1Y88A

Crystal structure of protein of unknown function af1548
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
184
structure length
184
Chain Sequence
NLYFQGHMVARLLEEHGFETKTNVIVQGNCVEQEIDVVAERDGERYMIECKFHNIPVYTGLKEAMYTYARFLDVEKHGFTQPWIFTNTKFSEEAKKYAGCVGIKLTGWSYPEKEGIEVLLESKGLYPITILRIDKEVLDELVRAGLVFCRDVVSAGEEKLREIGLSAKKAREVIAEAKKVIGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of hypothetical protein AF1548 from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AF1548
total genus 59
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2004-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1y88A02
3.40.1350.10 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 1y88A01
4YFKA 4QZCA 3QEAZ 4DSJA 4F3OA 2KFNA 8ICJA 5FDKA 3UXPA 8ICTA 4QW9A 2ZJ8A 5J2IA 4B9LA 3Q8LA 5D46A 2FMSA 2M9NA 4UB4A 1NK8A 4EYIB 3C2KA 3JPTA 3M8SA 3HWTA 4DFPA 4K4IA 4QZFA 2IHMA 4ECVA 3AU6A 2C22A 4YMOA 4Z6EA 4F91B 4RQ1A 3M9MB 4F5NA 2BCSA 4Z6DA 2ISPA 3KTQA 1XMXA 4C8OA 4G3IA 2EO0A 5KFHA 5DKWA 3KHRA 5KFGA 4QWDA 3AJVA 3JPRA 2AGPA 1UA1A 2MAXA 1CEZA 4DEZA 5DGBA 5DB9A 1U47A 1KTQA 4YMNA 2AGQA 4KLFA 1ZQOA 3TARA 5J0PA 3OGUA 4NY8A 3C23A 4EZ9A 2R8HA 4DSEA 5KFYA 8ICCA 3K75D 9ICCA 2XCAA 1CUKA 2B21A 8ICMA 7ICEA 4DSFA 3ZD9A 1OB8A 3ZDBA 4LZGA 5KFDA 3C5FA 2A1JA 1LB2B 1SKWA 1L5UA 1U4BA 4PGYA 3TAQA 2AU0A 3V6HA 1C7YA 3C5GA 2GJWA 3ISCA 1RXVA 4M9LA 1ZQUA 5KFNA 3EPGA 4DSLA 9ICFA 4P2HA 4PHDA 4RQ3A 1BPDA 3JPOA 1GEFA 1S76D 3SYZA 4ECSA 4I2AA 3JPQA 4ED2A 1TV9A 2BHNA 4I27A 4JV1A 1OB9A 4RUAA 5HHHA 5KT5A 2BPGA 1ZQNA 4YD1A 1ZQKA 4ECRA 1S77D 2BCRA 4O5CA 1DOQA 9ICXA 4DQQA 1BGXT 8ICLA 1Z3EB 1QSLA 3PY8A 3OSNA 4KLIA 3JPNA 4P4MA 4RNMA 1N48A 4R64A 2VA2A 1ZQJA 4QZIA 3GILA 4DS4A 2J6TA 8ICQA 5KFXA 4Q44A 5IIKA 5KFBA 2P6RA 2PI5A 3SZ2A 4FO6A 2C2DA 4KLGA 4YR3A 2IMWP 4BDPA 2BQRA 1BPZA 5J2JA 1R11A 2AGOA 1N56A 2J6SA 4RQ2A 1AROP 4RNNA 4F4XA 2ZUBA 5BPCA 4O3PA 5IIIA 4Z6CA 3ZD8A 5L1LA 8ICZA 2JEFA 1X9WA 1R0VA 5KFJA 2W9MA 2GW6A 4I2EA 3RBDA 3ZDAA 1XSNA 2H5XA 3FYHA 4RU9A 2W9AA 4QZDA 4R65A 1ZQBA 4BWMA 4CCHA 8ICUA 9ICRA 5CJ7A 1KEJA 2VANA 1D8YA 4F4ZA 4XA5A 3M9NB 4O3NA 2W8KA 5L1KA 5DLFA 4DFMA 1S0VA 4QWEA 2JEIA 2NRZA 1K1QA 3K4GA 2XY5A 2R8KA 8ICIA 3RR7A 4I2GA 5J0WA 2FPLA 3HW8A 4QWBA 1SL2A 4DWIA 1T8EA 4C8KA 4Z6FA 3C21A 1WCLA 3BQ0A 5J29A 5HMLA 5BOMA 4F5RA 8ICAA 4M0AA 1WCNA 3PX0A 4DSKA 3KHLA 2UVRA 5KT2A 5L1JA 4M9HA 2PFNA 7ICUA 3Q8RB 4RT2A 2VA8A 2ZTEA 2WCWA 4GXIA 4J9LA 1S9FA 1B22A 1RZTA 1F1ZA 4J9RA 5D4BA 1NKBA 2P66A 4KLUA 2DPIA 2BPCA 1RZNA 2PFQA 3IHQB 5KG2A 5L9XA 5KFQA 4UBBA 8ICWA 2CV8A 4NLNA 5DQGA 4Q8FA 2ZJAA 1JIHA 4PGXA 1JXLA 5KG5A 4BXOA 4RQ5A 3N97B 5DGAA 3EYZA 4DF8A 5CP2A 7ICVA 5DB7A 1V9PA 4IQVA 4QWAA 4TUSA 2HVHA 2WCZA 4PHPA 7ICTA 4ECYA 1IM4A 5DLGA 9ICQA 4EEYA 2ASJA 4RQ4A 2RDIA 3BQ1A 1COOA 5HP4A 5KG3A 4R66A 3OJUA 4I2IA 3SV3A 4RQ7A 1RPLA 3KHGA 1JX4A 1ZETA 3RR8A 8ICBA 3H4DA 3H7IA 5KT4A 4KLSA 4KLLA 4IRCA 1X9SA 4MEYA 4C8LA 1A79A 5KT3A 3EZ5A 4GXKA 2ASDA 2JEJA 5HHIA 2BCUA 3T5KA 7ICLA 2ZUCA 2V4RA 5EWFA 2P6UA 5KFUA 1ZQRA 2XC9A 5KFAA 4KLHA 2INBA 1QSYA 4GXJA 2BPFA 4M9NA 4R8UB 5EOZA 4GLXA 2HHSA 1RLVA 2IHNA 1UT5A 3JPPA 4M9JA 7ICHA 1LV5A 4BXOB 3BQ2A 1Y1OA 4J9MA 1TFRA 4ECUA 3T5LA 5IILA 3RRGA 1ZQEA 4Q8EA 1D8LA 7ICJA 3UQ2A 9ICNA 8ICVA 5KFOA 2AQ4A 3ISBA 4B9UA 4IQWA 1ZQHA 3ETLA 9ICSA 1U49A 4UB5A 3OSPA 2JZBA 5KFVA 3C1ZA 3OHBA 1QTMA 1XC9A 4YR0A 4ED7A 3ORYA 2I9GA 9ICIA 2LYHA 1KSPA 2JZBB 4Q45A 4YR2A 2DPJA 4KN4A 4F5PA 4DS5A 5KG4A 1KLNA 4IQTA 5J0OA 4X5VA 8ICGA 3BDPA 2XY6A 2BR0A 5DG8A 1XU4A 1BPBA 3H8WA 4ELTA 1S0NA 2V9WA 9ICVA 3DNXA 3P1ZA 4JWMA 4ECXA 1ZQAA 2NRVA 5DG9A 4YG2A 3GIJA 4O3RA 5J2EA 1NK4A 3GQCA 1U45A 3HP6A 3RJGA 2OSTA 4F4WA 3GIMA 2BCVA 7ICGA 2FMPA 9ICEA 1MQ2A 8ICKA 5J2AA 3MR3A 3THVA 4YQWA 4O9MA 3RH5A 3UXOA 1D9FA 1ZQFA 1MSWD 1HUOA 1NJZA 4QBOA 2Y1IA 2GWSA 3MBYA 2ZYZB 4RZRA 4TURA 4R8UA 4O3OA 3Q8SB 1H38A 1S0MA 4QZEA 3E2EA 3UXNA 3V6JA 4LZDA 4J9OA 8ICYA 1TAQA 5KFPA 3RJEA 4B9TA 3PV8A 4F5QA 4XQ8A 5J2DA 2OKFA 4B9SA 3ZDDA 2A1JB 4MF2A 1ZQSA 2R8GA 1ZQXA 4TUQA 3LWLA 4DQRA 8ICRA 3HX0A 3PO4A 4ELUA 4KLEA 4EBEA 4I2FA 3P1YA 5IINA 5DBBA 4TUPA 5J2HA 4I2BA 5KG7A 4ZH4A 3IEYA 4DQPA 2W9CB 4ELVA 2AQ0A 3UQ0A 1L3UA 8ICSA 4F2SA 4YN4A 2F1IA 3MFIA 4EBCA 4I2DA 1ZQIA 4E0DA 9ICAA 1SZPA 2V4QA 1BPYA 4R63A 3RH6A 3N4MB 4UB2A 3H8JA 3PR5B 3OHAA 3TQ1A 1TK0A 2ZJ5A 4QZBA 2KZ3A 3V6KA 7ICMA 4GC6A 4ED1A 1ZQTA 2HHVA 4ED0A 4XUSA 2PFOA 2IA6A 2KTQA 4UAZA 3AJVB 2NRTA 4NLGA 2WTFA 4DL7A 2WJ0A 3MABA 4F92B 4BGDA 2XCPA 4F4YA 1L3VA 4KLQA 5J2KA 9ICLA 4QZHA 3ISDA 2VA3A 1X9MA 1L3SA 2ZTDA 1XSPA 9ICOA 4DL5A 4KLTA 5DQIA 4DLGA 3QZ7A 1SL0A 4PHEA 5CHGA 1B43A 5CR0A 2W9BB 4DLEA 3P1ZB 3PR4A 1TAUA 3B0XA 4NLZA 4NLKA 3PNCA 2HW3A 1BVSA 4DL6A 1KFDA 4YCXA 4KLMA 2HHQA 3Q8PB 4MF8A 3GDXA 4RPYA 3RRHA 3TFSA 1ZQVA 4M6WA 4O5KA 9ICJA 1NJYA 5J0XA 3PVXA 4DF4A 1D9DA 4O3SA 4F5OA 1KRPA 4P4OA 1ZQZA 5J0YA 4EBDA 4JV0A 3M9OB 1NJXA 4NM1A 4ED8A 1RYRA 2FLNA 4MFAA 2ALZA 3RB4A 3GV7B 3RBEA 4QBNA 4YXMA 4TQRA 2F1HA 1Z00B 4RUCA 2XO7A 4I2JA 1A77A 4ECQA 1ZQWA 5EWGA 4K4HA 7ICFA 5DB8A 4RQ8A 1S97A 1ZQPA 5KTQA 3RB0A 1QSSA 4MFFA 2HVIA 3RJIA 4DOBA 1MQ3A 3V7KA 4F8RA 4F2RA 2FLLA 1TVAA 3H8SA 1S10A 3QZ8A 4TKKA 7ICSA 1BPEA 4ECZA 1SL1A 4B9VA 1NKCA 4DFJA 5DBCA 4GC7A 1KDHA 1NK7A 3UPQA 3GFKB 4KTQA 1UA0A 3SV4A 3TANA 5CWRA 4B9NA 5IIOA 3EWAA 5DB6A 4J9SA 4K4GA 5DDMA 5J0QA 3V7JA 3T5JA 5CB1A 3PX6A 4MEXA 4I2CA 2F1JA 3MDAA 3C2LA 4FS1A 3Q8KA 2XGQA 2ZTCA 4DQIA 4KLJA 1DGSA 5KFRA 5DQHA 8ICHA 5KFTA 2OWOA 4UAWA 2FPMA 1KFSA 2PI4A 5KFSA 5EWEA 4KITB 1JXEA 1SKRA 8ICPA 3GIIA 2WIZA 9ICTA 3NTUA 5KFZA 4DFKA 1ZQYA 4DSIA 1Z00A 1XWLA 5J2GA 5F9LA 3PW0A 1JN3A 1TK5A 4J9QA 4RQ6A 2KZZA 3RAQA 4DL2A 2ASLA 3V7LA 1TK8A 2UVVA 3FOVA 4YD2A 4RNOA 4ED3A 3RAXA 4M9GA 5BOLA 5DDYA 2C28A 3EW9A 3GIKA 3H4BA 3G6YA 4F93B 1MC8A 7ICKA 2BKEA 2I1QA 5J0TA 1A76A 5KG1A 2KN7A 3RJJA 4PHAA 2AJQA 2C2RA 3PO5A 2NRXA 4QBLA 1X2IA 4KN7A 3BJYA 1PZNA 4PH5A 1UT8A 3LWMA 4KMUA 4UBCA 3M8RA 4C8NA 3TAPA 4XRHA 1ZQMA 4M04A 4DOCA 3JPSA 3PW2A 3BQTA 3C1YA 4EYHB 4RPZA 3AUOA 1ZYQA 4JWNA 2MUTA 1XS9D 1NK9A 1NK6A 3RJKA 1T0FA 4ECWA 2Y1JA 3TI0A 3V72A 4M2YA 9ICWA 3Q8QB 3QEBZ 1RYSA 3TFRA 1NJWA 2UVUA 3C2MA 4IR1A 5J2CA 4JV2A 2BQ3A 2KFZA 4UB3A 2W8LA 2C2EA 8ICFA 3MDCA 5HMMA 2XGPA 3T5HA 1IPIA 3RTVA 1NOMA 2PXIA 3PW7A 1HH1A 4DOAA 4UAYA 5KG6A 1T4GA 5HNKA 3T3FA 4J9PA 4QZGA 3MR5A 4DO9A 2WIWA 5D49A 5KFFA 9ICMA 2W9BA 4YMMA 4QZ9A 3MR6A 4B9MA 4FBUA 2FLPA 3PMNA 3AU2A 4O0IA 4IR9A 1QLNA 4YVZA 5KFKA 1S0OA 1ZQQA 4KLDA 5KT6A 5DG7A 4MFCA 7ICRA 4C8MA 2ISOA 3RH4A 9ICUA 8ICXA 4RT3A 1ZQLA 3G6VA 5J2BA 7ICIA 5KG0A 2FPKA 5L1IA 2BGWA 3MGIA 1T3NA 2HHUA 4PPXA 3RB3A 2ZUDA 3B0YA 4ED6A 2XY7A 4PGQA 3IM1A 8ICNA 4TKDA 2Q0ZX 4YP3A 4QZAA 2BDPA 1HJPA 4NM2A 3Q8MA 3GV8B 5KFCA 3NGDA 1JMSA 4QW8A 4FS2A 1SKSA 5F9NA 1NK5A 2J6UA 3HPOA 5DBAA 2PFPA 3RJHA 4IRDA 4O5EA 2BQUA 4IQUA 4LVSA 4BWJA 5KT7A 9ICBA 1ZP7A 1KFTA 4M47A 3GV5B 8ICEA 4QZ8A 3H40A 2W9CA 1U48A 4IRKA 1T7PA 1XSLA 4KLOA 5J0SA 4O3QA 5CA7A 4DQSA 1ZQGA 5IIJA 3PX4A 5J0RA 4F4KA 4RQ0A 3QE9Y 3OJSA 4EZ6A 4DL4A 3MGHA 1NKEA 5J0UA 5J2FA 4DL3A 2R8JA 8ICOA 2VLDA 3LK9A 4J9KA 1L3TA 7ICNA 1HUZA 2ZYZA 3ZDCA 5C5JA 3SI8A 4RPXA 3RJFA 4HYKA 3MFHA 1Y88A 4M6WB 4UQGA 1NK0A 2ATLA 4J9NA 5IIMA 1U9LA 3ZDEA 5KFWA 2HHWA 2KZMA 2DFLA 4ECTA 3LDAA 1ZJNA 4FBTA 4TQSA 4P4PA 1ZQCA 4UB1A 2MUTB 2NRWA 2JEGA 2HHXA 4F50A 2FCOA 3EPIA 2RDJA 1ZJMA 5KFIA 2BCQA 3PMLA 5TZVA 4JUZA 1K1SA 5KFEA 4JK1A 3KHHA 3PW4A 7ICQA 4I28A 7ICOA 2HHTA 7ICPA 1EXNA 3FDSA 4I2HA 3MR2A 2R8IA 2FMQA 9ICGA 4I29A 3PW5A 1BPXA 1XO1A 3G6XA 4Q43A 3RB6A 5KFMA 1TKDA 1ZQDA 4NXZA 5JUMA 1RXWA 9ICKA 9ICPA 2UVWA 5KFLA 9ICHA 1IXRA 4QWCA 4YXJA 2IBKA 3HT3A
chains in the Genus database with same CATH superfamily
