4DAVA

The structure of pyrococcus furiosus sfsa in complex with dna
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
231
structure length
231
Chain Sequence
AMKLMEVSPLFPCIFLRRVNRFVGLVRIKERIERALITNTGRLNEFMIPGRIGYCTPKAGGKTRYILLGFEDHGKIAIIDTRLQGKAFEKIIEKELLPELEGCRIIKREPRVGESRLDYLIECSKGEIFVETKSAVLREGEYAMYPDCPSVRGQRHIKELIKLARDGKRAMIVFIGALPNVSKFKPYKKGDPKIAELLKEALEAGVEIRALGLHMELSGEIIYRGELGVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sugar fermentation stimulation protein homolog
publication title The structure of SfsA and its DNA complex; A DNA/RNA nuclease with a novel domain combination
rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase/dna
total genus 63
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03749 SfsA Sugar fermentation stimulation protein RE domain
A PF17746 SfsA_N SfsA N-terminal OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.580 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4davA01
3.40.1350.60 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 4davA02
4DAPA 4DAVA 4DA2A
chains in the Genus database with same CATH superfamily
2KVMA 2MFIA 5EBCA 5IOCA 1NBWA 1TXYA 1K8MA 1Z6HA 1GO3E 1KAAA 2MUYA 1CKNA 1SJED 4PQXA 5IODA 3RZDH 3QIAA 3ULJA 2K6AA 1XTDA 5JPMC 2N49A 3BS1A 4A3LG 2RSOA 4R4OA 3MXGA 1EQQA 2D62A 3HOYB 1ZYRD 2K75A 1EZ8A 1B9NA 3RLFA 4LFAQ 1LTLA 3GTJH 2F0GA 3L7ZC 1PVOA 4KHPL 1IYVA 2EVBA 5KNDA 1HFNA 2BA0A 4JC0A 5IT9E 5C4HA 1HNXQ 4R8IA 2HD3A 4P71A 1KABA 2JYOA 3QWNA 4RFBA 3HOZG 1I4GA 3ONAB 3HRZC 3RN5A 1MIUA 5GAHC 4UP8A 1QUQB 4QUCA 4DA2A 3NEMA 1MD2D 1T5EA 4XTCS 4ZUJA 4RCNA 4A3FB 3S2HH 1E2ZA 3DEPA 4X62L 2IL8A 1SNDA 2A69C 1EY4A 1HQMC 1SNOA 3S17H 1SNQA 3K7AH 3I3CA 3NPPA 3SEBA 2VUMH 5CV7A 4YWLA 3U9OA 1PLFA 2A68D 3K7UC 3K59A 4BY7H 2Y0SE 2ZM6L 3M4PA 4LJZC 2K5WA 3N52A 4RWSC 3EA6A 1GUNA 3R93A 5J22A 4ZLTF 3HGBA 3VR3A 3A5ZB 1ET9A 1PHJA 1OB9A 3HP3A 3HOXG 3M3YH 4A3GH 2J4XA 4A3EG 1S5DD 1VQ6A 1R9TH 2K5VA 3HG9A 4BBSB 4LFBL 5M5XB 1TWFB 4YCWA 5C4JH 1I4QA 1Z7TA 2G9DA 4HCSA 2IX1A 1XMOL 1D6EC 1MJCA 2M00A 1S5CD 4A93B 3UE0A 4H0LC 1PRTC 4X66L 4OO1I 2UXDQ 1RTOA 3I4MB 1ZP7A 4DXGA 4DAYA 1WTPA 1XMQL 2Z8LA 1K3RA 4UP7A 2XWJB 5FLMH 1GD7A 2JA5H 5FK9C 3R2IA 3PO3G 1JE4A 4OL7A 3D31A 1Q82C 4Y7NH 4NXMQ 1BBWA 3GQBA 1QVCA 2KEEA 4DR5L 4WRDA 3R3OA 4GOPC 1XNRQ 4ZQ3A 4GZYC 2WV6D 1NAPA 1JORA 1JT8A 4K6DA 4UAIA 1KDBA 2R92B 1CI3M 2K4KA 5ELEA 1ONLA 2R93H 5JVH3 3PF4A 2WCZA 4PZ6A 5IYCH 3J81c 1PH4A 4XQJA 3SK6A 2F52A 2KENA 2L1BA 1EEFD 1SEBD 2FL3A 5ELOA 2JA6G 5M3FG 1DOLA 5C3WA 1TU2B 2NVXH 4KHVA 3V96A 3J80c 4DV1Q 2IX0A 2TSSA 2GN5A 4DV7L 4ID6A 1IZ6A 3NXWA 2FLCA 3LWUA 1TWCH 1QG7A 5GADC 2OTJA 1EQTA 3GTMH 4KLKA 4CJ1B 4DXFA 3LGJA 3AEVA 2F0NA 3M4YA 1EU3A 3N6RA 2DBSA 1VQ8A 2K14A 1ESFA 4RGTA 3GTQB 1VQCA 3D4WA 4LK1C 5E4XA 1QWYA 2Z6KC 1IKMA 1X9NA 2VS1A 2B2TC 3MHBA 2AMCB 2BE5C 2WB1G 3W1GA 4KN7C 1PMRA 1FVIA 2YYZA 3IFDA 5CGKA 3OTOQ 5C4XH 1PRTB 3F1ZA 3BVGA 5M3MG 3CC7A 4OHJA 1H9MA 2K1BA 1EYGA 2UUCL 1QNUA 2RF4A 1C8CA 3K0XA 1PFSA 4B3TL 5JJKA 1HXYD 1WCMH 2A19A 1N33Q 1G291 1HZAA 4WORA 4OELB 1EYAA 2KECA 1EY7A 5CR3A 2NN6I 2JA9A 2X6GA 4PG3A 1EUJA 4ZUIA 3H0GG 2DGYA 1GUOA 1BCPC 1AFPA 4LF4Q 2UXCQ 1HH1A 2E74C 3CCRA 2WAQG 5LMUQ 2BH2A 2ZXPA 2F0EA 1X3FA 4OWTB 3GTGH 1W3SA 4P73A 1O7IA 1S5FD 3TP5A 4RG1A 1TWAB 4BY1H 1DGSA 1F9PA 3S1QB 3OPOA 4U673 5IGGA 3I73A 2EXDA 3CXCA 1PH5A 3OIPA 3NTKA 4IPCA 3HOZB 4G7OC 4DK0A 2I07B 4CDCC 3RD4A 3ND9A 4WFN3 1KQSA 3WOEA 1LT6D 5FJ8H 1YNNC 5IYDG 4R4TA 2B8GA 5CBAE 4B08A 4C3JH 2KCMA 1RODA 4JYAQ 3G7LA 2IY5B 5M5WB 2DNCA 1BUVT 2F0SA 1HNXL 2FKCA 3CW2C 4QBOA 1ICFB 3TN2A 1FJGL 1B44D 4DV6L 1JJGA 2NB0A 4JI8Q 4ZRZA 5CORA 1J6QA 4K5VA 1O80A 3STBC 3U58A 2D0PA 5EAYA 4NW2A 4A3DH 1SYGA 3J81i 2BDOA 4JI5L 3DEOA 4BBRH 1SSOA 5IT9c 5EKKA 3HOXB 4BXXH 3H3VC 3CP0A 4H7BA 1QVGA 1E0BA 4A3EB 2IPKD 1F1ZA 2F0VA 2QDLA 1A0IA 2JSOA 3M4OH 4JI3L 1LYLA 4ILWA 2E2HH 3CRLC 4FF1A 3BDCA 4A3BH 1J5EQ 1LO5D 3FP9A 4JV5L 1XPOA 2ATWA 4KN4C 1U4MA 3MA2B 4QBLA 3MXNA 3SK8A 1Q86C 4EVOA 1ILQA 1VF5C 2MPMA 3B6YA 1UE5A 2JP1A 1VQ7A 1BCPB 2KCTA 2XRQD 4PMWA 3CMEA 2Z0RA 2YTYA 1LT5D 2PW5A 4HR7B 2J0TD 1O7LA 3SE0A 3E0EA 2VXWA 1SE2A 3PO3B 1ET6A 1C9OA 2VB2X 1D2BA 1Y8PB 1ESRA 4BWGB 4DR2Q 1K8GA 2N55A 1G2TA 2HDLA 2A6EC 4JI1Q 2EYMA 1BBXC 1YEZA 3M4QA 3ITPA 5TSSA 1Y1WH 2KJXA 1PTOD 2F0HA 2L9HA 2F3WA 2F0JA 5HURA 4LFCL 1STGA 2IWHA 1SFOB 3AFQA 1S5BD 1I50B 2CQAA 1HNWL 3T53B 4KY6A 3EROA 4OIJA 5C5LA 2F4VQ 1QILA 3PGZA 2JA6B 1HA6A 4PZ8A 4MTKA 3S2DH 5M3FB 1Y1VG 3I2ZA 4ULLA 1PDQA 3I70A 1WFQA 3GTPH 4DV4L 4F7XA 4ZKCB 4KV6A 4IPHA 3S15B 5F2DA 4DF7A 2INBA 2VNUD 2IJ0A 4JVZA 4O42A 1OB8A 1QE6A 1JWSD 5ELCA 2EXZA 1FR3A 2FINB 2WJ0A 1AW7A 1ZKOA 1AE3A 4C2MB 2Z1CA 4A3IG 4OXPA 1CA6A 4X64Q 2VQEQ 5LL6X 4LF7Q 1VQIA 2AKWB 4HEDA 4A75A 4HJ7A 3MFYA 4L5RC 1RF2D 2WB1B 1JOOA 4KMUC 2PNHA 4K0KQ 1AH9A 4RHSA 2TMPA 1Q46A 4DV0Q 5M3MB 2KHSA 1TS2A 5JJIA 1L1OB 2CWPA 4UPAA 3BVZA 2UU9Q 1L0YB 1LTSD 4K6LA 5COYA 5C6AA 3DWPA 4FDBA 5IIFA 4YY3L 3DLLA 1LTTD 3KFUA 1G51A 2AQ1B 2R6GA 1HHVA 1WOCA 2QGQA 4TQUS 4GNXC 1SROA 1XNQQ 3GTKB 5C3EH 3H0GB 1BXTA 4WJ3M 4LMQD 1HA5A 4IZ8A 4IFDI 2XN9C 2WP8J 3MWYW 1H9KA 1STBA 3TMEA 3DM1A 2WAQB 2MGSA 2KCNA 3P7JA 1Y8NB 2A1AA 1H9RA 4X3KA 4QUFA 2CWAA 2RDGA 2MNAA 5M9OA 4WJ4A 1RZNA 4AQYQ 1SAPA 3CPFA 1EWHA 5ELDA 1I3QB 3G71A 4FF3A 1W2BA 5C0XI 1SYBA 3PV0A 1KD1C 2A8VA 4LF4L 5K5PA 3S16B 2UXCL 2CW0C 4M8AA 4PNYA 2QEJC 4DKAC 4LQEA 1U4LA 3J81E 3F2BA 1SMYC 2B63B 2AUKA 1X3EA 3KF6A 1HR0L 2YU9B 4TSSA 2Q8RE 4C1NK 1HR0W 4RA8A 5D3IB 4OX9Q 1WJJA 5BN3A 3V2TA 4A3BG 3FKIH 4G57A 1PH9A 2JXMB 3PSIA 2NZHA 2B3GA 2KQ3A 1J8IA 5BR8L 1XPRA 5A2QE 3P20A 4DR3L 2FHTA 4CJ2C 2HQEA 3TP6A 2NVYH 4QGUA 3S1RH 3HKSA 4GN4B 2SNSA 2XTIA 2DNEA 3NE5B 5K36H 4FVMA 4YWMA 3K57A 1WD1A 4ABNA 1EQVA 4K5XA 4GNXB 2ID0A 4IPDA 3U4ZA 1JQYD 4ZQUA 4GKKQ 1C0AA 1XXGA 2HQLA 4J6HA 4FNFA 3T4AC 3D4RA 4OO1H 4JI2L 3T1HL 3S9WA 2B8FA 3IEYA 4C3HH 1VMPA 1PZJD 4JI7L 2HCCA 2A5HA 1MBYA 1JB7A 2NYZD 1UEBA 5J3BA 1J5EL 4DAMA 3M9BA 3I4OA 1R0VA 3EFXD 2F3IA 1PYBA 2EYPA 3EIVA 5I9OA 2VZAA 1IPIA 3EQLC 2K5DA 2XWBB 1GUWA 2VQFQ 1L0XB 2Z0SA 3PIO3 1PH1A 2OXPA 1SE8A 2OCEA 5KYLA 4O2DA 3TREA 2RKSA 2K7VA 2Q2HA 2CV8A 1D1KA 2LXKA 2PO4A 3CRKC 3F2DA 4CDDC 5LMNL 1GHKA 2EYJA 4JI1L 5LMNW 1TWGB 2RDFA 3PCOB 1Y1VB 3BYYB 2CFMA 2O4XA 2R7ZG 1JWMD 4LF6Q 5JOBA 1RIPA 1A62A 4X65L 2VLDA 4OGQC 1RCVD 2PMZB 1Z9FA 2DY8A 2KUMA 4DV3Q 1TWHB 1BO0A 2SDFA 4Q5VA 4G6UA 3AJVB 1IW7D 2JEAI 1H9JA 3I8ZA 3CCUA 1HTLD 3RMHA 2C35B 1EY8A 1PTOH 2V4DA 3D3RA 5G3LD 5FLXc 1SNMA 2AWOA 2R7FA 3TZUA 3JAMc 1V1PB 4JBWA 4A3IB 1A3UA 4DFAA 3RZOH 1CSQA 1AE2A 5DLQE 1I6VC 1Y69U 3CCEA 2NWGA 1TKWB 3HOVH 3PIPA 4RCOA 4OEMB 3D0FA 3DHQA 4K2LA 2N88A 2NVQH 1FD7D 2JE6I 2BOSA 2RBMA 2RHQB 4KKUA 3HOWG 1SRUA 3VA5A 4BA1I 1HQRD 2VQEL 1SYCA 1S40A 2PQEA 4A3JH 2WB1E 4GKJQ 5DM63 2JA7H 4CJ0B 4L8JA 4P72A 5EQ0A 1V1OA 1B9MA 3RR5A 3TP7A 3BZKA 3S1MH 3T16A 3VR4A 4K0KL 2B2WA 1MSHA 4C3IG 1W6JA 3K5NA 2UXBQ 1D7QA 4HJ9A 2NN6H 2XGTA 2K04A 2RCFA 2OQ0A 4ZAIA 1I6HH 3H6MA 1NY4A 1K9MC 1STYA 5ELBA 2IW3A 3H91A 2DJFC 4R4QA 2HDMA 3VYTA 4CDEC 3IFTA 4IQZA 3RNUA 1EY5A 5C4ZA 1M4VA 1KDAA 2VB3X 4IFDJ 3FKIG 4IALA 5IYBG 3AMUA 4I7ZC 5M5YB 2PI2E 3Q0AA 4RKBA 1YIJA 2GW6A 4JK1C 1SN8A 3E3XA 3BZDB 4DV5Q 2W8MA 2F0UA 1RKNA 3NUCA 2CZRA 3KLSA 2CQOA 1CK1A 3PMFA 3OWFA 5IGCA 2NVTH 3OSOA 1RL2A 4UP9A 5C0XJ 4EX5A 2HIVA 3GV6A 1LT4D 1HNZQ 1LUZA 1PYWD 3OWEB 4DNRB 2E2HB 2B2VA 3MTSA 3KF8B 4A3BB 2BH8A 4N8X1 3LNNA 4JW0A 1SYFA 5IP9H 4JPBW 1I4HA 1C7YA 3I4LA 5DM73 3Q24A 2B2UA 1I4XA 1STHA 4POGA 3GD7A 3MVVA 2Z4IA 3J81L 2DN8A 3VR6A 1LABA 3KBGA 2PPBC 4Y52H 5D14A 5IGBA 1K0RA 3E9IA 1W6KA 1LM0A 1K3BC 4A4IA 4X6AH 3T1YQ 2QA4A 1WTXA 3PO2H 3J80L 4AIMA 4DUZQ 4DR6L 2CHBD 2F4IA 4KD4A 3X3NA 4KKTA 5CC4A 5IE8A 1SXTA 5A2QL 3HOUH 2IHFA 4RAUC 2KHIA 3KLRA 4JI6Q 1BNZA 1N32Q 4HSPA 3JAMi 4DUYQ 4FXDA 3CMAA 3GV3A 3TRZA 3CPWA 5I6YA 1WTRA 2EZVA 5C44G 4POFA 2E5LL 2PQAB 1IBMQ 3I4NG 1CZWA 1UEAB 3NWTA 2LXJA 4L5SA 3OMGA 4DNIA 1YNJC 2IHEA 2RDHA 1PRTD 4XIGS 5I4DA 4A3MH 3K58A 1H9SA 3TDQA 5FDKA 1U0LA 2B2YA 3P75A 1Q8KA 3GP7A 3NQIA 4AYBE 3GTOH 4JBJA 1QB5D 4BS9A 4KHZA 1A3TA 4X3SA 4DR1L 2N3SA 1UWVA 5JEAJ 4JBKA 1L1OA 4IN3A 2R7DA 5FO8B 4G7ZC 1XMXA 2PW7A 1KRTA 1KNAA 4JOIA 4JI4Q 3CQZB 5IP7H 3GTLH 4PMBA 1EIFA 2XNAC 2JJQA 2R7ZB 1UE7A 3M7GA 1GM5A 3KBXA 