1Y88A

Crystal structure of protein of unknown function af1548
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
184
structure length
184
Chain Sequence
NLYFQGHMVARLLEEHGFETKTNVIVQGNCVEQEIDVVAERDGERYMIECKFHNIPVYTGLKEAMYTYARFLDVEKHGFTQPWIFTNTKFSEEAKKYAGCVGIKLTGWSYPEKEGIEVLLESKGLYPITILRIDKEVLDELVRAGLVFCRDVVSAGEEKLREIGLSAKKAREVIAEAKKVIGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AF1548
publication title The crystal structure of hypothetical protein AF1548 from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
total genus 59
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2004-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1y88A02
3.40.1350.10 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 1y88A01
3H7IA 4YMMA 1MC8A 3FYHA 1K1SA 3M8SA 1XSLA 1NK4A 4XQ8A 2BCSA 2R8JA 4B9MA 2NRXA 9ICPA 1T8EA 5J2AA 1ZQZA 1QLNA 5KG3A 8ICAA 1ZQLA 4I2IA 2HHSA 4QZAA 2BKEA 5JUMA 4RT2A 4FBUA 9ICMA 4F4WA 3AJVB 4XRHA 2RDIA 2ASDA 4F50A 8ICQA 2W9AA 4YMOA 4R66A 4PHAA 4DL6A 4I2HA 1JXLA 4DQPA 4ECXA 4M9HA 4FS1A 3Q8MA 5KFVA 9ICGA 4QZDA 4DSIA 4KLMA 3QZ8A 1ZQXA 4QZ8A 1KSPA 4I27A 1BPEA 3V72A 2WIWA 5DBAA 2HHVA 5BOMA 1IPIA 3RJJA 4O0IA 3BQ1A 5KG7A 5DB6A 4Q44A 4LZGA 4QZ9A 4IRCA 4NLZA 2AJQA 9ICEA 8ICBA 5EWGA 1ZQKA 2KTQA 4Q45A 3RJFA 2BR0A 2W8KA 4QW8A 1SKWA 4EYIB 5KT5A 4F5RA 5CHGA 1WCLA 4F5NA 3OGUA 5KTQA 1U47A 5BPCA 2ISPA 3KTQA 2XC9A 4RU9A 4UB4A 5KFAA 5CWRA 2C2RA 1NKEA 4TQRA 1ZQSA 7ICOA 4KLGA 9ICIA 5F9NA 1D9DA 1ZETA 2VA2A 5IILA 2P6RA 1UA0A 4QZIA 3RB6A 3RB4A 4NM2A 2ZJ5A 2MUTA 1ZQNA 4KLIA 4J9RA 3Q8LA 2ATLA 4QBNA 4EBEA 3IEYA 4KMUA 4QWEA 4IRKA 2JEFA 4JV1A 5KFSA 4UB1A 4GC7A 4QWDA 4M9GA 2B21A 1AROP 3GDXA 4TUQA 1TK0A 4O5CA 5IIJA 4YD1A 1ZQWA 3SI8A 5J0OA 8ICNA 8ICFA 2FPKA 4DSJA 2NRVA 4Z6FA 1NJWA 5D49A 3PW7A 2ASLA 3G6YA 4FO6A 4F5OA 5DLFA 1ZQAA 4Z6EA 5KFFA 3SV3A 1ZYQA 1UA1A 5KFGA 4ELUA 5DGAA 5KFMA 5DKWA 4BXOB 2AGPA 4YR0A 3GIKA 4M47A 5J2DA 1U4BA 5TZVA 5EOZA 3H4DA 1QSYA 3GFKB 2H5XA 1S0OA 4K4HA 4TQSA 1ZQPA 1NJXA 4RQ5A 4F2SA 3MFHA 4RNNA 4IRDA 3FDSA 2ZTDA 1ZQGA 4EZ9A 3RR7A 4FS2A 8ICXA 3PMNA 4J9QA 3H8JA 2C2EA 5DQHA 5L1JA 3V7LA 1ZQEA 2UVWA 2F1IA 2UVVA 4NY8A 4QZHA 3EYZA 3E2EA 5KFNA 4ED1A 1NK9A 9ICQA 3PNCA 3RR8A 1D8YA 3V6KA 4YR3A 1X9SA 4B9NA 7ICHA 3C21A 3EWAA 8ICGA 2INBA 2PI4A 5J0RA 2KFNA 4I2JA 4YP3A 4NXZA 4ED6A 3T5JA 4KLLA 3IHQB 4ED7A 1S10A 5IIMA 5DBBA 4I2GA 4MEXA 4YR2A 5KG1A 1ZJNA 3TFRA 1OB9A 4ED2A 4ELVA 2C28A 2HVIA 4DLEA 4RNOA 9ICAA 1OB8A 3PY8A 3BJYA 4Q8EA 3ZDBA 2AGQA 4LVSA 1JX4A 5KFYA 3RRGA 4UBCA 2R8IA 5KFTA 3HT3A 2BQUA 3PR4A 1KRPA 3RH5A 2BCVA 1TVAA 3PW2A 1R11A 3RH4A 2FPMA 4DL5A 5KFZA 7ICTA 4R63A 2BPGA 3SZ2A 4C8MA 4MF8A 1XMXA 1ZQVA 1Z3EB 3PX4A 4K4IA 1XSNA 4QWCA 8ICRA 3GIIA 3Q8QB 3B0YA 4B9TA 3TI0A 2JEGA 1SKRA 4J9MA 2XY6A 2GJWA 2BPCA 7ICJA 1BPXA 3N4MB 2FCOA 1Z00B 3MR2A 4ECVA 1ZQBA 4DOAA 4F93B 3EZ5A 1S0NA 4M0AA 1ZQYA 4ECTA 1D9FA 4KLJA 4ECZA 1X9MA 4YD2A 4IQWA 4QZEA 2JEJA 1DOQA 2VLDA 4RPYA 1T0FA 1XS9D 3PO5A 3H40A 1S97A 3M9OB 2XY7A 4DSKA 4IQUA 1NOMA 5J0TA 5J2CA 2XO7A 4UB5A 4F5QA 5KT4A 4NLKA 9ICOA 4C8LA 4JWMA 3QEAZ 7ICKA 4KLSA 1XC9A 4BXOA 5KG6A 8ICWA 4EZ6A 1V9PA 3C5FA 2W9BB 3UQ2A 4CCHA 1S77D 2R8KA 3T5HA 4QBLA 4QZGA 1ZQFA 3JPQA 1RYSA 5DQIA 1CUKA 4QW9A 3GQCA 4M9NA 2KN7A 2BQRA 4PPXA 3EPGA 5J2HA 4B9LA 7ICGA 3UPQA 4KLTA 3BQ0A 4RUAA 3M8RA 4PHEA 2V9WA 4F8RA 5D46A 4UQGA 2XCAA 1U45A 1Y1OA 3UQ0A 2BPFA 4MF2A 2JZBB 4YVZA 3OJSA 2OWOA 3B0XA 3H8WA 1XWLA 5KG5A 1SL1A 4BDPA 3P1ZB 3Q8PB 4P4MA 3RB3A 3BDPA 8ICSA 5HMMA 1R0VA 2ZJ8A 4TKKA 4DFJA 8ICMA 2XCPA 3DNXA 4UB3A 3M9NB 1MQ3A 4JV0A 5J2IA 1MSWD 4KLQA 1KTQA 1LV5A 4DOCA 2WCZA 2ZUCA 4DO9A 2F1JA 1NK5A 4ELTA 5DDMA 2R8GA 3TAQA 3ZDCA 1ZQQA 5IIIA 3TAPA 2W9MA 1BPDA 3RRHA 1LB2B 3FOVA 2FMPA 3V7KA 2V4RA 9ICFA 4PHPA 3LWMA 5L1LA 1H38A 3T3FA 2ALZA 4KN4A 2FMQA 4I29A 3KHGA 4DL2A 3MABA 4C8OA 7ICIA 4DL4A 4I2DA 4UAWA 2ZUBA 3LK9A 1GEFA 7ICQA 3TANA 4PH5A 4DQQA 5DG7A 4KLOA 4UBBA 9ICRA 4C8KA 4ECQA 3PMLA 4TUPA 4TURA 9ICSA 1ZQUA 2DPIA 1CEZA 1F1ZA 5KG2A 1BPBA 5KFBA 2BQ3A 4O5EA 8ICHA 1NK8A 7ICSA 4RQ1A 4JK1A 5KFJA 3GIMA 4DQRA 5HHHA 2ZYZA 5L1KA 3GV7B 4DQSA 5FDKA 3RBDA 4Z6CA 5KFDA 4J9OA 1BPZA 4O3RA 1JIHA 4YCXA 5J29A 3AUOA 3QE9Y 2MAXA 2OKFA 7ICRA 2WJ0A 4M9JA 3KHLA 2HHWA 4RT3A 3JPRA 2HHUA 5DDYA 4F3OA 3M9MB 2HVHA 8ICYA 3MR3A 5D4BA 2CV8A 1JN3A 5J0QA 2XY5A 9ICXA 1S0MA 4M04A 2IHMA 1SL0A 4B9SA 3C2KA 5J2FA 4PHDA 2W9BA 2JEIA 4F92B 3HW8A 1L3VA 4QBOA 4ECYA 3K75D 1B43A 4O3PA 3ISCA 1NKCA 9ICTA 5DLGA 4EEYA 3KHRA 4P2HA 1TV9A 4DQIA 2I1QA 4J9LA 3PV8A 5J2BA 3C1ZA 5KT7A 4RQ6A 3ISBA 4DL7A 2Y1JA 3RJEA 4TUSA 1L3UA 2KZMA 3THVA 1ZJMA 3SYZA 4Q43A 2NRWA 4X5VA 4KLEA 2PFQA 1S0VA 1QTMA 1L5UA 2HHQA 3Q8SB 2JZBA 2EO0A 4QZBA 2J6TA 4E0DA 4O5KA 3P1ZA 3PW5A 1ZQMA 3NTUA 8ICJA 3JPOA 8ICTA 9ICUA 5KFKA 5EWFA 1ZP7A 1XU4A 5KFQA 2ZTCA 3ZDDA 2A1JB 2KZ3A 5IIKA 3JPSA 2BHNA 3PVXA 1RZTA 1KFSA 2VA3A 4MFFA 1HUZA 5KFPA 3JPNA 4GC6A 4DSEA 1NJZA 1RYRA 1ZQRA 2W9CB 3UXNA 2IHNA 1UT8A 5DB7A 2HHTA 4R64A 3GIJA 3TQ1A 1XO1A 4LZDA 5CJ7A 1ZQDA 1K1QA 4F4YA 4RQ8A 4F91B 2MUTB 1UT5A 4B9VA 1WCNA 4YXJA 1NK7A 3GV8B 4O3NA 7ICEA 2AQ4A 2VANA 3ISDA 4DSFA 2UVUA 4P4OA 3ZDEA 3RAXA 4O3OA 5KT2A 2PI5A 5DB8A 3GILA 5J0PA 5KFXA 2M9NA 4ECSA 1T7PA 2I9GA 3RJGA 4I28A 2HW3A 7ICPA 4YN4A 1NK0A 2NRZA 5J0WA 4MFAA 4GLXA 4M6WB 3EPIA 5DG9A 4YFKA 4QWAA 4UB2A 2Q0ZX 2V4QA 5HP4A 1RXVA 2KFZA 4DFPA 1KLNA 1QSSA 1Y88A 5DGBA 1ZQIA 2BCRA 4J9KA 3ZD9A 1X9WA 4MEYA 5J0YA 2PFPA 1BGXT 4DS5A 2C22A 4NM1A 3MGIA 8ICPA 2OSTA 1C7YA 4YXMA 4C8NA 3PX6A 2IMWP 2W8LA 2FLNA 3IM1A 4QWBA 3QZ7A 3RH6A 2F1HA 5J0XA 9ICNA 1T4GA 3NGDA 5HMLA 1L3TA 4R8UB 5KFUA 4O3SA 4G3IA 3BQTA 2AQ0A 3EW9A 5KFCA 3V6HA 2BCQA 7ICVA 3RAQA 1A76A 4Q8FA 1TAUA 3P1YA 4IR9A 1NK6A 3MDAA 5J2JA 4EYHB 1S9FA 4I2EA 4Z6DA 1HUOA 1SZPA 1XSPA 5L1IA 1U48A 8ICLA 4KLDA 3UXPA 3JPPA 3RB0A 4R65A 1EXNA 5CB1A 2ASJA 2ISOA 2DFLA 5KG4A 4O9MA 8ICCA 2GW6A 4ZH4A 2ZJAA 3MR6A 2PFNA 3ORYA 4M9LA 2VA8A 1MQ2A 3MBYA 4RNMA 4ED8A 4JV2A 4RQ0A 9ICCA 3OHAA 3PX0A 5L9XA 2WTFA 9ICVA 3N97B 3G6VA 3HPOA 3MFIA 5J0SA 2R8HA 3C2LA 5CR0A 1U9LA 2FMSA 2A1JA 4P4PA 1RXWA 3UXOA 4DSLA 2WCWA 4RPZA 3MDCA 3OHBA 4ECWA 2IA6A 1KFTA 2W9CA 4KN7A 4QZCA 3V6JA 3MGHA 3V7JA 4GXJA 4M2YA 4YMNA 2PFOA 3JPTA 4JUZA 4YG2A 5KT3A 1KEJA 4PGQA 1N56A 1Z00A 5J2EA 3ETLA 3TFSA 3C2MA 3PR5B 3G6XA 1TK8A 3C1YA 4HYKA 4RQ3A 2RDJA 2DPJA 9ICLA 5KFLA 4ECUA 3T5LA 4I2CA 4KLUA 4RPXA 1COOA 8ICUA 5KFEA 4BGDA 2ZUDA 8ICZA 5DB9A 4JWNA 4RUCA 4NLGA 4NLNA 1HJPA 3TARA 1JMSA 5J0UA 1SKSA 4I2AA 1KDHA 2FLPA 4PGYA 4M6WA 3ZDAA 4O3QA 1TFRA 5CA7A 3SV4A 9ICJA 9ICWA 2Y1IA 1B22A 2LYHA 3BQ2A 1NKBA 8ICVA 1NJYA 3ZD8A 4J9NA 2XGQA 1X2IA 1IM4A 3PW0A 4DWIA 1JXEA 4PGXA 5KFOA 2BDPA 4DOBA 1ZQOA 2KZZA 4DFMA 4J9PA 2UVRA 3OSNA 4RQ4A 2J6SA 4IQVA 4EBCA 3T5KA 7ICFA 1D8LA 1T3NA 5C5JA 2P6UA 2AU0A 1N48A 1A77A 1QSLA 3RBEA 1ZQCA 3RJKA 4UAZA 3K4GA 4K4GA 5KFHA 9ICHA 1A79A 4KTQA 1ZQHA 2FLLA 5KFIA 3C23A 1SL2A 5IINA 4ECRA 5KG0A 5CP2A 2ZTEA 3LWLA 4YQWA 5IIOA 4IR1A 1TKDA 4R8UA 8ICEA 5HNKA 3H4BA 4F4KA 8ICOA 4UAYA 3AU2A 4KITB 1BPYA 4F4ZA 4GXKA 4IQTA 4DF8A 2C2DA 4I2BA 3H8SA 1TK5A 4TKDA 7ICLA 4RQ2A 1KFDA 4DFKA 5KFRA 3GV5B 3OJUA 1ZQJA 4DEZA 2AGOA 4DS4A 1S76D 4ED3A 5BOLA 1IXRA 4FBTA 2HHXA 5DQGA 3RJIA 1ZQTA 7ICMA 3HX0A 2P66A 2FPLA 4J9SA 3LDAA 4DL3A 5J2KA 3RJHA 5DBCA 5KT6A 3HWTA 3PW4A 4F5PA 4KLFA 1RPLA 7ICUA 3RTVA 9ICKA 2WIZA 8ICIA 4F2RA 3QEBZ 2IBKA 4BWJA 3AU6A 3C5GA 1L3SA 3Q8RB 1PZNA 2PXIA 4XUSA 3Q8KA 4B9UA 4I2FA 4ED0A 1BVSA 5J2GA 1RZNA 4RQ7A 3KHHA 1RLVA 3AJVA 5EWEA 4RZRA 5F9LA 4EBDA 3OSPA 1DGSA 1U49A 2GWSA 5HHIA 4XA5A 5KFWA 4DLGA 3PO4A 4KLHA 7ICNA 4QZFA 2BCUA 5DG8A 4BWMA 2NRTA 2BGWA 1HH1A 3MR5A 2ZYZB 4DF4A 4GXIA 9ICBA 2J6UA 2XGPA 4F4XA 8ICKA 4MFCA 1TAQA 3HP6A
chains in the Genus database with same CATH superfamily
