4M6W A;  5CHG A;  4QZB A;  2DPJ A;  3ZD8 A;  3MDA A;  4Q8F A;  4RU9 A;  9ICH A;  4O0I A;  5KFQ A;  3MGH A;  5KT5 A;  3MR6 A;  3HWT A;  4DOB A;  4DQS A;  2W8L A;  3RJK A;  3MFI A;  2FPL A;  3ISC A;  3P1Z A;  7ICR A;  5KT4 A;  1T3N A;  5KFO A;  1ZQG A;  1TK8 A;  3GDX A;  1ZQK A;  2AGQ A;  1NKC A;  3NGD A;  4DOC A;  4I2B A;  3BT7 A;  5BPC A;  8ICV A;  8ICG A;  3B0X A;  5F9L A;  1XSN A;  4M9H A;  2A1J B;  4DWI A;  3G6Y A;  4I29 A;  1TV9 A;  2XCA A;  5KT3 A;  1KLN A;  2ZYZ A;  3OGU A;  2OKF A;  2FKH B;  5J2C A;  3Q8L A;  2BQ3 A;  4J9O A;  4EZ9 A;  1ZQD A;  2J6U A;  4M9N A;  5III A;  4BDP A;  4MFF A;  4KLD A;  1ZQR A;  4B9M A;  4LVS A;  5J0P A;  3UXP A;  9ICN A;  5KG6 A;  2PFO A;  5J0X A;  2HHS A;  2ISO A;  3HT3 A;  2KZM A;  5DG9 A;  4YN4 A;  4C8N A;  3HX0 A;  3V7J A;  5KFL A;  4RNO A;  1PZN A;  4UBC A;  5KFY A;  3ISD A;  2W9M A;  2F1H A;  1TK0 A;  4DQQ A;  2BQR A;  3HPO A;  4ED7 A;  5J29 A;  2NRT A;  4KLS A;  5FDK A;  2BHN A;  1KTQ A;  3C1Z A;  5DG8 A;  5J0T A;  5KFV A;  4TUS A;  2AGO A;  1NKB A;  1KSP A;  1XO1 A;  2Y1J A;  5D4B A;  4LZG A;  2ISP A;  3K75 D;  4KLG A;  8ICQ A;  2FLC A;  3RRH A;  5IIK A;  1RXV A;  5KFU A;  4TQR A;  5J2F A;  4J9M A;  4F5Q A;  4BXO B;  8ICS A;  4ZQU A;  1Y88 A;  4NLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...