3HOVG 1PH6A 3DWQA 1F2MA 1B7YB 4YHHL 1EY0A 1X3QA 2B2WC 5EKIA 2WINB 1YJWA 1CUKA 2WKCA 3EN2A 2PI2A 1NR2A 3F2UA 3MXUA 2E2JB 1KNEA 4OIKA 3FEWX 4XQNA 4GOPB 4C56C 3OHXC 5EBDA 3UDGA 1IBLQ 3I7FA 5JAVA 3C3LA 1QZHA 2PMZE 2EY1A 4O0AA 3OYYA 1PRTF 5IWAQ 1I94L 4GLAC 4QJFA 2YV5A 1VS0A 1VMCA 1KAWA 1AZQA 4TKDA 4RGNA 5I2YA 3CHBD 5T1IA 2A6HC 2C5CA 1QCBD 3HZXA 2EJGC 3J7YW 3OW2A 4GN5A 1AZPA 3T56B 1I4PA 2VUMG 3HOYH 5DAUA 3HOWB 4MHEA 3C1EA 4QQBX 3S1NB 4BY7G 1RTNA 4K14A 1EYCA 1XJVA 1DJRD 1RJTA 4FYDA 4LF9Q 4TRDA 2BE5D 3KOJA 2RA4A 3TS2A 4QCLA 4LF8Q 4NXNQ 3NENA 4LFAL 3VYSA 5ELNA 2K5HA 4A3GG 1IHZA 4C3IB 1K0SA 1Q90A 4HMJA 4DV2Q 1XX8A 3P1ZA 3A74A 5KGUA 2L4NA 1PZID 5IT9L 4JG2A 4A76A 3NK9A 4PMCA 4A3FH 1EIGA 1FNWA 2YTXA 3L2PA 4IFDH 2DJGC 4JI0Q 1LT3D 1K28A 2F3VA 4B3MQ 3RUZA 1LLRD 3FKIB 1HRJA 3BT7A 2N78A 4IO9A 1YHBA 2ZJRA 1Y1OA 3CD6A 3QO2A 5C3XA 1BCPD 5FLMG 2JA5G 1X55A 2AHOB 3SK5A 5C0XH 1N34Q 2GA4B 2KCCA 3OIQA 1T5XD 1ENFA 4L5QA 3NTHA 4S3SA 3BVMA 5IGEA 3K81C 3S1RB 2JQOA 2MJ8A 1UE6A 4A3CH 1K8AC 1U5KA 4BBSH 4DR4Q 1G6PA 2ZYZA 4LF5Q 1TWFH 3CC4A 2R93G 1DONA 4DR7Q 1UAPA 1QVFA 1UNSA 1S72A 4R4IA 1XPUA 5IYCG 4A93H 1KL9A 1YNND 4A3KH 3PUVA 4BA2I 1OXUA 3MZ5A 2HT1A 3I4MH 3KLWA 2IX3A 4E6ZA 4EQ5A 5FLXE 1BKBA 1ASYA 1IL8A 3SGIA 1DCZA 4H13C 1D1IA 3JAME 4DAVA 2UXDL 4F88A 4CKCA 1N36Q 3NWSA 5EGTA 3WDNA 4IOCA 3STBD 3U9SA 3NTIA 3VYUA 1STEA 2CH4A 1YHQA 3CCMA 1KLUD 1NJIC 3QJYA 1IL2A 1M1KC 4K8IA 1BDOA 1JICA 5KEEA 4DAYB 1GHJA 4NXML 4N9PA 4B9XA 1X65A 4IUVA 3DNXA 3NSWA 2NUCA 4CKEA 2WCWA 3AJVA 1A15A 2RHSB 3MEHA 2K50A 1CKOA 1XNRL 1L0WA 3CC2A 3EBEA 3T1YL 4JBMA 2OEOA 1IYUA 4OWXB 4OONA 2L15A 5C44B 5C4XG 2H1EA 1JR0D 3I4NB 1CM9A 1V1PA 1VQ9A 3UI2A 3OMCA 3KK7A 3K0YA 5C5MA 3PUYA 1R11A 1CFMA 2HHHQ 1HJPA 3OW7A 4EQOA 1YZ6A 1WCMG 5JEAH 1Q3LA 2EY6A 1N8RC 2E8GA 4DV1L 3K5LA 3CU7A 5GQOA 1H95A 1J9OA 5L37A 3RZDB 5KYIA 2A6ED 1PTOF 2OT2A 5FOBB 5I2XA 3GTQH 1XWEA 4GS3A 3RZOB 1JMCA 1JWUD 2PYKA 4IJLA 1G6ZA 1QUQA 4NB3A 2F0OA 5KRUA 3GTJB 3HOVB 3FRPB 2AQ3B 1PXUA 5CV6A 4HIOA 3J7A5 2L55A 4BY1G 2IXSA 4OWWB 2YTVA 1NTGA 3H15A 1ML0D 1VQ5A 1NSNS 2QDBA 4IUQA 4KJNA 3M85A 5HY6A 1CT1D 2HCIA 3OTOL 4KJOA 4ZK9B 2G5DA 1VQOA 4X62Q 4RGOS 2VL6A 4G4KA 5IGDA 2Q8TA 2KOLA 5FJ8G 1PH3A 5I9PA 3CCLA 1ENAA 2QEXA 1CTMA 4KI0A 1UE1A 1GOZA 4C3JG 4MZ9A 1SNCA 3QB3A 4KKSA 3S2HB 2P5ZX 2FCOA 1ZEQX 2ZM6Q 1D8LA 5FO9B 1N33L 1CKMA 2ZT9C 3S17B 2ZTCA 3K7AB 4A3LH 1O78A 2FMCA 4NKLA 2VUMB 4IFDG 2JK8A 4BY7B 1E3PA 1IBLL 4RKLA 1TWAH 4B3RQ 1YJNA 4A3DG 5CV9A 3S1QH 1VQAA 2K01A 4LFBQ 2PNRC 4BBRG 1HUNA 5LMUL 4V190 1Q8IA 3BDOA 2NTSA 4WJWA 4DN4M 3M3YB 4BXXG 4A3GB 1R9TB 3R2TA 2K33A 2SOBA 3C2PA 5C0XG 4X66Q 2OF1A 2G9HD 2F0TA 5C4JB 1NUCA 1JB3A 3LX0A 1A8VA 1XMQQ 2K5NA 1SJHD 3NP8A 5M5WH 3X3MA 2O2LD 3FOVA 4LWCA 4RHRA 2EYHA 1PH2A 1Q12A 4R8NA 2MP1A 2WFWA 3RLOA 2OTLA 4EQPA 2L11A 1VQKA 1QJOA 1VQFA 4NPSA 4JYAL 3F8TA 4A3KG 5GROA 2JA5B 2ZXRA 3L3OC 4FXGC 2UUAQ 3Q8DA 4J15A 1ENCA 4P74A 1T9HA 4Y7NB 3GDEA 1XYIA 3TEHB 4JI8L 1YJ9A 1ICWA 3HOXH 5H1SE 5JJLA 1Y1WG 3DXJC 4A3EH 1C4QA 1SE4A 3MAQA 1AP0A 1FGUA 2R93B 3AYHB 1JCKB 2JN4A 1WTQA 4UY8C 1IBKQ 1SYDA 2K03A 1PYSB 1GEFA 2CW0D 1D5MC 2L12A 1I5FA 1JC7A 1TS4A 1RLVA 4DV7Q 1N34L 1CZGA 2E76C 3A5UA 2XSCA 2I0QA 2EIFA 3A55A 1WD0A 2D9UA 1SMXA 2UUBQ 2NVXB 5CV8A 4CHTB 2QF7A 3PO3H 5CBEE 2F1MA 2H4OA 1TY0A 1II3A 2ZJQA 2ZJPA 4PV1C 3ND8A 4NDXA 1TWCB 4DR7L 3G4SA 1ASZA 1CHPD 2EY5A 3MXNB 1PV4A 3GTMB 3MC0B 2F0PA 2EYFA 4TVAB 1EIYB 1DOKA 4YIJA 4DK3C 2V1CC 2IT1A 1B3QA 4DR2L 4KY7A 1ZYRC 2A74C 5IGFA 5AJ3Q 1QOHA 4P2CB 2EE1A 5E3FA 4UDUC 1YNMA 1B8AA 5FLXL 1PH8A 4R1JA 1EWCA 5E1FA 4CGYB 1SFOH 2LFNA 1I50H 1RHPA 3IKJA 1N36L 1HCZA 2UUCQ 3JC66 4JCVE 2E2IH 4B3TQ 3I72A 2D5DA 5C4XB 2JA6H 4EGVA 3TSSA 4Z9CB 1WI5A 4QF4A 3A8JE 3K5OA 2D2CC 3ICEA 2D0OA 1BR9A 2F4VL 2GVAA 3S15H 1WCMB 1Y14B 4XT3B 1NMGA 1TIID 1F2ZA 4HCEA 4HIDA 1K8OA 1SR3A 2AQ2B 1NR4A 4C2MH 5C3EG 2ICEC 4HJ5A 2A68C 1R4PB 1VQNA 2RSNA 2I5LX 4IJHA 2F0MA 1A79A 2HHHL 1V1QA 2GJWA 4QIWB 3GTGB 4I7AA 2QKIC 3ER0A 1STAA 1Y8OB 5BN4A 4FF4A 2H5XA 4BY1B 4X64L 1U4RA 2JA8H 1OXTA 5JVG3 4LF7L 3T13A 5M3MH 3KDFB 1TR5A 1X6OA 3IL8A 3S14H 3J7ZC 1OXVA 1SYEA 2LSSA 1TT2A 3D6CA 4J1MA 1EFID 1HZBA 4G7HC 2Z6KA 4QL5A 1K73C 5CYUA 1EL0A 2B2TA 4DV0L 4HJ8A 2K32A 1QZGA 4ME3A 3A0JA 1WTHA 1ZXTA 2KHJA 1MJEA 3DMUA 1FJGQ 1PH7A 4DV6Q 5G3LF 5CV5A 2XIWA 2UU9L 4C3JB 4C1NI 4QBNA 2FJ2A 3GTKH 1A3VA 3H0GH 2WKDA 1WYDA 3EJIA 2K52A 4KY5A 4JI5Q 4QMGA 1NMFA 5LL6S 1XNQL 5BN5A 5HGQA 5FO7B 4XYOA 4A3DB 2FXQA 4JI3Q 1HZ9A 2WAQE 3L9AX 1B53A 1PFBA 3FVQA 4BBRB 2QILA 1D5XC 1I3QH 3E5SA 3ZJYC 1VQJA 1VQMA 4JV5Q 4L5TA 1MGSA 1DYQA 3K80C 4FP5D 2F0QA 3HKZG 3KYHC 4F8MA 3S16H 3M4OB 3V05A 2J7ZA 5IYDH 4DPGA 5K36G 4TKKA 5JJZA 4FF2A 2SEBD 4AQYL 1T0FA 3AQQA 1YI2A 2B63H 3G6EA 4ODGA 4B3RL 3FPUB 1WTVA 2YU9H 1N9WA 3A8IE 3MFGA 1KHIA 1AEXA 4DK1A 4Q0FA 1SNPA 4X3TA 4K5WA 1B1ZA 1KRSA 2WIWA 4OO1G 5EPLA 3W2DA 3FDTA 1E1OA 4A3KB 2A69D 4C3HG 4G6VA 5EPJA 3H94A 4X3UA 3PQIA 4OX9L 2OKFA 4GLXA 4CKBA 1IXRA 3J7AV 3KF6B 4QY7A 3OOCA 4TKOB 2MQHA 1HH2P 5JPNC 2QW7A 4N9TA 4LFCQ 3ULLA 3GO5A 1Y1WB 1CA5A 3HS0C 4CDFC 1HNWQ 1IYJB 2WIIB 3BZCA 3G6JB 2Q2TA 3WOFA 2I5HA 1E22A 2ICIA 4CBVA 1X54A 3UE1A 5LHY1 4GLVB 2EJFC 4LUVA 3A56A 2UUAL 1LTBD 2BA1A 2NZOA 2ZTEA 4HJAA 4DV4Q 3QG1A 1EY6A 3A8KE 3ULPA 3D8GA 1OXSC 3S2DB 4DAPA 2Z6BA 3E0JA 1L2FA 2N8NA 1VQBA 3BYTB 2ASBA 2F0FA 3GTPB 1FNUA 4GKKL 1EYDA 3K5MA 3G48A 4H44C 4B3SQ 1B50A 4V0BA 3NHHA 1IBKL 1GXDC 1YHAA 4IUNA 1GKHA 3H3VI 1K83H 4NP5A 2EQSA 2Q2UA 1G2SA 1MI2A 4YCUA 4IOAA 2UUBL 1CQVA 3VDYA 1MSGA 1VDZA 2C9OA 2PZWA 3CCQA 3IEYB 2CKZB 1X3GA 5KIXA 2VQFL 4K2KA 3TP8A 1V8QA 4RMFA 1TQOA 3QOLA 2EDGA 3CKIB 4L63B 3VA7A 1HPCA 1TWGH 3MXPA 1WVLA 1S4ZA 1Y1VH 1MHWC 4YY3Q 3A54A 2LY7A 1RD9D 1LTID 2Z9HA 3NBHB 5KNCA 3PF5A 5AJ3L 1B2TA 3KUPA 1TWHH 3VYRA 3M7NA 1E24A 1HZCA 1AN8A 1MKHA 1BQQT 2JA8G 1E1TA 1E2VA 4KD3A 4A3JG 1KDCA 3D6WA 3TZDA 2JA7G 2MO1A 2ES2A 4LF6L 3SXHA 5KNBA 4DV3L 4RH6A 2F0IA 3AFPA 5C3EB 3FPPA 4A3IH 4QB4A 2NN6G 1YNJD 2A73B 4HMIA 3CCJA 5HGTA 1SBBB 2Y0SG 1PFMA 2M2LA 3SHLA 2K28A 3J7AF 1Y88A 2LKVA 3P1HA 4KTAA 1EU4A 1DM0B 3BG3A 2EO0A 3H09A 2RVLA 1EQRA 2EYOA 1PA6A 1YBYA 1M8AA 4DU9A 4AH6A 1CKNB 3SR1A 1F9QA 1R4QB 2B2VC 3ERQA 1GUTA 1HR0Q 1HUMA 2B29A 3Q6SA 2E75C 3E9HA 4LAAA 2DUDA 5J1ZA 2RCNA 4GN3B 4QIWE 1X32A 2B2UC 1EIHA 4PZ7A 2AUJD 3KJOA 4R4CA 2B39A 2OQKA 5NUCA 2EOTA 5BR8Q 1OXXK 3DWAA 4GKJL 1V43A 5EPKA 1NNXA 1E7ZA 3A7LA 2B63G 1PFNA 2O5JC 4DR3Q 1F9RA 1JJCB 3PUZA 2VY3A 5T1GA 5IP9G 2UXBL 2F0WA 2EJMA 1LTRD 1CHQD 4ME5A 2EY2A 1B3AA 4IUUA 3SVMA 4GNXA 3PIP3 1PTOC 2JEBI 4M1UB 5M5YH 3S24A 2A6HD 2XRSD 3PIOA 1YNXA 2NVYB 2I46A 1IKLA 3HKZB 3MEFA 2LS01 2FFKB 1WTOA 3U50C 5M5XH 1B4OA 4HAEA 3PO2G 2KBNA 4ZYSA 4JI2Q 3T1HQ 3W5OA 3T51B 2F0DA 3J80i 4DV5L 4HIKA 3U4VA 4JI7Q 3HOUG 1A2TA 5GAEC 3L0OA 2B2YC 4IURA 3KJPA 2EPBA 1KIXA 3CAMA 2FMMA 4C3HB 5J39A 3VR5A 1HNZL 2F0LA 2O5IC 2E2DC 3K6OA 4DNTB 1F2LA 1L1OC 4XQQA 3I91A 4AYBG 5DNFA 4JOIC 1G91A 1GJXA 1CQFA 4A3MG 1BCPF 1YITA 1C48A 5LMNQ 2R92H 4DGZA 1VQDA 1NCVA 1Q1EA 1SLJA 2NZ1D 1P8LA 1LV9A 4ALPA 2R3ZA 4X65Q 4IPGA 5AFWA 3FHWA 1Q7YC 1KTKA 3K8AA 4FO2A 1TY2A 2K5QA 5IP7G 4DUZL 3C46A 2AWNA 1SDFA 3AU7A 1JOKA 4J8QA 1EFWA 4U68A 2NTTA 2WACA 1X56A 2KEDA 2E2IB 1X3PA 3C1FA 4JI6L 1N32L 1DZ1A 4P75A 2MO0A 1A2UA 3F2CA 4DUYL 2KA7A 1PTOB 1VCIA 2HIXA 2RQXA 2K05A 1VF7A 1Q81C 1GUSA 1Z47A 3I55A 1IBML 4XDXA 4KHPQ 2MHVA 2L5TA 3KDFA 2F0KA 4B3SL 1EWIA 3PUXA 4ZKBB 4HIMA 2SNMA 2OWOA 3CQZH 2CCZA 1F2YA 1KLGD 3IRBA 3RLNA 2NVQB 1LTAD 1H9SB 2R7ZH 1QNKA 3RN2A 3HOYG 1G8ZD 1LACA 3J81j 5CV4A 2L0CA 4LUOA 4L6TB 4JI4L 2JA8B 2NBFA 1BF4A 1P16A 4A3JB 3PUWA 3NBIA 1E2WA 3S14B 2JA7B 1GVPA 5EJWA 4F87A 3BU2A 3S1MB 1U4PA 1RDPD 2E2JH 5D65A 1S3OA 3KLSX 4HSVA 3CCSA 4UHVA 1FGBD 3TS0A 3SK4A 1TS3A 1KC8C 4LNQA 1VQPA 2Y0SB 4H02A 3UDFA 4YCVA 1BVSA 1I6HB 1VQEA 3CCVA 3NELA 3NQTA 4A3FG 1TVXA 1U9RA 4LW1A 2CH4W 1A6XA 4IUPA 2ZTDA 3QOJA 1PZKD 3I56A 5IWAL 3QR8A 3HOWH 3HFZB 5A35A 1M90C 4DK6C 4RGMA 3EVQA 3KF8A 1VQLA 3D4DA 4I65A 3S1NH 3HOZH 3ZYYX 2R61A 5ELFA 1B70B 1XMOQ 3IF0X 2LMCB 1VQ4A 1ILPA 4MN3A 1D5ZC 4R9WA 4K8JA 3BDLA 3O13A 4YWKA 1JOQA 1TS5A 4HTHA 2HUGA 2NVTB 4FXKC 3I90A 3URYA 4C3IH 4A3CG 4LF9L 2EYLA 1EOTA 4ZCKA 4BBSG 2ALYB 4EQNA 4LF8L 3E6ZX 2PCFB 4NXNL 2VW9A 3TBIB 5IY0A 3Q22A 5CMDA 4DR5Q 5GAGC 4HN7A 1EZ6A 1GUGA 3W1BA 4DV2L 4A93G 3Q23A 3DUZA 2BCOA 1O7ZA 3BJUA 3DM3A 3TQYA 5EKLA 3I4MG 3J80E 3IAYA 1FYCA 4EV1A 5IYBH 2ENBA 2X69A 4DR6Q 3P1ZB 4JI0L 3UDIA 1OO9B 4B3ML 1FL0A 2DY7A 2FKHB 1Q1BA 5E4WC 3PO2B 2PQAA 3CF5A 4O1NA 1YVCA 4MTNA 2Q8IB 1VQHA 3UDXA 2ZXOA 1VQGA 2R92G 3HOUB 1OTCA 1EY9A 1EOVA 4N8FA 1SMYD 2E5LQ 3HKZE 1IW7C 1BOSA 2QCPX 1CSPA 2M9VA 4IUTA 1STNA 1V9PA 4DR4L 4LF5L 2PZUA 3VR2A 1KXLA 3WWVA 3HEJA 4KK7A 1EEID 1S5ED 1F9SA 4AYBB 3A7AB 4B9WA 3LWEA 3AB9A 4XYQA 1SE3A 5D3DA 4XT1B 1NE3A 4A3MB 2ZYZB 4MIUA 4E6IA 4DR1Q 2WIZA 3P1YA 2XVSA 2F03A 3GTOB 5JEAG 1HTPA 1K83B 3R8BA 4MNOA 3SDZA 2OSTA 2Z4HA 3NBHA 3JAML 4LUZA 2I5MX 5E7NA 1FNVA 4YHHQ 1DD2A 3GTLB 5ISRA 4GOPA 5M3FH 1BBUA 1F77A 2PZTA 1JJ2A 1A63A 5DEHA 1HFGA 1XTCD 3ERSX 2Q2IA 3W3AA 5C44H 3I4NH 2GVBA 2X6LA 5I6WA 2BDNA 1UUPA 4APVA 1DOMA 5FKAC 1O7YA 1I4RA 1DXMA 1LTGD 1JE5A 2CVRA 4NMZA 1WTWA 1I94Q 4XXEA 3FMCA 3H3VH