1MC8A 3FYHA 1K1SA 1NK4A 2R8JA 4EX6A 5KG3A 4FBUA 3HRDD 3AL0B 1X42A 3AJVB 2RDIA 1ZD2P 1DGJA 4PHAA 2LBOA 4DL6A 1JXLA 4DQPA 4I2HA 4ECXA 3QZ8A 2ZIWB 4QZ8A 4I27A 2WIWA 1BPEA 4BJQA 5DBAA 3QUTA 1L7MA 3RJJA 5AKKA 5KG7A 5DB6A 3T79A 2KSOB 5F3XB 8ICBA 5EWGA 2BR0A 2W8KA 1SKWA 2EZYA 1SXDA 5ALZA 5CHGA 1WCLA 2A3VA 2JMGA 2XC9A 4QNLA 5EE3A 5KFAA 3E58A 3D6JA 7ICOA 3LVVA 1T3QA 1ZETA 2VA2A 4ZOHC 3RB4A 5ALXA 2MUTA 2VS1A 3KFUF 4EBEA 3IEYA 3BS7A 1YNMA 5KFSA 5AKHA 2B21A 3GDXA 1TK0A 3QU2A 8ICNA 3IG8A 5CRXA 4DSJA 1NJWA 1ZD5A 5D49A 3PW7A 2ASLA 4IS7A 5DLFA 1ZQAA 1ZYQA 3UMBA 5DKWA 4BXOB 2AGPA 1CI4A 2H5XA 1PVRA 4RQ5A 2FJ6A 4EZ9A 2DBYA 3RR7A 2E1EA 2ZIVB 3H8JA 1L6NA 3CP8A 3ONNA 2UVWA 4A8EA 3RR8A 4B9NA 3BZKA 1RQNA 3EWAA 4ED7A 5AKZA 5IIMA 5DBBA 1ZJNA 1OB9A 4ELVA 2C28A 3PSFA 3QU4A 4RNOA 5JTIA 4RQMA 1N2XA 2GO7A 2AGQA 3WK4A 3QYPA 5KFTA 2BQUA 4AYBF 4P0QA 1R11A 3H0RB 2BPGA 1XMXA 1ZQVA 3PX4A 3Q8QB 2JEGA 1SKRA 2GJWA 2BPCA 2H3QA 1J2NA 3N4MB 2BDUA 1Z00B 4ECVA 3H8MA 4F93B 4M0AA 1ZQYA 4ECTA 4ECZA 2B0CA 1X9MA 2G5HB 4OD0A 4F5QA 9ICOA 2FI1A 4JWMA 7ICKA 3QEAZ 4KLSA 2KEYA 3UQ2A 4UASA 3T5HA 1BNPA 5B5EU 3DDHA 2W54A 2BQRA 4B9LA 2YN4A 7ICGA 5ALDA 4PHEA 4F8RA 5D46A 1PK3A 2XCAA 2YQEA 2BPFA 4YVZA 3OJSA 2OWOA 3B0XA 2G0AA 4BDPA 3BQ7A 5HMMA 2ZJ8A 2XCPA 5J2IA 4Y2JA 5AKXA 2ZUCA 4DO9A 2R8GA 1ZQQA 1BPDA 3KBBA 2OCEA 5EE9A 1N5WA 1PVPA 1OW5A 1X6JA 4PJ0U 1O08A 2E5SA 3LK9A 4PH5A 4DQQA 9ICRA 3IF0X 2ZXIA 4TURA 3IDWA 2DPIA 1CEZA 5KG2A 2K4HA 4UAUA 3SENA 2KHVA 3M7DA 4RQ1A 4US8A 3KOOA 4NLBA 5KFJA 3KKAA 5L1KA 1WWUA 3RBDA 5FP0A 5KFDA 4YCXA 1ZOLA 2DL0A 2DUYA 2OKFA 2WJ0A 4M9JA 5H2FU 2HVHA 3QU7A 3MR3A 5D4BA 1JN3A 2XY5A 4AYBC 4U7CA 4M04A 3HKZF 4PHDA 3HW8A 1L3VA 4ECYA 3GU3A 3KHRA 2L5YA 1URJA 3ISBA 5KT7A 4DL7A 1L3UA 3THVA 2ZG6A 5L1MA 2FLCA 2HHQA 3A0BU 2F44A 2QARA 1WYGA 3PW5A 4EEKA 2W55A 9ICUA 2JHDA 3WKBA 1ZP7A 5KFQA 2ZTCA 2A1JB 5J8YA 2CRXA 2VA3A 2BHNA 5GTIU 3JPNA 4OO1J 2FKCA 1RYRA 1ZQRA 2W9CB 4KX3A 3UXNA 4R64A 3GIJA 5CJ7A 1ZQDA 4F91B 2MUTB 4B9VA 4YXJA 2VANA 2PMZF 1KW4A 3LYSA 4ECSA 3RJGA 4OJ5A 2NRZA 4GLXA 5DG9A 2Z7JA 4YFKA 2W3SA 2Q0ZX 1KLNA 5AK3A 1Y88A 3SEIA 1LVHA 4Y2PA 4MEYA 2JRZA 5J0YA 1L7OA 1BGXT 1S8OA 1C7YA 2IMWP 4QIWF 3IM1A 9ICNA 1S5LU 3NGDA 4O3SA 2KKPA 2AQ0A 3BQTA 3QXGA 3RAQA 2G06A 3P1YA 1WUDA 3WKAA 2F76X 1QQ5A 4G6UA 5AKGA 3VC8A 1FFUA 3M6ZA 3MDAA 4EYHB 2G08A 1QH9A 5ALTA 3WKEA 8ICLA 1C20A 2ISOA 5KG4A 4ZH4A 4E6ZA 2LHTA 2VA8A 4RNMA 3UMGA 4ED8A 1PUZA 2RQ5A 3U26A 1RM6C 2KVSA 2WTFA 3MFIA 3C2LA 1WG8A 2K4EA 2FMSA 3HKZC 3AQFA 2XIDA 3MDCA 3OPXA 4KN7A 4QZCA 4GXJA 4KX5A 3JPTA 3ETLA 1YZ6A 1TK8A 3C1YA 4HYKA 4I2CA 2KKVA 4G9BA 5KFEA 4BGDA 5DB9A 4RUCA 5K4LA 1JMSA 5ALOA 1SKSA 3I28A 4I2AA 3AEVA 2G07A 1KDHA 2FLPA 4M6WA 1TFRA 1B22A 3QUCA 1NJYA 4J9NA 1JXEA 4PGXA 3QU9A 4DOBA 2KZZA 4DFMA 3OSNA 4RQ4A 4IQVA 2F77X 1D8LA 2EZXA 3RBEA 9ICHA 2PMZC 5IINA 2ZTEA 4F4KA 3HJEA 1BPYA 4F4ZA 2KE7A 4KMOB 4C7ZA 4RQ2A 4FZNA 5KFRA 4FE3A 3GV5B 4DEZA 2AGOA 4DS4A 2I5HA 2KHQA 4FBTA 5DQGA 2D6FC 4J9SA 3RJHA 2YY6A 3PW4A 4KLFA 9ICKA 2WIZA 4QIWC 5AM0A 2IBKA 4BWJA 3AU6A 1L3SA 4ED0A 1BVSA 2GLEA 4RQ7A 3KHHA 2CV8A 2IOHA 4QZFA 3SR6A 1T94A 1SXEA 2XGPA 4YMMA 4XQ8A 9ICPA 5J2AA 2YX8A 4I2IA 1LKYA 2BKEA 4QZAA 9ICMA 4F4WA 2H3FA 2W7PA 2ASDA 2W9AA 4R66A 2YMLA 3Q8MA 3AN1A 9ICGA 2KJ5A 3V72A 2HHVA 3BQ1A 4HAIA 4Q44A 4IRCA 2AHOB 4NLZA 2AJQA 2Q4TA 5AI8A 1ZQKA 2KTQA 3RJFA 3F53A 3QU5A 4EYIB 5KT5A 4F5RA 3CW2C 1U47A 3KTQA 1X6IA 4EENA 5CWRA 1ZXIA 5AM5A 1ZQSA 5F9NA 1D9DA 2XVTA 1QQ7A 1UA0A 1VJ5A 4QZIA 5ALQA 2ZJ5A 1ZQNA 2Y9UA 2HBJA 3I76A 4KMUA 4IRKA 4M9GA 3D2NA 4TUQA 4O5CA 1PK1B 5J0OA 8ICFA 2NRVA 4Z6FA 4FO6A 4F5OA 2RRDA 3NS1A 5TZVA 1M6YA 1ED1A 4K4HA 2KJ8A 1NJXA 4F2SA 3MFHA 4RNNA 4IRDA 2E1FA 8ICXA 1XO0A 2W03A 2C2EA 5DQHA 5L1JA 3V7LA 4NY8A 9ICQA 2XI9A 3F2DA 3V6KA 5ALRA 1X9SA 3R9KA 3C21A 4UB8U 8ICGA 5AKIA 2PI4A 4NXZA 4KLLA 3IHQB 3WK7A 1OXJA 4YR2A 5AKLA 5KG1A 1L8OA 3K1RB 3TADA 1OB8A 1N60A 4Q8EA 3C29A 3KZIU 1B0XA 4LVSA 1JX4A 4OCZA 4UBCA 2R8IA 3PR4A 1JRPA 2BCVA 1TVAA 1TE2A 5KFZA 7ICTA 2ZIUA 4R63A 3ED5A 3ETRA 4MF8A 1XSNA 5A0LA 3BS5A 2XY6A 7ICJA 2FCOA 3PSTA 2JV3A 4DOAA 3EZ5A 4KLJA 4IQWA 5AM2A 1L7PA 3PO5A 1S97A 3FC4A 4DSKA 3IN5A 5J2CA 4NLKA 4UB5A 5KT4A 2E3TA 1XC9A 8ICWA 4EZ6A 1V9PA 1S77D 3L3FX 4CCHA 2F3NA 3GQCA 4M9NA 2KN7A 4PPXA 3EPGA 2W43A 4RUAA 3M8RA 4UQGA 1V97A 3TKAA 4F71A 4P4MA 3BDPA 8ICSA 1R0VA 3WK5A 4DFJA 3DNXA 3F5EA 4IC9A 3M9NB 1LV5A 4DOCA 2WCZA 3TAQA 2W9MA 2FMPA 4PHPA 3LWMA 2IOFA 1NZBA 2ALZA 4KN4A 2FMQA 5ALVA 3KHGA 5AKJA 4C8OA 7ICIA 4DL4A 4KLOA 4UBBA 4ECQA 4OJOA 2QKQA 2BQ3A 2D3DA 4O5EA 8ICHA 1NK8A 7ICSA 3GIMA 4JK1A 2ZYZA 5HHHA 3GV7B 4Z6CA 5GTHU 5J29A 3AUOA 3QE9Y 2MAXA 2HOQA 1UQVA 3O0FA 2HHWA 2HHUA 2LYBA 5DDYA 4F3OA 1LKYB 5J0QA 1S0MA 1QQ6A 2IHMA 1SV0A 5J2FA 2W9BA 2JEIA 4F92B 3K75D 9ICTA 1NKCA 5DLGA 2KIVA 3AM9A 4EEYA 4P2HA 2AH5A 3TI0A 3PV8A 2KZMA 2WF9A 3RJEA 1ZJMA 4Q43A 2NRWA 3WU2U 2PFQA 1QTMA 3Q8SB 2YTUA 2JZBA 1DXSA 4QZBA 2J6TA 3M6KA 2ODGA 3P1ZA 3NTUA 5AI9A 8ICJA 3OTQA 5KFKA 5IIKA 2KZ3A 4MFFA 5ALKA 1HUZA 1SZHA 4ICAA 1XO1A 4LZDA 2YB1A 1UT5A 1WCNA 3KKAC 4O3NA 7ICEA 3ISDA 5EE1A 5KT2A 4AP9A 2PI5A 3WK6A 5J0PA 2FL3A 2O6KA 2I9GA 5J0WA 4UW9A 2OHFA 3WK8A 3GZFA 2BH2A 1Z19A 1Z4NA 1RXVA 2BZFA 2PFPA 2DKZA 4NM1A 2W8LA 2FLNA 4QWBA 3QZ7A 5J0XA 1T4GA 1J2MA 5HMLA 3UM9A 1L3TA 3F5AA 5KFUA 5KFCA 2BCQA 7ICVA 2B6GA 4Q8FA 1P7DA 2K8AA 5EE0A 4IR9A 4I2EA 1SZPA 1XSPA 3NVVA 1U48A 1NZPA 3RB0A 1EXNA 5J8YC 2GOLA 2GW6A 2ZJAA 2G09A 3ORYA 4M9LA 3MBYA 2OXOA 2NV3A 2W7OA 4RQ0A 3PX0A 5L9XA 1Z1VA 3KZXA 3HPOA 1JI7A 2WCWA 4P4PA 1WWVA 2IA6A 3V6JA 1JROA 3MGHA 2PFOA 4JUZA 4YG2A 5KT3A 1KEJA 5J2EA 2AXTU 3C2MA 4PL2A 1D8BA 3L5KA 4LJXA 4US9A 4RPXA 4KLUA 2ZUDA 1SB3C 4NLGA 4NLNA 1HJPA 3ZDAA 1VDVA 5AI4A 9ICJA 9ICWA 2LYHA 2F8LA 2M0NA 2YMPA 1NKBA 3IV6A 3ZD8A 2KK0A 4DWIA 5KFOA 2UVRA 3UMCA 2CN1A 3K4GA 5KFHA 3C23A 5CP2A 4YQWA 5IIOA 4R8UA 2K4PA 3KD3A 3H4BA 4UAYA 3AU2A 2DQNB 4GXKA 4CNQA 2RLTA 3RF9A 4JMUA 4DFKA 3OJUA 1GO3F 5JU5A 4Y2XA 3SAHA 2IOFK 4ED3A 5BOLA 1SWVA 3CNHA 4BUGA 5AM1A 1ZQTA 2FPLA 3LDAA 2PKEA 3HWTA 3IEYB 2FDRA 3H0LB 3QUQA 2EAOA 4XUSA 2IXSA 4CF4A 1RZNA 2JXJA 3PSPA 3IRUA 5ALYA 5EWEA 3OSPA 5F9LA 4LQEA 1DGSA 4KLHA 2GWSA 5HHIA 7ICNA 4DLGA 2MRLA 1HH1A 2ZYZB 4DF4A 1YZ7A 4GXIA 3HP6A 3H7IA 1XSLA 3M8SA 4B9MA 2BCSA 3ICXA 1ZQZA 1QLNA 1ZQLA 5JUMA 4OJ6A 2W3RA 5ALEA 1N63A 4M9HA 4FS1A 5KFVA 4QZDA 4KLMA 1ZQXA 1A0PA 2QLTA 1IPIA 1ZD4A 4LZGA 2HDOA 9ICEA 4QW8A 3OGUA 5KTQA 1K5OA 2ISPA 4CF3A 4RU9A 4UB4A 4CRXA 2C2RA 1NKEA 2FKHB 4P0QB 4CGZA 2CXYA 9ICIA 2EANA 1Z4OA 3RB6A 1AQ6A 4P0PA 1F5SA 4J9RA 2H3IA 3QNMA 2ATLA 4QBNA 4QWEA 4JV1A 4UB1A 5AHXA 4CDGA 4QWDA 3SI8A 2FPKA 2QB0A 3G6YA 1JALA 2F8KA 5ALHA 1UA1A 4M47A 4YR0A 3GIKA 4NL9A 3SD7A 2DGZA 3H4DA 2LM4A 5EOZA 3GFKB 1SIJA 3C28A 1ZQPA 2ZTDA 1ZQGA 1HIWA 3PMNA 2JH7A 3AJVA 2UVVA 4QZHA 2YB4A 4C80A 5KFNA 1D8YA 7ICHA 5AI0A 2KFNA 4YP3A 4ED6A 3T5JA 3B9JA 2KOBA 4I2GA 2KSOA 3TFRA 4FZMA 1ZQ1C 2JJQA 4DLEA 9ICAA 2ZIXA 3ZDBA 4IL6U 2DBSA 5KFYA 3RRGA 3IG5A 1KRPA 2K60A 3PW2A 3RH4A 2EDUA 3SZ2A 3DEEA 3SQIA 4K4IA 8ICRA 3GIIA 2WFAA 3B0YA 4B9TA 4J9MA 1BPXA 2WF7A 1ZQBA 2W11A 4YD2A 4UAVA 2JEJA 1DOQA 3NVWA 5T14A 1XS9D 3H40A 3M9OB 2XY7A 4DAVA 1NOMA 5J0TA 1O03A 4BXOA 1NI3A 2K4IA 1N5XA 4QBLA 2R8KA 3JPQA 1RYSA 4Y2SA 5ALMA 2EAPA 5J2HA 3UPQA 4KLTA 2V9WA 2ZIVA 1U45A 3UQ0A 3D2SA 2JR5A 1SV4A 3D2QA 1N62A 3H8WA 1XWLA 5KG5A 2QARB 1SL1A 3RB3A 1DRGA 4TKKA 8ICMA 4PZOA 3AMZA 1RDFA 1MQ3A 1KTQA 3NRWA 2F1JA 4ELTA 5ALLA 1L7NA 5DDMA 3ZDCA 3TAPA 1LB2B 3IP4B 3V7KA 9ICFA 5L1LA 2R18A 1H38A 4I29A 5TISU 2WF8A 3MABA 4NLCA 1FEZA 4I2DA 5ALPA 7ICQA 4TUPA 4NWIA 1ZQUA 1J97A 1BPBA 5ALIA 4DFDA 2HMXA 4Y2YA 4DQSA 4Y2QA 4J9OA 1BPZA 1KN5A 1JIHA 2NYVA 4GIBA 7ICRA 4RT3A 1X40A 3M9MB 1RG6A 9ICXA 1COKA 4B9SA 1UCVA 4NV0A 4QBOA 4O3PA 3ISCA 2I1QA 4J9LA 5J2BA 3SYZA 1S0VA 5ALNA 1L5UA 2EO0A 4E0DA 2LI6A 1SWWA 1X66A 5AI6A 1ZQMA 3PSIA 2W8MA 5AKEA 2CZRA 3JPOA 2HOIA 1N61A 1XU4A 3ZDDA 3NRZA 2Y0SF 2HBKA 1KFSA 1NJZA 4GC6A 2KMDA 2IHNA 2HHTA 1UT8A 2K89A 5DB7A 1MN8A 4OJPA 1F0MA 5ALFA 4F4YA 4DSFA 4P4OA 4USAA 3ZDEA 3F2BA 4O3OA 5AICA 1MA7A 3MGVA 1T7PA 4I28A 7ICPA 4YN4A 3QUBA 4MFAA 4M6WB 2KV2A 4J03A 2V4QA 5HP4A 2KFZA 4DFPA 2MSNA 1QSSA 4O3MA 4WJ3B 2BCRA 1IG6A 4J9KA 1X9WA 3MGIA 5ALGA 4YXMA 4C8NA 3PX6A 2F1HA 2QB1A 2WAQF 4G3IA 3EW9A 1A76A 1NK6A 2EH9A 3AQEA 2NO4A 4Z6DA 1HUOA 3UXPA 2HOFA 5JRTA 2LKYA 1KQQA 3NVZA 4O9MA 3MR6A 2PFNA 1MQ2A 2ZIXB 4JV2A 3OHAA 4C7YA 4FFDA 3G6VA 5J0SA 2R8HA 2A1AA 5CR0A 1U9LA 2A1JA 1FFVA 4RPZA 3OHBA 2W9CA 3V7JA 4YMNA 2K8CB 2ESEA 1QCKA 3G6XA 2RDJA 2DPJA 5E79U 9ICLA 5KNIA 5KFLA 4ECUA 3T5LA 8ICUA 1ZRNA 4DCCA 1NNLA 4CE6A 4EELA 3TARA 5J0UA 2HI0A 5CA7A 2Y0SC 1X2IA 1IM4A 4EX7A 3PW0A 1CRXA 2BDPA 2W04A 1ZQOA 