4DAVA

The structure of pyrococcus furiosus sfsa in complex with dna
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
231
structure length
231
Chain Sequence
AMKLMEVSPLFPCIFLRRVNRFVGLVRIKERIERALITNTGRLNEFMIPGRIGYCTPKAGGKTRYILLGFEDHGKIAIIDTRLQGKAFEKIIEKELLPELEGCRIIKREPRVGESRLDYLIECSKGEIFVETKSAVLREGEYAMYPDCPSVRGQRHIKELIKLARDGKRAMIVFIGALPNVSKFKPYKKGDPKIAELLKEALEAGVEIRALGLHMELSGEIIYRGELGVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of SfsA and its DNA complex; A DNA/RNA nuclease with a novel domain combination
rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase/dna
molecule keywords Sugar fermentation stimulation protein homolog
total genus 63
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03749 SfsA Sugar fermentation stimulation protein RE domain
A PF17746 SfsA_N SfsA N-terminal OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.580 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4davA01
3.40.1350.60 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 4davA02
4DA2A 4DAVA 4DAPA
chains in the Genus database with same CATH superfamily
1RDPD 3K5OA 4IUQA 2Z0RA 3W2DA 3A0JA 5C4HA 4DXGA 2D62A 2R93B 3PO2H 2VZAA 4ZQUA 4PZ8A 3J81i 4RCNA 1SMYD 4L5QA 2ATWA 1XMQQ 4O1NA 2KHSA 3Q23A 3AQQA 2NZHA 4JBWA 1QVGA 1HHVA 1EFWA 3EROA 1VQ9A 5FO7B 1ET9A 3CHBD 2PO4A 1UEBA 1EY6A 3T16A 4DXFA 3K81C 2A8VA 4BBSH 3L9AX 4XQQA 2WACA 1VQBA 1EU3A 4MTKA 5A35A 4LF4L 2A6EC 3KLWA 2F0LA 4KJOA 1A3TA 3FKIH 4K6DA 1FJGL 1IBLL 3M4OH 1GUSA 2WV6D 1YJNA 3A7LA 3TDQA 3U9SA 1MJEA 4PZ7A 3CCRA 1I50B 4DR4Q 4RCOA 1BXTA 2DNCA 2I5MX 3VYSA 3FMCA 4X62Q 4IURA 4AQYL 1F77A 3CQZH 4LFAL 2A73B 2EYPA 2WCWA 3QR8A 1BBXC 2P5ZX 3TP6A 1UWVA 4XQJA 2WKCA 5DNFA 4BXXH 5LMNW 2B3GA 4OWWB 2J0TD 2SEBD 4X64Q 4LUVA 2OKFA 4LFCQ 3S1QB 3NXWA 3BDOA 2FHTA 3VYRA 4ILWA 3TZDA 3FDTA 3UDIA 5FLXL 3J80c 1C7YA 4JPBW 1U5KA 1GHJA 4IALA 1L1OC 4FF2A 5DAUA 2IL8A 4N8FA 2WIZA 3NE5B 1S5BD 4IJLA 2WCZA 2D2CC 4P73A 4IUVA 3MC0B 3SVMA 5LHY1 3VR5A 3T1YQ 3S1NH 3T51B 2F0HA 4APVA 1E22A 2PQAB 4DR3L 5DLQE 2VQFQ 3K80C 3HKSA 4CJ2C 3CC7A 2NTTA 1AP0A 4JK1C 3AFQA 5NUCA 4DR5Q 1VQHA 5C3EG 4PMWA 1IKLA 1B70B 5EKLA 4GNXB 3GV6A 2KCMA 3I7FA 1NNXA 5CV6A 4KY5A 4CDDC 1KAWA 5IWAL 1WTRA 1F9PA 1IBMQ 4POGA 4JV5L 3F1ZA 