2I6XA 3QEAZ 2I5HA 5D46A 2FMSA 4UB4A 1NK8A 3WKBA 4QZFA 4ECVA 5KL8B 4Z6DA 5KFHA 5KFGA 3ALRA 3JPRA 1UA1A 1CEZA 5KAFU 5DB9A 4YMNA 4KLFA 5J0PA 4NY8A 3WU2U 2W3RA 1MA7A 4DSEA 1CUKA 2B21A 3UMGA 7ICEA 3QU5A 3ZD9A 2A1JA 1SKWA 4PGYA 3TAQA 1FIQA 3V6HA 1C7YA 2GJWA 4EX6A 1KKXA 5KFNA 5ALQA 5KT5A 1QQ7A 1ZQNA 4FZLA 5G5GA 4ECRA 3AEVA 5ALGA 1YZ7A 3KZXA 8ICLA 1QSLA 2K4IA 2ZIVA 2EAPA 2DKZA 1SWVA 4P4MA 4RQNA 4RNMA 2YQEA 1PK1A 1T3QA 2RRDA 3D2SA 5KFBA 2P6RA 4YR3A 2PKEA 3UM9A 2W7OA 5J2JA 2J6SA 2HDOA 4F4XA 5KL1B 4Z6CA 3ZD8A 8ICZA 1R0VA 4BX9C 5T14A 2W9MA 3RBDA 3NASA 1XSNA 3ZDAA 4RU9A 3TADA 3C29A 2VANA 1D8YA 4F4ZA 1QCKA 5L1KA 2JEIA 4DFMA 1UPHA 2XY5A 3RR7A 4DWIA 3HW8A 2B0CA 1T8EA 1V97A 2GH1A 2D6FC 2Z0RA 2UVRA 4M9HA 7ICUA 3SAFA 2KMDA 2NYVA 1O08A 8ICWA 4NLNA 5DQGA 1L7MA 2NO5A 2YB1A 4BXOA 2OM6A 2FLCA 5CP2A 1IM4A 2EH9A 4EEYA 2ASJA 3OJUA 3RR8A 3F53A 1F44A 1A79A 3QU7A 7ICLA 3HKZC 2XC9A 5ALMA 4U6PA 4GXJA 4M9NA 2JH1A 2IOFK 5ALTA 1RLVA 1L7OA 3JPPA 1X40A 5AM1A 4M9JA 5ALWA 3BQ2A 3QUTA 4F71A 1Y1OA 3RRGA 2WAQF 9ICNA 7ICJA 3QUCA 3TKAA 9ICSA 3WK7A 5KFVA 1QTMA 2I9GA 2QB0A 9ICIA 2LYHA 1KSPA 4Q45A 4F5PA 4C7YA 1FFUA 5KG4A 3B9JA 4IQTA 8ICGA 2BR0A 3H8WA 9ICVA 3P1ZA 4ECXA 2NRVA 1VLBA 4YG2A 1PVRA 3AL0B 5J2EA 2A19A 3HP6A 3GIMA 5AK4A 2FMPA 1MQ2A 8ICKA 4YQWA 3RH5A 3UXOA 1D9FA 5EE3A 2Y1IA 2GWSA 2GO7A 2ZYZB 2QKQA 4TURA 1RYUA 1S0MA 3E2EA 5AM0A 3V6JA 4LZDA 4J9OA 8ICYA 1BNPA 5KFPA 4F5QA 2K60A 3ZDDA 2A1JB 4PJ0U 4TUQA 2K8BB 3HX0A 2G5HB 4TUPA 4P0QA 1RQLA 2W9CB 4RQMA 3MFIA 1ZQIA 4I2DA 2LI6A 4IC9A 2V4QA 3D2QA 4C4RA 3N4MB 4UB2A 1N62A 3OHAA 2ZJ5A 2G5IB 3AN1A 2HI0A 3AJVB 1SV0A 4UAZA 1J97A 3MABA 4BGDA 4F4YA 5J2KA 4B6JA 2VA3A 1OW5A 1X9MA 2G0AA 1L3SA 1XSPA 4DL5A 3RF9A 3P1ZB 1TAUA 2CRXA 3E0FA 4NLZA 3PNCA 1KN5A 5AKGA 5AM3A 4DL6A 1WWUA 2HHQA 4MF8A 1A6SA 4RPYA 4O5KA 2KIVA 1D9DA 4F5OA 5J0YA 1SB3C 4JV0A 1T94A 2FLNA 3RB4A 2WF5A 3OPXA 5HR7A 1JRPA 4IS7A 5EWGA 5DB8A 4US9A 5ALSA 4Y2QA 3RJIA 5ALVA 1MQ3A 1NNLA 7ICSA 5DBCA 4GC7A 1KDHA 2WFAA 3GFKB 3SV4A 2FDRA 2YX8A 4J9SA 5DB6A 2DL0A 4I2CA 5E79U 2YMQA 2XGQA 3WKDA 2IXSA 4Y2RA 5KFRA 1CI4A 5KFTA 4UAWA 3DEEA 5KAIU 1SKRA 2HSZA 1RDFA 4DSIA 1Z00A 2LMRA 5J2GA 2KZZA 3RAQA 4DL2A 2ASLA 4QJFB 2UVVA 3FOVA 2JHDA 5AK6A 3KZIU 3HRDD 3DDHA 1MC8A 4EX7A 2BKEA 2I1QA 4PHAA 2C2RA 3QU2A 4C0ZA 3PO5A 1X2IA 3NVVA 3LWMA 1UT8A 1ED1A 3M8RA 4G6VA 2K8AA 3JPSA 2E1EA 2KK0A 3LVVA 2MUTA 4QIWC 3QEBZ 2GLEA 1NJWA 2KHQA 4IR1A 5J2CA 5AKXA 8ICFA 3WK4A 2IOHA 2XGPA 1QQ5A 3T5HA 2WF6A 4UASA 4USAA 1L7NA 3MR5A 5D49A 9ICMA 3IEYB 2FLPA 3PMNA 2HOQA 5AI0A 4YVZA 4WJ3B 5DG7A 3O0FA 3G6VA 5KG0A 2FPKA 4CF3A 3MGIA 4PPXA 2KG5A 3IM1A 2Q0ZX 4YP3A 3PSPA 1HJPA 2VS1A 4FS2A 3NGDA 5F9NA 2P35A 5KT7A 1ZP7A 3TADC 1IIPA 2W9CA 4P0QB 5CA7A 1ZQGA 4DQSA 5J0RA 3QX7A 2YY6A 4DL4A 2DBYA 2VLDA 5AKEA 4J9KA 1L3TA 4UAUA 3ZDCA 3IN5A 1AQ6A 3RJFA 5AKYA 3MFHA 2KICA 4M6WB 4UQGA 2JXJA 5KFWA 5ALEA 2K4HA 2Y9UA 3NVYA 4J03A 1ZQCA 5H2FU 2HHXA 4F50A 1ZJMA 2BCQA 3QUBA 4I28A 1UQVA 3FC4A 3E58A 2KV2A 2M0NA 1BPXA 2HBJA 5KFMA 2WF7A 1IXRA 2JR5A 4DS4A 3HT3A 4F3OA 4DSJA 2KFNA 8ICJA 1B0XA 8ICTA 3GU3A 2AHOB 2ZJ8A 4B9LA 2M9NA 1TAMA 3HWTA 4K4IA 4YMOA 4Z6EA 3M9MB 2F2AB 2BCSA 1XMXA 2FKCA 4G3IA 5DKWA 3KHRA 3AJVA 2AGPA 1U47A 2AGQA 1ZQOA 3SR6A 3OGUA 4EZ9A 5KFYA 3K75D 1O03A 3C28A 5KFDA 3C5FA 1U4BA 3QYPA 2W43A 1RXVA 1ZQUA 3L5KA 9ICFA 2JRZA 5EE1A 4ECSA 1LKYA 4I2AA 3JPQA 1DXSA 4JV1A 4RUAA 1ZQKA 3KKAA 1WWVA 1Z3EB 3PY8A 2FJ6A 3PSFA 3JPNA 1L8OA 1N48A 2YTUA 4R64A 1VJ5A 2J6TA 3SZ2A 5ALHA 5ALXA 4BDPA 2BQRA 5ALPA 2DF4B 4RNNA 5IIIA 2IOFA 4Y2JA 2JEFA 2HMXA 2H5XA 3FYHA 1ZQBA 9ICRA 4R65A 1KBUA 4BWMA 4NJ8A 4XA5A 3M9NB 5DLFA 4DFDA 4QWEA 1K1QA 3A0HU 4QWBA 3PSTA 4C8KA 4Z6FA 3C21A 2ZIWB 5HMLA 2A1AA 4CF5A 4M0AA 2B6GA 3KHLA 2G07A 2KE7A 2PFNA 2WCWA 2VA8A 4GXIA 1B22A 4DAPA 1M6YA 3IHQB 3ONNA 4UBBA 1PVQA 4FFDA 2ZJAA 1JXLA 2NV3A 3L3FX 1YT3A 7ICVA 1V9PA 4TUSA 2QB1A 2WCZA 2H3FA 3BQ7A 5DLGA 9ICQA 4RQ4A 3F5AA 3BQ1A 1FFVA 5KG3A 1RPLA 4KLSA 4KLLA 4C8LA 1Z19A 2ZIUA 3EZ5A 2DKXA 3MGVA 4EENA 2JEJA 2V4RA 2INBA 3D2NA 1ECWA 2BPFA 4GLXA 2HHSA 4PZNA 2KKPA 2IHNA 1ZD4A 7ICHA 2N1RA 1LV5A 3RFAA 2EZXA 4J9MA 4ECUA 3QNMA 3H0LB 2YMMA 3SAGA 4IQWA 4C7ZA 2KSOB 1ZQHA 3OSPA 1UCVA 3C1ZA 2BH2A 2JZBB 2DPJA 3ZI4A 1KLNA 5J0OA 4X5VA 3M6KA 3BDPA 5DG8A 4ELTA 4JWMA 3GIJA 4O3RA 5ALNA 1U45A 2XIDA 4F4WA 7ICGA 1UHUA 3KOOA 3MR3A 4O9MA 3AQFA 4A8EA 4QBOA 2XICA 4FZNA 3WK9A 3N7PD 4R8UA 4O3OA 3Q8SB 1H38A 3UXNA 3H0MB 3NVWA 2QARB 2OKFA 2FI1A 4MF2A 2Q4TA 8ICRA 4ELUA 2KJ5A 4CGZA 2KVCA 3P1YA 5IINA 2HBLA 5J2HA 2QARA 4ZH4A 4DQPA 4PZOA 4EBCA 9ICAA 3RH6A 3PR5B 3TQ1A 3BS5A 4ED1A 1ZQTA 4OO1J 3WKAA 2KTQA 2NRTA 2CXYA 2E8MA 4F92B 3IV6A 2XCPA 5A0LA 1ZD2P 4OJPA 5AKZA 1OXJA 4KLTA 5DQIA 4DLGA 2QB0B 1SL0A 3KD3A 4DLEA 3PR4A 3HILA 4NLKA 5JTIA 1BVSA 3PZPA 4UB8U 2VJ4A 3Q8PB 3RRHA 3TFSA 9ICJA 5J0XA 3PVXA 4DF4A 2FKHB 1KRPA 4P4OA 1ZQZA 4EBDA 1NJXA 3M9OB 4ED8A 4FZMA 5AKLA 2AH5A 1A77A 1ZQWA 1ZQPA 1S97A 2EQYA 2A3VA 2K4PA 5B66U 3V7KA 4F8RA 4F2RA 3H8SA 3QZ8A 5AI4A 4TKKA 1BPEA 1SL1A 4DFJA 4GFJA 4KTQA 4ACOA 1UA0A 3TANA 5CWRA 3EWAA 3F2BA 5DDMA 3V7JA 2F1JA 3MDAA 4FS1A 3Q8KA 2ZTCA 4KLJA 1DGSA 1PVPA 2CPRA 2KOBA 2FPMA 5EWEA 3N7RC 5FP0A 4Y2YA 5GTIU 8ICPA 2BDUA 1J2NA 1SIJA 3IP4B 4DFKA 1XWLA 5J8YA 2OH2A 2VIXA 4RQ6A 3V7LA 2ZXHA 1F5SA 4YD2A 4RNOA 4M9GA 2PMZC 4LJXA 1WG8A 5AKHA 4F93B 1DRGA 2OXOA 3RJJA 1DK2A 2E1FA 4ZOHC 4QBLA 4XRHA 5JU5A 4DA2A 4DOCA 3C1YA 3KFUF 1ZYQA 1NK9A 4M2YA 9ICWA 1RYSA 2KSOA 5L1MA 4AP9A 4UB3A 3ED5A 5ALUA 2G06A 2DQNB 3RTVA 3UMBA 1SXDA 1T4GA 4J9PA 4QZGA 2W9BA 4YMMA 4UARA 3MR6A 4B9MA 2DWQA 4O0IA 1ZXIA 4IR9A 3SENA 5KFKA 1ZQQA 4MFCA 4C8MA 8ICXA 4RT3A 7ICIA 5J2BA 1T3NA 1X6IA 1ZRMA 3GV8B 1SKSA 2J6UA 3RJHA 3HPOA 5DBAA 2BQUA 4LVSA 4ICAA 2D3DA 8ICEA 3H40A 4IRKA 1T7PA 4G6UA 2CN1A 4OJ5A 3PX4A 2H3QA 4F4KA 3OJSA 4EZ6A 3MGHA 1NKEA 5J2FA 8ICOA 5C0YA 2O6KA 3BZKA 2LM4A 3SI8A 4HYKA 4JB3A 1NK0A 2ATLA 2E5SA 5IIMA 4NL9A 4ECTA 1ZJNA 3LDAA 4P4PA 2MUTB 2JEGA 4LQEA 3PMLA 5KFEA 1N61A 3BZCA 3PW4A 7ICQA 1CRXA 2EZYA 4QIWF 3NUQA 3FDSA 3R9KA 4I2HA 4FE3A 4I29A 2JGAA 2QLTA 3RB6A 2KP7A 1ZQDA 4NXZA 4QWCA 2IBKA 4YFKA 4QZCA 3QU9A 3UXPA 5FDKA 4Y2PA 2LYBA 2WF8A 4KX5A 4EYIB 3JPTA 1ZOLA 2IHMA 2K4EA 3KTQA 4F5NA 4QWDA 3F5EA 2MAXA 1KTQA 4EEKA 5JRTA 3TARA 2JMGA 2YN4A 2R8HA 8ICCA 1X42A 8ICMA 1OB8A 3ZDBA 1LB2B 1L5UA 3WK5A 3C5GA 3ISCA 2G08A 4M9LA 4DSLA 2XVTA 1BPDA 4UAVA 4I27A 5AM2A 1OB9A 3IF0X 3CRXA 5HHHA 1SXEA 4NLBA 4DQQA 1BGXT 1D8BA 3M1YA 3HJEA 2EAMA 2K8CB 3OSNA 4KLIA 2ZG6A 3SAHA 1S8OA 1ZQJA 3GILA 5KFXA 3I28A 4Q44A 2PI5A 4FO6A 2IMWP 1R11A 1BPZA 3LYSA 1N2XA 1N56A 2OYYA 3AM9A 1AROP 2ZUBA 5BPCA 1X66A 3KKAC 2GW6A 2AXTU 4QZDA 4CCHA 8ICUA 5CJ7A 1KEJA 4O3NA 1S0VA 2NRZA 2R8KA 8ICIA 2R18A 4I2GA 2MSNA 2FPLA 2HCFA 1WCLA 2DGZA 1BNOA 5J29A 4EV1A 5BOMA 4BJQA 4F5RA 3GZFA 3PX0A 5KT2A 3Q8RB 1S9FA 1L8LA 1RZTA 1FO4A 5D4BA 2P66A 1NKBA 5AI8A 4KLUA 2DPIA 1RZNA 5ALJA 5KG2A 2PFQA 5KFQA 2CV8A 4Q8FA 3N97B 4IQVA 2W3SA 3OTQA 7ICTA 2RDIA 5HP4A 4R66A 1JX4A 4I2IA 8ICBA 2OEHA 1ZETA 2CZRA 3H4DA 5KT4A 1X9SA 4MEYA 2XI9A 4GXKA 2ASDA 1MN8A 5HHIA 4OCZA 2ZUCA 5KFAA 2WF9A 5ALKA 4R8UB 2W7PA 5AICA 3QU4A 1N5WA 2KKVA 3NVZA 4QNLA 1TFRA 5IILA 1ZQEA 3WKCA 1PUZA 4Q8EA 5KFOA 2AQ4A 4B9UA 1UWVA 3QUQA 2JZBA 3OHBA 4YR0A 3N28A 1XU4A 1BPBA 1S0NA 2V9WA 1HEKA 1Q3UA 1NK4A 3GQCA 3RJGA 3AMZA 9ICEA 3THVA 1ZQFA 1HUOA 1NJZA 5AI9A 3MBYA 4RZRA 1NZPA 4QZEA 3T79A 4E6ZA 2ZIXA 2WAQC 1TAQA 4EELA 3PV8A 4XQ8A 2ZXIA 3ETRA 3I76A 2ZIVB 1ZQSA 3LWLA 4DQRA 3PO4A 4KLEA 4I2FA 5DBBA 3IEYA 2AQ0A 1ZRNA 2G09A 2W04A 1L3UA 2F77X 2F1IA 4F72A 1BPYA 4R63A 5AM4A 4DCCA 1TK0A 4QZBA 1GO3F 3V6KA 3WK6A 7ICMA 3PSIA 2LPEA 2L5YA 4NLGA 2WTFA 2WJ0A 3N7SC 1L3VA 5CEHA 2WB1F 2ZTDA 9ICOA 3QZ7A 5CHGA 1B43A 2W9BB 3B0XA 4UATA 2HW3A 3AQEA 3IRUA 4KLMA 4M6WA 1NJYA 4O3SA 5AHXA 1Z1VA 4NM1A 2OHFA 1RYRA 4MFAA 5ALDA 3GV7B 3RBEA 4TQRA 2XO7A 4RUCA 2F1HA 1Z00B 4PL2A 4I2JA 4ECQA 4K4HA 5KTQA 3RB0A 1QSSA 3NS1A 4MFFA 2HVIA 2W03A 1HIWA 2FLLA 1TVAA 4U7CA 4ECZA 3UPQA 2KJ9A 4B9NA 5IIOA 2ODGA 4CE6A 5J0QA 2LYAA 5CB1A 4MEXA 5DQHA 3LVWA 5ALIA 2PI4A 5AIBA 4KITB 1JXEA 2WIZA 9ICTA 3NTUA 4NLCA 3WKEA 1ZQYA 2F44A 3PW0A 5F9LA 1TK5A 1JN3A 2DBSA 4J9QA 3NRWA 3RAXA 2C28A 3EW9A 4MHVA 5J0TA 1A76A 3BJYA 2D8CA 3MC1A 4KMUA 4UBCA 3TAPA 4C8NA 1ZQMA 4C4TA 1JROA 3ICXA 4EYHB 5J8YC 4JWNA 2H3ZA 1XS9D 3RJKA 4ECWA 3TFRA 3C2MA 3F2CA 2KFZA 3HKZF 2H3VA 2C2EA 5AI5A 3CP8A 5AI6A 3F2DA 5ALZA 2PXIA 3PW7A 4P0PB 5KG6A 2HBMA 2LKYA 3NRZA 2E8NA 4DO9A 5CRXA 3FM9A 3IG8A 2FE9A 1N60A 5EE0A 3AU2A 1QLNA 1S0OA 4KLDA 5KT6A 3BS5B 3M6ZA 1ZQLA 2BGWA 5L1IA 2HHUA 3RB3A 2ZUDA 3B0YA 4G9BA 4ED6A 3VC8A 2XY7A 1ZQ1C 2ZIXB 2RQ5A 5KFCA 1JMSA 2PFPA 5F3XB 4O3MA 9ICBA 1VDVA 4KLOA 4O3QA 1JI7A 5IIJA 1SZHA 4RQ0A 3QE9Y 4NL9C 2R8JA 4NWIA 4CNQA 7ICNA 