1FIQA 1Q3VA 4J9PA 2J6SA 7ICFA 1T3NA 1QSLA 3RJKA 1A79A 5CEHA 4KTQA 2FLLA 5KFIA 1SL2A 3N28A 5KG0A 4IR1A 1TKDA 5HR7A 8ICOA 3HILA 1IV8A 4DF8A 2C2DA 1TK5A 5AK4A 4TKDA 3RFAA 7ICLA 1L8LA 2CPRA 1TAMA 1S76D 2HHXA 3HX0A 2P66A 4DL3A 5DBCA 5KT6A 4F5PA 2OH2A 3EUB2 2Z0RA 3RTVA 8ICIA 5AI5A 3QEBZ 3DV9A 4F2RA 2KJ9A 2WHEA 3Q8RB 2WAQC 4B9UA 4I2FA 1RLVA 3L4PA 2A19A 3PO4A 5KFWA 4XA5A 2EAMA 2BCUA 2E8NA 5DG8A 4BWMA 3I1YA 2NRTA 3S6JA 8ICKA 3MC1A 1TAQA 4MFCA 9ICSA 1Q46A 5HR6A 2NRXA 5KAFU 1UWVA 1T8EA 5ALUA 8ICAA 2YMQA 2HHSA 1VLBA 4RT2A 4XRHA 4F50A 8ICQA 4YMOA 1B4FA 3J81j 3WKCA 2MA1A 4DSIA 1KSPA 5BOMA 4O0IA 2XICA 4QZ9A 1KBUA 4EV1A 4Q45A 3PZPA 2EQYA 2DWQA 4F5NA 1UHUA 5BPCA 4TQRA 2VKQA 3ZI4A 2ZIUB 4KLGA 2NO5A 5IILA 2P6RA 2KG5A 4KLIA 4NM2A 4GFJA 2GH1A 3BS5B 3Q8LA 2H3ZA 5ALSA 2JEFA 1V38A 4GC7A 1AROP 5IIJA 4YD1A 1ZQWA 4NJ8A 3N7PD 4Z6EA 5KFFA 3SV3A 5KFGA 4ELUA 4U6PA 5DGAA 5KFMA 5J2DA 1U4BA 1V85A 1QSYA 1S0OA 4TQSA 4C4RA 2E8MA 3FDSA 4Y2TA 4FS2A 2G5IB 4J9QA 1ZQEA 3E2EA 2F1IA 3EYZA 2DF4B 4ED1A 1NK9A 3PNCA 4ZQUA 4YR3A 1FO4A 2INBA 5J0RA 4I2JA 1S10A 5AIBA 4MEXA 2VJ4A 1KKXA 4ED2A 4B6JA 2HVIA 3PY8A 3BJYA 3ALRA 3VCBA 1Z1BA 3HT3A 3F2CA 1SGGA 3RH5A 4C4TA 1Q8KA 4MHVA 2WF6A 2FPMA 4DL5A 1Q3UA 4C8MA 1Z3EB 4QWCA 2RP5A 3WK9A 3SAGA 2ZXHA 4C4SA 3MR2A 5G5HA 4OJLA 2KP7A 1S0NA 4NL9C 1D9FA 4QZEA 2VLDA 4RPYA 1PK1A 3NASA 1T0FA 4IQUA 4Y2RA 2XO7A 4C8LA 5KG6A 3FM9A 3C5FA 2W9BB 4QZGA 1ZQFA 3BT7A 5DQIA 1CUKA 4QW9A 5KL8B 4BX9C 2F2AB 3BQ0A 1F44A 1Y1OA 4MF2A 2JZBB 3SMVA 2LYAA 3P1ZB 3Q8PB 4UB3A 3BZCA 4JV0A 1MSWD 4KLQA 5G5GA 1NK5A 4PZNA 5IIIA 3FOVA 3RRHA 2V4RA 1ZRMA 2D8CA 1RQLA 1DK3A 3T3FA 1A6SA 3E0FA 2YMMA 4CF5A 4DL2A 4UAWA 2ZUBA 1GEFA 3TANA 5DG7A 4C8KA 3CYMA 3N7RC 3PMLA 4Y2UA 1F1ZA 5AK5A 5KFBA 3QX7A 4DQRA 4QJFB 5FDKA 2JH1A 4O3RA 3KHLA 4PL1A 3JPRA 8ICYA 2EZZA 1SL0A 3C2KA 1B43A 3N7SC 1RYUA 2ZIWA 3H0MB 1TV9A 4DQIA 3C1ZA 4RQ6A 2Y1JA 4TUSA 4X5VA 4KLEA 2WF5A 4O5KA 3A0HU 3NUQA 5AKYA 2RHFA 1HEKA 4F72A 3LVWA 1X9XA 5KAIU 8ICTA 5KL1B 5EWFA 1UPHA 1RZTA 3JPSA 3PVXA 5KFPA 4DSEA 2LM1A 2E8PA 3TQ1A 5AM4A 1K1QA 4RQ8A 5ALWA 1NK7A 3GV8B 1XNSA 2AQ4A 4FZLA 2UVUA 5ALJA 3RAXA 2P35A 2H3VA 1KL9A 5DB8A 3GILA 5KFXA 2M9NA 3M1YA 2HW3A 1NK0A 4UB6U 3EPIA 4RQNA 2OM6A 4QWAA 4UB2A 2OEHA 5DGBA 1ZQIA 2LPEA 3ZD9A 2HBLA 4G6VA 1YT3A 1BNOA 8ICPA 4DS5A 2C22A 2OSTA 3SAFA 2DKXA 2KICA 3RH6A 4DA2A 4R8UB 1ECWA 3V6HA 3TADC 1TAUA 5J2JA 1S9FA 3K1ZA 3CRXA 2WB1F 4UARA 5L1IA 3JPPA 4R65A 5CB1A 2ASJA 2DFLA 8ICCA 2LMRA 9ICCA 9ICVA 3N97B 3NVYA 2MU2A 4DSLA 1RXWA 3UXOA 2KNJA 4ECWA 1KFTA 2FE9A 2KD1A 1OUQA 4M2YA 1ZD3A 4PGQA 1N56A 1Z00A 3TFSA 3PR5B 4RQ3A 2I6XA 1JUDA 1COOA 2ES6A 8ICZA 4JWNA 5C0YA 2Y9TA 4PGYA 2KVCA 4O3QA 3SV4A 2Y1IA 3WKDA 5B66U 3BQ2A 8ICVA 2JGAA 2XGQA 2K8BB 5AK6A 3T5KA 4EBCA 1N48A 5C5JA 2P6UA 2AU0A 1A77A 1ZQCA 4UAZA 4JB3A 4K4GA 1ZQHA 4ECRA 3LWLA 8ICEA 2N1RA 3FAHA 5HNKA 4KITB 4IQTA 4I2BA 3H8SA 4C0ZA 5AIAA 1KFDA 2E8OA 1ZQJA 1IXRA 3RJIA 7ICMA 4ACOA 5J2KA 4P0PB 4DAPA 1RPLA 7ICUA 1DK2A 5AM3A 3C5GA 2PXIA 1PZNA 3Q8KA 1IIPA 4UATA 5J2GA 2HCFA 4Y2VA 2VIXA 3TACB 4EBDA 2QB0B 4RZRA 1U49A 1PVQA 4KLDA 2OYYA 2HBMA 2HSZA 2WB1C 2BGWA 3MR5A 2VJ5A 9ICBA 1SV0C 2KIWA 4F4XA 2J6UA
chains in the Genus database with same CATH topology
3H7IA 4YMMA 1MC8A 3FYHA 1K1SA 3M8SA 1XSLA 1NK4A 4XQ8A 2BCSA 2R8JA 4B9MA 2NRXA 9ICPA 1T8EA 5J2AA 1UWVA 1ZQZA 1QLNA 5KG3A 8ICAA 1ZQLA 4I2IA 2HHSA 4QZAA 2BKEA 5JUMA 4RT2A 4FBUA 9ICMA 4F4WA 3AJVB 4XRHA 2RDIA 2ASDA 4F50A 8ICQA 2W9AA 4YMOA 4R66A 4PHAA 4DL6A 4I2HA 1JXLA 4DQPA 4ECXA 4M9HA 4FS1A 3Q8MA 5KFVA 9ICGA 4QZDA 4DSIA 4KLMA 3QZ8A 1ZQXA 4QZ8A 1KSPA 4I27A 1BPEA 3V72A 2WIWA 5DBAA 2HHVA 5BOMA 1IPIA 4LQEA 3RJJA 4O0IA 3BQ1A 5KG7A 5DB6A 4Q44A 4LZGA 4QZ9A 4EV1A 4IRCA 4NLZA 2AJQA 9ICEA 8ICBA 5EWGA 1ZQKA 2KTQA 4Q45A 3RJFA 2BR0A 2W8KA 4QW8A 1SKWA 4EYIB 5KT5A 4F5RA 5CHGA 1WCLA 4F5NA 3OGUA 5KTQA 1U47A 5BPCA 2ISPA 3KTQA 2XC9A 4RU9A 4UB4A 5KFAA 5CWRA 2C2RA 1NKEA 2FKHB 4TQRA 1ZQSA 7ICOA 4KLGA 9ICIA 5F9NA 1D9DA 1ZETA 2VA2A 5IILA 2P6RA 1UA0A 4QZIA 3RB6A 3RB4A 4NM2A 2ZJ5A 2MUTA 1ZQNA 4KLIA 4J9RA 3Q8LA 2VS1A 2ATLA 4QBNA 4EBEA 3IEYA 4KMUA 4QWEA 4IRKA 1YNMA 2JEFA 4JV1A 5KFSA 4UB1A 4GC7A 4QWDA 4M9GA 2B21A 1AROP 3GDXA 4TUQA 1TK0A 4O5CA 5IIJA 4YD1A 1ZQWA 3SI8A 5J0OA 8ICNA 8ICFA 2FPKA 4DSJA 2NRVA 4Z6FA 1NJWA 5D49A 3PW7A 2ASLA 3G6YA 4FO6A 4F5OA 5DLFA 1ZQAA 4Z6EA 5KFFA 3SV3A 1ZYQA 1UA1A 5KFGA 4ELUA 5DGAA 5KFMA 5DKWA 4BXOB 2AGPA 4YR0A 3GIKA 4M47A 5J2DA 1U4BA 5TZVA 5EOZA 3H4DA 1QSYA 3GFKB 2H5XA 1S0OA 4K4HA 4TQSA 1ZQPA 1NJXA 4RQ5A 4F2SA 3MFHA 4RNNA 4IRDA 3FDSA 2ZTDA 1ZQGA 4EZ9A 3RR7A 4FS2A 8ICXA 3PMNA 4J9QA 3H8JA 2C2EA 5DQHA 5L1JA 3V7LA 1ZQEA 2UVWA 2F1IA 2UVVA 4NY8A 4QZHA 3EYZA 3E2EA 5KFNA 4ED1A 1NK9A 9ICQA 3PNCA 3RR8A 1D8YA 3V6KA 4ZQUA 4YR3A 1X9SA 4B9NA 7ICHA 3C21A 3EWAA 8ICGA 2INBA 2PI4A 5J0RA 2KFNA 4I2JA 4YP3A 4NXZA 4ED6A 3T5JA 4KLLA 3IHQB 4ED7A 1S10A 5IIMA 5DBBA 4I2GA 4MEXA 4YR2A 5KG1A 1ZJNA 3TFRA 1OB9A 4ED2A 4ELVA 2C28A 2JJQA 2HVIA 4DLEA 4RNOA 9ICAA 1OB8A 3PY8A 3BJYA 4Q8EA 3ZDBA 2AGQA 4LVSA 1JX4A 5KFYA 3RRGA 2DBSA 4UBCA 2R8IA 5KFTA 3HT3A 2BQUA 3PR4A 1KRPA 3RH5A 2BCVA 1TVAA 3PW2A 1R11A 3RH4A 2FPMA 4DL5A 5KFZA 7ICTA 4R63A 2BPGA 3SZ2A 4C8MA 4MF8A 1XMXA 1ZQVA 1Z3EB 3PX4A 4K4IA 1XSNA 4QWCA 8ICRA 3GIIA 3Q8QB 3B0YA 4B9TA 3TI0A 2JEGA 1SKRA 4J9MA 2XY6A 2GJWA 2BPCA 7ICJA 1BPXA 3N4MB 2FCOA 1Z00B 3MR2A 4ECVA 1ZQBA 4DOAA 4F93B 3EZ5A 1S0NA 4M0AA 1ZQYA 4ECTA 1D9FA 4KLJA 4ECZA 1X9MA 4YD2A 4IQWA 4QZEA 2JEJA 1DOQA 2VLDA 4RPYA 1T0FA 1XS9D 3PO5A 3H40A 1S97A 3M9OB 2XY7A 4DSKA 4IQUA 4DAVA 1NOMA 5J0TA 5J2CA 2XO7A 4UB5A 4F5QA 5KT4A 4NLKA 9ICOA 4C8LA 4JWMA 3QEAZ 7ICKA 4KLSA 1XC9A 4BXOA 5KG6A 8ICWA 4EZ6A 1V9PA 3C5FA 2W9BB 3UQ2A 4CCHA 1S77D 2R8KA 3T5HA 4QBLA 4QZGA 1ZQFA 3JPQA 1RYSA 3BT7A 5DQIA 1CUKA 4QW9A 3GQCA 4M9NA 2KN7A 2BQRA 4PPXA 3EPGA 5J2HA 4B9LA 7ICGA 3UPQA 4KLTA 3BQ0A 4RUAA 3M8RA 4PHEA 2V9WA 4F8RA 5D46A 4UQGA 2XCAA 1U45A 1Y1OA 3UQ0A 2BPFA 4MF2A 2JZBB 4YVZA 3OJSA 2OWOA 3B0XA 3H8WA 1XWLA 5KG5A 1SL1A 4BDPA 3P1ZB 3Q8PB 4P4MA 3RB3A 3BDPA 8ICSA 5HMMA 1R0VA 2ZJ8A 4TKKA 4DFJA 8ICMA 2XCPA 3DNXA 4UB3A 3M9NB 1MQ3A 4JV0A 5J2IA 1MSWD 4KLQA 1KTQA 1LV5A 4DOCA 2WCZA 2ZUCA 4DO9A 2F1JA 1NK5A 4ELTA 5DDMA 2R8GA 3TAQA 3ZDCA 1ZQQA 5IIIA 3TAPA 2W9MA 1BPDA 3RRHA 1LB2B 3FOVA 2FMPA 3V7KA 2V4RA 9ICFA 4PHPA 3LWMA 5L1LA 1H38A 3T3FA 2ALZA 4KN4A 2FMQA 4I29A 3KHGA 4DL2A 3MABA 4C8OA 7ICIA 4DL4A 4I2DA 4UAWA 2ZUBA 3LK9A 1GEFA 7ICQA 3TANA 4PH5A 4DQQA 5DG7A 4KLOA 4UBBA 9ICRA 4C8KA 4ECQA 3PMLA 4TUPA 3IF0X 4TURA 9ICSA 1ZQUA 2DPIA 1CEZA 1F1ZA 5KG2A 1BPBA 5KFBA 2BQ3A 4O5EA 8ICHA 1NK8A 7ICSA 4RQ1A 4JK1A 5KFJA 3GIMA 4DQRA 5HHHA 2ZYZA 5L1KA 3GV7B 4DQSA 5FDKA 3RBDA 4Z6CA 5KFDA 4J9OA 1BPZA 4O3RA 1JIHA 4YCXA 5J29A 3AUOA 3QE9Y 2MAXA 2OKFA 7ICRA 2WJ0A 4M9JA 3KHLA 2HHWA 4RT3A 3JPRA 2HHUA 5DDYA 4F3OA 3M9MB 2HVHA 8ICYA 3MR3A 5D4BA 2CV8A 1JN3A 5J0QA 2XY5A 9ICXA 1S0MA 4M04A 2IHMA 1SL0A 4B9SA 3C2KA 5J2FA 4PHDA 2W9BA 2JEIA 4F92B 3HW8A 1L3VA 4QBOA 4ECYA 3K75D 1B43A 4O3PA 3ISCA 1NKCA 9ICTA 5DLGA 4EEYA 3KHRA 4P2HA 1TV9A 4DQIA 2I1QA 4J9LA 3PV8A 5J2BA 3C1ZA 5KT7A 4RQ6A 3ISBA 4DL7A 2Y1JA 3RJEA 4TUSA 1L3UA 2KZMA 3THVA 1ZJMA 3SYZA 4Q43A 2NRWA 4X5VA 4KLEA 2PFQA 1S0VA 2FLCA 1QTMA 1L5UA 2HHQA 3Q8SB 2JZBA 2EO0A 4QZBA 2J6TA 4E0DA 4O5KA 3P1ZA 3PW5A 1ZQMA 3NTUA 2W8MA 2CZRA 8ICJA 3JPOA 8ICTA 9ICUA 5KFKA 5EWFA 1ZP7A 1XU4A 5KFQA 2ZTCA 3ZDDA 2A1JB 2KZ3A 5IIKA 3JPSA 2BHNA 3PVXA 1RZTA 1KFSA 2VA3A 4MFFA 1HUZA 5KFPA 3JPNA 4GC6A 4DSEA 1NJZA 2FKCA 1RYRA 1ZQRA 2W9CB 3UXNA 2IHNA 1UT8A 5DB7A 2HHTA 4R64A 3GIJA 3TQ1A 1XO1A 4LZDA 5CJ7A 1ZQDA 1K1QA 4F4YA 4RQ8A 4F91B 2MUTB 1UT5A 4B9VA 1WCNA 4YXJA 1NK7A 3GV8B 4O3NA 7ICEA 2AQ4A 2VANA 3ISDA 4DSFA 2UVUA 4P4OA 3ZDEA 3RAXA 4O3OA 5KT2A 2PI5A 5DB8A 3GILA 5J0PA 2FL3A 5KFXA 2M9NA 4ECSA 1T7PA 2I9GA 3RJGA 4I28A 2HW3A 7ICPA 4YN4A 1NK0A 2NRZA 5J0WA 4MFAA 4GLXA 4M6WB 3EPIA 5DG9A 4YFKA 4QWAA 2BH2A 4UB2A 2Q0ZX 2V4QA 5HP4A 1RXVA 2KFZA 4DFPA 1KLNA 1QSSA 1Y88A 5DGBA 1ZQIA 2BCRA 4J9KA 3ZD9A 1X9WA 4G6VA 4MEYA 5J0YA 2PFPA 1BGXT 4DS5A 2C22A 4NM1A 3MGIA 8ICPA 2OSTA 1C7YA 4YXMA 4C8NA 3PX6A 2IMWP 2W8LA 2FLNA 3IM1A 4QWBA 3QZ7A 3RH6A 2F1HA 5J0XA 9ICNA 1T4GA 3NGDA 5HMLA 4DA2A 1L3TA 4R8UB 5KFUA 4O3SA 4G3IA 3BQTA 2AQ0A 3EW9A 