chains in the Genus database with same CATH topology
2KVMA 5EBCA 5IOCA 1K8MA 1Z6HA 1KAAA 2MUYA 1SJED 4PQXA 5IODA 3QIAA 2K6AA 5JPMC 3BS1A 2RSOA 3MXGA 2D62A 3HOYB 1ZYRD 1EZ8A 1B9NA 3RLFA 2F0GA 3L7ZC 1IYVA 2EVBA 5KNDA 1HFNA 2BA0A 5IT9E 5C4HA 4R8IA 1KABA 2JYOA 3QWNA 4RFBA 1I4GA 3ONAB 3HRZC 4QUCA 4DA2A 1MD2D 1T5EA 4XTCS 4ZUJA 4RCNA 4A3FB 1E2ZA 3DEPA 2IL8A 1SNDA 2A69C 1EY4A 1HQMC 1SNOA 1SNQA 3I3CA 3NPPA 3SEBA 5CV7A 3U9OA 1PLFA 2A68D 3K59A 4LJZC 2K5WA 3N52A 4RWSC 3EA6A 1GUNA 3R93A 5J22A 4ZLTF 3HGBA 3VR3A 1ET9A 1OB9A 3HP3A 2J4XA 1S5DD 3HG9A 4BBSB 5M5XB 1TWFB 1I4QA 1Z7TA 2G9DA 4HCSA 2IX1A 1D6EC 2M00A 1S5CD 4A93B 4H0LC 1PRTC 4OO1I 1RTOA 3I4MB 1ZP7A 4DXGA 4DAYA 1WTPA 2Z8LA 2XWJB 5FK9C 3R2IA 1JE4A 4OL7A 3D31A 3GQBA 2KEEA 4WRDA 3R3OA 4GZYC 4ZQ3A 2WV6D 1NAPA 1JORA 4K6DA 4UAIA 1KDBA 2R92B 1CI3M 5ELEA 1ONLA 5JVH3 2WCZA 4XQJA 3SK6A 2L1BA 1EEFD 1SEBD 2FL3A 1DOLA 5C3WA 1TU2B 4KHVA 3V96A 2IX0A 2TSSA 4ID6A 3NXWA 2FLCA 3LWUA 1QG7A 1EQTA 4CJ1B 4DXFA 2F0NA 3M4YA 1EU3A 3N6RA 2DBSA 1ESFA 4RGTA 3GTQB 3D4WA 4LK1C 5E4XA 1QWYA 1IKMA 2VS1A 2B2TC 3MHBA 2BE5C 4KN7C 1PMRA 2YYZA 3IFDA 5CGKA 1PRTB 3BVGA 4OHJA 1H9MA 2K1BA 1QNUA 1C8CA 1HXYD 1G291 4WORA 1EYAA 2KECA 1EY7A 5CR3A 2NN6I 2X6GA 4ZUIA 1GUOA 1BCPC 1AFPA 1HH1A 2E74C 2BH2A 2ZXPA 2F0EA 1S5FD 3TP5A 1TWAB 1F9PA 3S1QB 3OPOA 4U673 5IGGA 3I73A 3OIPA 3NTKA 4G7OC 3HOZB 4DK0A 2I07B 3RD4A 3ND9A 4WFN3 3WOEA 1LT6D 1YNNC 2B8GA 5CBAE 4B08A 1RODA 3G7LA 5M5WB 2DNCA 1BUVT 2F0SA 2FKCA 4QBOA 3TN2A 1B44D 2NB0A 4ZRZA 5CORA 4K5VA 1O80A 4NW2A 1SYGA 2BDOA 3DEOA 1SSOA 5EKKA 3HOXB 3H3VC 4H7BA 1E0BA 4A3EB 2IPKD 1F1ZA 2F0VA 2JSOA 4ILWA 3CRLC 4FF1A 3BDCA 1LO5D 4KN4C 1U4MA 3MA2B 4QBLA 3MXNA 3SK8A 4EVOA 1ILQA 1VF5C 2MPMA 2JP1A 1BCPB 2XRQD 4PMWA 2Z0RA 1LT5D 2PW5A 4HR7B 2J0TD 1O7LA 3SE0A 2VXWA 1SE2A 3PO3B 1ET6A 2VB2X 1D2BA 1Y8PB 1ESRA 4BWGB 2N55A 1G2TA 2HDLA 2A6EC 2EYMA 1BBXC 3ITPA 5TSSA 2KJXA 1PTOD 2F0HA 2L9HA 5HURA 2F3WA 2F0JA 1STGA 2IWHA 1SFOB 1S5BD 1I50B 2CQAA 3T53B 4KY6A 3EROA 4OIJA 5C5LA 1QILA 2JA6B 1HA6A 5M3FB 4ULLA 1PDQA 3I70A 4F7XA 4ZKCB 4KV6A 3S15B 5F2DA 4DF7A 2INBA 2VNUD 2IJ0A 4O42A 1OB8A 1QE6A 1JWSD 5ELCA 2EXZA 1FR3A 2FINB 2WJ0A 1AW7A 1ZKOA 4C2MB 2Z1CA 1CA6A 5LL6X 4HEDA 3MFYA 1RF2D 2WB1B 1JOOA 4KMUC 4RHSA 2TMPA 5M3MB 2KHSA 1TS2A 3BVZA 1L0YB 1LTSD 4K6LA 5COYA 5C6AA 3DWPA 5IIFA 1LTTD 2AQ1B 2R6GA 1HHVA 4TQUS 3GTKB 3H0GB 1BXTA 4LMQD 1HA5A 4IZ8A 4IFDI 2XN9C 2WP8J 1H9KA 3MWYW 1STBA 3TMEA 3DM1A 2WAQB 2MGSA 2KCNA 3P7JA 1Y8NB 1H9RA 4X3KA 4QUFA 2RDGA 5M9OA 1RZNA 1SAPA 1EWHA 5ELDA 1I3QB 4FF3A 5C0XI 1SYBA 3PV0A 3S16B 5K5PA 2CW0C 4M8AA 4PNYA 2QEJC 4LQEA 1U4LA 3J81E 1SMYC 2B63B 2AUKA 2YU9B 4TSSA 2Q8RE 4C1NK 4RA8A 5D3IB 5BN3A 3V2TA 4G57A 2JXMB 2KQ3A 1J8IA 5A2QE 3P20A 2FHTA 4CJ2C 2HQEA 3TP6A 2SNSA 2DNEA 3NE5B 5K36H 4FVMA 3K57A 1WD1A 4ABNA 1EQVA 4K5XA 2ID0A 1JQYD 4ZQUA 1XXGA 4J6HA 4FNFA 3T4AC 3D4RA 4OO1H 3S9WA 2B8FA 3IEYA 1VMPA 1PZJD 2HCCA 2A5HA 1MBYA 2NYZD 1R0VA 3EFXD 2EYPA 5I9OA 1IPIA 3EQLC 2K5DA 2XWBB 1GUWA 1L0XB 3PIO3 2OXPA 5KYLA 2RKSA 2K7VA 2CV8A 1D1KA 2PO4A 3CRKC 1GHKA 2EYJA 1TWGB 2RDFA 1Y1VB 3BYYB 2O4XA 1JWMD 5JOBA 2VLDA 4OGQC 1RCVD 2KUMA 2DY8A 2PMZB 1TWHB 1BO0A 2SDFA 4Q5VA 4G6UA 3AJVB 1IW7D 2JEAI 1H9JA 3I8ZA 1HTLD 3RMHA 1EY8A 1PTOH 2V4DA 3D3RA 5G3LD 1SNMA 2AWOA 3TZUA 1V1PB 4JBWA 4A3IB 1A3UA 4DFAA 1I6VC 1Y69U 2NWGA 1TKWB 4RCOA 3DHQA 4K2LA 2N88A 1FD7D 2JE6I 2BOSA 2RBMA 4KKUA 3VA5A 4BA1I 1HQRD 1SYCA 2PQEA 5DM63 4CJ0B 4L8JA 5EQ0A 1V1OA 1B9MA 3TP7A 3T16A 3VR4A 2B2WA 1MSHA 4C3IG 1W6JA 3K5NA 2NN6H 2K04A 4ZAIA 3H6MA 1STYA 5ELBA 2IW3A 3H91A 2HDMA 3VYTA 3IFTA 4IQZA 1EY5A 5C4ZA 1M4VA 1KDAA 2VB3X 4IFDJ 4IALA 3AMUA 4I7ZC 5M5YB 3Q0AA 4RKBA 2GW6A 4JK1C 3BZDB 2W8MA 2F0UA 1RKNA 3NUCA 2CZRA 3KLSA 1CK1A 3PMFA 3OWFA 5IGCA 3OSOA 5C0XJ 3GV6A 1LT4D 1PYWD 3OWEB 4DNRB 2E2HB 2B2VA 3MTSA 4A3BB 3LNNA 1SYFA 1I4HA 3I4LA 5DM73 3Q24A 2B2UA 1I4XA 1STHA 3GD7A 3MVVA 2Z4IA 3J81L 2DN8A 3VR6A 1LABA 3KBGA 2PPBC 5D14A 5IGBA 1W6KA 1WTXA 3J80L 2CHBD 2F4IA 4KD4A 3X3NA 4KKTA 5CC4A 1SXTA 5A2QL 4RAUC 3KLRA 1BNZA 4HSPA 4FXDA 3GV3A 5I6YA 1WTRA 2EZVA 1CZWA 1UEAB 3NWTA 3OMGA 1YNJC 2RDHA 4XIGS 1PRTD 5I4DA 3K58A 1H9SA 3TDQA 5FDKA 2B2YA 3P75A 3GP7A 3NQIA 1QB5D 4BS9A 4KHZA 1A3TA 4X3SA 5JEAJ 1UWVA 4IN3A 5FO8B 4G7ZC 1XMXA 2PW7A 1KNAA 3CQZB 4PMBA 2XNAC 2JJQA 2R7ZB 3M7GA 3KBXA 3DWQA 1F2MA 1EY0A 1X3QA 2B2WC 5EKIA 2WINB 2WKCA 1NR2A 3F2UA 3MXUA 2E2JB 1KNEA 4OIKA 3FEWX 4XQNA 4C56C 3OHXC 5EBDA 5JAVA 3C3LA 2EY1A 1PRTF 1AZQA 1VMCA 4TKDA 5I2YA 4RGNA 3CHBD 5T1IA 2A6HC 2C5CA 1QCBD 3HZXA 2EJGC 3J7YW 1AZPA 3T56B 1I4PA 5DAUA 3HOWB 4MHEA 3C1EA 3S1NB 1RTNA 4K14A 1EYCA 1DJRD 1RJTA 4FYDA 4TRDA 2BE5D 2RA4A 4QCLA 3VYSA 1IHZA 4C3IB 1Q90A 4HMJA 1XX8A 3P1ZA 5KGUA 2L4NA 1PZID 5IT9L 3NK9A 4PMCA 1EIGA 1FNWA 4IFDH 1LT3D 2F3VA 3RUZA 1LLRD 3FKIB 1HRJA 3BT7A 1Y1OA 3QO2A 5C3XA 1BCPD 3SK5A 5C0XH 2GA4B 2KCCA 3OIQA 1T5XD 1ENFA 3NTHA 4S3SA 3BVMA 5IGEA 3S1RB 2MJ8A 2ZYZA 1DONA 1UAPA 1UNSA 1YNND 3PUVA 4BA2I 1OXUA 3MZ5A 2IX3A 4E6ZA 5FLXE 1IL8A 1DCZA 4H13C 1D1IA 3JAME 4DAVA 4F88A 4CKCA 3NWSA 5EGTA 3WDNA 3U9SA 3NTIA 3VYUA 1STEA 1KLUD 3QJYA 4K8IA 1BDOA 1JICA 5KEEA 1GHJA 4N9PA 4B9XA 4IUVA 3DNXA 2NUCA 4CKEA 3NSWA 2WCWA 3AJVA 1A15A 3MEHA 2OEOA 1IYUA 5C44B 2H1EA 1JR0D 3I4NB 1CM9A 1V1PA 3UI2A 3OMCA 3KK7A 3K0YA 5C5MA 3PUYA 1R11A 1CFMA 3OW7A 4EQOA 5JEAH 1Q3LA 2EY6A 3K5LA 3CU7A 1J9OA 3RZDB 5KYIA 2A6ED 1PTOF 2OT2A 5FOBB 5I2XA 1XWEA 3RZOB 1JWUD 2PYKA 1G6ZA 2F0OA 5KRUA 3GTJB 3HOVB 3FRPB 2AQ3B 1PXUA 5CV6A 2L55A 2IXSA 1ML0D 1NSNS 2QDBA 4IUQA 4KJNA 3M85A 1CT1D 2HCIA 4KJOA 4ZK9B 4RGOS 4G4KA 5IGDA 2Q8TA 2KOLA 5I9PA 1ENAA 1CTMA 4KI0A 1GOZA 4C3JG 1SNCA 3QB3A 4KKSA 3S2HB 2FCOA 1ZEQX 5FO9B 2ZT9C 3S17B 3K7AB 1O78A 2FMCA 4NKLA 2VUMB 4IFDG 4BY7B 4RKLA 5CV9A 2K01A 2PNRC 1HUNA 4V190 1Q8IA 3BDOA 2NTSA 4WJWA 4DN4M 3M3YB 4A3GB 1R9TB 3R2TA 2K33A 2SOBA 3C2PA 5C0XG 2OF1A 2G9HD 2F0TA 5C4JB 1NUCA 1JB3A 3LX0A 1SJHD 3NP8A 3X3MA 2O2LD 3FOVA 4RHRA 2EYHA 1Q12A 4R8NA 2MP1A 4EQPA 2L11A 1QJOA 2JA5B 2ZXRA 3L3OC 4FXGC 1ENCA 4Y7NB 1XYIA 1ICWA 3DXJC 1C4QA 1SE4A 3MAQA 1AP0A 2R93B 1JCKB 1WTQA 1SYDA 2K03A 1GEFA 2CW0D 1D5MC 2L12A 1TS4A 1JC7A 1RLVA 1CZGA 2E76C 2XSCA 3A55A 1WD0A 2D9UA 2NVXB 5CV8A 4CHTB 2QF7A 5CBEE 2F1MA 2H4OA 1TY0A 1II3A 4PV1C 3ND8A 4NDXA 1TWCB 1CHPD 2EY5A 3GTMB 3MC0B 2F0PA 2EYFA 1DOKA 4YIJA 2IT1A 4KY7A 1ZYRC 2A74C 5IGFA 1QOHA 4P2CB 2EE1A 5E3FA 4UDUC 1YNMA 5FLXL 1EWCA 5E1FA 4CGYB 2LFNA 1RHPA 3IKJA 1HCZA 3I72A 2D5DA 5C4XB 4EGVA 3TSSA 4Z9CB 4QF4A 3A8JE 3K5OA 2D2CC 1BR9A 1WCMB 4XT3B 1TIID 1F2ZA 4HCEA 1K8OA 2AQ2B 1NR4A 2ICEC 2A68C 1R4PB 2RSNA 2F0MA 1A79A 2GJWA 4QIWB 3GTGB 2QKIC 4FF4A 5BN4A 1STAA 1Y8OB 4BY1B 1U4RA 1OXTA 5JVG3 3T13A 1TR5A 3IL8A 1OXVA 1SYEA 1TT2A 3D6CA 4J1MA 1EFID 4G7HC 5CYUA 1EL0A 2B2TA 2K32A 1ZXTA 3DMUA 5G3LF 5CV5A 2XIWA 4C3JB 4C1NI 4QBNA 2FJ2A 1A3VA 2WKDA 3EJIA 4KY5A 4QMGA 5LL6S 5BN5A 5FO7B 4XYOA 4A3DB 3L9AX 1B53A 1PFBA 3FVQA 4BBRB 2QILA 1D5XC 3E5SA 1MGSA 1DYQA 4FP5D 4F8MA 2F0QA 3M4OB 3V05A 2J7ZA 5K36G 4TKKA 5JJZA 4FF2A 2SEBD 1T0FA 4ODGA 3FPUB 1WTVA 3A8IE 3MFGA 1AEXA 4DK1A 4Q0FA 1SNPA 4X3TA 4K5WA 1B1ZA 2WIWA 4OO1G 5EPLA 3W2DA 3FDTA 4A3KB 2A69D 4C3HG 4G6VA 5EPJA 3H94A 4X3UA 2OKFA 4CKBA 3J7AV 4TKOB 3OOCA 5JPNC 4N9TA 3GO5A 1Y1WB 1CA5A 3HS0C 3G6JB 2WIIB 3WOFA 2ICIA 4CBVA 5LHY1 2EJFC 3A56A 1LTBD 2BA1A 3QG1A 1EY6A 3A8KE 3D8GA 1OXSC 3S2DB 4DAPA 3E0JA 3BYTB 2F0FA 3GTPB 1FNUA 1EYDA 3K5MA 