1HUZA 2ZYZA 1P7DA 5C5JA 2Y9TA 2F3NA 2W11A 1Y88A 1NI3A 1U9LA 3ZDEA 2DFLA 3K1ZA 5ALOA 1RM6C 4UB1A 2NRWA 3UMCA 2FCOA 3EPIA 2RDJA 5KFIA 2EZZA 1KW4A 1K1SA 1SV4A 1Q3VA 7ICPA 3MR2A 9ICGA 3PW5A 1XO1A 3G6XA 3CYMA 2UVWA 9ICHA 4YXJA 2NO4A 5B5EU 4OD0A 4QW9A 5J2IA 3Q8LA 3KBBA 3SD7A 3C2KA 3M8SA 4DFPA 3VCBA 3AU6A 2C22A 1QH9A 4F91B 4RQ1A 2ISPA 4C8OA 2EO0A 2RLTA 4DEZA 5DGBA 2YMLA 3C23A 5AKKA 4AYBF 9ICCA 4C80A 2XCAA 4DSFA 1F0MA 1TE2A 4LZGA 2AU0A 1S5LU 2OCEA 1KQQA 1Q46A 3EPGA 4P2HA 4PHDA 4RQ3A 3JPOA 1GEFA 1S76D 3SYZA 1TV9A 4ED2A 2BHNA 4US8A 1C20A 2LHTA 2RHFA 2BPGA 4YD1A 1FEZA 1S77D 2BCRA 4O5CA 1DOQA 9ICXA 3SMVA 4CRXA 2VA2A 4QZIA 8ICQA 5IIKA 3L4PA 4KLGA 2C2DA 3H8MA 5AK5A 2E8PA 2JV3A 3IG5A 2AGOA 4RQ2A 4O3PA 5L1LA 1X9WA 5KFJA 2HOFA 4I2EA 1J2MA 2W9AA 4BUGA 2LM1A 2W8KA 3K4GA 5J0WA 2K89A 1SL2A 5G5HA 3BQ0A 3IDWA 3H0RB 1WCNA 4DSKA 1YNMA 5L1JA 4RT2A 2ZTEA 1IG6A 2FL3A 4J9LA 4Y2SA 1F1ZA 4JMUA 4J9RA 3EUB2 2BPCA 3DV9A 5L9XA 2KNJA 1JIHA 4PGXA 2YMPA 5KG5A 3S6JA 4RQ5A 5DGAA 3EYZA 4DF8A 5DB7A 4QWAA 2HVHA 4PHPA 4ECYA 1COOA 4KX3A 3SV3A 9ICKA 9ICPA 4RQ7A 3KHGA 2H3IA 3H7IA 4KMOB 2KD1A 4GIBA 4IRCA 3WK8A 5KT3A 1DK3A 1N5XA 2BCUA 3T5KA 5EWFA 2P6UA 5KFUA 1ZQRA 4KLHA 1QSYA 4HAIA 5EOZA 1UT5A 2WHEA 4BXOB 3T5LA 1Q8KA 2GOLA 3K1RB 2Y0SF 1D8LA 3UQ2A 4C4SA 8ICVA 2KIWA 3ISBA 4Y2UA 3ETLA 2VJ5A 1U49A 3A0BU 5AIAA 5GTHU 4UB5A 1XC9A 4ED7A 3ORYA 5AK3A 1X9XA 4YR2A 4KN4A 4DS5A 3QXGA 2E8OA 3TACB 2XY6A 3DNXA 2ZIUB 1SV0C 3CNHA 1ZQAA 5DG9A 2WB1C 3U26A 4NV0A 1XNSA 5HR6A 2EAOA 2OSTA 1LKYB 2BCVA 5J2AA 4Y2TA 1MSWD 5ALRA 1DGJA 3BS7A 2W55A 5AM5A 2Y0SC 1PK3A 3RJEA 4B9TA 5J2DA 4B9SA 2F76X 1JALA 2R8GA 1ZQXA 2F8LA 4EBEA 1SGGA 1ZD5A 4Y2XA 4I2BA 1X6JA 5KG7A 1B4FA 4ELVA 3UQ0A 8ICSA 4YN4A 4E0DA 1SZPA 5TISU 5AKIA 1A0PA 3H8JA 2EANA 2DUYA 2KZ3A 1V38A 4GC6A 1KL9A 1Z4NA 2HHVA 2W54A 4ED0A 4XUSA 2PFOA 2IA6A 4OJ6A 4DL7A 4KLQA 9ICLA 3BT7A 4QZHA 3ISDA 2ES6A 4PHEA 2LBOA 5CR0A 1Z4OA 1KFDA 4YCXA 3SQIA 1JUDA 3GDXA 1ZQVA 4CDGA 2KJ8A 2KEYA 2EDUA 1SWWA 2ALZA 3SEIA 4QBNA 1QQ6A 4YXMA 1XO0A 5KNIA 7ICFA 4IL6U 8ICAA 4RQ8A 1N63A 4DOBA 2RP5A 1S10A 3I1YA 4B9VA 1NKCA 1NK7A 3CW2C 4Y2VA 5AKJA 4K4GA 2JH7A 3T5JA 2MRLA 3PX6A 3J81j 3C2LA 1NZBA 4DQIA 8ICHA 2OWOA 2MA1A 1KFSA 1WUDA 5KFSA 4ZQUA 3GIIA 5ALLA 1RG6A 5KFZA 5ALFA 2ZIWA 1RQNA 1V85A 1TK8A 2BZFA 4ED3A 5BOLA 5DDYA 3FAHA 3H4BA 3GIKA 3G6YA 7ICKA 5KG1A 2KN7A 2AJQA 2NRXA 5K4LA 4KN7A 1PZNA 4PH5A 2Z7JA 4M04A 3PW2A 3BQTA 4RPZA 3AUOA 1NK6A 1T0FA 3M7DA 2Y1JA 3TI0A 3V72A 3Q8QB 2UVUA 4JV2A 2BQ3A 1ZD3A 2W8LA 4AYBC 5HMMA 3MDCA 1IPIA 1NOMA 1HH1A 4DOAA 4UAYA 3T3FA 5HNKA 2WIWA 5KFFA 4PL1A 1IV8A 1COKA 4QZ9A 4FBUA 2ESEA 7ICRA 2ISOA 3RH4A 9ICUA 1K5OA 2YB4A 2F8KA 2W8MA 2JJQA 1L6NA 4PGQA 8ICNA 4TKDA 2HBKA 5ALYA 1LVHA 4QZAA 2BDPA 4NM2A 3Q8MA 4F2SA 4QW8A 4O5EA 1NK5A 4IRDA 4IQUA 4BWJA 4OJOA 2HOIA 2PMZF 1KFTA 4M47A 3GV5B 5EE9A 4QZ8A 1U48A 2MU2A 1XSLA 2VKQA 5J0SA 2KHVA 5J0UA 4DL3A 3LK9A 1OUQA 4UW9A 1L7PA 2E3TA 1YZ6A 4RPXA 4J9NA 2HHWA 2KZMA 4FBTA 4TQSA 4P0PA 1WYGA 1Z1BA 5TZVA 4JUZA 4JK1A 3KHHA 4CF4A 7ICOA 2HHTA 1EXNA 2R8IA 2FMQA 2KVSA 3D6JA 1URJA 4Q43A 1TKDA 1PK1B 5JUMA 1RXWA 4UB6U 5KFLA 4OJLA 4DAVA
chains in the Genus database with same CATH topology
4YFKA 4QZCA 3QEAZ 4DSJA 4F3OA 2KFNA 8ICJA 5FDKA 3UXPA 8ICTA 4QW9A 2ZJ8A 5J2IA 4B9LA 3Q8LA 5D46A 2FMSA 2M9NA 4UB4A 1NK8A 4EYIB 3C2KA 3JPTA 3M8SA 3HWTA 4DFPA 4K4IA 4QZFA 2IHMA 4ECVA 3AU6A 2C22A 4YMOA 4Z6EA 4F91B 4RQ1A 3M9MB 4F5NA 2BCSA 4Z6DA 2ISPA 3KTQA 1XMXA 2FKCA 4C8OA 4G3IA 2EO0A 5KFHA 5DKWA 3KHRA 5KFGA 4QWDA 3AJVA 3JPRA 2AGPA 1UA1A 2MAXA 1CEZA 4DEZA 5DGBA 5DB9A 1U47A 1KTQA 4YMNA 2AGQA 4KLFA 1ZQOA 3TARA 5J0PA 3OGUA 4NY8A 3C23A 4EZ9A 2R8HA 4DSEA 5KFYA 8ICCA 3K75D 9ICCA 2XCAA 1CUKA 2B21A 8ICMA 7ICEA 4DSFA 3ZD9A 1OB8A 3ZDBA 4LZGA 5KFDA 3C5FA 2A1JA 1LB2B 1SKWA 1L5UA 1U4BA 4PGYA 3TAQA 2AU0A 3V6HA 1C7YA 3C5GA 2GJWA 3ISCA 1RXVA 4M9LA 1ZQUA 5KFNA 3EPGA 4DSLA 9ICFA 4P2HA 4PHDA 4RQ3A 1BPDA 3JPOA 1GEFA 1S76D 3SYZA 4ECSA 4I2AA 3JPQA 4ED2A 1TV9A 2BHNA 4I27A 4JV1A 1OB9A 3IF0X 4RUAA 5HHHA 5KT5A 2BPGA 1ZQNA 4YD1A 1ZQKA 4ECRA 1S77D 2BCRA 4O5CA 1DOQA 9ICXA 4DQQA 1BGXT 8ICLA 1Z3EB 1QSLA 3PY8A 3OSNA 4KLIA 3JPNA 4P4MA 4RNMA 1N48A 4R64A 2VA2A 1ZQJA 4QZIA 3GILA 4DS4A 2J6TA 8ICQA 5KFXA 4Q44A 5IIKA 5KFBA 2P6RA 2PI5A 3SZ2A 4FO6A 2C2DA 4KLGA 4YR3A 2IMWP 4BDPA 2BQRA 1BPZA 5J2JA 1R11A 2AGOA 1N56A 2J6SA 4RQ2A 1AROP 4RNNA 4F4XA 2ZUBA 5BPCA 4O3PA 5IIIA 4Z6CA 3ZD8A 5L1LA 8ICZA 2JEFA 1X9WA 1R0VA 2FKHB 5KFJA 2W9MA 2GW6A 4I2EA 3RBDA 3ZDAA 1XSNA 2H5XA 3FYHA 4RU9A 2W9AA 4QZDA 4R65A 1ZQBA 4BWMA 4CCHA 8ICUA 9ICRA 5CJ7A 1KEJA 2VANA 1D8YA 4F4ZA 4XA5A 3M9NB 4O3NA 2W8KA 5L1KA 5DLFA 4DFMA 1S0VA 4QWEA 2JEIA 2NRZA 1K1QA 3K4GA 2XY5A 2R8KA 8ICIA 3RR7A 4I2GA 5J0WA 2FPLA 3HW8A 4QWBA 1SL2A 4DWIA 1T8EA 4C8KA 4Z6FA 3C21A 1WCLA 3BQ0A 5J29A 4EV1A 5HMLA 5BOMA 4F5RA 8ICAA 4M0AA 1WCNA 3PX0A 4DSKA 1YNMA 2Z0RA 3KHLA 2UVRA 5KT2A 5L1JA 4M9HA 2PFNA 7ICUA 3Q8RB 4RT2A 2VA8A 2ZTEA 2WCWA 4GXIA 4J9LA 1S9FA 1B22A 1RZTA 1F1ZA 4DAPA 4J9RA 5D4BA 1NKBA 2P66A 4KLUA 2DPIA 2BPCA 1RZNA 2PFQA 3IHQB 5KG2A 5L9XA 5KFQA 4UBBA 8ICWA 2CV8A 4NLNA 5DQGA 4Q8FA 2ZJAA 1JIHA 4PGXA 1JXLA 5KG5A 4BXOA 4RQ5A 3N97B 5DGAA 3EYZA 4DF8A 2FLCA 5CP2A 7ICVA 5DB7A 1V9PA 4IQVA 4QWAA 4TUSA 2HVHA 2WCZA 4PHPA 7ICTA 4ECYA 1IM4A 5DLGA 9ICQA 4EEYA 2ASJA 4RQ4A 2RDIA 3BQ1A 1COOA 5HP4A 5KG3A 4R66A 3OJUA 4I2IA 3SV3A 4RQ7A 1RPLA 3KHGA 1JX4A 1ZETA 3RR8A 8ICBA 2CZRA 3H4DA 3H7IA 5KT4A 4KLSA 4KLLA 4IRCA 1X9SA 4MEYA 4C8LA 1A79A 5KT3A 3EZ5A 4GXKA 2ASDA 2JEJA 5HHIA 2BCUA 3T5KA 7ICLA 2ZUCA 2V4RA 5EWFA 2P6UA 5KFUA 1ZQRA 2XC9A 5KFAA 4KLHA 2INBA 1QSYA 4GXJA 2BPFA 4M9NA 4R8UB 5EOZA 4GLXA 2HHSA 1RLVA 2IHNA 1UT5A 3JPPA 4M9JA 7ICHA 1LV5A 4BXOB 3BQ2A 1Y1OA 4J9MA 1TFRA 4ECUA 3T5LA 5IILA 3RRGA 1ZQEA 4Q8EA 1D8LA 7ICJA 3UQ2A 9ICNA 8ICVA 5KFOA 2AQ4A 3ISBA 4B9UA 4IQWA 1ZQHA 3ETLA 9ICSA 1U49A 1UWVA 4UB5A 3OSPA 2JZBA 5KFVA 3C1ZA 3OHBA 1QTMA 1XC9A 4YR0A 2BH2A 4ED7A 3ORYA 2I9GA 9ICIA 2LYHA 1KSPA 2JZBB 4Q45A 4YR2A 2DPJA 4KN4A 4F5PA 4DS5A 5KG4A 1KLNA 4IQTA 5J0OA 4X5VA 8ICGA 3BDPA 2XY6A 2BR0A 5DG8A 1XU4A 1BPBA 3H8WA 4ELTA 1S0NA 2V9WA 9ICVA 3DNXA 3P1ZA 4JWMA 4ECXA 1ZQAA 2NRVA 5DG9A 4YG2A 3GIJA 4O3RA 5J2EA 1NK4A 3GQCA 1U45A 3HP6A 3RJGA 2OSTA 4F4WA 3GIMA 2BCVA 7ICGA 2FMPA 9ICEA 1MQ2A 8ICKA 5J2AA 3MR3A 3THVA 4YQWA 4O9MA 3RH5A 3UXOA 1D9FA 1ZQFA 1MSWD 1HUOA 1NJZA 4QBOA 2Y1IA 2GWSA 3MBYA 2ZYZB 4RZRA 4TURA 4R8UA 4O3OA 3Q8SB 1H38A 1S0MA 4QZEA 3E2EA 3UXNA 3V6JA 4E6ZA 4LZDA 4J9OA 8ICYA 1TAQA 5KFPA 3RJEA 4B9TA 3PV8A 4F5QA 4XQ8A 5J2DA 2OKFA 4B9SA 3ZDDA 2A1JB 4MF2A 1ZQSA 2R8GA 1ZQXA 4TUQA 3LWLA 4DQRA 8ICRA 3HX0A 3PO4A 4ELUA 4KLEA 4EBEA 4I2FA 3P1YA 5IINA 5DBBA 4TUPA 5J2HA 4I2BA 5KG7A 4ZH4A 3IEYA 4DQPA 2W9CB 4ELVA 2AQ0A 3UQ0A 1L3UA 8ICSA 4F2SA 4YN4A 2F1IA 3MFIA 4EBCA 4I2DA 1ZQIA 4E0DA 9ICAA 1SZPA 2V4QA 1BPYA 4R63A 3RH6A 3N4MB 4UB2A 3H8JA 3PR5B 3OHAA 3TQ1A 1TK0A 2ZJ5A 4QZBA 2KZ3A 3V6KA 7ICMA 4GC6A 4ED1A 1ZQTA 2HHVA 4ED0A 4XUSA 2PFOA 2IA6A 2KTQA 4UAZA 3AJVB 2NRTA 4NLGA 2WTFA 4DL7A 2WJ0A 3MABA 4F92B 4BGDA 2XCPA 4F4YA 1L3VA 4KLQA 5J2KA 9ICLA 3BT7A 4QZHA 3ISDA 2VA3A 1X9MA 1L3SA 2ZTDA 1XSPA 9ICOA 4DL5A 4KLTA 5DQIA 4DLGA 3QZ7A 1SL0A 4PHEA 5CHGA 1B43A 5CR0A 2W9BB 4DLEA 3P1ZB 3PR4A 1TAUA 3B0XA 4NLZA 4NLKA 3PNCA 2HW3A 1BVSA 4DL6A 1KFDA 4YCXA 4KLMA 2HHQA 3Q8PB 4MF8A 3GDXA 4RPYA 3RRHA 3TFSA 1ZQVA 4M6WA 4O5KA 9ICJA 1NJYA 5J0XA 3PVXA 4DF4A 1D9DA 4O3SA 4F5OA 1KRPA 4P4OA 1ZQZA 5J0YA 4EBDA 4JV0A 3M9OB 1NJXA 4NM1A 4ED8A 1RYRA 2FLNA 4MFAA 2ALZA 3RB4A 3GV7B 3RBEA 4QBNA 4YXMA 4TQRA 2F1HA 1Z00B 4RUCA 2XO7A 4I2JA 1A77A 4ECQA 1ZQWA 5EWGA 4K4HA 7ICFA 5DB8A 4RQ8A 1S97A 1ZQPA 5KTQA 3RB0A 1QSSA 4MFFA 2HVIA 3RJIA 4DOBA 1MQ3A 3V7KA 4F8RA 4F2RA 2FLLA 1TVAA 3H8SA 1S10A 3QZ8A 4TKKA 7ICSA 1BPEA 4ECZA 1SL1A 4B9VA 1NKCA 4DFJA 5DBCA 4GC7A 1KDHA 1NK7A 3UPQA 3GFKB 4KTQA 1UA0A 3SV4A 3TANA 5CWRA 4B9NA 5IIOA 3EWAA 5DB6A 4J9SA 4K4GA 5DDMA 5J0QA 3V7JA 3T5JA 5CB1A 3PX6A 4MEXA 4I2CA 2F1JA 3MDAA 3C2LA 4FS1A 3Q8KA 2XGQA 2ZTCA 2IXSA 4DQIA 4KLJA 1DGSA 5KFRA 5DQHA 8ICHA 5KFTA 2OWOA 4UAWA 2FPMA 1KFSA 2PI4A 5KFSA 5EWEA 4KITB 4ZQUA 1JXEA 1SKRA 8ICPA 3GIIA 2WIZA 9ICTA 3NTUA 5KFZA 4DFKA 1ZQYA 4DSIA 1Z00A 1XWLA 5J2GA 5F9LA 3PW0A 1JN3A 1TK5A 2DBSA 