5KFCA 3V6HA 2BCQA 7ICVA 3RAQA 1A76A 4Q8FA 1TAUA 3P1YA 4IR9A 4G6UA 1NK6A 3MDAA 5J2JA 4EYHB 1S9FA 4I2EA 4Z6DA 1HUOA 1SZPA 1XSPA 5L1IA 1U48A 8ICLA 4KLDA 3UXPA 3JPPA 3RB0A 4R65A 1EXNA 5CB1A 2ASJA 2ISOA 2DFLA 5KG4A 4O9MA 8ICCA 2GW6A 4ZH4A 2ZJAA 3MR6A 2PFNA 3ORYA 4M9LA 4E6ZA 2VA8A 1MQ2A 3MBYA 4RNMA 4ED8A 4JV2A 4RQ0A 9ICCA 3OHAA 3PX0A 5L9XA 2WTFA 9ICVA 3N97B 3G6VA 3HPOA 3MFIA 5J0SA 2R8HA 3C2LA 5CR0A 1U9LA 2FMSA 2A1JA 4P4PA 1RXWA 3UXOA 4DSLA 2WCWA 4RPZA 3MDCA 3OHBA 4ECWA 2IA6A 1KFTA 2W9CA 4KN7A 4QZCA 3V6JA 3MGHA 3V7JA 4GXJA 4M2YA 4YMNA 2PFOA 3JPTA 4JUZA 4YG2A 5KT3A 1KEJA 4PGQA 1N56A 1Z00A 5J2EA 3ETLA 3TFSA 3C2MA 3PR5B 3G6XA 1TK8A 3C1YA 4HYKA 4RQ3A 2RDJA 2DPJA 9ICLA 5KFLA 4ECUA 3T5LA 4I2CA 4KLUA 4RPXA 1COOA 8ICUA 5KFEA 4BGDA 2ZUDA 8ICZA 5DB9A 4JWNA 4RUCA 4NLGA 4NLNA 1HJPA 3TARA 1JMSA 5J0UA 1SKSA 4I2AA 1KDHA 2FLPA 4PGYA 4M6WA 3ZDAA 4O3QA 1TFRA 5CA7A 3SV4A 9ICJA 9ICWA 2Y1IA 1B22A 2LYHA 3BQ2A 1NKBA 8ICVA 1NJYA 3ZD8A 4J9NA 2XGQA 1X2IA 1IM4A 3PW0A 4DWIA 1JXEA 4PGXA 5KFOA 2BDPA 4DOBA 1ZQOA 2KZZA 4DFMA 4J9PA 2UVRA 3OSNA 4RQ4A 2J6SA 4IQVA 4EBCA 3T5KA 7ICFA 1D8LA 1T3NA 5C5JA 2P6UA 2AU0A 1N48A 1A77A 1QSLA 3RBEA 1ZQCA 3RJKA 4UAZA 3K4GA 4K4GA 5KFHA 9ICHA 1A79A 4KTQA 1ZQHA 2FLLA 5KFIA 3C23A 1SL2A 5IINA 4ECRA 5KG0A 5CP2A 2ZTEA 3LWLA 4YQWA 5IIOA 4IR1A 1TKDA 4R8UA 8ICEA 5HNKA 3H4BA 4F4KA 8ICOA 4UAYA 3AU2A 4KITB 1BPYA 4F4ZA 4GXKA 4IQTA 4DF8A 2C2DA 4I2BA 3H8SA 1TK5A 4TKDA 7ICLA 4RQ2A 1KFDA 4DFKA 5KFRA 3GV5B 3OJUA 1ZQJA 4DEZA 2AGOA 4DS4A 1S76D 4ED3A 5BOLA 1IXRA 4FBTA 2HHXA 5DQGA 3RJIA 1ZQTA 7ICMA 3HX0A 2P66A 2FPLA 4J9SA 3LDAA 4DL3A 5J2KA 3RJHA 5DBCA 5KT6A 3HWTA 3PW4A 4F5PA 4KLFA 4DAPA 1RPLA 7ICUA 3RTVA 9ICKA 2Z0RA 2WIZA 8ICIA 4F2RA 3QEBZ 3IEYB 2IBKA 4BWJA 3AU6A 3C5GA 1L3SA 3Q8RB 1PZNA 2PXIA 4XUSA 3Q8KA 4B9UA 2IXSA 4I2FA 4ED0A 1BVSA 5J2GA 1RZNA 4RQ7A 3KHHA 1RLVA 3AJVA 5EWEA 4RZRA 5F9LA 4EBDA 3OSPA 1DGSA 1U49A 2GWSA 5HHIA 4XA5A 5KFWA 4DLGA 3PO4A 4KLHA 7ICNA 4QZFA 2BCUA 5DG8A 4BWMA 2NRTA 2BGWA 1HH1A 3MR5A 2ZYZB 4DF4A 4GXIA 9ICBA 2J6UA 2XGPA 4F4XA 8ICKA 4MFCA 1TAQA 3HP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H7I A;  4YMM A;  1MC8 A;  3FYH A;  1K1S A;  3M8S A;  1XSL A;  1NK4 A;  4XQ8 A;  2BCS A;  2R8J A;  4B9M A;  2NRX A;  9ICP A;  1T8E A;  5J2A A;  1ZQZ A;  1QLN A;  5KG3 A;  8ICA A;  1ZQL A;  4I2I A;  2HHS A;  4QZA A;  2BKE A;  5JUM A;  4RT2 A;  4FBU A;  9ICM A;  4F4W A;  3AJV B;  4XRH A;  2RDI A;  2ASD A;  4F50 A;  8ICQ A;  2W9A A;  4YMO A;  4R66 A;  4PHA A;  4DL6 A;  4I2H A;  1JXL A;  4DQP A;  4ECX A;  4M9H A;  4FS1 A;  3Q8M A;  5KFV A;  9ICG A;  4QZD A;  4DSI A;  4KLM A;  3QZ8 A;  1ZQX A;  4QZ8 A;  1KSP A;  4I27 A;  1BPE A;  3V72 A;  2WIW A;  5DBA A;  2HHV A;  5BOM A;  1IPI A;  3RJJ A;  4O0I A;  3BQ1 A;  5KG7 A;  5DB6 A;  4Q44 A;  4LZG A;  4QZ9 A;  4IRC A;  4NLZ A;  2AJQ A;  9ICE A;  8ICB A;  5EWG A;  1ZQK A;  2KTQ A;  4Q45 A;  3RJF A;  2BR0 A;  2W8K A;  4QW8 A;  1SKW A;  4EYI B;  5KT5 A;  4F5R A;  5CHG A;  1WCL A;  4F5N A;  3OGU A;  5KTQ A;  1U47 A;  5BPC A;  2ISP A;  3KTQ A;  2XC9 A;  4RU9 A;  4UB4 A;  5KFA A;  5CWR A;  2C2R A;  1NKE A;  4TQR A;  1ZQS A;  7ICO A;  4KLG A;  9ICI A;  5F9N A;  1D9D A;  1ZET A;  2VA2 A;  5IIL A;  2P6R A;  1UA0 A;  4QZI A;  3RB6 A;  3RB4 A;  4NM2 A;  2ZJ5 A;  2MUT A;  1ZQN A;  4KLI A;  4J9R A;  3Q8L A;  2ATL A;  4QBN A;  4EBE A;  3IEY A;  4KMU A;  4QWE A;  4IRK A;  2JEF A;  4JV1 A;  5KFS A;  4UB1 A;  4GC7 A;  4QWD A;  4M9G A;  2B21 A;  1ARO P;  3GDX A;  4TUQ A;  1TK0 A;  4O5C A;  5IIJ A;  4YD1 A;  1ZQW A;  3SI8 A;  5J0O A;  8ICN A;  8ICF A;  2FPK A;  4DSJ A;  2NRV A;  4Z6F A;  1NJW A;  5D49 A;  3PW7 A;  2ASL A;  3G6Y A;  4FO6 A;  4F5O A;  5DLF A;  1ZQA A;  4Z6E A;  5KFF A;  3SV3 A;  1ZYQ A;  1UA1 A;  5KFG A;  4ELU A;  5DGA A;  5KFM A;  5DKW A;  4BXO B;  2AGP A;  4YR0 A;  3GIK A;  4M47 A;  5J2D A;  1U4B A;  5TZV A;  5EOZ A;  3H4D A;  1QSY A;  3GFK B;  2H5X A;  1S0O A;  4K4H A;  4TQS A;  1ZQP A;  1NJX A;  4RQ5 A;  4F2S A;  3MFH A;  4RNN A;  4IRD A;  3FDS A;  2ZTD A;  1ZQG A;  4EZ9 A;  3RR7 A;  4FS2 A;  8ICX A;  3PMN A;  4J9Q A;  3H8J A;  2C2E A;  5DQH A;  5L1J A;  3V7L A;  1ZQE A;  2UVW A;  2F1I A;  2UVV A;  4NY8 A;  4QZH A;  3EYZ A;  3E2E A;  5KFN A;  4ED1 A;  1NK9 A;  9ICQ A;  3PNC A;  3RR8 A;  1D8Y A;  3V6K A;  4YR3 A;  1X9S A;  4B9N A;  7ICH A;  3C21 A;  3EWA A;  8ICG A;  2INB A;  2PI4 A;  5J0R A;  2KFN A;  4I2J A;  4YP3 A;  4NXZ A;  4ED6 A;  3T5J A;  4KLL A;  3IHQ B;  4ED7 A;  1S10 A;  5IIM A;  5DBB A;  4I2G A;  4MEX A;  4YR2 A;  5KG1 A;  1ZJN A;  3TFR A;  1OB9 A;  4ED2 A;  4ELV A;  2C28 A;  2HVI A;  4DLE A;  4RNO A;  9ICA A;  1OB8 A;  3PY8 A;  3BJY A;  4Q8E A;  3ZDB A;  2AGQ A;  4LVS A;  1JX4 A;  5KFY A;  3RRG A;  4UBC A;  2R8I A;  5KFT A;  3HT3 A;  2BQU A;  3PR4 A;  1KRP A;  3RH5 A;  2BCV A;  1TVA A;  3PW2 A;  1R11 A;  3RH4 A;  2FPM A;  4DL5 A;  5KFZ A;  7ICT A;  4R63 A;  2BPG A;  3SZ2 A;  4C8M A;  4MF8 A;  1XMX A;  1ZQV A;  1Z3E B;  3PX4 A;  4K4I A;  1XSN A;  4QWC A;  8ICR A;  3GII A;  3Q8Q B;  3B0Y A;  4B9T A;  3TI0 A;  2JEG A;  1SKR A;  4J9M A;  2XY6 A;  2GJW A;  2BPC A;  7ICJ A;  1BPX A;  3N4M B;  2FCO A;  1Z00 B;  3MR2 A;  4ECV A;  1ZQB A;  4DOA A;  4F93 B;  3EZ5 A;  1S0N A;  4M0A A;  1ZQY A;  4ECT A;  1D9F A;  4KLJ A;  4ECZ A;  1X9M A;  4YD2 A;  4IQW A;  4QZE A;  2JEJ A;  1DOQ A;  2VLD A;  4RPY A;  1T0F A;  1XS9 D;  3PO5 A;  3H40 A;  1S97 A;  3M9O B;  2XY7 A;  4DSK A;  4IQU A;  1NOM A;  5J0T A;  5J2C A;  2XO7 A;  4UB5 A;  4F5Q A;  5KT4 A;  4NLK A;  9ICO A;  4C8L A;  4JWM A;  3QEA Z;  7ICK A;  4KLS A;  1XC9 A;  4BXO A;  5KG6 A;  8ICW A;  4EZ6 A;  1V9P A;  3C5F A;  2W9B B;  3UQ2 A;  4CCH A;  1S77 D;  2R8K A;  3T5H A;  4QBL A;  4QZG A;  1ZQF A;  3JPQ A;  1RYS A;  5DQI A;  1CUK A;  4QW9 A;  3GQC A;  4M9N A;  2KN7 A;  2BQR A;  4PPX A;  3EPG A;  5J2H A;  4B9L A;  7ICG A;  3UPQ A;  4KLT A;  3BQ0 A;  4RUA A;  3M8R A;  4PHE A;  2V9W A;  4F8R A;  5D46 A;  4UQG A;  2XCA A;  1U45 A;  1Y1O A;  3UQ0 A;  2BPF A;  4MF2 A;  2JZB B;  4YVZ A;  3OJS A;  2OWO A;  3B0X A;  3H8W A;  1XWL A;  5KG5 A;  1SL1 A;  4BDP A;  3P1Z B;  3Q8P B;  4P4M A;  3RB3 A;  3BDP A;  8ICS A;  5HMM A;  1R0V A;  2ZJ8 A;  4TKK A;  4DFJ A;  8ICM A;  2XCP A;  3DNX A;  4UB3 A;  3M9N B;  1MQ3 A;  4JV0 A;  5J2I A;  1MSW D;  4KLQ A;  1KTQ A;  1LV5 A;  4DOC A;  2WCZ A;  2ZUC A;  4DO9 A;  2F1J A;  1NK5 A;  4ELT A;  5DDM A;  2R8G A;  3TAQ A;  3ZDC A;  1ZQQ A;  5III A;  3TAP A;  2W9M A;  1BPD A;  3RRH A;  1LB2 B;  3FOV A;  2FMP A;  3V7K A;  2V4R A;  9ICF A;  4PHP A;  3LWM A;  5L1L A;  1H38 A;  3T3F A;  2ALZ A;  4KN4 A;  2FMQ A;  4I29 A;  3KHG A;  4DL2 A;  3MAB A;  4C8O A;  7ICI A;  4DL4 A;  4I2D A;  4UAW A;  2ZUB A;  3LK9 A;  1GEF A;  7ICQ A;  3TAN A;  4PH5 A;  4DQQ A;  5DG7 A;  4KLO A;  4UBB A;  9ICR A;  4C8K A;  4ECQ A;  3PML A;  4TUP A;  4TUR A;  9ICS A;  1ZQU A;  2DPI A;  1CEZ A;  1F1Z A;  5KG2 A;  1BPB A;  5KFB A;  2BQ3 A;  4O5E A;  8ICH A;  1NK8 A;  7ICS A;  4RQ1 A;  4JK1 A;  5KFJ A;  3GIM A;  4DQR A;  5HHH A;  2ZYZ A;  5L1K A;  3GV7 B;  4DQS A;  5FDK A;  3RBD A;  4Z6C A;  5KFD A;  4J9O A;  1BPZ A;  4O3R A;  1JIH A;  4YCX A;  5J29 A;  3AUO A;  3QE9 Y;  2MAX A;  2OKF A;  7ICR A;  2WJ0 A;  4M9J A;  3KHL A;  2HHW A;  4RT3 A;  3JPR A;  2HHU A;  5DDY A;  4F3O A;  3M9M B;  2HVH A;  8ICY A;  3MR3 A;  5D4B A;  2CV8 A;  1JN3 A;  5J0Q A;  2XY5 A;  9ICX A;  1S0M A;  4M04 A;  2IHM A;  1SL0 A;  4B9S A;  3C2K A;  5J2F A;  4PHD A;  2W9B A;  2JEI A;  4F92 B;  3HW8 A;  1L3V A;  4QBO A;  4ECY A;  3K75 D;  1B43 A;  4O3P A;  3ISC A;  1NKC A;  9ICT A;  5DLG A;  4EEY A;  3KHR A;  4P2H A;  1TV9 A;  4DQI A;  2I1Q A;  4J9L A;  3PV8 A;  5J2B A;  3C1Z A;  5KT7 A;  4RQ6 A;  3ISB A;  4DL7 A;  2Y1J A;  3RJE A;  4TUS A;  1L3U A;  2KZM A;  3THV A;  1ZJM A;  3SYZ A;  4Q43 A;  2NRW A;  4X5V A;  4KLE A;  2PFQ A;  1S0V A;  1QTM A;  1L5U A;  2HHQ A;  3Q8S B;  2JZB A;  2EO0 A;  4QZB A;  2J6T A;  4E0D A;  4O5K A;  3P1Z A;  3PW5 A;  1ZQM A;  3NTU A;  8ICJ A;  3JPO A;  8ICT A;  9ICU A;  5KFK A;  5EWF A;  1ZP7 A;  1XU4 A;  5KFQ A;  2ZTC A;  3ZDD A;  2A1J B;  2KZ3 A;  5IIK