4H44C 1B50A 4V0BA 3NHHA 1GXDC 4IUNA 4NP5A 1G2SA 1MI2A 1CQVA 1MSGA 1VDZA 2C9OA 2PZWA 3IEYB 5KIXA 4K2KA 3TP8A 1V8QA 1TQOA 3QOLA 2EDGA 3CKIB 4L63B 3VA7A 1HPCA 3MXPA 1WVLA 1S4ZA 3A54A 2LY7A 1RD9D 1LTID 5KNCA 1B2TA 3KUPA 3VYRA 3M7NA 1AN8A 1BQQT 1E2VA 4KD3A 1KDCA 3D6WA 3TZDA 3SXHA 5KNBA 4RH6A 2F0IA 5C3EB 3FPPA 4QB4A 2NN6G 1YNJD 2A73B 4HMIA 5HGTA 1SBBB 1PFMA 2M2LA 3SHLA 2K28A 3J7AF 1Y88A 2LKVA 3P1HA 4KTAA 1EU4A 1DM0B 3BG3A 2EO0A 3H09A 2RVLA 2EYOA 1M8AA 4DU9A 3SR1A 1F9QA 1R4QB 2B2VC 3ERQA 1GUTA 1HUMA 3Q6SA 2E75C 4LAAA 5J1ZA 1X32A 2B2UC 1EIHA 2AUJD 2B39A 5NUCA 2EOTA 1OXXK 3DWAA 1V43A 5EPKA 3A7LA 1PFNA 2O5JC 1F9RA 3PUZA 5T1GA 2F0WA 2EJMA 1LTRD 1CHQD 4ME5A 2EY2A 1B3AA 4IUUA 3SVMA 3PIP3 1PTOC 2JEBI 4M1UB 2A6HD 2XRSD 2NVYB 2I46A 1IKLA 3HKZB 2LS01 2FFKB 1WTOA 1B4OA 4HAEA 4ZYSA 3T51B 2F0DA 1A2TA 2B2YC 4IURA 2EPBA 2FMMA 4C3HB 5J39A 3VR5A 2F0LA 2O5IC 2E2DC 3K6OA 4DNTB 1F2LA 4XQQA 3I91A 5DNFA 1GJXA 1G91A 1CQFA 1BCPF 1C48A 4DGZA 1NCVA 1Q1EA 2NZ1D 1LV9A 2R3ZA 5AFWA 1KTKA 4FO2A 1TY2A 2K5QA 3C46A 2AWNA 1SDFA 3AU7A 1JOKA 4J8QA 4U68A 2NTTA 2WACA 2KEDA 2E2IB 1X3PA 3C1FA 1DZ1A 1A2UA 2KA7A 1PTOB 1VCIA 2RQXA 2K05A 1VF7A 1GUSA 1Z47A 4XDXA 2MHVA 2L5TA 2F0KA 3PUXA 4ZKBB 2SNMA 1F2YA 1KLGD 2NVQB 1LTAD 1H9SB 1QNKA 1G8ZD 1LACA 5CV4A 2L0CA 4L6TB 2JA8B 2NBFA 1BF4A 4A3JB 3PUWA 3NBIA 1E2WA 3S14B 2JA7B 5EJWA 4F87A 3S1MB 1U4PA 1RDPD 5D65A 4HSVA 3KLSX 1FGBD 3SK4A 1TS3A 2Y0SB 1I6HB 3NQTA 1TVXA 1U9RA 1A6XA 4IUPA 3QOJA 1PZKD 5A35A 4RGMA 3EVQA 3KF8A 3D4DA 4I65A 3ZYYX 2R61A 5ELFA 3IF0X 2LMCB 1ILPA 4MN3A 1D5ZC 4R9WA 4K8JA 3BDLA 3O13A 1JOQA 1TS5A 4HTHA 2HUGA 2NVTB 4FXKC 3I90A 3URYA 2EYLA 1EOTA 4EQNA 3E6ZX 2PCFB 3TBIB 3Q22A 5CMDA 4HN7A 1EZ6A 1GUGA 3Q23A 3DUZA 2BCOA 1O7ZA 5EKLA 3J80E 3IAYA 1FYCA 4EV1A 2ENBA 2X69A 3P1ZB 1OO9B 2DY7A 2FKHB 1Q1BA 5E4WC 3PO2B 4O1NA 2Q8IB 2ZXOA 3HOUB 1EY9A 1SMYD 1IW7C 1BOSA 2QCPX 2M9VA 4IUTA 1STNA 2PZUA 3VR2A 3HEJA 4KK7A 1EEID 1S5ED 1F9SA 4AYBB 3A7AB 4B9WA 3LWEA 3AB9A 4XYQA 1SE3A 5D3DA 4XT1B 4A3MB 2ZYZB 4MIUA 4E6IA 2WIZA 3P1YA 2XVSA 2F03A 3GTOB 5JEAG 1HTPA 1K83B 3R8BA 3SDZA 2OSTA 2Z4HA 3NBHA 3JAML 1FNVA 1DD2A 3GTLB 5ISRA 1F77A 2PZTA 5DEHA 1HFGA 1XTCD 3W3AA 2X6LA 5I6WA 2BDNA 1UUPA 1DOMA 5FKAC 1O7YA 1I4RA 1DXMA 1LTGD 2CVRA 4NMZA 1WTWA 4XXEA 3FMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DAP A;  4DAV A;  4DA2 A; 
#chains in the Genus database with same CATH topology
 2KVM A;  2MFI A;  5EBC A;  5IOC A;  1NBW A;  1TXY A;  1K8M A;  1Z6H A;  1GO3 E;  1KAA A;  2MUY A;  1CKN A;  1SJE D;  4PQX A;  5IOD A;  3RZD H;  3QIA A;  3ULJ A;  2K6A A;  1XTD A;  5JPM C;  2N49 A;  3BS1 A;  4A3L G;  2RSO A;  4R4O A;  3MXG A;  1EQQ A;  2D62 A;  3HOY B;  1ZYR D;  2K75 A;  1EZ8 A;  1B9N A;  3RLF A;  4LFA Q;  1LTL A;  3GTJ H;  2F0G A;  3L7Z C;  1PVO A;  4KHP L;  1IYV A;  2EVB A;  5KND A;  1HFN A;  2BA0 A;  4JC0 A;  5IT9 E;  5C4H A;  1HNX Q;  4R8I A;  2HD3 A;  4P71 A;  1KAB A;  2JYO A;  3QWN A;  4RFB A;  3HOZ G;  1I4G A;  3ONA B;  3HRZ C;  3RN5 A;  1MIU A;  5GAH C;  4UP8 A;  1QUQ B;  4QUC A;  4DA2 A;  3NEM A;  1MD2 D;  1T5E A;  4XTC S;  4ZUJ A;  4RCN A;  4A3F B;  3S2H H;  1E2Z A;  3DEP A;  4X62 L;  2IL8 A;  1SND A;  2A69 C;  1EY4 A;  1HQM C;  1SNO A;  3S17 H;  1SNQ A;  3K7A H;  3I3C A;  3NPP A;  3SEB A;  2VUM H;  5CV7 A;  4YWL A;  3U9O A;  1PLF A;  2A68 D;  3K7U C;  3K59 A;  4BY7 H;  2Y0S E;  2ZM6 L;  3M4P A;  4LJZ C;  2K5W A;  3N52 A;  4RWS C;  3EA6 A;  1GUN A;  3R93 A;  5J22 A;  4ZLT F;  3HGB A;  3VR3 A;  3A5Z B;  1ET9 A;  1PHJ A;  1OB9 A;  3HP3 A;  3HOX G;  3M3Y H;  4A3G H;  2J4X A;  4A3E G;  1S5D D;  1VQ6 A;  1R9T H;  2K5V A;  3HG9 A;  4BBS B;  4LFB L;  5M5X B;  1TWF B;  4YCW A;  5C4J H;  1I4Q A;  1Z7T A;  2G9D A;  4HCS A;  2IX1 A;  1XMO L;  1D6E C;  1MJC A;  2M00 A;  1S5C D;  4A93 B;  3UE0 A;  4H0L C;  1PRT C;  4X66 L;  4OO1 I;  2UXD Q;  1RTO A;  3I4M B;  1ZP7 A;  4DXG A;  4DAY A;  1WTP A;  1XMQ L;  2Z8L A;  1K3R A;  4UP7 A;  2XWJ B;  5FLM H;  1GD7 A;  2JA5 H;  5FK9 C;  3R2I A;  3PO3 G;  1JE4 A;  4OL7 A;  3D31 A;  1Q82 C;  4Y7N H;  4NXM Q;  1BBW A;  3GQB A;  1QVC A;  2KEE A;  4DR5 L;  4WRD A;  3R3O A;  4GOP C;  1XNR Q;  4ZQ3 A;  4GZY C;  2WV6 D;  1NAP A;  1JOR A;  1JT8 A;  4K6D A;  4UAI A;  1KDB A;  2R92 B;  1CI3 M;  2K4K A;  5ELE A;  1ONL A;  2R93 H;  5JVH 3;  3PF4 A;  2WCZ A;  4PZ6 A;  5IYC H;  3J81 c;  1PH4 A;  4XQJ A;  3SK6 A;  2F52 A;  2KEN A;  2L1B A;  1EEF D;  1SEB D;  2FL3 A;  5ELO A;  2JA6 G;  5M3F G;  1DOL A;  5C3W A;  1TU2 B;  2NVX H;  4KHV A;  3V96 A;  3J80 c;  4DV1 Q;  2IX0 A;  2TSS A;  2GN5 A;  4DV7 L;  4ID6 A;  1IZ6 A;  3NXW A;  2FLC A;  3LWU A;  1TWC H;  1QG7 A;  5GAD C;  2OTJ A;  1EQT A;  3GTM H;  4KLK A;  4CJ1 B;  4DXF A;  3LGJ A;  3AEV A;  2F0N A;  3M4Y A;  1EU3 A;  3N6R A;  2DBS A;  1VQ8 A;  2K14 A;  1ESF A;  4RGT A;  3GTQ B;  1VQC A;  3D4W A;  4LK1 C;  5E4X A;  1QWY A;  2Z6K C;  1IKM A;  1X9N A;  2VS1 A;  2B2T C;  3MHB A;  2AMC B;  2BE5 C;  2WB1 G;  3W1G A;  4KN7 C;  1PMR A;  1FVI A;  2YYZ A;  3IFD A;  5CGK A;  3OTO Q;  5C4X H;  1PRT B;  3F1Z A;  3BVG A;  5M3M G;  3CC7 A;  4OHJ A;  1H9M A;  2K1B A;  1EYG A;  2UUC L;  1QNU A;  2RF4 A;  1C8C A;  3K0X A;  1PFS A;  4B3T L;  5JJK A;  1HXY D;  1WCM H;  2A19 A;  1N33 Q;  1G29 1;  1HZA A;  4WOR A;  4OEL B;  1EYA A;  2KEC A;  1EY7 A;  5CR3 A;  2NN6 I;  2JA9 A;  2X6G A;  4PG3 A;  1EUJ A;  4ZUI A;  3H0G G;  2DGY A;  1GUO A;  1BCP C;  1AFP A;  4LF4 Q;  2UXC Q;  1HH1 A;  2E74 C;  3CCR A;  2WAQ G;  5LMU Q;  2BH2 A;  2ZXP A;  2F0E A;  1X3F A;  4OWT B;  3GTG H;  1W3S A;  4P73 A;  1O7I A;  1S5F D;  3TP5 A;  4RG1 A;  1TWA B;  4BY1 H;  1DGS A;  1F9P A;  3S1Q B;  3OPO A;  4U67 3;  5IGG A;  3I73 A;  2EXD A;  3CXC A;  1PH5 A;  3OIP A;  3NTK A;  4IPC A;  3HOZ B;  4G7O C;  4DK0 A;  2I07 B;  4CDC C;  3RD4 A;  3ND9 A;  4WFN 3;  1KQS A;  3WOE A;  1LT6 D;  5FJ8 H;  1YNN C;  5IYD G;  4R4T A;  2B8G A;  5CBA E;  4B08 A;  4C3J H;  2KCM A;  1ROD A;  4JYA Q;  3G7L A;  2IY5 B;  5M5W B;  2DNC A;  1BUV T;  2F0S A;  1HNX L;  2FKC A;  3CW2 C;  4QBO A;  1ICF B;  3TN2 A;  1FJG L;  1B44 D;  4DV6 L;  1JJG A;  2NB0 A;  4JI8 Q;  4ZRZ A;  5COR A;  1J6Q A;  4K5V A;  1O80 A;  3STB C;  3U58 A;  2D0P A;  5EAY A;  4NW2 A;  4A3D H;  1SYG A;  3J81 i;  2BDO A;  4JI5 L;  3DEO A;  4BBR H;  1SSO A;  5IT9 c;  5EKK A;  3HOX B;  4BXX H;  3H3V C;  3CP0 A;  4H7B A;  1QVG A;  1E0B A;  4A3E B;  2IPK D;  1F1Z A;  2F0V A;  2QDL A;  1A0I A;  2JSO A;  3M4O H;  4JI3 L;  1LYL A;  4ILW A;  2E2H H;  3CRL C;  4FF1 A;  3BDC A;  4A3B H;  1J5E Q;  1LO5 D;  3FP9 A;  4JV5 L;  1XPO A;  2ATW A;  4KN4 C;  1U4M A;  3MA2 B;  4QBL A;  3MXN A;  3SK8 A;  1Q86 C;  4EVO A;  1ILQ A;  1VF5 C;  2MPM A;  3B6Y A;  1UE5 A;  2JP1 A;  1VQ7 A;  1BCP B;  2KCT A;  2XRQ D;  4PMW A;  3CME A;  2Z0R A;  2YTY A;  1LT5 D;  2PW5 A;  4HR7 B;  2J0T D;  1O7L A;  3SE0 A;  3E0E A;  2VXW A;  1SE2 A;  3PO3 B;  1ET6 A;  1C9O A;  2VB2 X;  1D2B A;  1Y8P B;  1ESR A;  4BWG B;  4DR2 Q;  1K8G A;  2N55 A;  1G2T A;  2HDL A;  2A6E C;  4JI1 Q;  2EYM A;  1BBX C;  1YEZ A;  3M4Q A;  3ITP A;  5TSS A;  1Y1W H;  2KJX A;  1PTO D;  2F0H A;  2L9H A;  2F3W A;  2F0J A;  5HUR A;  4LFC L;  1STG A;  2IWH A;  1SFO B;  3AFQ A;  1S5B D;  1I50 B;  2CQA A;  1HNW L;  3T53 B;  4KY6 A;  3ERO A;  4OIJ A;  5C5L A;  2F4V Q;  1QIL A;  3PGZ A;  2JA6 B;  1HA6 A;  4PZ8 A;  4MTK A;  3S2D H;  5M3F B;  1Y1V G;  3I2Z A;  4ULL A;  1PDQ A;  3I70 A;  1WFQ A;  3GTP H;  4DV4 L;  4F7X A;  4ZKC B;  4KV6 A;  4IPH A;  3S15 B;  5F2D A;  4DF7 A;  2INB A;  2VNU D;  2IJ0 A;  4JVZ A;  4O42 A;  1OB8 A;  1QE6 A;  1JWS D;  5ELC A;  2EXZ A;  1FR3 A;  2FIN B;  2WJ0 A;  1AW7 A;  1ZKO A;  1AE3 A;  4C2M B;  2Z1C A;  4A3I G;  4OXP A;  1CA6 A;  4X64 Q;  2VQE Q;  5LL6 X;  4LF7 Q;  1VQI A;  2AKW B;  4HED A;  4A75 A;  4HJ7 A;  3MFY A;  4L5R C;  1RF2 D;  2WB1 B;  1JOO A;  4KMU C;  2PNH A;  4K0K Q;  1AH9 A;  4RHS A;  2TMP A;  1Q46 A;  4DV0 Q;  5M3M B;  2KHS A;  1TS2 A;  5JJI A;  1L1O B;  2CWP A;  4UPA A;  3BVZ A;  2UU9 Q;  1L0Y B;  1LTS D;  4K6L A;  5COY A;  5C6A A;  3DWP A;  4FDB A;  5IIF A;  4YY3 L;  3DLL A;  1LTT D;  3KFU A;  1G51 A;  2AQ1 B;  2R6G A;  1HHV A;  1WOC A;  2QGQ A;  4TQU S;  4GNX C;  1SRO A;  1XNQ Q;  3GTK B;  