4J9QA 4RQ6A 2KZZA 3RAQA 4DL2A 2ASLA 3V7LA 1TK8A 2UVVA 3FOVA 4YD2A 4RNOA 4ED3A 3RAXA 4M9GA 5BOLA 5DDYA 2C28A 3EW9A 3GIKA 3H4BA 3G6YA 4F93B 1MC8A 7ICKA 2BKEA 2I1QA 5J0TA 1A76A 5KG1A 2KN7A 3RJJA 4PHAA 2AJQA 2C2RA 4DAVA 3PO5A 2NRXA 4QBLA 1X2IA 4KN7A 3BJYA 1PZNA 4PH5A 1UT8A 3LWMA 4KMUA 4UBCA 3M8RA 4C8NA 3TAPA 4XRHA 1ZQMA 4M04A 4DOCA 4G6VA 4DA2A 3JPSA 3PW2A 3BQTA 3C1YA 4EYHB 4RPZA 3AUOA 1ZYQA 4JWNA 2MUTA 1XS9D 1NK9A 1NK6A 3RJKA 1T0FA 4ECWA 2Y1JA 3TI0A 3V72A 4M2YA 9ICWA 3Q8QB 3QEBZ 1RYSA 3TFRA 1NJWA 2UVUA 3C2MA 4IR1A 5J2CA 4JV2A 2BQ3A 2KFZA 4UB3A 2W8LA 2C2EA 8ICFA 3MDCA 5HMMA 2XGPA 3T5HA 1IPIA 3RTVA 1NOMA 2PXIA 3PW7A 1HH1A 4DOAA 4UAYA 5KG6A 1T4GA 5HNKA 3T3FA 4J9PA 4QZGA 3MR5A 4DO9A 2WIWA 5D49A 5KFFA 9ICMA 2W9BA 4YMMA 4QZ9A 3MR6A 4B9MA 4FBUA 3IEYB 2FLPA 3PMNA 3AU2A 4O0IA 4IR9A 1QLNA 4YVZA 5KFKA 1S0OA 1ZQQA 4KLDA 5KT6A 5DG7A 4MFCA 7ICRA 4C8MA 2ISOA 3RH4A 9ICUA 8ICXA 4RT3A 1ZQLA 3G6VA 5J2BA 7ICIA 5KG0A 2FPKA 5L1IA 2BGWA 3MGIA 1T3NA 2W8MA 2JJQA 2HHUA 4PPXA 3RB3A 2ZUDA 3B0YA 4ED6A 2XY7A 4PGQA 3IM1A 8ICNA 4TKDA 2Q0ZX 4YP3A 4QZAA 2BDPA 1HJPA 4NM2A 3Q8MA 3GV8B 2VS1A 5KFCA 3NGDA 1JMSA 4QW8A 4FS2A 1SKSA 5F9NA 1NK5A 2J6UA 3HPOA 5DBAA 2PFPA 3RJHA 4IRDA 4O5EA 2BQUA 4IQUA 4LVSA 4BWJA 5KT7A 9ICBA 1ZP7A 1KFTA 4M47A 3GV5B 8ICEA 4QZ8A 3H40A 2W9CA 1U48A 4IRKA 1T7PA 4G6UA 1XSLA 4KLOA 5J0SA 4O3QA 5CA7A 4DQSA 1ZQGA 5IIJA 3PX4A 5J0RA 4F4KA 4RQ0A 3QE9Y 3OJSA 4EZ6A 4DL4A 3MGHA 1NKEA 5J0UA 5J2FA 4DL3A 2R8JA 8ICOA 2VLDA 3LK9A 4J9KA 1L3TA 7ICNA 1HUZA 2ZYZA 3ZDCA 5C5JA 3SI8A 4RPXA 3RJFA 4HYKA 3MFHA 1Y88A 4M6WB 4UQGA 1NK0A 2ATLA 4J9NA 5IIMA 1U9LA 3ZDEA 5KFWA 2HHWA 2KZMA 2DFLA 4ECTA 3LDAA 1ZJNA 4FBTA 4TQSA 4P4PA 1ZQCA 4UB1A 2MUTB 2NRWA 2JEGA 2HHXA 4F50A 2FCOA 3EPIA 4LQEA 2RDJA 1ZJMA 5KFIA 2BCQA 3PMLA 5TZVA 4JUZA 1K1SA 5KFEA 4JK1A 3KHHA 3PW4A 7ICQA 4I28A 7ICOA 2HHTA 7ICPA 1EXNA 3FDSA 4I2HA 3MR2A 2R8IA 2FMQA 9ICGA 4I29A 3PW5A 1BPXA 1XO1A 2FL3A 3G6XA 4Q43A 3RB6A 5KFMA 1TKDA 1ZQDA 4NXZA 5JUMA 1RXWA 9ICKA 9ICPA 2UVWA 5KFLA 9ICHA 1IXRA 4QWCA 4YXJA 2IBKA 3HT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFK A;  4QZC A;  3QEA Z;  4DSJ A;  4F3O A;  2KFN A;  8ICJ A;  5FDK A;  3UXP A;  8ICT A;  4QW9 A;  2ZJ8 A;  5J2I A;  4B9L A;  3Q8L A;  5D46 A;  2FMS A;  2M9N A;  4UB4 A;  1NK8 A;  4EYI B;  3C2K A;  3JPT A;  3M8S A;  3HWT A;  4DFP A;  4K4I A;  4QZF A;  2IHM A;  4ECV A;  3AU6 A;  2C22 A;  4YMO A;  4Z6E A;  4F91 B;  4RQ1 A;  3M9M B;  4F5N A;  2BCS A;  4Z6D A;  2ISP A;  3KTQ A;  1XMX A;  4C8O A;  4G3I A;  2EO0 A;  5KFH A;  5DKW A;  3KHR A;  5KFG A;  4QWD A;  3AJV A;  3JPR A;  2AGP A;  1UA1 A;  2MAX A;  1CEZ A;  4DEZ A;  5DGB A;  5DB9 A;  1U47 A;  1KTQ A;  4YMN A;  2AGQ A;  4KLF A;  1ZQO A;  3TAR A;  5J0P A;  3OGU A;  4NY8 A;  3C23 A;  4EZ9 A;  2R8H A;  4DSE A;  5KFY A;  8ICC A;  3K75 D;  9ICC A;  2XCA A;  1CUK A;  2B21 A;  8ICM A;  7ICE A;  4DSF A;  3ZD9 A;  1OB8 A;  3ZDB A;  4LZG A;  5KFD A;  3C5F A;  2A1J A;  1LB2 B;  1SKW A;  1L5U A;  1U4B A;  4PGY A;  3TAQ A;  2AU0 A;  3V6H A;  1C7Y A;  3C5G A;  2GJW A;  3ISC A;  1RXV A;  4M9L A;  1ZQU A;  5KFN A;  3EPG A;  4DSL A;  9ICF A;  4P2H A;  4PHD A;  4RQ3 A;  1BPD A;  3JPO A;  1GEF A;  1S76 D;  3SYZ A;  4ECS A;  4I2A A;  3JPQ A;  4ED2 A;  1TV9 A;  2BHN A;  4I27 A;  4JV1 A;  1OB9 A;  4RUA A;  5HHH A;  5KT5 A;  2BPG A;  1ZQN A;  4YD1 A;  1ZQK A;  4ECR A;  1S77 D;  2BCR A;  4O5C A;  1DOQ A;  9ICX A;  4DQQ A;  1BGX T;  8ICL A;  1Z3E B;  1QSL A;  3PY8 A;  3OSN A;  4KLI A;  3JPN A;  4P4M A;  4RNM A;  1N48 A;  4R64 A;  2VA2 A;  1ZQJ A;  4QZI A;  3GIL A;  4DS4 A;  2J6T A;  8ICQ A;  5KFX A;  4Q44 A;  5IIK A;  5KFB A;  2P6R A;  2PI5 A;  3SZ2 A;  4FO6 A;  2C2D A;  4KLG A;  4YR3 A;  2IMW P;  4BDP A;  2BQR A;  1BPZ A;  5J2J A;  1R11 A;  2AGO A;  1N56 A;  2J6S A;  4RQ2 A;  1ARO P;  4RNN A;  4F4X A;  2ZUB A;  5BPC A;  4O3P A;  5III A;  4Z6C A;  3ZD8 A;  5L1L A;  8ICZ A;  2JEF A;  1X9W A;  1R0V A;  5KFJ A;  2W9M A;  2GW6 A;  4I2E A;  3RBD A;  3ZDA A;  1XSN A;  2H5X A;  3FYH A;  4RU9 A;  2W9A A;  4QZD A;  4R65 A;  1ZQB A;  4BWM A;  4CCH A;  8ICU A;  9ICR A;  5CJ7 A;  1KEJ A;  2VAN A;  1D8Y A;  4F4Z A;  4XA5 A;  3M9N B;  4O3N A;  2W8K A;  5L1K A;  5DLF A;  4DFM A;  1S0V A;  4QWE A;  2JEI A;  2NRZ A;  1K1Q A;  3K4G A;  2XY5 A;  2R8K A;  8ICI A;  3RR7 A;  4I2G A;  5J0W A;  2FPL A;  3HW8 A;  4QWB A;  1SL2 A;  4DWI A;  1T8E A;  4C8K A;  4Z6F A;  3C21 A;  1WCL A;  3BQ0 A;  5J29 A;  5HML A;  5BOM A;  4F5R A;  8ICA A;  4M0A A;  1WCN A;  3PX0 A;  4DSK A;  3KHL A;  2UVR A;  5KT2 A;  5L1J A;  4M9H A;  2PFN A;  7ICU A;  3Q8R B;  4RT2 A;  2VA8 A;  2ZTE A;  2WCW A;  4GXI A;  4J9L A;  1S9F A;  1B22 A;  1RZT A;  1F1Z A;  4J9R A;  5D4B A;  1NKB A;  2P66 A;  4KLU A;  2DPI A;  2BPC A;  1RZN A;  2PFQ A;  3IHQ B;  5KG2 A;  5L9X A;  5KFQ A;  4UBB A;  8ICW A;  2CV8 A;  4NLN A;  5DQG A;  4Q8F A;  2ZJA A;  1JIH A;  4PGX A;  1JXL A;  5KG5 A;  4BXO A;  4RQ5 A;  3N97 B;  5DGA A;  3EYZ A;  4DF8 A;  5CP2 A;  7ICV A;  5DB7 A;  1V9P A;  4IQV A;  4QWA A;  4TUS A;  2HVH A;  2WCZ A;  4PHP A;  7ICT A;  4ECY A;  1IM4 A;  5DLG A;  9ICQ A;  4EEY A;  2ASJ A;  4RQ4 A;  2RDI A;  3BQ1 A;  1COO A;  5HP4 A;  5KG3 A;  4R66 A;  3OJU A;  4I2I A;  3SV3 A;  4RQ7 A;  1RPL A;  3KHG A;  1JX4 A;  1ZET A;  3RR8 A;  8ICB A;  3H4D A;  3H7I A;  5KT4 A;  4KLS A;  4KLL A;  4IRC A;  1X9S A;  4MEY A;  4C8L A;  1A79 A;  5KT3 A;  3EZ5 A;  4GXK A;  2ASD A;  2JEJ A;  5HHI A;  2BCU A;  3T5K A;  7ICL A;  2ZUC A;  2V4R A;  5EWF A;  2P6U A;  5KFU A;  1ZQR A;  2XC9 A;  5KFA A;  4KLH A;  2INB A;  1QSY A;  4GXJ A;  2BPF A;  4M9N A;  4R8U B;  5EOZ A;  4GLX A;  2HHS A;  1RLV A;  2IHN A;  1UT5 A;  3JPP A;  4M9J A;  7ICH A;  1LV5 A;  4BXO B;  3BQ2 A;  1Y1O A;  4J9M A;  1TFR A;  4ECU A;  3T5L A;  5IIL A;  3RRG A;  1ZQE A;  4Q8E A;  1D8L A;  7ICJ A;  3UQ2 A;  9ICN A;  8ICV A;  5KFO A;  2AQ4 A;  3ISB A;  4B9U A;  4IQW A;  1ZQH A;  3ETL A;  9ICS A;  1U49 A;  4UB5 A;  3OSP A;  2JZB A;  5KFV A;  3C1Z A;  3OHB A;  1QTM A;  1XC9 A;  4YR0 A;  4ED7 A;  3ORY A;  2I9G A;  9ICI A;  2LYH A;  1KSP A;  2JZB B;  4Q45 A;  4YR2 A;  2DPJ A;  4KN4 A;  4F5P A;  4DS5 A;  5KG4 A;  1KLN A;  4IQT A;  5J0O A;  4X5V A;  8ICG A;  3BDP A;  2XY6 A;  2BR0 A;  5DG8 A;  1XU4 A;  1BPB A;  3H8W A;  4ELT A;  1S0N A;  2V9W A;  9ICV A;  3DNX A;  3P1Z A;  4JWM A;  4ECX A;  1ZQA A;  2NRV A;  5DG9 A;  4YG2 A;  3GIJ A;  4O3R A;  5J2E A;  1NK4 A;  3GQC A;  1U45 A;  3HP6 A;  3RJG A;  2OST A;  4F4W A;  3GIM A;  2BCV A;  7ICG A;  2FMP A;  9ICE A;  1MQ2 A;  8ICK A;  5J2A A;  3MR3 A;  3THV A;  4YQW A;  4O9M A;  3RH5 A;  3UXO A;  1D9F A;  1ZQF A;  1MSW D;  1HUO A;  1NJZ A;  4QBO A;  2Y1I A;  2GWS A;  3MBY A;  2ZYZ B;  4RZR A;  4TUR A;  4R8U A;  4O3O A;  3Q8S B;  1H38 A;  1S0M A;  4QZE A;  3E2E A;  3UXN A;  3V6J A;  4LZD A;  4J9O A;  8ICY A;  1TAQ A;  5KFP A;  3RJE A;  4B9T A;  3PV8 A;  4F5Q A;  4XQ8 A;  5J2D A;  2OKF A;  4B9S A;  3ZDD A;  2A1J B;  4MF2 A;  1ZQS A;  2R8G A;  1ZQX A;  4TUQ A;  3LWL A;  4DQR A;  8ICR A;  3HX0 A;  3PO4 A;  4ELU A;  4KLE A;  4EBE A;  4I2F A;  3P1Y A;  5IIN A;  5DBB A;  4TUP A;  5J2H A;  4I2B A;  5KG7 A;  4ZH4 A;  3IEY A;  4DQP A;  2W9C B;  4ELV A;  2AQ0 A;  3UQ0 A;  1L3U A;  8ICS A;  4F2S A;  4YN4 A;  2F1I A;  3MFI A;  4EBC A;  4I2D A;  1ZQI A;  4E0D A;  9ICA A;  1SZP A;  2V4Q A;  1BPY A;  4R63 A;  3RH6 A;  3N4M B;  4UB2 A;  3H8J A;  3PR5 B;  3OHA A;  3TQ1 A;  1TK0 A;  2ZJ5 A;  4QZB A;  2KZ3 A;  3V6K A;  7ICM A;  4GC6 A;  4ED1 A;  1ZQT A;  2HHV A;  4ED0 A;  4XUS A;  2PFO A;  2IA6 A;  2KTQ A;  4UAZ A;  3AJV B;  2NRT A;  4NLG A;  2WTF A;  4DL7 A;  2WJ0 A;  3MAB A;  4F92 B;  4BGD A;  2XCP A;  4F4Y A;  1L3V A;  4KLQ A;  5J2K A;  9ICL A;  4QZH A;  3ISD A;  2VA3 A;  1X9M A;  1L3S A;  2ZTD A;  1XSP A;  9ICO A;  4DL5 A;  4KLT A;  5DQI A;  4DLG A;  3QZ7 A;  1SL0 A;  4PHE A;  5CHG A;  1B43 A;  5CR0 A;  2W9B B;  4DLE A;  3P1Z B;  3PR4 A;  1TAU A;  3B0X A;  4NLZ A;  4NLK A;  3PNC A;  2HW3 A;  1BVS A;  4DL6 A;  1KFD A;  4YCX A;  4KLM A;  2HHQ A;  3Q8P B;  4MF8 A;  3GDX A;  4RPY A;  3RRH A;  3TFS A;  1ZQV A;  4M6W A;  4O5K A;  