A;  3JPS A;  2BHN A;  3PVX A;  1RZT A;  1KFS A;  2VA3 A;  4MFF A;  1HUZ A;  5KFP A;  3JPN A;  4GC6 A;  4DSE A;  1NJZ A;  1RYR A;  1ZQR A;  2W9C B;  3UXN A;  2IHN A;  1UT8 A;  5DB7 A;  2HHT A;  4R64 A;  3GIJ A;  3TQ1 A;  1XO1 A;  4LZD A;  5CJ7 A;  1ZQD A;  1K1Q A;  4F4Y A;  4RQ8 A;  4F91 B;  2MUT B;  1UT5 A;  4B9V A;  1WCN A;  4YXJ A;  1NK7 A;  3GV8 B;  4O3N A;  7ICE A;  2AQ4 A;  2VAN A;  3ISD A;  4DSF A;  2UVU A;  4P4O A;  3ZDE A;  3RAX A;  4O3O A;  5KT2 A;  2PI5 A;  5DB8 A;  3GIL A;  5J0P A;  5KFX A;  2M9N A;  4ECS A;  1T7P A;  2I9G A;  3RJG A;  4I28 A;  2HW3 A;  7ICP A;  4YN4 A;  1NK0 A;  2NRZ A;  5J0W A;  4MFA A;  4GLX A;  4M6W B;  3EPI A;  5DG9 A;  4YFK A;  4QWA A;  4UB2 A;  2Q0Z X;  2V4Q A;  5HP4 A;  1RXV A;  2KFZ A;  4DFP A;  1KLN A;  1QSS A;  1Y88 A;  5DGB A;  1ZQI A;  2BCR A;  4J9K A;  3ZD9 A;  1X9W A;  4MEY A;  5J0Y A;  2PFP A;  1BGX T;  4DS5 A;  2C22 A;  4NM1 A;  3MGI A;  8ICP A;  2OST A;  1C7Y A;  4YXM A;  4C8N A;  3PX6 A;  2IMW P;  2W8L A;  2FLN A;  3IM1 A;  4QWB A;  3QZ7 A;  3RH6 A;  2F1H A;  5J0X A;  9ICN A;  1T4G A;  3NGD A;  5HML A;  1L3T A;  4R8U B;  5KFU A;  4O3S A;  4G3I A;  3BQT A;  2AQ0 A;  3EW9 A;  5KFC A;  3V6H A;  2BCQ A;  7ICV A;  3RAQ A;  1A76 A;  4Q8F A;  1TAU A;  3P1Y A;  4IR9 A;  1NK6 A;  3MDA A;  5J2J A;  4EYH B;  1S9F A;  4I2E A;  4Z6D A;  1HUO A;  1SZP A;  1XSP A;  5L1I A;  1U48 A;  8ICL A;  4KLD A;  3UXP A;  3JPP A;  3RB0 A;  4R65 A;  1EXN A;  5CB1 A;  2ASJ A;  2ISO A;  2DFL A;  5KG4 A;  4O9M A;  8ICC A;  2GW6 A;  4ZH4 A;  2ZJA A;  3MR6 A;  2PFN A;  3ORY A;  4M9L A;  2VA8 A;  1MQ2 A;  3MBY A;  4RNM A;  4ED8 A;  4JV2 A;  4RQ0 A;  9ICC A;  3OHA A;  3PX0 A;  5L9X A;  2WTF A;  9ICV A;  3N97 B;  3G6V A;  3HPO A;  3MFI A;  5J0S A;  2R8H A;  3C2L A;  5CR0 A;  1U9L A;  2FMS A;  2A1J A;  4P4P A;  1RXW A;  3UXO A;  4DSL A;  2WCW A;  4RPZ A;  3MDC A;  3OHB A;  4ECW A;  2IA6 A;  1KFT A;  2W9C A;  4KN7 A;  4QZC A;  3V6J A;  3MGH A;  3V7J A;  4GXJ A;  4M2Y A;  4YMN A;  2PFO A;  3JPT A;  4JUZ A;  4YG2 A;  5KT3 A;  1KEJ A;  4PGQ A;  1N56 A;  1Z00 A;  5J2E A;  3ETL A;  3TFS A;  3C2M A;  3PR5 B;  3G6X A;  1TK8 A;  3C1Y A;  4HYK A;  4RQ3 A;  2RDJ A;  2DPJ A;  9ICL A;  5KFL A;  4ECU A;  3T5L A;  4I2C A;  4KLU A;  4RPX A;  1COO A;  8ICU A;  5KFE A;  4BGD A;  2ZUD A;  8ICZ A;  5DB9 A;  4JWN A;  4RUC A;  4NLG A;  4NLN A;  1HJP A;  3TAR A;  1JMS A;  5J0U A;  1SKS A;  4I2A A;  1KDH A;  2FLP A;  4PGY A;  4M6W A;  3ZDA A;  4O3Q A;  1TFR A;  5CA7 A;  3SV4 A;  9ICJ A;  9ICW A;  2Y1I A;  1B22 A;  2LYH A;  3BQ2 A;  1NKB A;  8ICV A;  1NJY A;  3ZD8 A;  4J9N A;  2XGQ A;  1X2I A;  1IM4 A;  3PW0 A;  4DWI A;  1JXE A;  4PGX A;  5KFO A;  2BDP A;  4DOB A;  1ZQO A;  2KZZ A;  4DFM A;  4J9P A;  2UVR A;  3OSN A;  4RQ4 A;  2J6S A;  4IQV A;  4EBC A;  3T5K A;  7ICF A;  1D8L A;  1T3N A;  5C5J A;  2P6U A;  2AU0 A;  1N48 A;  1A77 A;  1QSL A;  3RBE A;  1ZQC A;  3RJK A;  4UAZ A;  3K4G A;  4K4G A;  5KFH A;  9ICH A;  1A79 A;  4KTQ A;  1ZQH A;  2FLL A;  5KFI A;  3C23 A;  1SL2 A;  5IIN A;  4ECR A;  5KG0 A;  5CP2 A;  2ZTE A;  3LWL A;  4YQW A;  5IIO A;  4IR1 A;  1TKD A;  4R8U A;  8ICE A;  5HNK A;  3H4B A;  4F4K A;  8ICO A;  4UAY A;  3AU2 A;  4KIT B;  1BPY A;  4F4Z A;  4GXK A;  4IQT A;  4DF8 A;  2C2D A;  4I2B A;  3H8S A;  1TK5 A;  4TKD A;  7ICL A;  4RQ2 A;  1KFD A;  4DFK A;  5KFR A;  3GV5 B;  3OJU A;  1ZQJ A;  4DEZ A;  2AGO A;  4DS4 A;  1S76 D;  4ED3 A;  5BOL A;  1IXR A;  4FBT A;  2HHX A;  5DQG A;  3RJI A;  1ZQT A;  7ICM A;  3HX0 A;  2P66 A;  2FPL A;  4J9S A;  3LDA A;  4DL3 A;  5J2K A;  3RJH A;  5DBC A;  5KT6 A;  3HWT A;  3PW4 A;  4F5P A;  4KLF A;  1RPL A;  7ICU A;  3RTV A;  9ICK A;  2WIZ A;  8ICI A;  4F2R A;  3QEB Z;  2IBK A;  4BWJ A;  3AU6 A;  3C5G A;  1L3S A;  3Q8R B;  1PZN A;  2PXI A;  4XUS A;  3Q8K A;  4B9U A;  4I2F A;  4ED0 A;  1BVS A;  5J2G A;  1RZN A;  4RQ7 A;  3KHH A;  1RLV A;  3AJV A;  5EWE A;  4RZR A;  5F9L A;  4EBD A;  3OSP A;  1DGS A;  1U49 A;  2GWS A;  5HHI A;  4XA5 A;  5KFW A;  4DLG A;  3PO4 A;  4KLH A;  7ICN A;  4QZF A;  2BCU A;  5DG8 A;  4BWM A;  2NRT A;  2BGW A;  1HH1 A;  3MR5 A;  2ZYZ B;  4DF4 A;  4GXI A;  9ICB A;  2J6U A;  2XGP A;  4F4X A;  8ICK A;  4MFC A;  1TAQ A;  3HP6 A; 
#chains in the Genus database with same CATH topology
 1MC8 A;  3FYH A;  1K1S A;  1NK4 A;  2R8J A;  4EX6 A;  5KG3 A;  4FBU A;  3HRD D;  3AL0 B;  1X42 A;  3AJV B;  2RDI A;  1ZD2 P;  1DGJ A;  4PHA A;  2LBO A;  4DL6 A;  1JXL A;  4DQP A;  4I2H A;  4ECX A;  3QZ8 A;  2ZIW B;  4QZ8 A;  4I27 A;  2WIW A;  1BPE A;  4BJQ A;  5DBA A;  3QUT A;  1L7M A;  3RJJ A;  5AKK A;  5KG7 A;  5DB6 A;  3T79 A;  2KSO B;  5F3X B;  8ICB A;  5EWG A;  2BR0 A;  2W8K A;  1SKW A;  2EZY A;  1SXD A;  5ALZ A;  5CHG A;  1WCL A;  2A3V A;  2JMG A;  2XC9 A;  4QNL A;  5EE3 A;  5KFA A;  3E58 A;  3D6J A;  7ICO A;  3LVV A;  1T3Q A;  1ZET A;  2VA2 A;  4ZOH C;  3RB4 A;  5ALX A;  2MUT A;  2VS1 A;  3KFU F;  4EBE A;  3IEY A;  3BS7 A;  1YNM A;  5KFS A;  5AKH A;  2B21 A;  3GDX A;  1TK0 A;  3QU2 A;  8ICN A;  3IG8 A;  5CRX A;  4DSJ A;  1NJW A;  1ZD5 A;  5D49 A;  3PW7 A;  2ASL A;  4IS7 A;  5DLF A;  1ZQA A;  1ZYQ A;  3UMB A;  5DKW A;  4BXO B;  2AGP A;  1CI4 A;  2H5X A;  1PVR A;  4RQ5 A;  2FJ6 A;  4EZ9 A;  2DBY A;  3RR7 A;  2E1E A;  2ZIV B;  3H8J A;  1L6N A;  3CP8 A;  3ONN A;  2UVW A;  4A8E A;  3RR8 A;  4B9N A;  3BZK A;  1RQN A;  3EWA A;  4ED7 A;  5AKZ A;  5IIM A;  5DBB A;  1ZJN A;  1OB9 A;  4ELV A;  2C28 A;  3PSF A;  3QU4 A;  4RNO A;  5JTI A;  4RQM A;  1N2X A;  2GO7 A;  2AGQ A;  3WK4 A;  3QYP A;  5KFT A;  2BQU A;  4AYB F;  4P0Q A;  1R11 A;  3H0R B;  2BPG A;  1XMX A;  1ZQV A;  3PX4 A;  3Q8Q B;  2JEG A;  1SKR A;  2GJW A;  2BPC A;  2H3Q A;  1J2N A;  3N4M B;  2BDU A;  1Z00 B;  4ECV A;  3H8M A;  4F93 B;  4M0A A;  1ZQY A;  4ECT A;  4ECZ A;  2B0C A;  1X9M A;  2G5H B;  4OD0 A;  4F5Q A;  9ICO A;  2FI1 A;  4JWM A;  7ICK A;  3QEA Z;  4KLS A;  2KEY A;  3UQ2 A;  4UAS A;  3T5H A;  1BNP A;  5B5E U;  3DDH A;  2W54 A;  2BQR A;  4B9L A;  2YN4 A;  7ICG A;  5ALD A;  4PHE A;  4F8R A;  5D46 A;  1PK3 A;  2XCA A;  2YQE A;  2BPF A;  4YVZ A;  3OJS A;  2OWO A;  3B0X A;  2G0A A;  4BDP A;  3BQ7 A;  5HMM A;  2ZJ8 A;  2XCP A;  5J2I A;  4Y2J A;  5AKX A;  2ZUC A;  4DO9 A;  2R8G A;  1ZQQ A;  1BPD A;  3KBB A;  2OCE A;  5EE9 A;  1N5W A;  1PVP A;  1OW5 A;  1X6J A;  4PJ0 U;  1O08 A;  2E5S A;  3LK9 A;  4PH5 A;  4DQQ A;  9ICR A;  3IF0 X;  2ZXI A;  4TUR A;  3IDW A;  2DPI A;  1CEZ A;  5KG2 A;  2K4H A;  4UAU A;  3SEN A;  2KHV A;  3M7D A;  4RQ1 A;  4US8 A;  3KOO A;  4NLB A;  5KFJ A;  3KKA A;  5L1K A;  1WWU A;  3RBD A;  5FP0 A;  5KFD A;  4YCX A;  1ZOL A;  2DL0 A;  2DUY A;  2OKF A;  2WJ0 A;  4M9J A;  5H2F U;  2HVH A;  3QU7 A;  3MR3 A;  5D4B A;  1JN3 A;  2XY5 A;  4AYB C;  4U7C A;  4M04 A;  3HKZ F;  4PHD A;  3HW8 A;  1L3V A;  4ECY A;  3GU3 A;  3KHR A;  2L5Y A;  1URJ A;  3ISB A;  5KT7 A;  4DL7 A;  1L3U A;  3THV A;  2ZG6 A;  5L1M A;  2FLC A;  2HHQ A;  3A0B U;  2F44 A;  2QAR A;  1WYG A;  3PW5 A;  4EEK A;  2W55 A;  9ICU A;  2JHD A;  3WKB A;  1ZP7 A;  5KFQ A;  2ZTC A;  2A1J B;  5J8Y A;  2CRX A;  2VA3 A;  2BHN A;  5GTI U;  3JPN A;  4OO1 J;  2FKC A;  1RYR A;  1ZQR A;  2W9C B;  4KX3 A;  3UXN A;  4R64 A;  3GIJ A;  5CJ7 A;  1ZQD A;  4F91 B;  2MUT B;  4B9V A;  4YXJ A;  2VAN A;  2PMZ F;  1KW4 A;  3LYS A;  4ECS A;  3RJG A;  4OJ5 A;  2NRZ A;  4GLX A;  5DG9 A;  2Z7J A;  4YFK A;  2W3S A;  2Q0Z X;  1KLN A;  5AK3 A;  1Y88 A;  3SEI A;  1LVH A;  4Y2P A;  4MEY A;  2JRZ A;  5J0Y A;  1L7O A;  1BGX T;  1S8O A;  1C7Y A;  2IMW P;  4QIW F;  3IM1 A;  9ICN A;  1S5L U;  3NGD A;  4O3S A;  2KKP A;  2AQ0 A;  3BQT A;  3QXG A;  3RAQ A;  2G06 A;  3P1Y A;  1WUD A;  3WKA A;  2F76 X;  1QQ5 A;  4G6U A;  5AKG A;  3VC8 A;  1FFU A;  3M6Z A;  3MDA A;  4EYH B;  2G08 A;  1QH9 A;  5ALT A;  3WKE A;  8ICL A;  1C20 A;  2ISO A;  5KG4 A;  4ZH4 A;  4E6Z A;  2LHT A;  2VA8 A;  4RNM A;  3UMG A;  4ED8 A;  1PUZ A;  2RQ5 A;  3U26 A;  1RM6 C;  2KVS A;  2WTF A;  3MFI A;  3C2L A;  1WG8 A;  2K4E A;  2FMS A;  3HKZ C;  3AQF A;  2XID A;  3MDC A;  3OPX A;  4KN7 A;  4QZC A;  4GXJ A;  4KX5 A;  3JPT A;  3ETL