5C3E H;  3H0G B;  1BXT A;  4WJ3 M;  4LMQ D;  1HA5 A;  4IZ8 A;  4IFD I;  2XN9 C;  2WP8 J;  3MWY W;  1H9K A;  1STB A;  3TME A;  3DM1 A;  2WAQ B;  2MGS A;  2KCN A;  3P7J A;  1Y8N B;  2A1A A;  1H9R A;  4X3K A;  4QUF A;  2CWA A;  2RDG A;  2MNA A;  5M9O A;  4WJ4 A;  1RZN A;  4AQY Q;  1SAP A;  3CPF A;  1EWH A;  5ELD A;  1I3Q B;  3G71 A;  4FF3 A;  1W2B A;  5C0X I;  1SYB A;  3PV0 A;  1KD1 C;  2A8V A;  4LF4 L;  5K5P A;  3S16 B;  2UXC L;  2CW0 C;  4M8A A;  4PNY A;  2QEJ C;  4DKA C;  4LQE A;  1U4L A;  3J81 E;  3F2B A;  1SMY C;  2B63 B;  2AUK A;  1X3E A;  3KF6 A;  1HR0 L;  2YU9 B;  4TSS A;  2Q8R E;  4C1N K;  1HR0 W;  4RA8 A;  5D3I B;  4OX9 Q;  1WJJ A;  5BN3 A;  3V2T A;  4A3B G;  3FKI H;  4G57 A;  1PH9 A;  2JXM B;  3PSI A;  2NZH A;  2B3G A;  2KQ3 A;  1J8I A;  5BR8 L;  1XPR A;  5A2Q E;  3P20 A;  4DR3 L;  2FHT A;  4CJ2 C;  2HQE A;  3TP6 A;  2NVY H;  4QGU A;  3S1R H;  3HKS A;  4GN4 B;  2SNS A;  2XTI A;  2DNE A;  3NE5 B;  5K36 H;  4FVM A;  4YWM A;  3K57 A;  1WD1 A;  4ABN A;  1EQV A;  4K5X A;  4GNX B;  2ID0 A;  4IPD A;  3U4Z A;  1JQY D;  4ZQU A;  4GKK Q;  1C0A A;  1XXG A;  2HQL A;  4J6H A;  4FNF A;  3T4A C;  3D4R A;  4OO1 H;  4JI2 L;  3T1H L;  3S9W A;  2B8F A;  3IEY A;  4C3H H;  1VMP A;  1PZJ D;  4JI7 L;  2HCC A;  2A5H A;  1MBY A;  1JB7 A;  2NYZ D;  1UEB A;  5J3B A;  1J5E L;  4DAM A;  3M9B A;  3I4O A;  1R0V A;  3EFX D;  2F3I A;  1PYB A;  2EYP A;  3EIV A;  5I9O A;  2VZA A;  1IPI A;  3EQL C;  2K5D A;  2XWB B;  1GUW A;  2VQF Q;  1L0X B;  2Z0S A;  3PIO 3;  1PH1 A;  2OXP A;  1SE8 A;  2OCE A;  5KYL A;  4O2D A;  3TRE A;  2RKS A;  2K7V A;  2Q2H A;  2CV8 A;  1D1K A;  2LXK A;  2PO4 A;  3CRK C;  3F2D A;  4CDD C;  5LMN L;  1GHK A;  2EYJ A;  4JI1 L;  5LMN W;  1TWG B;  2RDF A;  3PCO B;  1Y1V B;  3BYY B;  2CFM A;  2O4X A;  2R7Z G;  1JWM D;  4LF6 Q;  5JOB A;  1RIP A;  1A62 A;  4X65 L;  2VLD A;  4OGQ C;  1RCV D;  2PMZ B;  1Z9F A;  2DY8 A;  2KUM A;  4DV3 Q;  1TWH B;  1BO0 A;  2SDF A;  4Q5V A;  4G6U A;  3AJV B;  1IW7 D;  2JEA I;  1H9J A;  3I8Z A;  3CCU A;  1HTL D;  3RMH A;  2C35 B;  1EY8 A;  1PTO H;  2V4D A;  3D3R A;  5G3L D;  5FLX c;  1SNM A;  2AWO A;  2R7F A;  3TZU A;  3JAM c;  1V1P B;  4JBW A;  4A3I B;  1A3U A;  4DFA A;  3RZO H;  1CSQ A;  1AE2 A;  5DLQ E;  1I6V C;  1Y69 U;  3CCE A;  2NWG A;  1TKW B;  3HOV H;  3PIP A;  4RCO A;  4OEM B;  3D0F A;  3DHQ A;  4K2L A;  2N88 A;  2NVQ H;  1FD7 D;  2JE6 I;  2BOS A;  2RBM A;  2RHQ B;  4KKU A;  3HOW G;  1SRU A;  3VA5 A;  4BA1 I;  1HQR D;  2VQE L;  1SYC A;  1S40 A;  2PQE A;  4A3J H;  2WB1 E;  4GKJ Q;  5DM6 3;  2JA7 H;  4CJ0 B;  4L8J A;  4P72 A;  5EQ0 A;  1V1O A;  1B9M A;  3RR5 A;  3TP7 A;  3BZK A;  3S1M H;  3T16 A;  3VR4 A;  4K0K L;  2B2W A;  1MSH A;  4C3I G;  1W6J A;  3K5N A;  2UXB Q;  1D7Q A;  4HJ9 A;  2NN6 H;  2XGT A;  2K04 A;  2RCF A;  2OQ0 A;  4ZAI A;  1I6H H;  3H6M A;  1NY4 A;  1K9M C;  1STY A;  5ELB A;  2IW3 A;  3H91 A;  2DJF C;  4R4Q A;  2HDM A;  3VYT A;  4CDE C;  3IFT A;  4IQZ A;  3RNU A;  1EY5 A;  5C4Z A;  1M4V A;  1KDA A;  2VB3 X;  4IFD J;  3FKI G;  4IAL A;  5IYB G;  3AMU A;  4I7Z C;  5M5Y B;  2PI2 E;  3Q0A A;  4RKB A;  1YIJ A;  2GW6 A;  4JK1 C;  1SN8 A;  3E3X A;  3BZD B;  4DV5 Q;  2W8M A;  2F0U A;  1RKN A;  3NUC A;  2CZR A;  3KLS A;  2CQO A;  1CK1 A;  3PMF A;  3OWF A;  5IGC A;  2NVT H;  3OSO A;  1RL2 A;  4UP9 A;  5C0X J;  4EX5 A;  2HIV A;  3GV6 A;  1LT4 D;  1HNZ Q;  1LUZ A;  1PYW D;  3OWE B;  4DNR B;  2E2H B;  2B2V A;  3MTS A;  3KF8 B;  4A3B B;  2BH8 A;  4N8X 1;  3LNN A;  4JW0 A;  1SYF A;  5IP9 H;  4JPB W;  1I4H A;  1C7Y A;  3I4L A;  5DM7 3;  3Q24 A;  2B2U A;  1I4X A;  1STH A;  4POG A;  3GD7 A;  3MVV A;  2Z4I A;  3J81 L;  2DN8 A;  3VR6 A;  1LAB A;  3KBG A;  2PPB C;  4Y52 H;  5D14 A;  5IGB A;  1K0R A;  3E9I A;  1W6K A;  1LM0 A;  1K3B C;  4A4I A;  4X6A H;  3T1Y Q;  2QA4 A;  1WTX A;  3PO2 H;  3J80 L;  4AIM A;  4DUZ Q;  4DR6 L;  2CHB D;  2F4I A;  4KD4 A;  3X3N A;  4KKT A;  5CC4 A;  5IE8 A;  1SXT A;  5A2Q L;  3HOU H;  2IHF A;  4RAU C;  2KHI A;  3KLR A;  4JI6 Q;  1BNZ A;  1N32 Q;  4HSP A;  3JAM i;  4DUY Q;  4FXD A;  3CMA A;  3GV3 A;  3TRZ A;  3CPW A;  5I6Y A;  1WTR A;  2EZV A;  5C44 G;  4POF A;  2E5L L;  2PQA B;  1IBM Q;  3I4N G;  1CZW A;  1UEA B;  3NWT A;  2LXJ A;  4L5S A;  3OMG A;  4DNI A;  1YNJ C;  2IHE A;  2RDH A;  1PRT D;  4XIG S;  5I4D A;  4A3M H;  3K58 A;  1H9S A;  3TDQ A;  5FDK A;  1U0L A;  2B2Y A;  3P75 A;  1Q8K A;  3GP7 A;  3NQI A;  4AYB E;  3GTO H;  4JBJ A;  1QB5 D;  4BS9 A;  4KHZ A;  1A3T A;  4X3S A;  4DR1 L;  2N3S A;  1UWV A;  5JEA J;  4JBK A;  1L1O A;  4IN3 A;  2R7D A;  5FO8 B;  4G7Z C;  1XMX A;  2PW7 A;  1KRT A;  1KNA A;  4JOI A;  4JI4 Q;  3CQZ B;  5IP7 H;  3GTL H;  4PMB A;  1EIF A;  2XNA C;  2JJQ A;  2R7Z B;  1UE7 A;  3M7G A;  1GM5 A;  3KBX A;  3HOV G;  1PH6 A;  3DWQ A;  1F2M A;  1B7Y B;  4YHH L;  1EY0 A;  1X3Q A;  2B2W C;  5EKI A;  2WIN B;  1YJW A;  1CUK A;  2WKC A;  3EN2 A;  2PI2 A;  1NR2 A;  3F2U A;  3MXU A;  2E2J B;  1KNE A;  4OIK A;  3FEW X;  4XQN A;  4GOP B;  4C56 C;  3OHX C;  5EBD A;  3UDG A;  1IBL Q;  3I7F A;  5JAV A;  3C3L A;  1QZH A;  2PMZ E;  2EY1 A;  4O0A A;  3OYY A;  1PRT F;  5IWA Q;  1I94 L;  4GLA C;  4QJF A;  2YV5 A;  1VS0 A;  1VMC A;  1KAW A;  1AZQ A;  4TKD A;  4RGN A;  5I2Y A;  3CHB D;  5T1I A;  2A6H C;  2C5C A;  1QCB D;  3HZX A;  2EJG C;  3J7Y W;  3OW2 A;  4GN5 A;  1AZP A;  3T56 B;  1I4P A;  2VUM G;  3HOY H;  5DAU A;  3HOW B;  4MHE A;  3C1E A;  4QQB X;  3S1N B;  4BY7 G;  1RTN A;  4K14 A;  1EYC A;  1XJV A;  1DJR D;  1RJT A;  4FYD A;  4LF9 Q;  4TRD A;  2BE5 D;  3KOJ A;  2RA4 A;  3TS2 A;  4QCL A;  4LF8 Q;  4NXN Q;  3NEN A;  4LFA L;  3VYS A;  5ELN A;  2K5H A;  4A3G G;  1IHZ A;  4C3I B;  1K0S A;  1Q90 A;  4HMJ A;  4DV2 Q;  1XX8 A;  3P1Z A;  3A74 A;  5KGU A;  2L4N A;  1PZI D;  5IT9 L;  4JG2 A;  4A76 A;  3NK9 A;  4PMC A;  4A3F H;  1EIG A;  1FNW A;  2YTX A;  3L2P A;  4IFD H;  2DJG C;  4JI0 Q;  1LT3 D;  1K28 A;  2F3V A;  4B3M Q;  3RUZ A;  1LLR D;  3FKI B;  1HRJ A;  3BT7 A;  2N78 A;  4IO9 A;  1YHB A;  2ZJR A;  1Y1O A;  3CD6 A;  3QO2 A;  5C3X A;  1BCP D;  5FLM G;  2JA5 G;  1X55 A;  2AHO B;  3SK5 A;  5C0X H;  1N34 Q;  2GA4 B;  2KCC A;  3OIQ A;  1T5X D;  1ENF A;  4L5Q A;  3NTH A;  4S3S A;  3BVM A;  5IGE A;  3K81 C;  3S1R B;  2JQO A;  2MJ8 A;  1UE6 A;  4A3C H;  1K8A C;  1U5K A;  4BBS H;  4DR4 Q;  1G6P A;  2ZYZ A;  4LF5 Q;  1TWF H;  3CC4 A;  2R93 G;  1DON A;  4DR7 Q;  1UAP A;  1QVF A;  1UNS A;  1S72 A;  4R4I A;  1XPU A;  5IYC G;  4A93 H;  1KL9 A;  1YNN D;  4A3K H;  3PUV A;  4BA2 I;  1OXU A;  3MZ5 A;  2HT1 A;  3I4M H;  3KLW A;  2IX3 A;  4E6Z A;  4EQ5 A;  5FLX E;  1BKB A;  1ASY A;  1IL8 A;  3SGI A;  1DCZ A;  4H13 C;  1D1I A;  3JAM E;  4DAV A;  2UXD L;  4F88 A;  4CKC A;  1N36 Q;  3NWS A;  5EGT A;  3WDN A;  4IOC A;  3STB D;  3U9S A;  3NTI A;  3VYU A;  1STE A;  2CH4 A;  1YHQ A;  3CCM A;  1KLU D;  1NJI C;  3QJY A;  1IL2 A;  1M1K C;  4K8I A;  1BDO A;  1JIC A;  5KEE A;  4DAY B;  1GHJ A;  4NXM L;  4N9P A;  4B9X A;  1X65 A;  4IUV A;  3DNX A;  3NSW A;  2NUC A;  4CKE A;  2WCW A;  3AJV A;  1A15 A;  2RHS B;  3MEH A;  2K50 A;  1CKO A;  1XNR L;  1L0W A;  3CC2 A;  3EBE A;  3T1Y L;  4JBM A;  2OEO A;  1IYU A;  4OWX B;  4OON A;  2L15 A;  5C44 B;  5C4X G;  2H1E A;  1JR0 D;  3I4N B;  1CM9 A;  1V1P A;  1VQ9 A;  3UI2 A;  3OMC A;  3KK7 A;  3K0Y A;  5C5M A;  3PUY A;  1R11 A;  1CFM A;  2HHH Q;  1HJP A;  3OW7 A;  4EQO A;  1YZ6 A;  1WCM G;  5JEA H;  1Q3L A;  2EY6 A;  1N8R C;  2E8G A;  4DV1 L;  3K5L A;  3CU7 A;  5GQO A;  1H95 A;  1J9O A;  5L37 A;  3RZD B;  5KYI A;  2A6E D;  1PTO F;  2OT2 A;  5FOB B;  5I2X A;  3GTQ H;  1XWE A;  4GS3 A;  3RZO B;  1JMC A;  1JWU D;  2PYK A;  4IJL A;  1G6Z A;  1QUQ A;  4NB3 A;  2F0O A;  5KRU A;  3GTJ B;  3HOV B;  3FRP B;  2AQ3 B;  1PXU A;  5CV6 A;  4HIO A;  3J7A 5;  2L55 A;  4BY1 G;  2IXS A;  4OWW B;  2YTV A;  1NTG A;  3H15 A;  1ML0 D;  1VQ5 A;  1NSN S;  2QDB A;  4IUQ A;  4KJN A;  3M85 A;  5HY6 A;  1CT1 D;  2HCI A;  3OTO L;  4KJO A;  4ZK9 B;  2G5D A;  1VQO A;  4X62 Q;  4RGO S;  2VL6 A;  4G4K A;  5IGD A;  2Q8T A;  2KOL A;  5FJ8 G;  1PH3 A;  5I9P A;  3CCL A;  1ENA A;  2QEX A;  1CTM A;  4KI0 A;  1UE1 A;  1GOZ A;  4C3J G;  4MZ9 A;  1SNC A;  3QB3 A;  4KKS