9ICJ A;  1NJY A;  5J0X A;  3PVX A;  4DF4 A;  1D9D A;  4O3S A;  4F5O A;  1KRP A;  4P4O A;  1ZQZ A;  5J0Y A;  4EBD A;  4JV0 A;  3M9O B;  1NJX A;  4NM1 A;  4ED8 A;  1RYR A;  2FLN A;  4MFA A;  2ALZ A;  3RB4 A;  3GV7 B;  3RBE A;  4QBN A;  4YXM A;  4TQR A;  2F1H A;  1Z00 B;  4RUC A;  2XO7 A;  4I2J A;  1A77 A;  4ECQ A;  1ZQW A;  5EWG A;  4K4H A;  7ICF A;  5DB8 A;  4RQ8 A;  1S97 A;  1ZQP A;  5KTQ A;  3RB0 A;  1QSS A;  4MFF A;  2HVI A;  3RJI A;  4DOB A;  1MQ3 A;  3V7K A;  4F8R A;  4F2R A;  2FLL A;  1TVA A;  3H8S A;  1S10 A;  3QZ8 A;  4TKK A;  7ICS A;  1BPE A;  4ECZ A;  1SL1 A;  4B9V A;  1NKC A;  4DFJ A;  5DBC A;  4GC7 A;  1KDH A;  1NK7 A;  3UPQ A;  3GFK B;  4KTQ A;  1UA0 A;  3SV4 A;  3TAN A;  5CWR A;  4B9N A;  5IIO A;  3EWA A;  5DB6 A;  4J9S A;  4K4G A;  5DDM A;  5J0Q A;  3V7J A;  3T5J A;  5CB1 A;  3PX6 A;  4MEX A;  4I2C A;  2F1J A;  3MDA A;  3C2L A;  4FS1 A;  3Q8K A;  2XGQ A;  2ZTC A;  4DQI A;  4KLJ A;  1DGS A;  5KFR A;  5DQH A;  8ICH A;  5KFT A;  2OWO A;  4UAW A;  2FPM A;  1KFS A;  2PI4 A;  5KFS A;  5EWE A;  4KIT B;  1JXE A;  1SKR A;  8ICP A;  3GII A;  2WIZ A;  9ICT A;  3NTU A;  5KFZ A;  4DFK A;  1ZQY A;  4DSI A;  1Z00 A;  1XWL A;  5J2G A;  5F9L A;  3PW0 A;  1JN3 A;  1TK5 A;  4J9Q A;  4RQ6 A;  2KZZ A;  3RAQ A;  4DL2 A;  2ASL A;  3V7L A;  1TK8 A;  2UVV A;  3FOV A;  4YD2 A;  4RNO A;  4ED3 A;  3RAX A;  4M9G A;  5BOL A;  5DDY A;  2C28 A;  3EW9 A;  3GIK A;  3H4B A;  3G6Y A;  4F93 B;  1MC8 A;  7ICK A;  2BKE A;  2I1Q A;  5J0T A;  1A76 A;  5KG1 A;  2KN7 A;  3RJJ A;  4PHA A;  2AJQ A;  2C2R A;  3PO5 A;  2NRX A;  4QBL A;  1X2I A;  4KN7 A;  3BJY A;  1PZN A;  4PH5 A;  1UT8 A;  3LWM A;  4KMU A;  4UBC A;  3M8R A;  4C8N A;  3TAP A;  4XRH A;  1ZQM A;  4M04 A;  4DOC A;  3JPS A;  3PW2 A;  3BQT A;  3C1Y A;  4EYH B;  4RPZ A;  3AUO A;  1ZYQ A;  4JWN A;  2MUT A;  1XS9 D;  1NK9 A;  1NK6 A;  3RJK A;  1T0F A;  4ECW A;  2Y1J A;  3TI0 A;  3V72 A;  4M2Y A;  9ICW A;  3Q8Q B;  3QEB Z;  1RYS A;  3TFR A;  1NJW A;  2UVU A;  3C2M A;  4IR1 A;  5J2C A;  4JV2 A;  2BQ3 A;  2KFZ A;  4UB3 A;  2W8L A;  2C2E A;  8ICF A;  3MDC A;  5HMM A;  2XGP A;  3T5H A;  1IPI A;  3RTV A;  1NOM A;  2PXI A;  3PW7 A;  1HH1 A;  4DOA A;  4UAY A;  5KG6 A;  1T4G A;  5HNK A;  3T3F A;  4J9P A;  4QZG A;  3MR5 A;  4DO9 A;  2WIW A;  5D49 A;  5KFF A;  9ICM A;  2W9B A;  4YMM A;  4QZ9 A;  3MR6 A;  4B9M A;  4FBU A;  2FLP A;  3PMN A;  3AU2 A;  4O0I A;  4IR9 A;  1QLN A;  4YVZ A;  5KFK A;  1S0O A;  1ZQQ A;  4KLD A;  5KT6 A;  5DG7 A;  4MFC A;  7ICR A;  4C8M A;  2ISO A;  3RH4 A;  9ICU A;  8ICX A;  4RT3 A;  1ZQL A;  3G6V A;  5J2B A;  7ICI A;  5KG0 A;  2FPK A;  5L1I A;  2BGW A;  3MGI A;  1T3N A;  2HHU A;  4PPX A;  3RB3 A;  2ZUD A;  3B0Y A;  4ED6 A;  2XY7 A;  4PGQ A;  3IM1 A;  8ICN A;  4TKD A;  2Q0Z X;  4YP3 A;  4QZA A;  2BDP A;  1HJP A;  4NM2 A;  3Q8M A;  3GV8 B;  5KFC A;  3NGD A;  1JMS A;  4QW8 A;  4FS2 A;  1SKS A;  5F9N A;  1NK5 A;  2J6U A;  3HPO A;  5DBA A;  2PFP A;  3RJH A;  4IRD A;  4O5E A;  2BQU A;  4IQU A;  4LVS A;  4BWJ A;  5KT7 A;  9ICB A;  1ZP7 A;  1KFT A;  4M47 A;  3GV5 B;  8ICE A;  4QZ8 A;  3H40 A;  2W9C A;  1U48 A;  4IRK A;  1T7P A;  1XSL A;  4KLO A;  5J0S A;  4O3Q A;  5CA7 A;  4DQS A;  1ZQG A;  5IIJ A;  3PX4 A;  5J0R A;  4F4K A;  4RQ0 A;  3QE9 Y;  3OJS A;  4EZ6 A;  4DL4 A;  3MGH A;  1NKE A;  5J0U A;  5J2F A;  4DL3 A;  2R8J A;  8ICO A;  2VLD A;  3LK9 A;  4J9K A;  1L3T A;  7ICN A;  1HUZ A;  2ZYZ A;  3ZDC A;  5C5J A;  3SI8 A;  4RPX A;  3RJF A;  4HYK A;  3MFH A;  1Y88 A;  4M6W B;  4UQG A;  1NK0 A;  2ATL A;  4J9N A;  5IIM A;  1U9L A;  3ZDE A;  5KFW A;  2HHW A;  2KZM A;  2DFL A;  4ECT A;  3LDA A;  1ZJN A;  4FBT A;  4TQS A;  4P4P A;  1ZQC A;  4UB1 A;  2MUT B;  2NRW A;  2JEG A;  2HHX A;  4F50 A;  2FCO A;  3EPI A;  2RDJ A;  1ZJM A;  5KFI A;  2BCQ A;  3PML A;  5TZV A;  4JUZ A;  1K1S A;  5KFE A;  4JK1 A;  3KHH A;  3PW4 A;  7ICQ A;  4I28 A;  7ICO A;  2HHT A;  7ICP A;  1EXN A;  3FDS A;  4I2H A;  3MR2 A;  2R8I A;  2FMQ A;  9ICG A;  4I29 A;  3PW5 A;  1BPX A;  1XO1 A;  3G6X A;  4Q43 A;  3RB6 A;  5KFM A;  1TKD A;  1ZQD A;  4NXZ A;  5JUM A;  1RXW A;  9ICK A;  9ICP A;  2UVW A;  5KFL A;  9ICH A;  1IXR A;  4QWC A;  4YXJ A;  2IBK A;  3HT3 A; 
#chains in the Genus database with same CATH topology
 2I6X A;  3QEA Z;  2I5H A;  5D46 A;  2FMS A;  4UB4 A;  1NK8 A;  3WKB A;  4QZF A;  4ECV A;  5KL8 B;  4Z6D A;  5KFH A;  5KFG A;  3ALR A;  3JPR A;  1UA1 A;  1CEZ A;  5KAF U;  5DB9 A;  4YMN A;  4KLF A;  5J0P A;  4NY8 A;  3WU2 U;  2W3R A;  1MA7 A;  4DSE A;  1CUK A;  2B21 A;  3UMG A;  7ICE A;  3QU5 A;  3ZD9 A;  2A1J A;  1SKW A;  4PGY A;  3TAQ A;  1FIQ A;  3V6H A;  1C7Y A;  2GJW A;  4EX6 A;  1KKX A;  5KFN A;  5ALQ A;  5KT5 A;  1QQ7 A;  1ZQN A;  4FZL A;  5G5G A;  4ECR A;  3AEV A;  5ALG A;  1YZ7 A;  3KZX A;  8ICL A;  1QSL A;  2K4I A;  2ZIV A;  2EAP A;  2DKZ A;  1SWV A;  4P4M A;  4RQN A;  4RNM A;  2YQE A;  1PK1 A;  1T3Q A;  2RRD A;  3D2S A;  5KFB A;  2P6R A;  4YR3 A;  2PKE A;  3UM9 A;  2W7O A;  5J2J A;  2J6S A;  2HDO A;  4F4X A;  5KL1 B;  4Z6C A;  3ZD8 A;  8ICZ A;  1R0V A;  4BX9 C;  5T14 A;  2W9M A;  3RBD A;  3NAS A;  1XSN A;  3ZDA A;  4RU9 A;  3TAD A;  3C29 A;  2VAN A;  1D8Y A;  4F4Z A;  1QCK A;  5L1K A;  2JEI A;  4DFM A;  1UPH A;  2XY5 A;  3RR7 A;  4DWI A;  3HW8 A;  2B0C A;  1T8E A;  1V97 A;  2GH1 A;  2D6F C;  2Z0R A;  2UVR A;  4M9H A;  7ICU A;  3SAF A;  2KMD A;  2NYV A;  1O08 A;  8ICW A;  4NLN A;  5DQG A;  1L7M A;  2NO5 A;  2YB1 A;  4BXO A;  2OM6 A;  2FLC A;  5CP2 A;  1IM4 A;  2EH9 A;  4EEY A;  2ASJ A;  3OJU A;  3RR8 A;  3F53 A;  1F44 A;  1A79 A;  3QU7 A;  7ICL A;  3HKZ C;  2XC9 A;  5ALM A;  4U6P A;  4GXJ A;  4M9N A;  2JH1 A;  2IOF K;  5ALT A;  1RLV A;  1L7O A;  3JPP A;  1X40 A;  5AM1 A;  4M9J A;  5ALW A;  3BQ2 A;  3QUT A;  4F71 A;  1Y1O A;  3RRG A;  2WAQ F;  9ICN A;  7ICJ A;  3QUC A;  3TKA A;  9ICS A;  3WK7 A;  5KFV A;  1QTM A;  2I9G A;  2QB0 A;  9ICI A;  2LYH A;  1KSP A;  4Q45 A;  4F5P A;  4C7Y A;  1FFU A;  5KG4 A;  3B9J A;  4IQT A;  8ICG A;  2BR0 A;  3H8W A;  9ICV A;  3P1Z A;  4ECX A;  2NRV A;  1VLB A;  4YG2 A;  1PVR A;  3AL0 B;  5J2E A;  2A19 A;  3HP6 A;  3GIM A;  5AK4 A;  2FMP A;  1MQ2 A;  8ICK A;  4YQW A;  3RH5 A;  3UXO A;  1D9F A;  5EE3 A;  2Y1I A;  2GWS A;  2GO7 A;  2ZYZ B;  2QKQ A;  4TUR A;  1RYU A;  1S0M A;  3E2E A;  5AM0 A;  3V6J A;  4LZD A;  4J9O A;  8ICY A;  1BNP A;  5KFP A;  4F5Q A;  2K60 A;  3ZDD A;  2A1J B;  4PJ0 U;  4TUQ A;  2K8B B;  3HX0 A;  2G5H B;  4TUP A;  4P0Q A;  1RQL A;  2W9C B;  4RQM A;  3MFI A;  1ZQI A;  4I2D A;  2LI6 A;  4IC9 A;  2V4Q A;  3D2Q A;  4C4R A;  3N4M B;  4UB2 A;  1N62 A;  3OHA A;  2ZJ5 A;  2G5I B;  3AN1 A;  2HI0 A;  3AJV B;  1SV0 A;  4UAZ A;  1J97 A;  3MAB A;  4BGD A;  4F4Y A;  5J2K A;  4B6J A;  2VA3 A;  1OW5 A;  1X9M A;  2G0A A;  1L3S A;  1XSP A;  4DL5 A;  3RF9 A;  3P1Z B;  1TAU A;  2CRX A;  3E0F A;  4NLZ A;  3PNC A;  1KN5 A;  5AKG A;  5AM3 A;  4DL6 A;  1WWU A;  2HHQ A;  4MF8 A;  1A6S A;  4RPY A;  4O5K A;  2KIV A;  1D9D A;  4F5O A;  5J0Y A;  1SB3 C;  4JV0 A;  1T94 A;  2FLN A;  3RB4 A;  2WF5 A;  3OPX A;  5HR7 A;  1JRP A;  4IS7 A;  5EWG A;  5DB8 A;  4US9 A;  5ALS A;  4Y2Q A;  3RJI A;  5ALV A;  1MQ3 A;  1NNL A;  7ICS A;  5DBC A;  4GC7 A;  1KDH A;  2WFA A;  3GFK B;  3SV4 A;  2FDR A;  2YX8 A;  4J9S A;  5DB6 A;  2DL0 A;  4I2C A;  5E79 U;  2YMQ A;  2XGQ A;  3WKD A;  2IXS A;  4Y2R A;  5KFR A;  1CI4 A;  5KFT A;  4UAW A;  3DEE A;  5KAI U;  1SKR A;  2HSZ A;  1RDF A;  4DSI A;  1Z00 A;  2LMR A;  5J2G A;  2KZZ A;  3RAQ A;  4DL2 A;  2ASL A;  4QJF B;  2UVV A;  3FOV A;  2JHD A;  5AK6 A;  3KZI U;  3HRD D;  3DDH A;  1MC8 A;  4EX7 A;  2BKE A;  2I1Q A;  4PHA A;  2C2R A;  3QU2 A;  4C0Z A;  3PO5 A;  1X2I A;  3NVV A;  3LWM A;  1UT8 A;  1ED1 A;  3M8R A;  4G6V A;  2K8A A;  3JPS A;  2E1E A;  2KK0 A;  3LVV A;  2MUT A;  4QIW C;  3QEB Z;  2GLE A;  1NJW A;  2KHQ A;  4IR1 A;  5J2C A;  5AKX A;  8ICF A;  3WK4 A;  2IOH A;  2XGP A;  1QQ5 A;  3T5H A;  2WF6 A;  4UAS A;  4USA A;  1L7N A;  3MR5 A;  5D49 A;  9ICM A;  3IEY B;  2FLP A;  3PMN A;  2HOQ A;  5AI0 A;  4YVZ A;  4WJ3 B;  5DG7 A;  3O0F A;  3G6V A;  5KG0 