A;  1YZ6 A;  1TK8 A;  3C1Y A;  4HYK A;  4I2C A;  2KKV A;  4G9B A;  5KFE A;  4BGD A;  5DB9 A;  4RUC A;  5K4L A;  1JMS A;  5ALO A;  1SKS A;  3I28 A;  4I2A A;  3AEV A;  2G07 A;  1KDH A;  2FLP A;  4M6W A;  1TFR A;  1B22 A;  3QUC A;  1NJY A;  4J9N A;  1JXE A;  4PGX A;  3QU9 A;  4DOB A;  2KZZ A;  4DFM A;  3OSN A;  4RQ4 A;  4IQV A;  2F77 X;  1D8L A;  2EZX A;  3RBE A;  9ICH A;  2PMZ C;  5IIN A;  2ZTE A;  4F4K A;  3HJE A;  1BPY A;  4F4Z A;  2KE7 A;  4KMO B;  4C7Z A;  4RQ2 A;  4FZN A;  5KFR A;  4FE3 A;  3GV5 B;  4DEZ A;  2AGO A;  4DS4 A;  2I5H A;  2KHQ A;  4FBT A;  5DQG A;  2D6F C;  4J9S A;  3RJH A;  2YY6 A;  3PW4 A;  4KLF A;  9ICK A;  2WIZ A;  4QIW C;  5AM0 A;  2IBK A;  4BWJ A;  3AU6 A;  1L3S A;  4ED0 A;  1BVS A;  2GLE A;  4RQ7 A;  3KHH A;  2CV8 A;  2IOH A;  4QZF A;  3SR6 A;  1T94 A;  1SXE A;  2XGP A;  4YMM A;  4XQ8 A;  9ICP A;  5J2A A;  2YX8 A;  4I2I A;  1LKY A;  2BKE A;  4QZA A;  9ICM A;  4F4W A;  2H3F A;  2W7P A;  2ASD A;  2W9A A;  4R66 A;  2YML A;  3Q8M A;  3AN1 A;  9ICG A;  2KJ5 A;  3V72 A;  2HHV A;  3BQ1 A;  4HAI A;  4Q44 A;  4IRC A;  2AHO B;  4NLZ A;  2AJQ A;  2Q4T A;  5AI8 A;  1ZQK A;  2KTQ A;  3RJF A;  3F53 A;  3QU5 A;  4EYI B;  5KT5 A;  4F5R A;  3CW2 C;  1U47 A;  3KTQ A;  1X6I A;  4EEN A;  5CWR A;  1ZXI A;  5AM5 A;  1ZQS A;  5F9N A;  1D9D A;  2XVT A;  1QQ7 A;  1UA0 A;  1VJ5 A;  4QZI A;  5ALQ A;  2ZJ5 A;  1ZQN A;  2Y9U A;  2HBJ A;  3I76 A;  4KMU A;  4IRK A;  4M9G A;  3D2N A;  4TUQ A;  4O5C A;  1PK1 B;  5J0O A;  8ICF A;  2NRV A;  4Z6F A;  4FO6 A;  4F5O A;  2RRD A;  3NS1 A;  5TZV A;  1M6Y A;  1ED1 A;  4K4H A;  2KJ8 A;  1NJX A;  4F2S A;  3MFH A;  4RNN A;  4IRD A;  2E1F A;  8ICX A;  1XO0 A;  2W03 A;  2C2E A;  5DQH A;  5L1J A;  3V7L A;  4NY8 A;  9ICQ A;  2XI9 A;  3F2D A;  3V6K A;  5ALR A;  1X9S A;  3R9K A;  3C21 A;  4UB8 U;  8ICG A;  5AKI A;  2PI4 A;  4NXZ A;  4KLL A;  3IHQ B;  3WK7 A;  1OXJ A;  4YR2 A;  5AKL A;  5KG1 A;  1L8O A;  3K1R B;  3TAD A;  1OB8 A;  1N60 A;  4Q8E A;  3C29 A;  3KZI U;  1B0X A;  4LVS A;  1JX4 A;  4OCZ A;  4UBC A;  2R8I A;  3PR4 A;  1JRP A;  2BCV A;  1TVA A;  1TE2 A;  5KFZ A;  7ICT A;  2ZIU A;  4R63 A;  3ED5 A;  3ETR A;  4MF8 A;  1XSN A;  5A0L A;  3BS5 A;  2XY6 A;  7ICJ A;  2FCO A;  3PST A;  2JV3 A;  4DOA A;  3EZ5 A;  4KLJ A;  4IQW A;  5AM2 A;  1L7P A;  3PO5 A;  1S97 A;  3FC4 A;  4DSK A;  3IN5 A;  5J2C A;  4NLK A;  4UB5 A;  5KT4 A;  2E3T A;  1XC9 A;  8ICW A;  4EZ6 A;  1V9P A;  1S77 D;  3L3F X;  4CCH A;  2F3N A;  3GQC A;  4M9N A;  2KN7 A;  4PPX A;  3EPG A;  2W43 A;  4RUA A;  3M8R A;  4UQG A;  1V97 A;  3TKA A;  4F71 A;  4P4M A;  3BDP A;  8ICS A;  1R0V A;  3WK5 A;  4DFJ A;  3DNX A;  3F5E A;  4IC9 A;  3M9N B;  1LV5 A;  4DOC A;  2WCZ A;  3TAQ A;  2W9M A;  2FMP A;  4PHP A;  3LWM A;  2IOF A;  1NZB A;  2ALZ A;  4KN4 A;  2FMQ A;  5ALV A;  3KHG A;  5AKJ A;  4C8O A;  7ICI A;  4DL4 A;  4KLO A;  4UBB A;  4ECQ A;  4OJO A;  2QKQ A;  2BQ3 A;  2D3D A;  4O5E A;  8ICH A;  1NK8 A;  7ICS A;  3GIM A;  4JK1 A;  2ZYZ A;  5HHH A;  3GV7 B;  4Z6C A;  5GTH U;  5J29 A;  3AUO A;  3QE9 Y;  2MAX A;  2HOQ A;  1UQV A;  3O0F A;  2HHW A;  2HHU A;  2LYB A;  5DDY A;  4F3O A;  1LKY B;  5J0Q A;  1S0M A;  1QQ6 A;  2IHM A;  1SV0 A;  5J2F A;  2W9B A;  2JEI A;  4F92 B;  3K75 D;  9ICT A;  1NKC A;  5DLG A;  2KIV A;  3AM9 A;  4EEY A;  4P2H A;  2AH5 A;  3TI0 A;  3PV8 A;  2KZM A;  2WF9 A;  3RJE A;  1ZJM A;  4Q43 A;  2NRW A;  3WU2 U;  2PFQ A;  1QTM A;  3Q8S B;  2YTU A;  2JZB A;  1DXS A;  4QZB A;  2J6T A;  3M6K A;  2ODG A;  3P1Z A;  3NTU A;  5AI9 A;  8ICJ A;  3OTQ A;  5KFK A;  5IIK A;  2KZ3 A;  4MFF A;  5ALK A;  1HUZ A;  1SZH A;  4ICA A;  1XO1 A;  4LZD A;  2YB1 A;  1UT5 A;  1WCN A;  3KKA C;  4O3N A;  7ICE A;  3ISD A;  5EE1 A;  5KT2 A;  4AP9 A;  2PI5 A;  3WK6 A;  5J0P A;  2FL3 A;  2O6K A;  2I9G A;  5J0W A;  4UW9 A;  2OHF A;  3WK8 A;  3GZF A;  2BH2 A;  1Z19 A;  1Z4N A;  1RXV A;  2BZF A;  2PFP A;  2DKZ A;  4NM1 A;  2W8L A;  2FLN A;  4QWB A;  3QZ7 A;  5J0X A;  1T4G A;  1J2M A;  5HML A;  3UM9 A;  1L3T A;  3F5A A;  5KFU A;  5KFC A;  2BCQ A;  7ICV A;  2B6G A;  4Q8F A;  1P7D A;  2K8A A;  5EE0 A;  4IR9 A;  4I2E A;  1SZP A;  1XSP A;  3NVV A;  1U48 A;  1NZP A;  3RB0 A;  1EXN A;  5J8Y C;  2GOL A;  2GW6 A;  2ZJA A;  2G09 A;  3ORY A;  4M9L A;  3MBY A;  2OXO A;  2NV3 A;  2W7O A;  4RQ0 A;  3PX0 A;  5L9X A;  1Z1V A;  3KZX A;  3HPO A;  1JI7 A;  2WCW A;  4P4P A;  1WWV A;  2IA6 A;  3V6J A;  1JRO A;  3MGH A;  2PFO A;  4JUZ A;  4YG2 A;  5KT3 A;  1KEJ A;  5J2E A;  2AXT U;  3C2M A;  4PL2 A;  1D8B A;  3L5K A;  4LJX A;  4US9 A;  4RPX A;  4KLU A;  2ZUD A;  1SB3 C;  4NLG A;  4NLN A;  1HJP A;  3ZDA A;  1VDV A;  5AI4 A;  9ICJ A;  9ICW A;  2LYH A;  2F8L A;  2M0N A;  2YMP A;  1NKB A;  3IV6 A;  3ZD8 A;  2KK0 A;  4DWI A;  5KFO A;  2UVR A;  3UMC A;  2CN1 A;  3K4G A;  5KFH A;  3C23 A;  5CP2 A;  4YQW A;  5IIO A;  4R8U A;  2K4P A;  3KD3 A;  3H4B A;  4UAY A;  3AU2 A;  2DQN B;  4GXK A;  4CNQ A;  2RLT A;  3RF9 A;  4JMU A;  4DFK A;  3OJU A;  1GO3 F;  5JU5 A;  4Y2X A;  3SAH A;  2IOF K;  4ED3 A;  5BOL A;  1SWV A;  3CNH A;  4BUG A;  5AM1 A;  1ZQT A;  2FPL A;  3LDA A;  2PKE A;  3HWT A;  3IEY B;  2FDR A;  3H0L B;  3QUQ A;  2EAO A;  4XUS A;  2IXS A;  4CF4 A;  1RZN A;  2JXJ A;  3PSP A;  3IRU A;  5ALY A;  5EWE A;  3OSP A;  5F9L A;  4LQE A;  1DGS A;  4KLH A;  2GWS A;  5HHI A;  7ICN A;  4DLG A;  2MRL A;  1HH1 A;  2ZYZ B;  4DF4 A;  1YZ7 A;  4GXI A;  3HP6 A;  3H7I A;  1XSL A;  3M8S A;  4B9M A;  2BCS A;  3ICX A;  1ZQZ A;  1QLN A;  1ZQL A;  5JUM A;  4OJ6 A;  2W3R A;  5ALE A;  1N63 A;  4M9H A;  4FS1 A;  5KFV A;  4QZD A;  4KLM A;  1ZQX A;  1A0P A;  2QLT A;  1IPI A;  1ZD4 A;  4LZG A;  2HDO A;  9ICE A;  4QW8 A;  3OGU A;  5KTQ A;  1K5O A;  2ISP A;  4CF3 A;  4RU9 A;  4UB4 A;  4CRX A;  2C2R A;  1NKE A;  2FKH B;  4P0Q B;  4CGZ A;  2CXY A;  9ICI A;  2EAN A;  1Z4O A;  3RB6 A;  1AQ6 A;  4P0P A;  1F5S A;  4J9R A;  2H3I A;  3QNM A;  2ATL A;  4QBN A;  4QWE A;  4JV1 A;  4UB1 A;  5AHX A;  4CDG A;  4QWD A;  3SI8 A;  2FPK A;  2QB0 A;  3G6Y A;  1JAL A;  2F8K A;  5ALH A;  1UA1 A;  4M47 A;  4YR0 A;  3GIK A;  4NL9 A;  3SD7 A;  2DGZ A;  3H4D A;  2LM4 A;  5EOZ A;  3GFK B;  1SIJ A;  3C28 A;  1ZQP A;  2ZTD A;  1ZQG A;  1HIW A;  3PMN A;  2JH7 A;  3AJV A;  2UVV A;  4QZH A;  2YB4 A;  4C80 A;  5KFN A;  1D8Y A;  7ICH A;  5AI0 A;  2KFN A;  4YP3 A;  4ED6 A;  3T5J A;  3B9J A;  2KOB A;  4I2G A;  2KSO A;  3TFR A;  4FZM A;  1ZQ1 C;  2JJQ A;  4DLE A;  9ICA A;  2ZIX A;  3ZDB A;  4IL6 U;  2DBS A;  5KFY A;  3RRG A;  3IG5 A;  1KRP A;  2K60 A;  3PW2 A;  3RH4 A;  2EDU A;  3SZ2 A;  3DEE A;  3SQI A;  4K4I A;  8ICR A;  3GII A;  2WFA A;  3B0Y A;  4B9T A;  4J9M A;  1BPX A;  2WF7 A;  1ZQB A;  2W11 A;  4YD2 A;  4UAV A;  2JEJ A;  1DOQ A;  3NVW A;  5T14 A;  1XS9 D;  3H40 A;  3M9O B;  2XY7 A;  4DAV A;  1NOM A;  5J0T A;  1O03 A;  4BXO A;  1NI3 A;  2K4I A;  1N5X A;  4QBL A;  2R8K A;  3JPQ A;  1RYS A;  4Y2S A;  5ALM A;  2EAP A;  5J2H A;  3UPQ A;  4KLT A;  2V9W A;  2ZIV A;  1U45 A;  3UQ0 A;  3D2S A;  2JR5 A;  1SV4 A;  3D2Q A;  1N62 A;  3H8W A;  1XWL A;  5KG5 A;  2QAR B;  1SL1 A;  3RB3 A;  1DRG A;  4TKK A;  8ICM A;  4PZO A;  3AMZ A;  1RDF A;  1MQ3 A;  1KTQ A;  3NRW A;  2F1J A;  4ELT A;  5ALL A;  1L7N A;  5DDM A;  3ZDC A;  3TAP A;  1LB2 B;  3IP4 B;  3V7K A;  9ICF A;  5L1L A;  2R18 A;  1H38 A;  4I29 A;  5TIS U;  2WF8 A;  3MAB A;  4NLC A;  1FEZ A;  4I2D A;  5ALP A;  7ICQ A;  4TUP A;  4NWI A;  1ZQU A;  1J97 A;  1BPB A;  5ALI A;  4DFD A;  2HMX A;  4Y2Y A;  4DQS A;  4Y2Q A;  4J9O A;  1BPZ A;  1KN5 A;  1JIH A;  2NYV A;  4GIB A;  7ICR A;  4RT3 A;  1X40 A;  3M9M B;  1RG6 A;  9ICX A;  1COK A;  4B9S A;  1UCV A;  4NV0 A;  4QBO A;  4O3P A;  3ISC A;  2I1Q A;  4J9L A;  5J2B A;  3SYZ A;  1S0V A;  5ALN A;  1L5U A;  2EO0 A;  4E0D A;  2LI6 A;  1SWW A;  1X66 A;  5AI6 A;  1ZQM A;  3PSI A;  2W8M A;  5AKE A;  2CZR A;  3JPO A;  2HOI A;  1N61 A;  1XU4 A;  3ZDD A;  3NRZ A;  2Y0S F;  2HBK A;  1KFS A;  1NJZ A;  4GC6 A;  2KMD A;  2IHN A;  2HHT A;  1UT8 A;  2K89 A;  5DB7 A;  1MN8 A;  4OJP A;  1F0M A;  5ALF A;  4F4Y A;  4DSF A;  4P4O A;  4USA A;  3ZDE A;  3F2B A;  4O3O A;  5AIC A;  