A;  3S2H B;  2P5Z X;  2FCO A;  1ZEQ X;  2ZM6 Q;  1D8L A;  5FO9 B;  1N33 L;  1CKM A;  2ZT9 C;  3S17 B;  2ZTC A;  3K7A B;  4A3L H;  1O78 A;  2FMC A;  4NKL A;  2VUM B;  4IFD G;  2JK8 A;  4BY7 B;  1E3P A;  1IBL L;  4RKL A;  1TWA H;  4B3R Q;  1YJN A;  4A3D G;  5CV9 A;  3S1Q H;  1VQA A;  2K01 A;  4LFB Q;  2PNR C;  4BBR G;  1HUN A;  5LMU L;  4V19 0;  1Q8I A;  3BDO A;  2NTS A;  4WJW A;  4DN4 M;  3M3Y B;  4BXX G;  4A3G B;  1R9T B;  3R2T A;  2K33 A;  2SOB A;  3C2P A;  5C0X G;  4X66 Q;  2OF1 A;  2G9H D;  2F0T A;  5C4J B;  1NUC A;  1JB3 A;  3LX0 A;  1A8V A;  1XMQ Q;  2K5N A;  1SJH D;  3NP8 A;  5M5W H;  3X3M A;  2O2L D;  3FOV A;  4LWC A;  4RHR A;  2EYH A;  1PH2 A;  1Q12 A;  4R8N A;  2MP1 A;  2WFW A;  3RLO A;  2OTL A;  4EQP A;  2L11 A;  1VQK A;  1QJO A;  1VQF A;  4NPS A;  4JYA L;  3F8T A;  4A3K G;  5GRO A;  2JA5 B;  2ZXR A;  3L3O C;  4FXG C;  2UUA Q;  3Q8D A;  4J15 A;  1ENC A;  4P74 A;  1T9H A;  4Y7N B;  3GDE A;  1XYI A;  3TEH B;  4JI8 L;  1YJ9 A;  1ICW A;  3HOX H;  5H1S E;  5JJL A;  1Y1W G;  3DXJ C;  4A3E H;  1C4Q A;  1SE4 A;  3MAQ A;  1AP0 A;  1FGU A;  2R93 B;  3AYH B;  1JCK B;  2JN4 A;  1WTQ A;  4UY8 C;  1IBK Q;  1SYD A;  2K03 A;  1PYS B;  1GEF A;  2CW0 D;  1D5M C;  2L12 A;  1I5F A;  1JC7 A;  1TS4 A;  1RLV A;  4DV7 Q;  1N34 L;  1CZG A;  2E76 C;  3A5U A;  2XSC A;  2I0Q A;  2EIF A;  3A55 A;  1WD0 A;  2D9U A;  1SMX A;  2UUB Q;  2NVX B;  5CV8 A;  4CHT B;  2QF7 A;  3PO3 H;  5CBE E;  2F1M A;  2H4O A;  1TY0 A;  1II3 A;  2ZJQ A;  2ZJP A;  4PV1 C;  3ND8 A;  4NDX A;  1TWC B;  4DR7 L;  3G4S A;  1ASZ A;  1CHP D;  2EY5 A;  3MXN B;  1PV4 A;  3GTM B;  3MC0 B;  2F0P A;  2EYF A;  4TVA B;  1EIY B;  1DOK A;  4YIJ A;  4DK3 C;  2V1C C;  2IT1 A;  1B3Q A;  4DR2 L;  4KY7 A;  1ZYR C;  2A74 C;  5IGF A;  5AJ3 Q;  1QOH A;  4P2C B;  2EE1 A;  5E3F A;  4UDU C;  1YNM A;  1B8A A;  5FLX L;  1PH8 A;  4R1J A;  1EWC A;  5E1F A;  4CGY B;  1SFO H;  2LFN A;  1I50 H;  1RHP A;  3IKJ A;  1N36 L;  1HCZ A;  2UUC Q;  3JC6 6;  4JCV E;  2E2I H;  4B3T Q;  3I72 A;  2D5D A;  5C4X B;  2JA6 H;  4EGV A;  3TSS A;  4Z9C B;  1WI5 A;  4QF4 A;  3A8J E;  3K5O A;  2D2C C;  3ICE A;  2D0O A;  1BR9 A;  2F4V L;  2GVA A;  3S15 H;  1WCM B;  1Y14 B;  4XT3 B;  1NMG A;  1TII D;  1F2Z A;  4HCE A;  4HID A;  1K8O A;  1SR3 A;  2AQ2 B;  1NR4 A;  4C2M H;  5C3E G;  2ICE C;  4HJ5 A;  2A68 C;  1R4P B;  1VQN A;  2RSN A;  2I5L X;  4IJH A;  2F0M A;  1A79 A;  2HHH L;  1V1Q A;  2GJW A;  4QIW B;  3GTG B;  4I7A A;  2QKI C;  3ER0 A;  1STA A;  1Y8O B;  5BN4 A;  4FF4 A;  2H5X A;  4BY1 B;  4X64 L;  1U4R A;  2JA8 H;  1OXT A;  5JVG 3;  4LF7 L;  3T13 A;  5M3M H;  3KDF B;  1TR5 A;  1X6O A;  3IL8 A;  3S14 H;  3J7Z C;  1OXV A;  1SYE A;  2LSS A;  1TT2 A;  3D6C A;  4J1M A;  1EFI D;  1HZB A;  4G7H C;  2Z6K A;  4QL5 A;  1K73 C;  5CYU A;  1EL0 A;  2B2T A;  4DV0 L;  4HJ8 A;  2K32 A;  1QZG A;  4ME3 A;  3A0J A;  1WTH A;  1ZXT A;  2KHJ A;  1MJE A;  3DMU A;  1FJG Q;  1PH7 A;  4DV6 Q;  5G3L F;  5CV5 A;  2XIW A;  2UU9 L;  4C3J B;  4C1N I;  4QBN A;  2FJ2 A;  3GTK H;  1A3V A;  3H0G H;  2WKD A;  1WYD A;  3EJI A;  2K52 A;  4KY5 A;  4JI5 Q;  4QMG A;  1NMF A;  5LL6 S;  1XNQ L;  5BN5 A;  5HGQ A;  5FO7 B;  4XYO A;  4A3D B;  2FXQ A;  4JI3 Q;  1HZ9 A;  2WAQ E;  3L9A X;  1B53 A;  1PFB A;  3FVQ A;  4BBR B;  2QIL A;  1D5X C;  1I3Q H;  3E5S A;  3ZJY C;  1VQJ A;  1VQM A;  4JV5 Q;  4L5T A;  1MGS A;  1DYQ A;  3K80 C;  4FP5 D;  2F0Q A;  3HKZ G;  3KYH C;  4F8M A;  3S16 H;  3M4O B;  3V05 A;  2J7Z A;  5IYD H;  4DPG A;  5K36 G;  4TKK A;  5JJZ A;  4FF2 A;  2SEB D;  4AQY L;  1T0F A;  3AQQ A;  1YI2 A;  2B63 H;  3G6E A;  4ODG A;  4B3R L;  3FPU B;  1WTV A;  2YU9 H;  1N9W A;  3A8I E;  3MFG A;  1KHI A;  1AEX A;  4DK1 A;  4Q0F A;  1SNP A;  4X3T A;  4K5W A;  1B1Z A;  1KRS A;  2WIW A;  4OO1 G;  5EPL A;  3W2D A;  3FDT A;  1E1O A;  4A3K B;  2A69 D;  4C3H G;  4G6V A;  5EPJ A;  3H94 A;  4X3U A;  3PQI A;  4OX9 L;  2OKF A;  4GLX A;  4CKB A;  1IXR A;  3J7A V;  3KF6 B;  4QY7 A;  3OOC A;  4TKO B;  2MQH A;  1HH2 P;  5JPN C;  2QW7 A;  4N9T A;  4LFC Q;  3ULL A;  3GO5 A;  1Y1W B;  1CA5 A;  3HS0 C;  4CDF C;  1HNW Q;  1IYJ B;  2WII B;  3BZC A;  3G6J B;  2Q2T A;  3WOF A;  2I5H A;  1E22 A;  2ICI A;  4CBV A;  1X54 A;  3UE1 A;  5LHY 1;  4GLV B;  2EJF C;  4LUV A;  3A56 A;  2UUA L;  1LTB D;  2BA1 A;  2NZO A;  2ZTE A;  4HJA A;  4DV4 Q;  3QG1 A;  1EY6 A;  3A8K E;  3ULP A;  3D8G A;  1OXS C;  3S2D B;  4DAP A;  2Z6B A;  3E0J A;  1L2F A;  2N8N A;  1VQB A;  3BYT B;  2ASB A;  2F0F A;  3GTP B;  1FNU A;  4GKK L;  1EYD A;  3K5M A;  3G48 A;  4H44 C;  4B3S Q;  1B50 A;  4V0B A;  3NHH A;  1IBK L;  1GXD C;  1YHA A;  4IUN A;  1GKH A;  3H3V I;  1K83 H;  4NP5 A;  2EQS A;  2Q2U A;  1G2S A;  1MI2 A;  4YCU A;  4IOA A;  2UUB L;  1CQV A;  3VDY A;  1MSG A;  1VDZ A;  2C9O A;  2PZW A;  3CCQ A;  3IEY B;  2CKZ B;  1X3G A;  5KIX A;  2VQF L;  4K2K A;  3TP8 A;  1V8Q A;  4RMF A;  1TQO A;  3QOL A;  2EDG A;  3CKI B;  4L63 B;  3VA7 A;  1HPC A;  1TWG H;  3MXP A;  1WVL A;  1S4Z A;  1Y1V H;  1MHW C;  4YY3 Q;  3A54 A;  2LY7 A;  1RD9 D;  1LTI D;  2Z9H A;  3NBH B;  5KNC A;  3PF5 A;  5AJ3 L;  1B2T A;  3KUP A;  1TWH H;  3VYR A;  3M7N A;  1E24 A;  1HZC A;  1AN8 A;  1MKH A;  1BQQ T;  2JA8 G;  1E1T A;  1E2V A;  4KD3 A;  4A3J G;  1KDC A;  3D6W A;  3TZD A;  2JA7 G;  2MO1 A;  2ES2 A;  4LF6 L;  3SXH A;  5KNB A;  4DV3 L;  4RH6 A;  2F0I A;  3AFP A;  5C3E B;  3FPP A;  4A3I H;  4QB4 A;  2NN6 G;  1YNJ D;  2A73 B;  4HMI A;  3CCJ A;  5HGT A;  1SBB B;  2Y0S G;  1PFM A;  2M2L A;  3SHL A;  2K28 A;  3J7A F;  1Y88 A;  2LKV A;  3P1H A;  4KTA A;  1EU4 A;  1DM0 B;  3BG3 A;  2EO0 A;  3H09 A;  2RVL A;  1EQR A;  2EYO A;  1PA6 A;  1YBY A;  1M8A A;  4DU9 A;  4AH6 A;  1CKN B;  3SR1 A;  1F9Q A;  1R4Q B;  2B2V C;  3ERQ A;  1GUT A;  1HR0 Q;  1HUM A;  2B29 A;  3Q6S A;  2E75 C;  3E9H A;  4LAA A;  2DUD A;  5J1Z A;  2RCN A;  4GN3 B;  4QIW E;  1X32 A;  2B2U C;  1EIH A;  4PZ7 A;  2AUJ D;  3KJO A;  4R4C A;  2B39 A;  2OQK A;  5NUC A;  2EOT A;  5BR8 Q;  1OXX K;  3DWA A;  4GKJ L;  1V43 A;  5EPK A;  1NNX A;  1E7Z A;  3A7L A;  2B63 G;  1PFN A;  2O5J C;  4DR3 Q;  1F9R A;  1JJC B;  3PUZ A;  2VY3 A;  5T1G A;  5IP9 G;  2UXB L;  2F0W A;  2EJM A;  1LTR D;  1CHQ D;  4ME5 A;  2EY2 A;  1B3A A;  4IUU A;  3SVM A;  4GNX A;  3PIP 3;  1PTO C;  2JEB I;  4M1U B;  5M5Y H;  3S24 A;  2A6H D;  2XRS D;  3PIO A;  1YNX A;  2NVY B;  2I46 A;  1IKL A;  3HKZ B;  3MEF A;  2LS0 1;  2FFK B;  1WTO A;  3U50 C;  5M5X H;  1B4O A;  4HAE A;  3PO2 G;  2KBN A;  4ZYS A;  4JI2 Q;  3T1H Q;  3W5O A;  3T51 B;  2F0D A;  3J80 i;  4DV5 L;  4HIK A;  3U4V A;  4JI7 Q;  3HOU G;  1A2T A;  5GAE C;  3L0O A;  2B2Y C;  4IUR A;  3KJP A;  2EPB A;  1KIX A;  3CAM A;  2FMM A;  4C3H B;  5J39 A;  3VR5 A;  1HNZ L;  2F0L A;  2O5I C;  2E2D C;  3K6O A;  4DNT B;  1F2L A;  1L1O C;  4XQQ A;  3I91 A;  4AYB G;  5DNF A;  4JOI C;  1G91 A;  1GJX A;  1CQF A;  4A3M G;  1BCP F;  1YIT A;  1C48 A;  5LMN Q;  2R92 H;  4DGZ A;  1VQD A;  1NCV A;  1Q1E A;  1SLJ A;  2NZ1 D;  1P8L A;  1LV9 A;  4ALP A;  2R3Z A;  4X65 Q;  4IPG A;  5AFW A;  3FHW A;  1Q7Y C;  1KTK A;  3K8A A;  4FO2 A;  1TY2 A;  2K5Q A;  5IP7 G;  4DUZ L;  3C46 A;  2AWN A;  1SDF A;  3AU7 A;  1JOK A;  4J8Q A;  1EFW A;  4U68 A;  2NTT A;  2WAC A;  1X56 A;  2KED A;  2E2I B;  1X3P A;  3C1F A;  4JI6 L;  1N32 L;  1DZ1 A;  4P75 A;  2MO0 A;  1A2U A;  3F2C A;  4DUY L;  2KA7 A;  1PTO B;  1VCI A;  2HIX A;  2RQX A;  2K05 A;  1VF7 A;  1Q81 C;  1GUS A;  1Z47 A;  3I55 A;  1IBM L;  4XDX A;  4KHP Q;  2MHV A;  2L5T A;  3KDF A;  2F0K A;  4B3S L;  1EWI A;  3PUX A;  4ZKB B;  4HIM A;  2SNM A;  2OWO A;  3CQZ H;  2CCZ A;  1F2Y A;  1KLG D;  3IRB A;  3RLN A;  2NVQ B;  1LTA D;  1H9S B;  2R7Z H;  1QNK A;  3RN2 A;  3HOY G;  1G8Z D;  1LAC A;  3J81 j;  5CV4 A;  2L0C A;  4LUO A;  4L6T B;  4JI4 L;  2JA8 B;  2NBF A;  1BF4 A;  1P16 A;  4A3J B;  3PUW A;  3NBI A;  1E2W A;  3S14 B;  2JA7 B;  1GVP A;  5EJW A;  4F87 A;  3BU2 A;  3S1M B;  1U4P A;  1RDP D;  2E2J H;  5D65 A;  1S3O A;  3KLS X;  4HSV A;  3CCS A;  4UHV A;  1FGB D;  3TS0 A;  3SK4 A;  1TS3 A;  1KC8 C;  4LNQ A;  1VQP A;  2Y0S B;  4H02 A;  3UDF A;  4YCV A;  1BVS A;  1I6H B;  1VQE A;  3CCV A;  3NEL A;  3NQT A;  4A3F G;  1TVX A;  1U9R