A;  2FPK A;  4CF3 A;  3MGI A;  4PPX A;  2KG5 A;  3IM1 A;  2Q0Z X;  4YP3 A;  3PSP A;  1HJP A;  2VS1 A;  4FS2 A;  3NGD A;  5F9N A;  2P35 A;  5KT7 A;  1ZP7 A;  3TAD C;  1IIP A;  2W9C A;  4P0Q B;  5CA7 A;  1ZQG A;  4DQS A;  5J0R A;  3QX7 A;  2YY6 A;  4DL4 A;  2DBY A;  2VLD A;  5AKE A;  4J9K A;  1L3T A;  4UAU A;  3ZDC A;  3IN5 A;  1AQ6 A;  3RJF A;  5AKY A;  3MFH A;  2KIC A;  4M6W B;  4UQG A;  2JXJ A;  5KFW A;  5ALE A;  2K4H A;  2Y9U A;  3NVY A;  4J03 A;  1ZQC A;  5H2F U;  2HHX A;  4F50 A;  1ZJM A;  2BCQ A;  3QUB A;  4I28 A;  1UQV A;  3FC4 A;  3E58 A;  2KV2 A;  2M0N A;  1BPX A;  2HBJ A;  5KFM A;  2WF7 A;  1IXR A;  2JR5 A;  4DS4 A;  3HT3 A;  4F3O A;  4DSJ A;  2KFN A;  8ICJ A;  1B0X A;  8ICT A;  3GU3 A;  2AHO B;  2ZJ8 A;  4B9L A;  2M9N A;  1TAM A;  3HWT A;  4K4I A;  4YMO A;  4Z6E A;  3M9M B;  2F2A B;  2BCS A;  1XMX A;  2FKC A;  4G3I A;  5DKW A;  3KHR A;  3AJV A;  2AGP A;  1U47 A;  2AGQ A;  1ZQO A;  3SR6 A;  3OGU A;  4EZ9 A;  5KFY A;  3K75 D;  1O03 A;  3C28 A;  5KFD A;  3C5F A;  1U4B A;  3QYP A;  2W43 A;  1RXV A;  1ZQU A;  3L5K A;  9ICF A;  2JRZ A;  5EE1 A;  4ECS A;  1LKY A;  4I2A A;  3JPQ A;  1DXS A;  4JV1 A;  4RUA A;  1ZQK A;  3KKA A;  1WWV A;  1Z3E B;  3PY8 A;  2FJ6 A;  3PSF A;  3JPN A;  1L8O A;  1N48 A;  2YTU A;  4R64 A;  1VJ5 A;  2J6T A;  3SZ2 A;  5ALH A;  5ALX A;  4BDP A;  2BQR A;  5ALP A;  2DF4 B;  4RNN A;  5III A;  2IOF A;  4Y2J A;  2JEF A;  2HMX A;  2H5X A;  3FYH A;  1ZQB A;  9ICR A;  4R65 A;  1KBU A;  4BWM A;  4NJ8 A;  4XA5 A;  3M9N B;  5DLF A;  4DFD A;  4QWE A;  1K1Q A;  3A0H U;  4QWB A;  3PST A;  4C8K A;  4Z6F A;  3C21 A;  2ZIW B;  5HML A;  2A1A A;  4CF5 A;  4M0A A;  2B6G A;  3KHL A;  2G07 A;  2KE7 A;  2PFN A;  2WCW A;  2VA8 A;  4GXI A;  1B22 A;  4DAP A;  1M6Y A;  3IHQ B;  3ONN A;  4UBB A;  1PVQ A;  4FFD A;  2ZJA A;  1JXL A;  2NV3 A;  3L3F X;  1YT3 A;  7ICV A;  1V9P A;  4TUS A;  2QB1 A;  2WCZ A;  2H3F A;  3BQ7 A;  5DLG A;  9ICQ A;  4RQ4 A;  3F5A A;  3BQ1 A;  1FFV A;  5KG3 A;  1RPL A;  4KLS A;  4KLL A;  4C8L A;  1Z19 A;  2ZIU A;  3EZ5 A;  2DKX A;  3MGV A;  4EEN A;  2JEJ A;  2V4R A;  2INB A;  3D2N A;  1ECW A;  2BPF A;  4GLX A;  2HHS A;  4PZN A;  2KKP A;  2IHN A;  1ZD4 A;  7ICH A;  2N1R A;  1LV5 A;  3RFA A;  2EZX A;  4J9M A;  4ECU A;  3QNM A;  3H0L B;  2YMM A;  3SAG A;  4IQW A;  4C7Z A;  2KSO B;  1ZQH A;  3OSP A;  1UCV A;  3C1Z A;  2BH2 A;  2JZB B;  2DPJ A;  3ZI4 A;  1KLN A;  5J0O A;  4X5V A;  3M6K A;  3BDP A;  5DG8 A;  4ELT A;  4JWM A;  3GIJ A;  4O3R A;  5ALN A;  1U45 A;  2XID A;  4F4W A;  7ICG A;  1UHU A;  3KOO A;  3MR3 A;  4O9M A;  3AQF A;  4A8E A;  4QBO A;  2XIC A;  4FZN A;  3WK9 A;  3N7P D;  4R8U A;  4O3O A;  3Q8S B;  1H38 A;  3UXN A;  3H0M B;  3NVW A;  2QAR B;  2OKF A;  2FI1 A;  4MF2 A;  2Q4T A;  8ICR A;  4ELU A;  2KJ5 A;  4CGZ A;  2KVC A;  3P1Y A;  5IIN A;  2HBL A;  5J2H A;  2QAR A;  4ZH4 A;  4DQP A;  4PZO A;  4EBC A;  9ICA A;  3RH6 A;  3PR5 B;  3TQ1 A;  3BS5 A;  4ED1 A;  1ZQT A;  4OO1 J;  3WKA A;  2KTQ A;  2NRT A;  2CXY A;  2E8M A;  4F92 B;  3IV6 A;  2XCP A;  5A0L A;  1ZD2 P;  4OJP A;  5AKZ A;  1OXJ A;  4KLT A;  5DQI A;  4DLG A;  2QB0 B;  1SL0 A;  3KD3 A;  4DLE A;  3PR4 A;  3HIL A;  4NLK A;  5JTI A;  1BVS A;  3PZP A;  4UB8 U;  2VJ4 A;  3Q8P B;  3RRH A;  3TFS A;  9ICJ A;  5J0X A;  3PVX A;  4DF4 A;  2FKH B;  1KRP A;  4P4O A;  1ZQZ A;  4EBD A;  1NJX A;  3M9O B;  4ED8 A;  4FZM A;  5AKL A;  2AH5 A;  1A77 A;  1ZQW A;  1ZQP A;  1S97 A;  2EQY A;  2A3V A;  2K4P A;  5B66 U;  3V7K A;  4F8R A;  4F2R A;  3H8S A;  3QZ8 A;  5AI4 A;  4TKK A;  1BPE A;  1SL1 A;  4DFJ A;  4GFJ A;  4KTQ A;  4ACO A;  1UA0 A;  3TAN A;  5CWR A;  3EWA A;  3F2B A;  5DDM A;  3V7J A;  2F1J A;  3MDA A;  4FS1 A;  3Q8K A;  2ZTC A;  4KLJ A;  1DGS A;  1PVP A;  2CPR A;  2KOB A;  2FPM A;  5EWE A;  3N7R C;  5FP0 A;  4Y2Y A;  5GTI U;  8ICP A;  2BDU A;  1J2N A;  1SIJ A;  3IP4 B;  4DFK A;  1XWL A;  5J8Y A;  2OH2 A;  2VIX A;  4RQ6 A;  3V7L A;  2ZXH A;  1F5S A;  4YD2 A;  4RNO A;  4M9G A;  2PMZ C;  4LJX A;  1WG8 A;  5AKH A;  4F93 B;  1DRG A;  2OXO A;  3RJJ A;  1DK2 A;  2E1F A;  4ZOH C;  4QBL A;  4XRH A;  5JU5 A;  4DA2 A;  4DOC A;  3C1Y A;  3KFU F;  1ZYQ A;  1NK9 A;  4M2Y A;  9ICW A;  1RYS A;  2KSO A;  5L1M A;  4AP9 A;  4UB3 A;  3ED5 A;  5ALU A;  2G06 A;  2DQN B;  3RTV A;  3UMB A;  1SXD A;  1T4G A;  4J9P A;  4QZG A;  2W9B A;  4YMM A;  4UAR A;  3MR6 A;  4B9M A;  2DWQ A;  4O0I A;  1ZXI A;  4IR9 A;  3SEN A;  5KFK A;  1ZQQ A;  4MFC A;  4C8M A;  8ICX A;  4RT3 A;  7ICI A;  5J2B A;  1T3N A;  1X6I A;  1ZRM A;  3GV8 B;  1SKS A;  2J6U A;  3RJH A;  3HPO A;  5DBA A;  2BQU A;  4LVS A;  4ICA A;  2D3D A;  8ICE A;  3H40 A;  4IRK A;  1T7P A;  4G6U A;  2CN1 A;  4OJ5 A;  3PX4 A;  2H3Q A;  4F4K A;  3OJS A;  4EZ6 A;  3MGH A;  1NKE A;  5J2F A;  8ICO A;  5C0Y A;  2O6K A;  3BZK A;  2LM4 A;  3SI8 A;  4HYK A;  4JB3 A;  1NK0 A;  2ATL A;  2E5S A;  5IIM A;  4NL9 A;  4ECT A;  1ZJN A;  3LDA A;  4P4P A;  2MUT B;  2JEG A;  4LQE A;  3PML A;  5KFE A;  1N61 A;  3BZC A;  3PW4 A;  7ICQ A;  1CRX A;  2EZY A;  4QIW F;  3NUQ A;  3FDS A;  3R9K A;  4I2H A;  4FE3 A;  4I29 A;  2JGA A;  2QLT A;  3RB6 A;  2KP7 A;  1ZQD A;  4NXZ A;  4QWC A;  2IBK A;  4YFK A;  4QZC A;  3QU9 A;  3UXP A;  5FDK A;  4Y2P A;  2LYB A;  2WF8 A;  4KX5 A;  4EYI B;  3JPT A;  1ZOL A;  2IHM A;  2K4E A;  3KTQ A;  4F5N A;  4QWD A;  3F5E A;  2MAX A;  1KTQ A;  4EEK A;  5JRT A;  3TAR A;  2JMG A;  2YN4 A;  2R8H A;  8ICC A;  1X42 A;  8ICM A;  1OB8 A;  3ZDB A;  1LB2 B;  1L5U A;  3WK5 A;  3C5G A;  3ISC A;  2G08 A;  4M9L A;  4DSL A;  2XVT A;  1BPD A;  4UAV A;  4I27 A;  5AM2 A;  1OB9 A;  3IF0 X;  3CRX A;  5HHH A;  1SXE A;  4NLB A;  4DQQ A;  1BGX T;  1D8B A;  3M1Y A;  3HJE A;  2EAM A;  2K8C B;  3OSN A;  4KLI A;  2ZG6 A;  3SAH A;  1S8O A;  1ZQJ A;  3GIL A;  5KFX A;  3I28 A;  4Q44 A;  2PI5 A;  4FO6 A;  2IMW P;  1R11 A;  1BPZ A;  3LYS A;  1N2X A;  1N56 A;  2OYY A;  3AM9 A;  1ARO P;  2ZUB A;  5BPC A;  1X66 A;  3KKA C;  2GW6 A;  2AXT U;  4QZD A;  4CCH A;  8ICU A;  5CJ7 A;  1KEJ A;  4O3N A;  1S0V A;  2NRZ A;  2R8K A;  8ICI A;  2R18 A;  4I2G A;  2MSN A;  2FPL A;  2HCF A;  1WCL A;  2DGZ A;  1BNO A;  5J29 A;  4EV1 A;  5BOM A;  4BJQ A;  4F5R A;  3GZF A;  3PX0 A;  5KT2 A;  3Q8R B;  1S9F A;  1L8L A;  1RZT A;  1FO4 A;  5D4B A;  2P66 A;  1NKB A;  5AI8 A;  4KLU A;  2DPI A;  1RZN A;  5ALJ A;  5KG2 A;  2PFQ A;  5KFQ A;  2CV8 A;  4Q8F A;  3N97 B;  4IQV A;  2W3S A;  3OTQ A;  7ICT A;  2RDI A;  5HP4 A;  4R66 A;  1JX4 A;  4I2I A;  8ICB A;  2OEH A;  1ZET A;  2CZR A;  3H4D A;  5KT4 A;  1X9S A;  4MEY A;  2XI9 A;  4GXK A;  2ASD A;  1MN8 A;  5HHI A;  4OCZ A;  2ZUC A;  5KFA A;  2WF9 A;  5ALK A;  4R8U B;  2W7P A;  5AIC A;  3QU4 A;  1N5W A;  2KKV A;  3NVZ A;  4QNL A;  1TFR A;  5IIL A;  1ZQE A;  3WKC A;  1PUZ A;  4Q8E A;  5KFO A;  2AQ4 A;  4B9U A;  1UWV A;  3QUQ A;  2JZB A;  3OHB A;  4YR0 A;  3N28 A;  1XU4 A;  1BPB A;  1S0N A;  2V9W A;  1HEK A;  1Q3U A;  1NK4 A;  3GQC A;  3RJG A;  3AMZ A;  9ICE A;  3THV A;  1ZQF A;  1HUO A;  1NJZ A;  5AI9 A;  3MBY A;  4RZR A;  1NZP A;  4QZE A;  3T79 A;  4E6Z A;  2ZIX A;  2WAQ C;  1TAQ A;  4EEL A;  3PV8 A;  4XQ8 A;  2ZXI A;  3ETR A;  3I76 A;  2ZIV B;  1ZQS A;  3LWL A;  4DQR A;  3PO4 A;  4KLE A;  4I2F A;  5DBB A;  3IEY A;  2AQ0 A;  1ZRN A;  2G09 A;  2W04 A;  1L3U A;  2F77 X;  2F1I A;  4F72 A;  1BPY A;  4R63 A;  5AM4 A;  4DCC A;  1TK0 A;  4QZB A;  1GO3 F;  3V6K A;  3WK6 A;  7ICM A;  3PSI A;  2LPE A;  2L5Y A;  4NLG A;  2WTF A;  2WJ0 A;  3N7S C;  1L3V A;  5CEH A;  2WB1 F;  2ZTD A;  9ICO A;  3QZ7 A;  5CHG A;  1B43 A;  2W9B B;  3B0X A;  4UAT A;  2HW3 A;  3AQE A;  3IRU A;  4KLM A;  4M6W A;  1NJY A;  4O3S A;  5AHX A;  1Z1V A;  4NM1 A;  2OHF A;  1RYR A;  4MFA A;  5ALD A;  3GV7 B;  3RBE A;  4TQR A;  2XO7 A;  4RUC A;  2F1H A;  1Z00 B;  4PL2 A;  4I2J A;  4ECQ A;  4K4H A;  5KTQ A;  3RB0 A;  1QSS A;  3NS1 A;  4MFF A;  2HVI A;  2W03 A;  1HIW A;  2FLL A;  1TVA A;  4U7C A;  4ECZ A;  3UPQ A;  2KJ9 A;  4B9N A;  5IIO A;  2ODG A;  4CE6 A;  5J0Q A;  2LYA A;  5CB1 A;  4MEX A;  5DQH A;  3LVW A;  5ALI A;  2PI4 A;  5AIB A;  4KIT B;  1JXE A;  2WIZ A;  9ICT A;  