1MA7 A;  3MGV A;  1T7P A;  4I28 A;  7ICP A;  4YN4 A;  3QUB A;  4MFA A;  4M6W B;  2KV2 A;  4J03 A;  2V4Q A;  5HP4 A;  2KFZ A;  4DFP A;  2MSN A;  1QSS A;  4O3M A;  4WJ3 B;  2BCR A;  1IG6 A;  4J9K A;  1X9W A;  3MGI A;  5ALG A;  4YXM A;  4C8N A;  3PX6 A;  2F1H A;  2QB1 A;  2WAQ F;  4G3I A;  3EW9 A;  1A76 A;  1NK6 A;  2EH9 A;  3AQE A;  2NO4 A;  4Z6D A;  1HUO A;  3UXP A;  2HOF A;  5JRT A;  2LKY A;  1KQQ A;  3NVZ A;  4O9M A;  3MR6 A;  2PFN A;  1MQ2 A;  2ZIX B;  4JV2 A;  3OHA A;  4C7Y A;  4FFD A;  3G6V A;  5J0S A;  2R8H A;  2A1A A;  5CR0 A;  1U9L A;  2A1J A;  1FFV A;  4RPZ A;  3OHB A;  2W9C A;  3V7J A;  4YMN A;  2K8C B;  2ESE A;  1QCK A;  3G6X A;  2RDJ A;  2DPJ A;  5E79 U;  9ICL A;  5KNI A;  5KFL A;  4ECU A;  3T5L A;  8ICU A;  1ZRN A;  4DCC A;  1NNL A;  4CE6 A;  4EEL A;  3TAR A;  5J0U A;  2HI0 A;  5CA7 A;  2Y0S C;  1X2I A;  1IM4 A;  4EX7 A;  3PW0 A;  1CRX A;  2BDP A;  2W04 A;  1ZQO A;  1FIQ A;  1Q3V A;  4J9P A;  2J6S A;  7ICF A;  1T3N A;  1QSL A;  3RJK A;  1A79 A;  5CEH A;  4KTQ A;  2FLL A;  5KFI A;  1SL2 A;  3N28 A;  5KG0 A;  4IR1 A;  1TKD A;  5HR7 A;  8ICO A;  3HIL A;  1IV8 A;  4DF8 A;  2C2D A;  1TK5 A;  5AK4 A;  4TKD A;  3RFA A;  7ICL A;  1L8L A;  2CPR A;  1TAM A;  1S76 D;  2HHX A;  3HX0 A;  2P66 A;  4DL3 A;  5DBC A;  5KT6 A;  4F5P A;  2OH2 A;  3EUB 2;  2Z0R A;  3RTV A;  8ICI A;  5AI5 A;  3QEB Z;  3DV9 A;  4F2R A;  2KJ9 A;  2WHE A;  3Q8R B;  2WAQ C;  4B9U A;  4I2F A;  1RLV A;  3L4P A;  2A19 A;  3PO4 A;  5KFW A;  4XA5 A;  2EAM A;  2BCU A;  2E8N A;  5DG8 A;  4BWM A;  3I1Y A;  2NRT A;  3S6J A;  8ICK A;  3MC1 A;  1TAQ A;  4MFC A;  9ICS A;  1Q46 A;  5HR6 A;  2NRX A;  5KAF U;  1UWV A;  1T8E A;  5ALU A;  8ICA A;  2YMQ A;  2HHS A;  1VLB A;  4RT2 A;  4XRH A;  4F50 A;  8ICQ A;  4YMO A;  1B4F A;  3J81 j;  3WKC A;  2MA1 A;  4DSI A;  1KSP A;  5BOM A;  4O0I A;  2XIC A;  4QZ9 A;  1KBU A;  4EV1 A;  4Q45 A;  3PZP A;  2EQY A;  2DWQ A;  4F5N A;  1UHU A;  5BPC A;  4TQR A;  2VKQ A;  3ZI4 A;  2ZIU B;  4KLG A;  2NO5 A;  5IIL A;  2P6R A;  2KG5 A;  4KLI A;  4NM2 A;  4GFJ A;  2GH1 A;  3BS5 B;  3Q8L A;  2H3Z A;  5ALS A;  2JEF A;  1V38 A;  4GC7 A;  1ARO P;  5IIJ A;  4YD1 A;  1ZQW A;  4NJ8 A;  3N7P D;  4Z6E A;  5KFF A;  3SV3 A;  5KFG A;  4ELU A;  4U6P A;  5DGA A;  5KFM A;  5J2D A;  1U4B A;  1V85 A;  1QSY A;  1S0O A;  4TQS A;  4C4R A;  2E8M A;  3FDS A;  4Y2T A;  4FS2 A;  2G5I B;  4J9Q A;  1ZQE A;  3E2E A;  2F1I A;  3EYZ A;  2DF4 B;  4ED1 A;  1NK9 A;  3PNC A;  4ZQU A;  4YR3 A;  1FO4 A;  2INB A;  5J0R A;  4I2J A;  1S10 A;  5AIB A;  4MEX A;  2VJ4 A;  1KKX A;  4ED2 A;  4B6J A;  2HVI A;  3PY8 A;  3BJY A;  3ALR A;  3VCB A;  1Z1B A;  3HT3 A;  3F2C A;  1SGG A;  3RH5 A;  4C4T A;  1Q8K A;  4MHV A;  2WF6 A;  2FPM A;  4DL5 A;  1Q3U A;  4C8M A;  1Z3E B;  4QWC A;  2RP5 A;  3WK9 A;  3SAG A;  2ZXH A;  4C4S A;  3MR2 A;  5G5H A;  4OJL A;  2KP7 A;  1S0N A;  4NL9 C;  1D9F A;  4QZE A;  2VLD A;  4RPY A;  1PK1 A;  3NAS A;  1T0F A;  4IQU A;  4Y2R A;  2XO7 A;  4C8L A;  5KG6 A;  3FM9 A;  3C5F A;  2W9B B;  4QZG A;  1ZQF A;  3BT7 A;  5DQI A;  1CUK A;  4QW9 A;  5KL8 B;  4BX9 C;  2F2A B;  3BQ0 A;  1F44 A;  1Y1O A;  4MF2 A;  2JZB B;  3SMV A;  2LYA A;  3P1Z B;  3Q8P B;  4UB3 A;  3BZC A;  4JV0 A;  1MSW D;  4KLQ A;  5G5G A;  1NK5 A;  4PZN A;  5III A;  3FOV A;  3RRH A;  2V4R A;  1ZRM A;  2D8C A;  1RQL A;  1DK3 A;  3T3F A;  1A6S A;  3E0F A;  2YMM A;  4CF5 A;  4DL2 A;  4UAW A;  2ZUB A;  1GEF A;  3TAN A;  5DG7 A;  4C8K A;  3CYM A;  3N7R C;  3PML A;  4Y2U A;  1F1Z A;  5AK5 A;  5KFB A;  3QX7 A;  4DQR A;  4QJF B;  5FDK A;  2JH1 A;  4O3R A;  3KHL A;  4PL1 A;  3JPR A;  8ICY A;  2EZZ A;  1SL0 A;  3C2K A;  1B43 A;  3N7S C;  1RYU A;  2ZIW A;  3H0M B;  1TV9 A;  4DQI A;  3C1Z A;  4RQ6 A;  2Y1J A;  4TUS A;  4X5V A;  4KLE A;  2WF5 A;  4O5K A;  3A0H U;  3NUQ A;  5AKY A;  2RHF A;  1HEK A;  4F72 A;  3LVW A;  1X9X A;  5KAI U;  8ICT A;  5KL1 B;  5EWF A;  1UPH A;  1RZT A;  3JPS A;  3PVX A;  5KFP A;  4DSE A;  2LM1 A;  2E8P A;  3TQ1 A;  5AM4 A;  1K1Q A;  4RQ8 A;  5ALW A;  1NK7 A;  3GV8 B;  1XNS A;  2AQ4 A;  4FZL A;  2UVU A;  5ALJ A;  3RAX A;  2P35 A;  2H3V A;  1KL9 A;  5DB8 A;  3GIL A;  5KFX A;  2M9N A;  3M1Y A;  2HW3 A;  1NK0 A;  4UB6 U;  3EPI A;  4RQN A;  2OM6 A;  4QWA A;  4UB2 A;  2OEH A;  5DGB A;  1ZQI A;  2LPE A;  3ZD9 A;  2HBL A;  4G6V A;  1YT3 A;  1BNO A;  8ICP A;  4DS5 A;  2C22 A;  2OST A;  3SAF A;  2DKX A;  2KIC A;  3RH6 A;  4DA2 A;  4R8U B;  1ECW A;  3V6H A;  3TAD C;  1TAU A;  5J2J A;  1S9F A;  3K1Z A;  3CRX A;  2WB1 F;  4UAR A;  5L1I A;  3JPP A;  4R65 A;  5CB1 A;  2ASJ A;  2DFL A;  8ICC A;  2LMR A;  9ICC A;  9ICV A;  3N97 B;  3NVY A;  2MU2 A;  4DSL A;  1RXW A;  3UXO A;  2KNJ A;  4ECW A;  1KFT A;  2FE9 A;  2KD1 A;  1OUQ A;  4M2Y A;  1ZD3 A;  4PGQ A;  1N56 A;  1Z00 A;  3TFS A;  3PR5 B;  4RQ3 A;  2I6X A;  1JUD A;  1COO A;  2ES6 A;  8ICZ A;  4JWN A;  5C0Y A;  2Y9T A;  4PGY A;  2KVC A;  4O3Q A;  3SV4 A;  2Y1I A;  3WKD A;  5B66 U;  3BQ2 A;  8ICV A;  2JGA A;  2XGQ A;  2K8B B;  5AK6 A;  3T5K A;  4EBC A;  1N48 A;  5C5J A;  2P6U A;  2AU0 A;  1A77 A;  1ZQC A;  4UAZ A;  4JB3 A;  4K4G A;  1ZQH A;  4ECR A;  3LWL A;  8ICE A;  2N1R A;  3FAH A;  5HNK A;  4KIT B;  4IQT A;  4I2B A;  3H8S A;  4C0Z A;  5AIA A;  1KFD A;  2E8O A;  1ZQJ A;  1IXR A;  3RJI A;  7ICM A;  4ACO A;  5J2K A;  4P0P B;  4DAP A;  1RPL A;  7ICU A;  1DK2 A;  5AM3 A;  3C5G A;  2PXI A;  1PZN A;  3Q8K A;  1IIP A;  4UAT A;  5J2G A;  2HCF A;  4Y2V A;  2VIX A;  3TAC B;  4EBD A;  2QB0 B;  4RZR A;  1U49 A;  1PVQ A;  4KLD A;  2OYY A;  2HBM A;  2HSZ A;  2WB1 C;  2BGW A;  3MR5 A;  2VJ5 A;  9ICB A;  1SV0 C;  2KIW A;  4F4X A;  2J6U A; 
#chains in the Genus database with same CATH homology
 3H7I A;  4YMM A;  1MC8 A;  3FYH A;  1K1S A;  3M8S A;  1XSL A;  1NK4 A;  4XQ8 A;  2BCS A;  2R8J A;  4B9M A;  2NRX A;  9ICP A;  1T8E A;  5J2A A;  1UWV A;  1ZQZ A;  1QLN A;  5KG3 A;  8ICA A;  1ZQL A;  4I2I A;  2HHS A;  4QZA A;  2BKE A;  5JUM A;  4RT2 A;  4FBU A;  9ICM A;  4F4W A;  3AJV B;  4XRH A;  2RDI A;  2ASD A;  4F50 A;  8ICQ A;  2W9A A;  4YMO A;  4R66 A;  4PHA A;  4DL6 A;  4I2H A;  1JXL A;  4DQP A;  4ECX A;  4M9H A;  4FS1 A;  3Q8M A;  5KFV A;  9ICG A;  4QZD A;  4DSI A;  4KLM A;  3QZ8 A;  1ZQX A;  4QZ8 A;  1KSP A;  4I27 A;  1BPE A;  3V72 A;  2WIW A;  5DBA A;  2HHV A;  5BOM A;  1IPI A;  4LQE A;  3RJJ A;  4O0I A;  3BQ1 A;  5KG7 A;  5DB6 A;  4Q44 A;  4LZG A;  4QZ9 A;  4EV1 A;  4IRC A;  4NLZ A;  2AJQ A;  9ICE A;  8ICB A;  5EWG A;  1ZQK A;  2KTQ A;  4Q45 A;  3RJF A;  2BR0 A;  2W8K A;  4QW8 A;  1SKW A;  4EYI B;  5KT5 A;  4F5R A;  5CHG A;  1WCL A;  4F5N A;  3OGU A;  5KTQ A;  1U47 A;  5BPC A;  2ISP A;  3KTQ A;  2XC9 A;  4RU9 A;  4UB4 A;  5KFA A;  5CWR A;  2C2R A;  1NKE A;  2FKH B;  4TQR A;  1ZQS A;  7ICO A;  4KLG A;  9ICI A;  5F9N A;  1D9D A;  1ZET A;  2VA2 A;  5IIL A;  2P6R A;  1UA0 A;  4QZI A;  3RB6 A;  3RB4 A;  4NM2 A;  2ZJ5 A;  2MUT A;  1ZQN A;  4KLI A;  4J9R A;  3Q8L A;  2VS1 A;  2ATL A;  4QBN A;  4EBE A;  3IEY A;  4KMU A;  4QWE A;  4IRK A;  1YNM A;  2JEF A;  4JV1 A;  5KFS A;  4UB1 A;  4GC7 A;  4QWD A;  4M9G A;  2B21 A;  1ARO P;  3GDX A;  4TUQ A;  1TK0 A;  4O5C A;  5IIJ A;  4YD1 A;  1ZQW A;  3SI8 A;  5J0O A;  8ICN A;  8ICF A;  2FPK A;  4DSJ A;  2NRV A;  4Z6F A;  1NJW A;  5D49 A;  3PW7 A;  2ASL A;  3G6Y A;  4FO6 A;  4F5O A;  5DLF A;  1ZQA A;  4Z6E A;  5KFF A;  3SV3 A;  1ZYQ A;  1UA1 A;  5KFG A;  4ELU A;  5DGA A;  5KFM A;  5DKW A;  4BXO B;  2AGP A;  4YR0 A;  3GIK A;  4M47 A;  5J2D A;  1U4B A;  5TZV A;  5EOZ A;  3H4D A;  1QSY A;  3GFK B;  2H5X A;  1S0O A;  4K4H A;  4TQS A;  1ZQP A;  1NJX A;  4RQ5 A;  4F2S A;  3MFH A;  4RNN A;  4IRD A;  3FDS A;  2ZTD A;  1ZQG A;  4EZ9 A;  3RR7 A;  4FS2 A;  8ICX A;  3PMN A;  4J9Q A;  3H8J A;  2C2E A;  5DQH A;  5L1J A;  3V7L A;  1ZQE A;  2UVW A;  2F1I A;  2UVV A;  4NY8 A;  4QZH A;  3EYZ A;  3E2E A;  5KFN A;  4ED1 A;  1NK9 A;  9ICQ A;  3PNC A;  3RR8 A;  1D8Y A;  3V6K A;  4ZQU A;  4YR3 A;  1X9S A;  4B9N A;  7ICH A;  3C21 A;  3EWA A;  8ICG A;  2INB A;  2PI4 A;  5J0R A;  2KFN A;  4I2J A;  4YP3 A;  4NXZ A;  4ED6 A;  3T5J A;  4KLL A;  3IHQ B;  