A;  4LW1 A;  2CH4 W;  1A6X A;  4IUP A;  2ZTD A;  3QOJ A;  1PZK D;  3I56 A;  5IWA L;  3QR8 A;  3HOW H;  3HFZ B;  5A35 A;  1M90 C;  4DK6 C;  4RGM A;  3EVQ A;  3KF8 A;  1VQL A;  3D4D A;  4I65 A;  3S1N H;  3HOZ H;  3ZYY X;  2R61 A;  5ELF A;  1B70 B;  1XMO Q;  3IF0 X;  2LMC B;  1VQ4 A;  1ILP A;  4MN3 A;  1D5Z C;  4R9W A;  4K8J A;  3BDL A;  3O13 A;  4YWK A;  1JOQ A;  1TS5 A;  4HTH A;  2HUG A;  2NVT B;  4FXK C;  3I90 A;  3URY A;  4C3I H;  4A3C G;  4LF9 L;  2EYL A;  1EOT A;  4ZCK A;  4BBS G;  2ALY B;  4EQN A;  4LF8 L;  3E6Z X;  2PCF B;  4NXN L;  2VW9 A;  3TBI B;  5IY0 A;  3Q22 A;  5CMD A;  4DR5 Q;  5GAG C;  4HN7 A;  1EZ6 A;  1GUG A;  3W1B A;  4DV2 L;  4A93 G;  3Q23 A;  3DUZ A;  2BCO A;  1O7Z A;  3BJU A;  3DM3 A;  3TQY A;  5EKL A;  3I4M G;  3J80 E;  3IAY A;  1FYC A;  4EV1 A;  5IYB H;  2ENB A;  2X69 A;  4DR6 Q;  3P1Z B;  4JI0 L;  3UDI A;  1OO9 B;  4B3M L;  1FL0 A;  2DY7 A;  2FKH B;  1Q1B A;  5E4W C;  3PO2 B;  2PQA A;  3CF5 A;  4O1N A;  1YVC A;  4MTN A;  2Q8I B;  1VQH A;  3UDX A;  2ZXO A;  1VQG A;  2R92 G;  3HOU B;  1OTC A;  1EY9 A;  1EOV A;  4N8F A;  1SMY D;  2E5L Q;  3HKZ E;  1IW7 C;  1BOS A;  2QCP X;  1CSP A;  2M9V A;  4IUT A;  1STN A;  1V9P A;  4DR4 L;  4LF5 L;  2PZU A;  3VR2 A;  1KXL A;  3WWV A;  3HEJ A;  4KK7 A;  1EEI D;  1S5E D;  1F9S A;  4AYB B;  3A7A B;  4B9W A;  3LWE A;  3AB9 A;  4XYQ A;  1SE3 A;  5D3D A;  4XT1 B;  1NE3 A;  4A3M B;  2ZYZ B;  4MIU A;  4E6I A;  4DR1 Q;  2WIZ A;  3P1Y A;  2XVS A;  2F03 A;  3GTO B;  5JEA G;  1HTP A;  1K83 B;  3R8B A;  4MNO A;  3SDZ A;  2OST A;  2Z4H A;  3NBH A;  3JAM L;  4LUZ A;  2I5M X;  5E7N A;  1FNV A;  4YHH Q;  1DD2 A;  3GTL B;  5ISR A;  4GOP A;  5M3F H;  1BBU A;  1F77 A;  2PZT A;  1JJ2 A;  1A63 A;  5DEH A;  1HFG A;  1XTC D;  3ERS X;  2Q2I A;  3W3A A;  5C44 H;  3I4N H;  2GVB A;  2X6L A;  5I6W A;  2BDN A;  1UUP A;  4APV A;  1DOM A;  5FKA C;  1O7Y A;  1I4R A;  1DXM A;  1LTG D;  1JE5 A;  2CVR A;  4NMZ A;  1WTW A;  1I94 Q;  4XXE A;  3FMC A;  3H3V H; 
#chains in the Genus database with same CATH homology
 2KVM A;  5EBC A;  5IOC A;  1K8M A;  1Z6H A;  1KAA A;  2MUY A;  1SJE D;  4PQX A;  5IOD A;  3QIA A;  2K6A A;  5JPM C;  3BS1 A;  2RSO A;  3MXG A;  2D62 A;  3HOY B;  1ZYR D;  1EZ8 A;  1B9N A;  3RLF A;  2F0G A;  3L7Z C;  1IYV A;  2EVB A;  5KND A;  1HFN A;  2BA0 A;  5IT9 E;  5C4H A;  4R8I A;  1KAB A;  2JYO A;  3QWN A;  4RFB A;  1I4G A;  3ONA B;  3HRZ C;  4QUC A;  4DA2 A;  1MD2 D;  1T5E A;  4XTC S;  4ZUJ A;  4RCN A;  4A3F B;  1E2Z A;  3DEP A;  2IL8 A;  1SND A;  2A69 C;  1EY4 A;  1HQM C;  1SNO A;  1SNQ A;  3I3C A;  3NPP A;  3SEB A;  5CV7 A;  3U9O A;  1PLF A;  2A68 D;  3K59 A;  4LJZ C;  2K5W A;  3N52 A;  4RWS C;  3EA6 A;  1GUN A;  3R93 A;  5J22 A;  4ZLT F;  3HGB A;  3VR3 A;  1ET9 A;  1OB9 A;  3HP3 A;  2J4X A;  1S5D D;  3HG9 A;  4BBS B;  5M5X B;  1TWF B;  1I4Q A;  1Z7T A;  2G9D A;  4HCS A;  2IX1 A;  1D6E C;  2M00 A;  1S5C D;  4A93 B;  4H0L C;  1PRT C;  4OO1 I;  1RTO A;  3I4M B;  1ZP7 A;  4DXG A;  4DAY A;  1WTP A;  2Z8L A;  2XWJ B;  5FK9 C;  3R2I A;  1JE4 A;  4OL7 A;  3D31 A;  3GQB A;  2KEE A;  4WRD A;  3R3O A;  4GZY C;  4ZQ3 A;  2WV6 D;  1NAP A;  1JOR A;  4K6D A;  4UAI A;  1KDB A;  2R92 B;  1CI3 M;  5ELE A;  1ONL A;  5JVH 3;  2WCZ A;  4XQJ A;  3SK6 A;  2L1B A;  1EEF D;  1SEB D;  2FL3 A;  1DOL A;  5C3W A;  1TU2 B;  4KHV A;  3V96 A;  2IX0 A;  2TSS A;  4ID6 A;  3NXW A;  2FLC A;  3LWU A;  1QG7 A;  1EQT A;  4CJ1 B;  4DXF A;  2F0N A;  3M4Y A;  1EU3 A;  3N6R A;  2DBS A;  1ESF A;  4RGT A;  3GTQ B;  3D4W A;  4LK1 C;  5E4X A;  1QWY A;  1IKM A;  2VS1 A;  2B2T C;  3MHB A;  2BE5 C;  4KN7 C;  1PMR A;  2YYZ A;  3IFD A;  5CGK A;  1PRT B;  3BVG A;  4OHJ A;  1H9M A;  2K1B A;  1QNU A;  1C8C A;  1HXY D;  1G29 1;  4WOR A;  1EYA A;  2KEC A;  1EY7 A;  5CR3 A;  2NN6 I;  2X6G A;  4ZUI A;  1GUO A;  1BCP C;  1AFP A;  1HH1 A;  2E74 C;  2BH2 A;  2ZXP A;  2F0E A;  1S5F D;  3TP5 A;  1TWA B;  1F9P A;  3S1Q B;  3OPO A;  4U67 3;  5IGG A;  3I73 A;  3OIP A;  3NTK A;  4G7O C;  3HOZ B;  4DK0 A;  2I07 B;  3RD4 A;  3ND9 A;  4WFN 3;  3WOE A;  1LT6 D;  1YNN C;  2B8G A;  5CBA E;  4B08 A;  1ROD A;  3G7L A;  5M5W B;  2DNC A;  1BUV T;  2F0S A;  2FKC A;  4QBO A;  3TN2 A;  1B44 D;  2NB0 A;  4ZRZ A;  5COR A;  4K5V A;  1O80 A;  4NW2 A;  1SYG A;  2BDO A;  3DEO A;  1SSO A;  5EKK A;  3HOX B;  3H3V C;  4H7B A;  1E0B A;  4A3E B;  2IPK D;  1F1Z A;  2F0V A;  2JSO A;  4ILW A;  3CRL C;  4FF1 A;  3BDC A;  1LO5 D;  4KN4 C;  1U4M A;  3MA2 B;  4QBL A;  3MXN A;  3SK8 A;  4EVO A;  1ILQ A;  1VF5 C;  2MPM A;  2JP1 A;  1BCP B;  2XRQ D;  4PMW A;  2Z0R A;  1LT5 D;  2PW5 A;  4HR7 B;  2J0T D;  1O7L A;  3SE0 A;  2VXW A;  1SE2 A;  3PO3 B;  1ET6 A;  2VB2 X;  1D2B A;  1Y8P B;  1ESR A;  4BWG B;  2N55 A;  1G2T A;  2HDL A;  2A6E C;  2EYM A;  1BBX C;  3ITP A;  5TSS A;  2KJX A;  1PTO D;  2F0H A;  2L9H A;  5HUR A;  2F3W A;  2F0J A;  1STG A;  2IWH A;  1SFO B;  1S5B D;  1I50 B;  2CQA A;  3T53 B;  4KY6 A;  3ERO A;  4OIJ A;  5C5L A;  1QIL A;  2JA6 B;  1HA6 A;  5M3F B;  4ULL A;  1PDQ A;  3I70 A;  4F7X A;  4ZKC B;  4KV6 A;  3S15 B;  5F2D A;  4DF7 A;  2INB A;  2VNU D;  2IJ0 A;  4O42 A;  1OB8 A;  1QE6 A;  1JWS D;  5ELC A;  2EXZ A;  1FR3 A;  2FIN B;  2WJ0 A;  1AW7 A;  1ZKO A;  4C2M B;  2Z1C A;  1CA6 A;  5LL6 X;  4HED A;  3MFY A;  1RF2 D;  2WB1 B;  1JOO A;  4KMU C;  4RHS A;  2TMP A;  5M3M B;  2KHS A;  1TS2 A;  3BVZ A;  1L0Y B;  1LTS D;  4K6L A;  5COY A;  5C6A A;  3DWP A;  5IIF A;  1LTT D;  2AQ1 B;  2R6G A;  1HHV A;  4TQU S;  3GTK B;  3H0G B;  1BXT A;  4LMQ D;  1HA5 A;  4IZ8 A;  4IFD I;  2XN9 C;  2WP8 J;  1H9K A;  3MWY W;  1STB A;  3TME A;  3DM1 A;  2WAQ B;  2MGS A;  2KCN A;  3P7J A;  1Y8N B;  1H9R A;  4X3K A;  4QUF A;  2RDG A;  5M9O A;  1RZN A;  1SAP A;  1EWH A;  5ELD A;  1I3Q B;  4FF3 A;  5C0X I;  1SYB A;  3PV0 A;  3S16 B;  5K5P A;  2CW0 C;  4M8A A;  4PNY A;  2QEJ C;  4LQE A;  1U4L A;  3J81 E;  1SMY C;  2B63 B;  2AUK A;  2YU9 B;  4TSS A;  2Q8R E;  4C1N K;  4RA8 A;  5D3I B;  5BN3 A;  3V2T A;  4G57 A;  2JXM B;  2KQ3 A;  1J8I A;  5A2Q E;  3P20 A;  2FHT A;  4CJ2 C;  2HQE A;  3TP6 A;  2SNS A;  2DNE A;  3NE5 B;  5K36 H;  4FVM A;  3K57 A;  1WD1 A;  4ABN A;  1EQV A;  4K5X A;  2ID0 A;  1JQY D;  4ZQU A;  1XXG A;  4J6H A;  4FNF A;  3T4A C;  3D4R A;  4OO1 H;  3S9W A;  2B8F A;  3IEY A;  1VMP A;  1PZJ D;  2HCC A;  2A5H A;  1MBY A;  2NYZ D;  1R0V A;  3EFX D;  2EYP A;  5I9O A;  1IPI A;  3EQL C;  2K5D A;  2XWB B;  1GUW A;  1L0X B;  3PIO 3;  2OXP A;  5KYL A;  2RKS A;  2K7V A;  2CV8 A;  1D1K A;  2PO4 A;  3CRK C;  1GHK A;  2EYJ A;  1TWG B;  2RDF A;  1Y1V B;  3BYY B;  2O4X A;  1JWM D;  5JOB A;  2VLD A;  4OGQ C;  1RCV D;  2KUM A;  2DY8 A;  2PMZ B;  1TWH B;  1BO0 A;  2SDF A;  4Q5V A;  4G6U A;  3AJV B;  1IW7 D;  2JEA I;  1H9J A;  3I8Z A;  1HTL D;  3RMH A;  1EY8 A;  1PTO H;  2V4D A;  3D3R A;  5G3L D;  1SNM A;  2AWO A;  3TZU A;  1V1P B;  4JBW A;  4A3I B;  1A3U A;  4DFA A;  1I6V C;  1Y69 U;  2NWG A;  1TKW B;  4RCO A;  3DHQ A;  4K2L A;  2N88 A;  1FD7 D;  2JE6 I;  2BOS A;  2RBM A;  4KKU A;  3VA5 A;  4BA1 I;  1HQR D;  1SYC A;  2PQE A;  5DM6 3;  4CJ0 B;  4L8J A;  5EQ0 A;  1V1O A;  1B9M A;  3TP7 A;  3T16 A;  3VR4 A;  2B2W A;  1MSH A;  4C3I G;  1W6J A;  3K5N A;  2NN6 H;  2K04 A;  4ZAI A;  3H6M A;  1STY A;  5ELB A;  2IW3 A;  3H91 A;  2HDM A;  3VYT A;  3IFT A;  4IQZ A;  1EY5 A;  5C4Z A;  1M4V A;  1KDA A;  2VB3 X;  4IFD J;  4IAL A;  3AMU A;  4I7Z C;  5M5Y B;  3Q0A A;  4RKB A;  2GW6 A;  4JK1 C;  3BZD B;  2W8M A;  2F0U A;  1RKN A;  3NUC A;  2CZR A;  3KLS A;  1CK1 A;  3PMF A;  3OWF A;  5IGC A;  3OSO A;  5C0X J;  3GV6 A;  1LT4 D;  1PYW D;  3OWE B;  4DNR B;  2E2H B;  2B2V A;  3MTS A;  4A3B B;  3LNN A;  1SYF A;  1I4H A;  3I4L A;  5DM7 3;  3Q24 A;  2B2U A;  1I4X A;  1STH A;  3GD7 A;  3MVV A;  2Z4I A;  3J81 L;  2DN8 A;  3VR6 A;  1LAB A;  3KBG A;  2PPB C;  5D14 A;  5IGB A;  1W6K A;  1WTX A;  3J80 L;  2CHB D;  2F4I A;  4KD4 A;  3X3N A;  4KKT A;  5CC4 A;  1SXT A;  5A2Q L;  4RAU C;  3KLR A;  1BNZ A;  4HSP A;  4FXD A;  3GV3 A;  5I6Y A;  1WTR A;  2EZV A;  1CZW A;  1UEA B;  3NWT A;  3OMG A;  1YNJ C;  2RDH A;  4XIG S;  1PRT D;  5I4D A;  3K58 A;  1H9S A;  3TDQ A;  5FDK A;  2B2Y A;  3P75 A;  3GP7 A;  