3NTU A;  4NLC A;  3WKE A;  1ZQY A;  2F44 A;  3PW0 A;  5F9L A;  1TK5 A;  1JN3 A;  2DBS A;  4J9Q A;  3NRW A;  3RAX A;  2C28 A;  3EW9 A;  4MHV A;  5J0T A;  1A76 A;  3BJY A;  2D8C A;  3MC1 A;  4KMU A;  4UBC A;  3TAP A;  4C8N A;  1ZQM A;  4C4T A;  1JRO A;  3ICX A;  4EYH B;  5J8Y C;  4JWN A;  2H3Z A;  1XS9 D;  3RJK A;  4ECW A;  3TFR A;  3C2M A;  3F2C A;  2KFZ A;  3HKZ F;  2H3V A;  2C2E A;  5AI5 A;  3CP8 A;  5AI6 A;  3F2D A;  5ALZ A;  2PXI A;  3PW7 A;  4P0P B;  5KG6 A;  2HBM A;  2LKY A;  3NRZ A;  2E8N A;  4DO9 A;  5CRX A;  3FM9 A;  3IG8 A;  2FE9 A;  1N60 A;  5EE0 A;  3AU2 A;  1QLN A;  1S0O A;  4KLD A;  5KT6 A;  3BS5 B;  3M6Z A;  1ZQL A;  2BGW A;  5L1I A;  2HHU A;  3RB3 A;  2ZUD A;  3B0Y A;  4G9B A;  4ED6 A;  3VC8 A;  2XY7 A;  1ZQ1 C;  2ZIX B;  2RQ5 A;  5KFC A;  1JMS A;  2PFP A;  5F3X B;  4O3M A;  9ICB A;  1VDV A;  4KLO A;  4O3Q A;  1JI7 A;  5IIJ A;  1SZH A;  4RQ0 A;  3QE9 Y;  4NL9 C;  2R8J A;  4NWI A;  4CNQ A;  7ICN A;  1HUZ A;  2ZYZ A;  1P7D A;  5C5J A;  2Y9T A;  2F3N A;  2W11 A;  1Y88 A;  1NI3 A;  1U9L A;  3ZDE A;  2DFL A;  3K1Z A;  5ALO A;  1RM6 C;  4UB1 A;  2NRW A;  3UMC A;  2FCO A;  3EPI A;  2RDJ A;  5KFI A;  2EZZ A;  1KW4 A;  1K1S A;  1SV4 A;  1Q3V A;  7ICP A;  3MR2 A;  9ICG A;  3PW5 A;  1XO1 A;  3G6X A;  3CYM A;  2UVW A;  9ICH A;  4YXJ A;  2NO4 A;  5B5E U;  4OD0 A;  4QW9 A;  5J2I A;  3Q8L A;  3KBB A;  3SD7 A;  3C2K A;  3M8S A;  4DFP A;  3VCB A;  3AU6 A;  2C22 A;  1QH9 A;  4F91 B;  4RQ1 A;  2ISP A;  4C8O A;  2EO0 A;  2RLT A;  4DEZ A;  5DGB A;  2YML A;  3C23 A;  5AKK A;  4AYB F;  9ICC A;  4C80 A;  2XCA A;  4DSF A;  1F0M A;  1TE2 A;  4LZG A;  2AU0 A;  1S5L U;  2OCE A;  1KQQ A;  1Q46 A;  3EPG A;  4P2H A;  4PHD A;  4RQ3 A;  3JPO A;  1GEF A;  1S76 D;  3SYZ A;  1TV9 A;  4ED2 A;  2BHN A;  4US8 A;  1C20 A;  2LHT A;  2RHF A;  2BPG A;  4YD1 A;  1FEZ A;  1S77 D;  2BCR A;  4O5C A;  1DOQ A;  9ICX A;  3SMV A;  4CRX A;  2VA2 A;  4QZI A;  8ICQ A;  5IIK A;  3L4P A;  4KLG A;  2C2D A;  3H8M A;  5AK5 A;  2E8P A;  2JV3 A;  3IG5 A;  2AGO A;  4RQ2 A;  4O3P A;  5L1L A;  1X9W A;  5KFJ A;  2HOF A;  4I2E A;  1J2M A;  2W9A A;  4BUG A;  2LM1 A;  2W8K A;  3K4G A;  5J0W A;  2K89 A;  1SL2 A;  5G5H A;  3BQ0 A;  3IDW A;  3H0R B;  1WCN A;  4DSK A;  1YNM A;  5L1J A;  4RT2 A;  2ZTE A;  1IG6 A;  2FL3 A;  4J9L A;  4Y2S A;  1F1Z A;  4JMU A;  4J9R A;  3EUB 2;  2BPC A;  3DV9 A;  5L9X A;  2KNJ A;  1JIH A;  4PGX A;  2YMP A;  5KG5 A;  3S6J A;  4RQ5 A;  5DGA A;  3EYZ A;  4DF8 A;  5DB7 A;  4QWA A;  2HVH A;  4PHP A;  4ECY A;  1COO A;  4KX3 A;  3SV3 A;  9ICK A;  9ICP A;  4RQ7 A;  3KHG A;  2H3I A;  3H7I A;  4KMO B;  2KD1 A;  4GIB A;  4IRC A;  3WK8 A;  5KT3 A;  1DK3 A;  1N5X A;  2BCU A;  3T5K A;  5EWF A;  2P6U A;  5KFU A;  1ZQR A;  4KLH A;  1QSY A;  4HAI A;  5EOZ A;  1UT5 A;  2WHE A;  4BXO B;  3T5L A;  1Q8K A;  2GOL A;  3K1R B;  2Y0S F;  1D8L A;  3UQ2 A;  4C4S A;  8ICV A;  2KIW A;  3ISB A;  4Y2U A;  3ETL A;  2VJ5 A;  1U49 A;  3A0B U;  5AIA A;  5GTH U;  4UB5 A;  1XC9 A;  4ED7 A;  3ORY A;  5AK3 A;  1X9X A;  4YR2 A;  4KN4 A;  4DS5 A;  3QXG A;  2E8O A;  3TAC B;  2XY6 A;  3DNX A;  2ZIU B;  1SV0 C;  3CNH A;  1ZQA A;  5DG9 A;  2WB1 C;  3U26 A;  4NV0 A;  1XNS A;  5HR6 A;  2EAO A;  2OST A;  1LKY B;  2BCV A;  5J2A A;  4Y2T A;  1MSW D;  5ALR A;  1DGJ A;  3BS7 A;  2W55 A;  5AM5 A;  2Y0S C;  1PK3 A;  3RJE A;  4B9T A;  5J2D A;  4B9S A;  2F76 X;  1JAL A;  2R8G A;  1ZQX A;  2F8L A;  4EBE A;  1SGG A;  1ZD5 A;  4Y2X A;  4I2B A;  1X6J A;  5KG7 A;  1B4F A;  4ELV A;  3UQ0 A;  8ICS A;  4YN4 A;  4E0D A;  1SZP A;  5TIS U;  5AKI A;  1A0P A;  3H8J A;  2EAN A;  2DUY A;  2KZ3 A;  1V38 A;  4GC6 A;  1KL9 A;  1Z4N A;  2HHV A;  2W54 A;  4ED0 A;  4XUS A;  2PFO A;  2IA6 A;  4OJ6 A;  4DL7 A;  4KLQ A;  9ICL A;  3BT7 A;  4QZH A;  3ISD A;  2ES6 A;  4PHE A;  2LBO A;  5CR0 A;  1Z4O A;  1KFD A;  4YCX A;  3SQI A;  1JUD A;  3GDX A;  1ZQV A;  4CDG A;  2KJ8 A;  2KEY A;  2EDU A;  1SWW A;  2ALZ A;  3SEI A;  4QBN A;  1QQ6 A;  4YXM A;  1XO0 A;  5KNI A;  7ICF A;  4IL6 U;  8ICA A;  4RQ8 A;  1N63 A;  4DOB A;  2RP5 A;  1S10 A;  3I1Y A;  4B9V A;  1NKC A;  1NK7 A;  3CW2 C;  4Y2V A;  5AKJ A;  4K4G A;  2JH7 A;  3T5J A;  2MRL A;  3PX6 A;  3J81 j;  3C2L A;  1NZB A;  4DQI A;  8ICH A;  2OWO A;  2MA1 A;  1KFS A;  1WUD A;  5KFS A;  4ZQU A;  3GII A;  5ALL A;  1RG6 A;  5KFZ A;  5ALF A;  2ZIW A;  1RQN A;  1V85 A;  1TK8 A;  2BZF A;  4ED3 A;  5BOL A;  5DDY A;  3FAH A;  3H4B A;  3GIK A;  3G6Y A;  7ICK A;  5KG1 A;  2KN7 A;  2AJQ A;  2NRX A;  5K4L A;  4KN7 A;  1PZN A;  4PH5 A;  2Z7J A;  4M04 A;  3PW2 A;  3BQT A;  4RPZ A;  3AUO A;  1NK6 A;  1T0F A;  3M7D A;  2Y1J A;  3TI0 A;  3V72 A;  3Q8Q B;  2UVU A;  4JV2 A;  2BQ3 A;  1ZD3 A;  2W8L A;  4AYB C;  5HMM A;  3MDC A;  1IPI A;  1NOM A;  1HH1 A;  4DOA A;  4UAY A;  3T3F A;  5HNK A;  2WIW A;  5KFF A;  4PL1 A;  1IV8 A;  1COK A;  4QZ9 A;  4FBU A;  2ESE A;  7ICR A;  2ISO A;  3RH4 A;  9ICU A;  1K5O A;  2YB4 A;  2F8K A;  2W8M A;  2JJQ A;  1L6N A;  4PGQ A;  8ICN A;  4TKD A;  2HBK A;  5ALY A;  1LVH A;  4QZA A;  2BDP A;  4NM2 A;  3Q8M A;  4F2S A;  4QW8 A;  4O5E A;  1NK5 A;  4IRD A;  4IQU A;  4BWJ A;  4OJO A;  2HOI A;  2PMZ F;  1KFT A;  4M47 A;  3GV5 B;  5EE9 A;  4QZ8 A;  1U48 A;  2MU2 A;  1XSL A;  2VKQ A;  5J0S A;  2KHV A;  5J0U A;  4DL3 A;  3LK9 A;  1OUQ A;  4UW9 A;  1L7P A;  2E3T A;  1YZ6 A;  4RPX A;  4J9N A;  2HHW A;  2KZM A;  4FBT A;  4TQS A;  4P0P A;  1WYG A;  1Z1B A;  5TZV A;  4JUZ A;  4JK1 A;  3KHH A;  4CF4 A;  7ICO A;  2HHT A;  1EXN A;  2R8I A;  2FMQ A;  2KVS A;  3D6J A;  1URJ A;  4Q43 A;  1TKD A;  1PK1 B;  5JUM A;  1RXW A;  4UB6 U;  5KFL A;  4OJL A;  4DAV A; 
#chains in the Genus database with same CATH homology
 4YFK A;  4QZC A;  3QEA Z;  4DSJ A;  4F3O A;  2KFN A;  8ICJ A;  5FDK A;  3UXP A;  8ICT A;  4QW9 A;  2ZJ8 A;  5J2I A;  4B9L A;  3Q8L A;  5D46 A;  2FMS A;  2M9N A;  4UB4 A;  1NK8 A;  4EYI B;  3C2K A;  3JPT A;  3M8S A;  3HWT A;  4DFP A;  4K4I A;  4QZF A;  2IHM A;  4ECV A;  3AU6 A;  2C22 A;  4YMO A;  4Z6E A;  4F91 B;  4RQ1 A;  3M9M B;  4F5N A;  2BCS A;  4Z6D A;  2ISP A;  3KTQ A;  1XMX A;  2FKC A;  4C8O A;  4G3I A;  2EO0 A;  5KFH A;  5DKW A;  3KHR A;  5KFG A;  4QWD A;  3AJV A;  3JPR A;  2AGP A;  1UA1 A;  2MAX A;  1CEZ A;  4DEZ A;  5DGB A;  5DB9 A;  1U47 A;  1KTQ A;  4YMN A;  2AGQ A;  4KLF A;  1ZQO A;  3TAR A;  5J0P A;  3OGU A;  4NY8 A;  3C23 A;  4EZ9 A;  2R8H A;  4DSE A;  5KFY A;  8ICC A;  3K75 D;  9ICC A;  2XCA A;  1CUK A;  2B21 A;  8ICM A;  7ICE A;  4DSF A;  3ZD9 A;  1OB8 A;  3ZDB A;  4LZG A;  5KFD A;  3C5F A;  2A1J A;  1LB2 B;  1SKW A;  1L5U A;  1U4B A;  4PGY A;  3TAQ A;  2AU0 A;  3V6H A;  1C7Y A;  3C5G A;  2GJW A;  3ISC A;  1RXV A;  4M9L A;  1ZQU A;  5KFN A;  3EPG A;  4DSL A;  9ICF A;  4P2H A;  4PHD A;  4RQ3 A;  1BPD A;  3JPO A;  1GEF A;  1S76 D;  3SYZ A;  4ECS A;  4I2A A;  3JPQ A;  4ED2 A;  1TV9 A;  2BHN A;  4I27 A;  4JV1 A;  1OB9 A;  3IF0 X;  4RUA A;  5HHH A;  5KT5 A;  2BPG A;  1ZQN A;  4YD1 A;  1ZQK A;  4ECR A;  1S77 D;  2BCR A;  4O5C A;  1DOQ A;  9ICX A;  4DQQ A;  1BGX T;  8ICL A;  1Z3E B;  1QSL A;  3PY8 A;  3OSN A;  4KLI A;  3JPN A;  4P4M A;  4RNM A;  1N48 A;  4R64 A;  2VA2 A;  1ZQJ A;  4QZI A;  3GIL A;  4DS4 A;  2J6T A;  8ICQ A;  5KFX A;  4Q44 A;  5IIK A;  5KFB A;  2P6R A;  2PI5 A;  3SZ2 A;  4FO6 A;  2C2D A;  4KLG A;  4YR3 A;  2IMW P;  4BDP A;  2BQR A;  1BPZ A;  5J2J A;  1R11 A;  2AGO A;  1N56 A;  2J6S A;  4RQ2 A;  1ARO P;  4RNN A;  4F4X A;  2ZUB A;  5BPC A;  4O3P A;  5III A;  4Z6C A;  3ZD8 A;  5L1L A;  8ICZ A;  2JEF A;  1X9W A;  1R0V A;  2FKH B;  5KFJ A;  2W9M A;  2GW6 A;  4I2E A;  3RBD A;  3ZDA A;  1XSN A;  2H5X A;  3FYH A;  4RU9 A;  2W9A A;  4QZD A;  4R65 A;  1ZQB A;  4BWM A;  4CCH A;  8ICU A;  9ICR A;  5CJ7 A;  1KEJ A;  2VAN A;  1D8Y A;  4F4Z A;  4XA5 A;  3M9N B;  4O3N A;  2W8K A;  5L1K A;  5DLF A;  4DFM A;  1S0V A;  4QWE A;  2JEI A;  2NRZ A;  1K1Q A;  3K4G A;  2XY5 A;  2R8K A;  8ICI A;  3RR7 A;  4I2G A;  5J0W A;  2FPL A;  3HW8 A;  4QWB A;  1SL2 A;  4DWI A;  1T8E A;  4C8K A;  4Z6F A;  3C21 A;  1WCL A;  3BQ0 A;  5J29 A;  4EV1 A;  5HML A;  5BOM A;  4F5R A;  8ICA A;  