4ED7 A;  1S10 A;  5IIM A;  5DBB A;  4I2G A;  4MEX A;  4YR2 A;  5KG1 A;  1ZJN A;  3TFR A;  1OB9 A;  4ED2 A;  4ELV A;  2C28 A;  2JJQ A;  2HVI A;  4DLE A;  4RNO A;  9ICA A;  1OB8 A;  3PY8 A;  3BJY A;  4Q8E A;  3ZDB A;  2AGQ A;  4LVS A;  1JX4 A;  5KFY A;  3RRG A;  2DBS A;  4UBC A;  2R8I A;  5KFT A;  3HT3 A;  2BQU A;  3PR4 A;  1KRP A;  3RH5 A;  2BCV A;  1TVA A;  3PW2 A;  1R11 A;  3RH4 A;  2FPM A;  4DL5 A;  5KFZ A;  7ICT A;  4R63 A;  2BPG A;  3SZ2 A;  4C8M A;  4MF8 A;  1XMX A;  1ZQV A;  1Z3E B;  3PX4 A;  4K4I A;  1XSN A;  4QWC A;  8ICR A;  3GII A;  3Q8Q B;  3B0Y A;  4B9T A;  3TI0 A;  2JEG A;  1SKR A;  4J9M A;  2XY6 A;  2GJW A;  2BPC A;  7ICJ A;  1BPX A;  3N4M B;  2FCO A;  1Z00 B;  3MR2 A;  4ECV A;  1ZQB A;  4DOA A;  4F93 B;  3EZ5 A;  1S0N A;  4M0A A;  1ZQY A;  4ECT A;  1D9F A;  4KLJ A;  4ECZ A;  1X9M A;  4YD2 A;  4IQW A;  4QZE A;  2JEJ A;  1DOQ A;  2VLD A;  4RPY A;  1T0F A;  1XS9 D;  3PO5 A;  3H40 A;  1S97 A;  3M9O B;  2XY7 A;  4DSK A;  4IQU A;  4DAV A;  1NOM A;  5J0T A;  5J2C A;  2XO7 A;  4UB5 A;  4F5Q A;  5KT4 A;  4NLK A;  9ICO A;  4C8L A;  4JWM A;  3QEA Z;  7ICK A;  4KLS A;  1XC9 A;  4BXO A;  5KG6 A;  8ICW A;  4EZ6 A;  1V9P A;  3C5F A;  2W9B B;  3UQ2 A;  4CCH A;  1S77 D;  2R8K A;  3T5H A;  4QBL A;  4QZG A;  1ZQF A;  3JPQ A;  1RYS A;  3BT7 A;  5DQI A;  1CUK A;  4QW9 A;  3GQC A;  4M9N A;  2KN7 A;  2BQR A;  4PPX A;  3EPG A;  5J2H A;  4B9L A;  7ICG A;  3UPQ A;  4KLT A;  3BQ0 A;  4RUA A;  3M8R A;  4PHE A;  2V9W A;  4F8R A;  5D46 A;  4UQG A;  2XCA A;  1U45 A;  1Y1O A;  3UQ0 A;  2BPF A;  4MF2 A;  2JZB B;  4YVZ A;  3OJS A;  2OWO A;  3B0X A;  3H8W A;  1XWL A;  5KG5 A;  1SL1 A;  4BDP A;  3P1Z B;  3Q8P B;  4P4M A;  3RB3 A;  3BDP A;  8ICS A;  5HMM A;  1R0V A;  2ZJ8 A;  4TKK A;  4DFJ A;  8ICM A;  2XCP A;  3DNX A;  4UB3 A;  3M9N B;  1MQ3 A;  4JV0 A;  5J2I A;  1MSW D;  4KLQ A;  1KTQ A;  1LV5 A;  4DOC A;  2WCZ A;  2ZUC A;  4DO9 A;  2F1J A;  1NK5 A;  4ELT A;  5DDM A;  2R8G A;  3TAQ A;  3ZDC A;  1ZQQ A;  5III A;  3TAP A;  2W9M A;  1BPD A;  3RRH A;  1LB2 B;  3FOV A;  2FMP A;  3V7K A;  2V4R A;  9ICF A;  4PHP A;  3LWM A;  5L1L A;  1H38 A;  3T3F A;  2ALZ A;  4KN4 A;  2FMQ A;  4I29 A;  3KHG A;  4DL2 A;  3MAB A;  4C8O A;  7ICI A;  4DL4 A;  4I2D A;  4UAW A;  2ZUB A;  3LK9 A;  1GEF A;  7ICQ A;  3TAN A;  4PH5 A;  4DQQ A;  5DG7 A;  4KLO A;  4UBB A;  9ICR A;  4C8K A;  4ECQ A;  3PML A;  4TUP A;  3IF0 X;  4TUR A;  9ICS A;  1ZQU A;  2DPI A;  1CEZ A;  1F1Z A;  5KG2 A;  1BPB A;  5KFB A;  2BQ3 A;  4O5E A;  8ICH A;  1NK8 A;  7ICS A;  4RQ1 A;  4JK1 A;  5KFJ A;  3GIM A;  4DQR A;  5HHH A;  2ZYZ A;  5L1K A;  3GV7 B;  4DQS A;  5FDK A;  3RBD A;  4Z6C A;  5KFD A;  4J9O A;  1BPZ A;  4O3R A;  1JIH A;  4YCX A;  5J29 A;  3AUO A;  3QE9 Y;  2MAX A;  2OKF A;  7ICR A;  2WJ0 A;  4M9J A;  3KHL A;  2HHW A;  4RT3 A;  3JPR A;  2HHU A;  5DDY A;  4F3O A;  3M9M B;  2HVH A;  8ICY A;  3MR3 A;  5D4B A;  2CV8 A;  1JN3 A;  5J0Q A;  2XY5 A;  9ICX A;  1S0M A;  4M04 A;  2IHM A;  1SL0 A;  4B9S A;  3C2K A;  5J2F A;  4PHD A;  2W9B A;  2JEI A;  4F92 B;  3HW8 A;  1L3V A;  4QBO A;  4ECY A;  3K75 D;  1B43 A;  4O3P A;  3ISC A;  1NKC A;  9ICT A;  5DLG A;  4EEY A;  3KHR A;  4P2H A;  1TV9 A;  4DQI A;  2I1Q A;  4J9L A;  3PV8 A;  5J2B A;  3C1Z A;  5KT7 A;  4RQ6 A;  3ISB A;  4DL7 A;  2Y1J A;  3RJE A;  4TUS A;  1L3U A;  2KZM A;  3THV A;  1ZJM A;  3SYZ A;  4Q43 A;  2NRW A;  4X5V A;  4KLE A;  2PFQ A;  1S0V A;  2FLC A;  1QTM A;  1L5U A;  2HHQ A;  3Q8S B;  2JZB A;  2EO0 A;  4QZB A;  2J6T A;  4E0D A;  4O5K A;  3P1Z A;  3PW5 A;  1ZQM A;  3NTU A;  2W8M A;  2CZR A;  8ICJ A;  3JPO A;  8ICT A;  9ICU A;  5KFK A;  5EWF A;  1ZP7 A;  1XU4 A;  5KFQ A;  2ZTC A;  3ZDD A;  2A1J B;  2KZ3 A;  5IIK A;  3JPS A;  2BHN A;  3PVX A;  1RZT A;  1KFS A;  2VA3 A;  4MFF A;  1HUZ A;  5KFP A;  3JPN A;  4GC6 A;  4DSE A;  1NJZ A;  2FKC A;  1RYR A;  1ZQR A;  2W9C B;  3UXN A;  2IHN A;  1UT8 A;  5DB7 A;  2HHT A;  4R64 A;  3GIJ A;  3TQ1 A;  1XO1 A;  4LZD A;  5CJ7 A;  1ZQD A;  1K1Q A;  4F4Y A;  4RQ8 A;  4F91 B;  2MUT B;  1UT5 A;  4B9V A;  1WCN A;  4YXJ A;  1NK7 A;  3GV8 B;  4O3N A;  7ICE A;  2AQ4 A;  2VAN A;  3ISD A;  4DSF A;  2UVU A;  4P4O A;  3ZDE A;  3RAX A;  4O3O A;  5KT2 A;  2PI5 A;  5DB8 A;  3GIL A;  5J0P A;  2FL3 A;  5KFX A;  2M9N A;  4ECS A;  1T7P A;  2I9G A;  3RJG A;  4I28 A;  2HW3 A;  7ICP A;  4YN4 A;  1NK0 A;  2NRZ A;  5J0W A;  4MFA A;  4GLX A;  4M6W B;  3EPI A;  5DG9 A;  4YFK A;  4QWA A;  2BH2 A;  4UB2 A;  2Q0Z X;  2V4Q A;  5HP4 A;  1RXV A;  2KFZ A;  4DFP A;  1KLN A;  1QSS A;  1Y88 A;  5DGB A;  1ZQI A;  2BCR A;  4J9K A;  3ZD9 A;  1X9W A;  4G6V A;  4MEY A;  5J0Y A;  2PFP A;  1BGX T;  4DS5 A;  2C22 A;  4NM1 A;  3MGI A;  8ICP A;  2OST A;  1C7Y A;  4YXM A;  4C8N A;  3PX6 A;  2IMW P;  2W8L A;  2FLN A;  3IM1 A;  4QWB A;  3QZ7 A;  3RH6 A;  2F1H A;  5J0X A;  9ICN A;  1T4G A;  3NGD A;  5HML A;  4DA2 A;  1L3T A;  4R8U B;  5KFU A;  4O3S A;  4G3I A;  3BQT A;  2AQ0 A;  3EW9 A;  5KFC A;  3V6H A;  2BCQ A;  7ICV A;  3RAQ A;  1A76 A;  4Q8F A;  1TAU A;  3P1Y A;  4IR9 A;  4G6U A;  1NK6 A;  3MDA A;  5J2J A;  4EYH B;  1S9F A;  4I2E A;  4Z6D A;  1HUO A;  1SZP A;  1XSP A;  5L1I A;  1U48 A;  8ICL A;  4KLD A;  3UXP A;  3JPP A;  3RB0 A;  4R65 A;  1EXN A;  5CB1 A;  2ASJ A;  2ISO A;  2DFL A;  5KG4 A;  4O9M A;  8ICC A;  2GW6 A;  4ZH4 A;  2ZJA A;  3MR6 A;  2PFN A;  3ORY A;  4M9L A;  4E6Z A;  2VA8 A;  1MQ2 A;  3MBY A;  4RNM A;  4ED8 A;  4JV2 A;  4RQ0 A;  9ICC A;  3OHA A;  3PX0 A;  5L9X A;  2WTF A;  9ICV A;  3N97 B;  3G6V A;  3HPO A;  3MFI A;  5J0S A;  2R8H A;  3C2L A;  5CR0 A;  1U9L A;  2FMS A;  2A1J A;  4P4P A;  1RXW A;  3UXO A;  4DSL A;  2WCW A;  4RPZ A;  3MDC A;  3OHB A;  4ECW A;  2IA6 A;  1KFT A;  2W9C A;  4KN7 A;  4QZC A;  3V6J A;  3MGH A;  3V7J A;  4GXJ A;  4M2Y A;  4YMN A;  2PFO A;  3JPT A;  4JUZ A;  4YG2 A;  5KT3 A;  1KEJ A;  4PGQ A;  1N56 A;  1Z00 A;  5J2E A;  3ETL A;  3TFS A;  3C2M A;  3PR5 B;  3G6X A;  1TK8 A;  3C1Y A;  4HYK A;  4RQ3 A;  2RDJ A;  2DPJ A;  9ICL A;  5KFL A;  4ECU A;  3T5L A;  4I2C A;  4KLU A;  4RPX A;  1COO A;  8ICU A;  5KFE A;  4BGD A;  2ZUD A;  8ICZ A;  5DB9 A;  4JWN A;  4RUC A;  4NLG A;  4NLN A;  1HJP A;  3TAR A;  1JMS A;  5J0U A;  1SKS A;  4I2A A;  1KDH A;  2FLP A;  4PGY A;  4M6W A;  3ZDA A;  4O3Q A;  1TFR A;  5CA7 A;  3SV4 A;  9ICJ A;  9ICW A;  2Y1I A;  1B22 A;  2LYH A;  3BQ2 A;  1NKB A;  8ICV A;  1NJY A;  3ZD8 A;  4J9N A;  2XGQ A;  1X2I A;  1IM4 A;  3PW0 A;  4DWI A;  1JXE A;  4PGX A;  5KFO A;  2BDP A;  4DOB A;  1ZQO A;  2KZZ A;  4DFM A;  4J9P A;  2UVR A;  3OSN A;  4RQ4 A;  2J6S A;  4IQV A;  4EBC A;  3T5K A;  7ICF A;  1D8L A;  1T3N A;  5C5J A;  2P6U A;  2AU0 A;  1N48 A;  1A77 A;  1QSL A;  3RBE A;  1ZQC A;  3RJK A;  4UAZ A;  3K4G A;  4K4G A;  5KFH A;  9ICH A;  1A79 A;  4KTQ A;  1ZQH A;  2FLL A;  5KFI A;  3C23 A;  1SL2 A;  5IIN A;  4ECR A;  5KG0 A;  5CP2 A;  2ZTE A;  3LWL A;  4YQW A;  5IIO A;  4IR1 A;  1TKD A;  4R8U A;  8ICE A;  5HNK A;  3H4B A;  4F4K A;  8ICO A;  4UAY A;  3AU2 A;  4KIT B;  1BPY A;  4F4Z A;  4GXK A;  4IQT A;  4DF8 A;  2C2D A;  4I2B A;  3H8S A;  1TK5 A;  4TKD A;  7ICL A;  4RQ2 A;  1KFD A;  4DFK A;  5KFR A;  3GV5 B;  3OJU A;  1ZQJ A;  4DEZ A;  2AGO A;  4DS4 A;  1S76 D;  4ED3 A;  5BOL A;  1IXR A;  4FBT A;  2HHX A;  5DQG A;  3RJI A;  1ZQT A;  7ICM A;  3HX0 A;  2P66 A;  2FPL A;  4J9S A;  3LDA A;  4DL3 A;  5J2K A;  3RJH A;  5DBC A;  5KT6 A;  3HWT A;  3PW4 A;  4F5P A;  4KLF A;  4DAP A;  1RPL A;  7ICU A;  3RTV A;  9ICK A;  2Z0R A;  2WIZ A;  8ICI A;  4F2R A;  3QEB Z;  3IEY B;  2IBK A;  4BWJ A;  3AU6 A;  3C5G A;  1L3S A;  3Q8R B;  1PZN A;  2PXI A;  4XUS A;  3Q8K A;  4B9U A;  2IXS A;  4I2F A;  4ED0 A;  1BVS A;  5J2G A;  1RZN A;  4RQ7 A;  3KHH A;  1RLV A;  3AJV A;  5EWE A;  4RZR A;  5F9L A;  4EBD A;  3OSP A;  1DGS A;  1U49 A;  2GWS A;  5HHI A;  4XA5 A;  5KFW A;  4DLG A;  3PO4 A;  4KLH A;  7ICN A;  4QZF A;  2BCU A;  5DG8 A;  4BWM A;  2NRT A;  2BGW A;  1HH1 A;  3MR5 A;  2ZYZ B;  4DF4 A;  4GXI A;  9ICB A;  2J6U A;  2XGP A;  4F4X A;  8ICK A;  4MFC A;  1TAQ A;  3HP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...