3NQI A;  1QB5 D;  4BS9 A;  4KHZ A;  1A3T A;  4X3S A;  5JEA J;  1UWV A;  4IN3 A;  5FO8 B;  4G7Z C;  1XMX A;  2PW7 A;  1KNA A;  3CQZ B;  4PMB A;  2XNA C;  2JJQ A;  2R7Z B;  3M7G A;  3KBX A;  3DWQ A;  1F2M A;  1EY0 A;  1X3Q A;  2B2W C;  5EKI A;  2WIN B;  2WKC A;  1NR2 A;  3F2U A;  3MXU A;  2E2J B;  1KNE A;  4OIK A;  3FEW X;  4XQN A;  4C56 C;  3OHX C;  5EBD A;  5JAV A;  3C3L A;  2EY1 A;  1PRT F;  1AZQ A;  1VMC A;  4TKD A;  5I2Y A;  4RGN A;  3CHB D;  5T1I A;  2A6H C;  2C5C A;  1QCB D;  3HZX A;  2EJG C;  3J7Y W;  1AZP A;  3T56 B;  1I4P A;  5DAU A;  3HOW B;  4MHE A;  3C1E A;  3S1N B;  1RTN A;  4K14 A;  1EYC A;  1DJR D;  1RJT A;  4FYD A;  4TRD A;  2BE5 D;  2RA4 A;  4QCL A;  3VYS A;  1IHZ A;  4C3I B;  1Q90 A;  4HMJ A;  1XX8 A;  3P1Z A;  5KGU A;  2L4N A;  1PZI D;  5IT9 L;  3NK9 A;  4PMC A;  1EIG A;  1FNW A;  4IFD H;  1LT3 D;  2F3V A;  3RUZ A;  1LLR D;  3FKI B;  1HRJ A;  3BT7 A;  1Y1O A;  3QO2 A;  5C3X A;  1BCP D;  3SK5 A;  5C0X H;  2GA4 B;  2KCC A;  3OIQ A;  1T5X D;  1ENF A;  3NTH A;  4S3S A;  3BVM A;  5IGE A;  3S1R B;  2MJ8 A;  2ZYZ A;  1DON A;  1UAP A;  1UNS A;  1YNN D;  3PUV A;  4BA2 I;  1OXU A;  3MZ5 A;  2IX3 A;  4E6Z A;  5FLX E;  1IL8 A;  1DCZ A;  4H13 C;  1D1I A;  3JAM E;  4DAV A;  4F88 A;  4CKC A;  3NWS A;  5EGT A;  3WDN A;  3U9S A;  3NTI A;  3VYU A;  1STE A;  1KLU D;  3QJY A;  4K8I A;  1BDO A;  1JIC A;  5KEE A;  1GHJ A;  4N9P A;  4B9X A;  4IUV A;  3DNX A;  2NUC A;  4CKE A;  3NSW A;  2WCW A;  3AJV A;  1A15 A;  3MEH A;  2OEO A;  1IYU A;  5C44 B;  2H1E A;  1JR0 D;  3I4N B;  1CM9 A;  1V1P A;  3UI2 A;  3OMC A;  3KK7 A;  3K0Y A;  5C5M A;  3PUY A;  1R11 A;  1CFM A;  3OW7 A;  4EQO A;  5JEA H;  1Q3L A;  2EY6 A;  3K5L A;  3CU7 A;  1J9O A;  3RZD B;  5KYI A;  2A6E D;  1PTO F;  2OT2 A;  5FOB B;  5I2X A;  1XWE A;  3RZO B;  1JWU D;  2PYK A;  1G6Z A;  2F0O A;  5KRU A;  3GTJ B;  3HOV B;  3FRP B;  2AQ3 B;  1PXU A;  5CV6 A;  2L55 A;  2IXS A;  1ML0 D;  1NSN S;  2QDB A;  4IUQ A;  4KJN A;  3M85 A;  1CT1 D;  2HCI A;  4KJO A;  4ZK9 B;  4RGO S;  4G4K A;  5IGD A;  2Q8T A;  2KOL A;  5I9P A;  1ENA A;  1CTM A;  4KI0 A;  1GOZ A;  4C3J G;  1SNC A;  3QB3 A;  4KKS A;  3S2H B;  2FCO A;  1ZEQ X;  5FO9 B;  2ZT9 C;  3S17 B;  3K7A B;  1O78 A;  2FMC A;  4NKL A;  2VUM B;  4IFD G;  4BY7 B;  4RKL A;  5CV9 A;  2K01 A;  2PNR C;  1HUN A;  4V19 0;  1Q8I A;  3BDO A;  2NTS A;  4WJW A;  4DN4 M;  3M3Y B;  4A3G B;  1R9T B;  3R2T A;  2K33 A;  2SOB A;  3C2P A;  5C0X G;  2OF1 A;  2G9H D;  2F0T A;  5C4J B;  1NUC A;  1JB3 A;  3LX0 A;  1SJH D;  3NP8 A;  3X3M A;  2O2L D;  3FOV A;  4RHR A;  2EYH A;  1Q12 A;  4R8N A;  2MP1 A;  4EQP A;  2L11 A;  1QJO A;  2JA5 B;  2ZXR A;  3L3O C;  4FXG C;  1ENC A;  4Y7N B;  1XYI A;  1ICW A;  3DXJ C;  1C4Q A;  1SE4 A;  3MAQ A;  1AP0 A;  2R93 B;  1JCK B;  1WTQ A;  1SYD A;  2K03 A;  1GEF A;  2CW0 D;  1D5M C;  2L12 A;  1TS4 A;  1JC7 A;  1RLV A;  1CZG A;  2E76 C;  2XSC A;  3A55 A;  1WD0 A;  2D9U A;  2NVX B;  5CV8 A;  4CHT B;  2QF7 A;  5CBE E;  2F1M A;  2H4O A;  1TY0 A;  1II3 A;  4PV1 C;  3ND8 A;  4NDX A;  1TWC B;  1CHP D;  2EY5 A;  3GTM B;  3MC0 B;  2F0P A;  2EYF A;  1DOK A;  4YIJ A;  2IT1 A;  4KY7 A;  1ZYR C;  2A74 C;  5IGF A;  1QOH A;  4P2C B;  2EE1 A;  5E3F A;  4UDU C;  1YNM A;  5FLX L;  1EWC A;  5E1F A;  4CGY B;  2LFN A;  1RHP A;  3IKJ A;  1HCZ A;  3I72 A;  2D5D A;  5C4X B;  4EGV A;  3TSS A;  4Z9C B;  4QF4 A;  3A8J E;  3K5O A;  2D2C C;  1BR9 A;  1WCM B;  4XT3 B;  1TII D;  1F2Z A;  4HCE A;  1K8O A;  2AQ2 B;  1NR4 A;  2ICE C;  2A68 C;  1R4P B;  2RSN A;  2F0M A;  1A79 A;  2GJW A;  4QIW B;  3GTG B;  2QKI C;  4FF4 A;  5BN4 A;  1STA A;  1Y8O B;  4BY1 B;  1U4R A;  1OXT A;  5JVG 3;  3T13 A;  1TR5 A;  3IL8 A;  1OXV A;  1SYE A;  1TT2 A;  3D6C A;  4J1M A;  1EFI D;  4G7H C;  5CYU A;  1EL0 A;  2B2T A;  2K32 A;  1ZXT A;  3DMU A;  5G3L F;  5CV5 A;  2XIW A;  4C3J B;  4C1N I;  4QBN A;  2FJ2 A;  1A3V A;  2WKD A;  3EJI A;  4KY5 A;  4QMG A;  5LL6 S;  5BN5 A;  5FO7 B;  4XYO A;  4A3D B;  3L9A X;  1B53 A;  1PFB A;  3FVQ A;  4BBR B;  2QIL A;  1D5X C;  3E5S A;  1MGS A;  1DYQ A;  4FP5 D;  4F8M A;  2F0Q A;  3M4O B;  3V05 A;  2J7Z A;  5K36 G;  4TKK A;  5JJZ A;  4FF2 A;  2SEB D;  1T0F A;  4ODG A;  3FPU B;  1WTV A;  3A8I E;  3MFG A;  1AEX A;  4DK1 A;  4Q0F A;  1SNP A;  4X3T A;  4K5W A;  1B1Z A;  2WIW A;  4OO1 G;  5EPL A;  3W2D A;  3FDT A;  4A3K B;  2A69 D;  4C3H G;  4G6V A;  5EPJ A;  3H94 A;  4X3U A;  2OKF A;  4CKB A;  3J7A V;  4TKO B;  3OOC A;  5JPN C;  4N9T A;  3GO5 A;  1Y1W B;  1CA5 A;  3HS0 C;  3G6J B;  2WII B;  3WOF A;  2ICI A;  4CBV A;  5LHY 1;  2EJF C;  3A56 A;  1LTB D;  2BA1 A;  3QG1 A;  1EY6 A;  3A8K E;  3D8G A;  1OXS C;  3S2D B;  4DAP A;  3E0J A;  3BYT B;  2F0F A;  3GTP B;  1FNU A;  1EYD A;  3K5M A;  4H44 C;  1B50 A;  4V0B A;  3NHH A;  1GXD C;  4IUN A;  4NP5 A;  1G2S A;  1MI2 A;  1CQV A;  1MSG A;  1VDZ A;  2C9O A;  2PZW A;  3IEY B;  5KIX A;  4K2K A;  3TP8 A;  1V8Q A;  1TQO A;  3QOL A;  2EDG A;  3CKI B;  4L63 B;  3VA7 A;  1HPC A;  3MXP A;  1WVL A;  1S4Z A;  3A54 A;  2LY7 A;  1RD9 D;  1LTI D;  5KNC A;  1B2T A;  3KUP A;  3VYR A;  3M7N A;  1AN8 A;  1BQQ T;  1E2V A;  4KD3 A;  1KDC A;  3D6W A;  3TZD A;  3SXH A;  5KNB A;  4RH6 A;  2F0I A;  5C3E B;  3FPP A;  4QB4 A;  2NN6 G;  1YNJ D;  2A73 B;  4HMI A;  5HGT A;  1SBB B;  1PFM A;  2M2L A;  3SHL A;  2K28 A;  3J7A F;  1Y88 A;  2LKV A;  3P1H A;  4KTA A;  1EU4 A;  1DM0 B;  3BG3 A;  2EO0 A;  3H09 A;  2RVL A;  2EYO A;  1M8A A;  4DU9 A;  3SR1 A;  1F9Q A;  1R4Q B;  2B2V C;  3ERQ A;  1GUT A;  1HUM A;  3Q6S A;  2E75 C;  4LAA A;  5J1Z A;  1X32 A;  2B2U C;  1EIH A;  2AUJ D;  2B39 A;  5NUC A;  2EOT A;  1OXX K;  3DWA A;  1V43 A;  5EPK A;  3A7L A;  1PFN A;  2O5J C;  1F9R A;  3PUZ A;  5T1G A;  2F0W A;  2EJM A;  1LTR D;  1CHQ D;  4ME5 A;  2EY2 A;  1B3A A;  4IUU A;  3SVM A;  3PIP 3;  1PTO C;  2JEB I;  4M1U B;  2A6H D;  2XRS D;  2NVY B;  2I46 A;  1IKL A;  3HKZ B;  2LS0 1;  2FFK B;  1WTO A;  1B4O A;  4HAE A;  4ZYS A;  3T51 B;  2F0D A;  1A2T A;  2B2Y C;  4IUR A;  2EPB A;  2FMM A;  4C3H B;  5J39 A;  3VR5 A;  2F0L A;  2O5I C;  2E2D C;  3K6O A;  4DNT B;  1F2L A;  4XQQ A;  3I91 A;  5DNF A;  1GJX A;  1G91 A;  1CQF A;  1BCP F;  1C48 A;  4DGZ A;  1NCV A;  1Q1E A;  2NZ1 D;  1LV9 A;  2R3Z A;  5AFW A;  1KTK A;  4FO2 A;  1TY2 A;  2K5Q A;  3C46 A;  2AWN A;  1SDF A;  3AU7 A;  1JOK A;  4J8Q A;  4U68 A;  2NTT A;  2WAC A;  2KED A;  2E2I B;  1X3P A;  3C1F A;  1DZ1 A;  1A2U A;  2KA7 A;  1PTO B;  1VCI A;  2RQX A;  2K05 A;  1VF7 A;  1GUS A;  1Z47 A;  4XDX A;  2MHV A;  2L5T A;  2F0K A;  3PUX A;  4ZKB B;  2SNM A;  1F2Y A;  1KLG D;  2NVQ B;  1LTA D;  1H9S B;  1QNK A;  1G8Z D;  1LAC A;  5CV4 A;  2L0C A;  4L6T B;  2JA8 B;  2NBF A;  1BF4 A;  4A3J B;  3PUW A;  3NBI A;  1E2W A;  3S14 B;  2JA7 B;  5EJW A;  4F87 A;  3S1M B;  1U4P A;  1RDP D;  5D65 A;  4HSV A;  3KLS X;  1FGB D;  3SK4 A;  1TS3 A;  2Y0S B;  1I6H B;  3NQT A;  1TVX A;  1U9R A;  1A6X A;  4IUP A;  3QOJ A;  1PZK D;  5A35 A;  4RGM A;  3EVQ A;  3KF8 A;  3D4D A;  4I65 A;  3ZYY X;  2R61 A;  5ELF A;  3IF0 X;  2LMC B;  1ILP A;  4MN3 A;  1D5Z C;  4R9W A;  4K8J A;  3BDL A;  3O13 A;  1JOQ A;  1TS5 A;  4HTH A;  2HUG A;  2NVT B;  4FXK C;  3I90 A;  3URY A;  2EYL A;  1EOT A;  4EQN A;  3E6Z X;  2PCF B;  3TBI B;  3Q22 A;  5CMD A;  4HN7 A;  1EZ6 A;  1GUG A;  3Q23 A;  3DUZ A;  2BCO A;  1O7Z A;  5EKL A;  3J80 E;  3IAY A;  1FYC A;  4EV1 A;  2ENB A;  2X69 A;  3P1Z B;  1OO9 B;  2DY7 A;  2FKH B;  1Q1B A;  5E4W C;  3PO2 B;  4O1N A;  2Q8I B;  2ZXO A;  3HOU B;  1EY9 A;  1SMY D;  1IW7 C;  1BOS A;  2QCP X;  2M9V A;  4IUT A;  1STN A;  2PZU A;  3VR2 A;  3HEJ A;  4KK7 A;  1EEI D;  1S5E D;  1F9S A;  4AYB B;  3A7A B;  4B9W A;  3LWE A;  3AB9 A;  4XYQ A;  1SE3 A;  5D3D A;  4XT1 B;  4A3M B;  2ZYZ B;  4MIU A;  4E6I A;  2WIZ A;  3P1Y A;  2XVS A;  2F03 A;  3GTO B;  5JEA G;  1HTP A;  1K83 B;  3R8B A;  3SDZ A;  2OST A;  2Z4H A;  3NBH A;  3JAM L;  1FNV A;  1DD2 A;  3GTL B;  5ISR A;  1F77 A;  2PZT A;  5DEH A;  1HFG A;  1XTC D;  3W3A A;  2X6L A;  5I6W A;  2BDN A;  1UUP A;  1DOM A;  5FKA C;  1O7Y A;  1I4R A;  1DXM A;  1LTG D;  2CVR A;  4NMZ A;  1WTW A;  4XXE A;  3FMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...