4M0A A;  1WCN A;  3PX0 A;  4DSK A;  1YNM A;  2Z0R A;  3KHL A;  2UVR A;  5KT2 A;  5L1J A;  4M9H A;  2PFN A;  7ICU A;  3Q8R B;  4RT2 A;  2VA8 A;  2ZTE A;  2WCW A;  4GXI A;  4J9L A;  1S9F A;  1B22 A;  1RZT A;  1F1Z A;  4DAP A;  4J9R A;  5D4B A;  1NKB A;  2P66 A;  4KLU A;  2DPI A;  2BPC A;  1RZN A;  2PFQ A;  3IHQ B;  5KG2 A;  5L9X A;  5KFQ A;  4UBB A;  8ICW A;  2CV8 A;  4NLN A;  5DQG A;  4Q8F A;  2ZJA A;  1JIH A;  4PGX A;  1JXL A;  5KG5 A;  4BXO A;  4RQ5 A;  3N97 B;  5DGA A;  3EYZ A;  4DF8 A;  2FLC A;  5CP2 A;  7ICV A;  5DB7 A;  1V9P A;  4IQV A;  4QWA A;  4TUS A;  2HVH A;  2WCZ A;  4PHP A;  7ICT A;  4ECY A;  1IM4 A;  5DLG A;  9ICQ A;  4EEY A;  2ASJ A;  4RQ4 A;  2RDI A;  3BQ1 A;  1COO A;  5HP4 A;  5KG3 A;  4R66 A;  3OJU A;  4I2I A;  3SV3 A;  4RQ7 A;  1RPL A;  3KHG A;  1JX4 A;  1ZET A;  3RR8 A;  8ICB A;  2CZR A;  3H4D A;  3H7I A;  5KT4 A;  4KLS A;  4KLL A;  4IRC A;  1X9S A;  4MEY A;  4C8L A;  1A79 A;  5KT3 A;  3EZ5 A;  4GXK A;  2ASD A;  2JEJ A;  5HHI A;  2BCU A;  3T5K A;  7ICL A;  2ZUC A;  2V4R A;  5EWF A;  2P6U A;  5KFU A;  1ZQR A;  2XC9 A;  5KFA A;  4KLH A;  2INB A;  1QSY A;  4GXJ A;  2BPF A;  4M9N A;  4R8U B;  5EOZ A;  4GLX A;  2HHS A;  1RLV A;  2IHN A;  1UT5 A;  3JPP A;  4M9J A;  7ICH A;  1LV5 A;  4BXO B;  3BQ2 A;  1Y1O A;  4J9M A;  1TFR A;  4ECU A;  3T5L A;  5IIL A;  3RRG A;  1ZQE A;  4Q8E A;  1D8L A;  7ICJ A;  3UQ2 A;  9ICN A;  8ICV A;  5KFO A;  2AQ4 A;  3ISB A;  4B9U A;  4IQW A;  1ZQH A;  3ETL A;  9ICS A;  1U49 A;  1UWV A;  4UB5 A;  3OSP A;  2JZB A;  5KFV A;  3C1Z A;  3OHB A;  1QTM A;  1XC9 A;  4YR0 A;  2BH2 A;  4ED7 A;  3ORY A;  2I9G A;  9ICI A;  2LYH A;  1KSP A;  2JZB B;  4Q45 A;  4YR2 A;  2DPJ A;  4KN4 A;  4F5P A;  4DS5 A;  5KG4 A;  1KLN A;  4IQT A;  5J0O A;  4X5V A;  8ICG A;  3BDP A;  2XY6 A;  2BR0 A;  5DG8 A;  1XU4 A;  1BPB A;  3H8W A;  4ELT A;  1S0N A;  2V9W A;  9ICV A;  3DNX A;  3P1Z A;  4JWM A;  4ECX A;  1ZQA A;  2NRV A;  5DG9 A;  4YG2 A;  3GIJ A;  4O3R A;  5J2E A;  1NK4 A;  3GQC A;  1U45 A;  3HP6 A;  3RJG A;  2OST A;  4F4W A;  3GIM A;  2BCV A;  7ICG A;  2FMP A;  9ICE A;  1MQ2 A;  8ICK A;  5J2A A;  3MR3 A;  3THV A;  4YQW A;  4O9M A;  3RH5 A;  3UXO A;  1D9F A;  1ZQF A;  1MSW D;  1HUO A;  1NJZ A;  4QBO A;  2Y1I A;  2GWS A;  3MBY A;  2ZYZ B;  4RZR A;  4TUR A;  4R8U A;  4O3O A;  3Q8S B;  1H38 A;  1S0M A;  4QZE A;  3E2E A;  3UXN A;  3V6J A;  4E6Z A;  4LZD A;  4J9O A;  8ICY A;  1TAQ A;  5KFP A;  3RJE A;  4B9T A;  3PV8 A;  4F5Q A;  4XQ8 A;  5J2D A;  2OKF A;  4B9S A;  3ZDD A;  2A1J B;  4MF2 A;  1ZQS A;  2R8G A;  1ZQX A;  4TUQ A;  3LWL A;  4DQR A;  8ICR A;  3HX0 A;  3PO4 A;  4ELU A;  4KLE A;  4EBE A;  4I2F A;  3P1Y A;  5IIN A;  5DBB A;  4TUP A;  5J2H A;  4I2B A;  5KG7 A;  4ZH4 A;  3IEY A;  4DQP A;  2W9C B;  4ELV A;  2AQ0 A;  3UQ0 A;  1L3U A;  8ICS A;  4F2S A;  4YN4 A;  2F1I A;  3MFI A;  4EBC A;  4I2D A;  1ZQI A;  4E0D A;  9ICA A;  1SZP A;  2V4Q A;  1BPY A;  4R63 A;  3RH6 A;  3N4M B;  4UB2 A;  3H8J A;  3PR5 B;  3OHA A;  3TQ1 A;  1TK0 A;  2ZJ5 A;  4QZB A;  2KZ3 A;  3V6K A;  7ICM A;  4GC6 A;  4ED1 A;  1ZQT A;  2HHV A;  4ED0 A;  4XUS A;  2PFO A;  2IA6 A;  2KTQ A;  4UAZ A;  3AJV B;  2NRT A;  4NLG A;  2WTF A;  4DL7 A;  2WJ0 A;  3MAB A;  4F92 B;  4BGD A;  2XCP A;  4F4Y A;  1L3V A;  4KLQ A;  5J2K A;  9ICL A;  3BT7 A;  4QZH A;  3ISD A;  2VA3 A;  1X9M A;  1L3S A;  2ZTD A;  1XSP A;  9ICO A;  4DL5 A;  4KLT A;  5DQI A;  4DLG A;  3QZ7 A;  1SL0 A;  4PHE A;  5CHG A;  1B43 A;  5CR0 A;  2W9B B;  4DLE A;  3P1Z B;  3PR4 A;  1TAU A;  3B0X A;  4NLZ A;  4NLK A;  3PNC A;  2HW3 A;  1BVS A;  4DL6 A;  1KFD A;  4YCX A;  4KLM A;  2HHQ A;  3Q8P B;  4MF8 A;  3GDX A;  4RPY A;  3RRH A;  3TFS A;  1ZQV A;  4M6W A;  4O5K A;  9ICJ A;  1NJY A;  5J0X A;  3PVX A;  4DF4 A;  1D9D A;  4O3S A;  4F5O A;  1KRP A;  4P4O A;  1ZQZ A;  5J0Y A;  4EBD A;  4JV0 A;  3M9O B;  1NJX A;  4NM1 A;  4ED8 A;  1RYR A;  2FLN A;  4MFA A;  2ALZ A;  3RB4 A;  3GV7 B;  3RBE A;  4QBN A;  4YXM A;  4TQR A;  2F1H A;  1Z00 B;  4RUC A;  2XO7 A;  4I2J A;  1A77 A;  4ECQ A;  1ZQW A;  5EWG A;  4K4H A;  7ICF A;  5DB8 A;  4RQ8 A;  1S97 A;  1ZQP A;  5KTQ A;  3RB0 A;  1QSS A;  4MFF A;  2HVI A;  3RJI A;  4DOB A;  1MQ3 A;  3V7K A;  4F8R A;  4F2R A;  2FLL A;  1TVA A;  3H8S A;  1S10 A;  3QZ8 A;  4TKK A;  7ICS A;  1BPE A;  4ECZ A;  1SL1 A;  4B9V A;  1NKC A;  4DFJ A;  5DBC A;  4GC7 A;  1KDH A;  1NK7 A;  3UPQ A;  3GFK B;  4KTQ A;  1UA0 A;  3SV4 A;  3TAN A;  5CWR A;  4B9N A;  5IIO A;  3EWA A;  5DB6 A;  4J9S A;  4K4G A;  5DDM A;  5J0Q A;  3V7J A;  3T5J A;  5CB1 A;  3PX6 A;  4MEX A;  4I2C A;  2F1J A;  3MDA A;  3C2L A;  4FS1 A;  3Q8K A;  2XGQ A;  2ZTC A;  2IXS A;  4DQI A;  4KLJ A;  1DGS A;  5KFR A;  5DQH A;  8ICH A;  5KFT A;  2OWO A;  4UAW A;  2FPM A;  1KFS A;  2PI4 A;  5KFS A;  5EWE A;  4KIT B;  4ZQU A;  1JXE A;  1SKR A;  8ICP A;  3GII A;  2WIZ A;  9ICT A;  3NTU A;  5KFZ A;  4DFK A;  1ZQY A;  4DSI A;  1Z00 A;  1XWL A;  5J2G A;  5F9L A;  3PW0 A;  1JN3 A;  1TK5 A;  2DBS A;  4J9Q A;  4RQ6 A;  2KZZ A;  3RAQ A;  4DL2 A;  2ASL A;  3V7L A;  1TK8 A;  2UVV A;  3FOV A;  4YD2 A;  4RNO A;  4ED3 A;  3RAX A;  4M9G A;  5BOL A;  5DDY A;  2C28 A;  3EW9 A;  3GIK A;  3H4B A;  3G6Y A;  4F93 B;  1MC8 A;  7ICK A;  2BKE A;  2I1Q A;  5J0T A;  1A76 A;  5KG1 A;  2KN7 A;  3RJJ A;  4PHA A;  2AJQ A;  2C2R A;  4DAV A;  3PO5 A;  2NRX A;  4QBL A;  1X2I A;  4KN7 A;  3BJY A;  1PZN A;  4PH5 A;  1UT8 A;  3LWM A;  4KMU A;  4UBC A;  3M8R A;  4C8N A;  3TAP A;  4XRH A;  1ZQM A;  4M04 A;  4DOC A;  4G6V A;  4DA2 A;  3JPS A;  3PW2 A;  3BQT A;  3C1Y A;  4EYH B;  4RPZ A;  3AUO A;  1ZYQ A;  4JWN A;  2MUT A;  1XS9 D;  1NK9 A;  1NK6 A;  3RJK A;  1T0F A;  4ECW A;  2Y1J A;  3TI0 A;  3V72 A;  4M2Y A;  9ICW A;  3Q8Q B;  3QEB Z;  1RYS A;  3TFR A;  1NJW A;  2UVU A;  3C2M A;  4IR1 A;  5J2C A;  4JV2 A;  2BQ3 A;  2KFZ A;  4UB3 A;  2W8L A;  2C2E A;  8ICF A;  3MDC A;  5HMM A;  2XGP A;  3T5H A;  1IPI A;  3RTV A;  1NOM A;  2PXI A;  3PW7 A;  1HH1 A;  4DOA A;  4UAY A;  5KG6 A;  1T4G A;  5HNK A;  3T3F A;  4J9P A;  4QZG A;  3MR5 A;  4DO9 A;  2WIW A;  5D49 A;  5KFF A;  9ICM A;  2W9B A;  4YMM A;  4QZ9 A;  3MR6 A;  4B9M A;  4FBU A;  3IEY B;  2FLP A;  3PMN A;  3AU2 A;  4O0I A;  4IR9 A;  1QLN A;  4YVZ A;  5KFK A;  1S0O A;  1ZQQ A;  4KLD A;  5KT6 A;  5DG7 A;  4MFC A;  7ICR A;  4C8M A;  2ISO A;  3RH4 A;  9ICU A;  8ICX A;  4RT3 A;  1ZQL A;  3G6V A;  5J2B A;  7ICI A;  5KG0 A;  2FPK A;  5L1I A;  2BGW A;  3MGI A;  1T3N A;  2W8M A;  2JJQ A;  2HHU A;  4PPX A;  3RB3 A;  2ZUD A;  3B0Y A;  4ED6 A;  2XY7 A;  4PGQ A;  3IM1 A;  8ICN A;  4TKD A;  2Q0Z X;  4YP3 A;  4QZA A;  2BDP A;  1HJP A;  4NM2 A;  3Q8M A;  3GV8 B;  2VS1 A;  5KFC A;  3NGD A;  1JMS A;  4QW8 A;  4FS2 A;  1SKS A;  5F9N A;  1NK5 A;  2J6U A;  3HPO A;  5DBA A;  2PFP A;  3RJH A;  4IRD A;  4O5E A;  2BQU A;  4IQU A;  4LVS A;  4BWJ A;  5KT7 A;  9ICB A;  1ZP7 A;  1KFT A;  4M47 A;  3GV5 B;  8ICE A;  4QZ8 A;  3H40 A;  2W9C A;  1U48 A;  4IRK A;  1T7P A;  4G6U A;  1XSL A;  4KLO A;  5J0S A;  4O3Q A;  5CA7 A;  4DQS A;  1ZQG A;  5IIJ A;  3PX4 A;  5J0R A;  4F4K A;  4RQ0 A;  3QE9 Y;  3OJS A;  4EZ6 A;  4DL4 A;  3MGH A;  1NKE A;  5J0U A;  5J2F A;  4DL3 A;  2R8J A;  8ICO A;  2VLD A;  3LK9 A;  4J9K A;  1L3T A;  7ICN A;  1HUZ A;  2ZYZ A;  3ZDC A;  5C5J A;  3SI8 A;  4RPX A;  3RJF A;  4HYK A;  3MFH A;  1Y88 A;  4M6W B;  4UQG A;  1NK0 A;  2ATL A;  4J9N A;  5IIM A;  1U9L A;  3ZDE A;  5KFW A;  2HHW A;  2KZM A;  2DFL A;  4ECT A;  3LDA A;  1ZJN A;  4FBT A;  4TQS A;  4P4P A;  1ZQC A;  4UB1 A;  2MUT B;  2NRW A;  2JEG A;  2HHX A;  4F50 A;  2FCO A;  3EPI A;  4LQE A;  2RDJ A;  1ZJM A;  5KFI A;  2BCQ A;  3PML A;  5TZV A;  4JUZ A;  1K1S A;  5KFE A;  4JK1 A;  3KHH A;  3PW4 A;  7ICQ A;  4I28 A;  7ICO A;  2HHT A;  7ICP A;  1EXN A;  3FDS A;  4I2H A;  3MR2 A;  2R8I A;  2FMQ A;  9ICG A;  4I29 A;  3PW5 A;  1BPX A;  1XO1 A;  2FL3 A;  3G6X A;  4Q43 A;  3RB6 A;  5KFM A;  1TKD A;  1ZQD A;  4NXZ A;  5JUM A;  1RXW A;  9ICK A;  9ICP A;  2UVW A;  5KFL A;  9ICH A;  1IXR A;  4QWC A;  4YXJ A;  2IBK A;  3HT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...