4NKLA 1SSOA 2C35B 1TS4A 3T53B 4HIKA 1X56A 5FK9C 1X3EA 4HCEA 3TP8A 4DR6L 1Q90A 2F3IA 2K7VA 4AIMA 2BA1A 2R7ZB 3VR3A 1HXYD 1MI2A 1PRTB 1WTWA 4GKJQ 1K0SA 5IYBH 2WIIB 3BYYB 1R0VA 1QUQB 4PMBA 3RR5A 3T1HQ 1N33Q 2NVQH 1W3SA 2ICEC 3K0YA 3HOUH 3UI2A 4GLVB 1SYCA 2E74C 3STBC 4NMZA 1PFNA 4QMGA 4DK6C 2PW5A 2WB1E 3D8GA 1ET6A 3ND8A 4JC0A 3VR4A 4A3LG 4OO1I 4QIWE 2ZTEA 3P1YA 4XTCS 2DGYA 2R92B 1SE2A 3FPUB 4Q0FA 2PYKA 4QBNA 2RDHA 4KI0A 1EQRA 3K59A 2DBSA 1IYJB 5KYIA 1BBUA 1HTPA 5JPNC 1AE3A 5I4DA 2A5HA 1IBML 2EDGA 3W3AA 4KV6A 2L12A 1IKMA 4DR7Q 1Y14B 5CGKA 2R61A 2M9VA 4DAYB 5HY6A 4CJ0B 5JEAG 1VDZA 4OL7A 4O0AA 4IUUA 3IEYB 3QWNA 1Z47A 3CRKC 3OW7A 2VQEQ 4BY7B 1XTDA 2GVAA 3VA5A 1VCIA 4A3MG 1ASZA 4UAIA 1D1IA 3KLSA 2F3WA 1Z6HA 4A3IG 4A3EB 3CU7A 4BA2I 2FFKB 3HP3A 4WJ3M 2QA4A 1TWGH 4ZAIA 1KDAA 4TVAB 5LL6X 1Q82C 5FLXE 2ZJPA 1VQ6A 4HJ7A 2I5LX 1HPCA 3NBHA 2E2HH 1NBWA 3M9BA 4BY1G 4Z9CB 4G7HC 1LT4D 4A93G 2Q2HA 1SYFA 3I55A 5IODA 4DV7L 1YNNC 5I2YA 3L3OC 1ONLA 1DCZA 2Y0SB 4JI8Q 4DNIA 2MNAA 2OQKA 2PQEA 2VB3X 3TREA 4ZKCB 1AFPA 2E75C 5I2XA 3RUZA 3K5MA 1DXMA 2Q2IA 4LWCA 2K5VA 3DEPA 3BDLA 3J80i 1WTPA 4QUCA 4GNXC 4DK1A 1SFOB 3H09A 3W1GA 1FJGQ 1CQFA 2BCOA 3PV0A 1WD0A 3NELA 1A62A 4UDUC 2UUAQ 2EJFC 2DY7A 2UXDQ 2EPBA 5IWAQ 1SYBA 1GOZA 5IGGA 1VQEA 2HQEA 2NVXB 5CV9A 1QZHA 2FKHB 5AJ3L 5M3MB 2R6GA 2C5CA 3HG9A 3RD4A 3H3VC 1HFNA 3AFPA 4A3GG 2F3VA 4DF7A 2UU9L 3OW2A 3MVVA 4P75A 4ZCKA 4XT3B 3IF0X 1F9RA 4L63B 1BF4A 1BCPF 1JOOA 4ZK9B 3TZUA 1VQOA 4X66L 2I0QA 1HUMA 1EU4A 5KNBA 1WTHA 2DUDA 5FJ8G 3FPPA 1Q12A 2YU9H 1VQGA 4EQOA 2QF7A 1GUOA 4CJ1B 3UE1A 3PUYA 5EAYA 4XT1B 1EY5A 4A3FG 2BE5D 5M5WH 5DM73 1F2LA 3RZDH 3I70A 3U4VA 3OTOL 2AQ2B 1NMFA 2VW9A 1XNQL 1IBKQ 2HUGA 1SYGA 3I4NH 1GUGA 1DZ1A 5JVH3 1TVXA 1NE3A 2MHVA 2KHIA 5LMUQ 1IYUA 4ZUJA 4DAMA 1OXVA 1SLJA 5D3DA 2B8GA 4A93B 1G2SA 3SHLA 3KF8B 2JA7G 2KCNA 1Q3LA 3E0EA 5JAVA 5ELEA 5IYCH 1VQJA 3ULLA 1PYWD 1HQMC 1ZYRC 2N78A 2AQ1B 2PMZE 2H4OA 2FXQA 1PZID 1N9WA 3D31A 1PFBA 1S72A 4DV1Q 5EQ0A 4RAUC 2SOBA 2YTVA 3DMUA 3KDFA 1E3PA 2EOTA 4P74A 1QB5D 4P72A 4G4KA 3J81c 3K5LA 3DLLA 4GN3B 2EYJA 3OOCA 3DNXA 1B4OA 1VQNA 1SNMA 2Z8LA 3RN2A 2B63G 4B08A 4TKKA 2BA0A 1HR0Q 1YHQA 1C9OA 2GJWA 4WJWA 2ZTDA 1QNKA 4OWXB 1U4RA 1VQ7A 5FOBB 1TR5A 3OIQA 4MN3A 4L5SA 1LTID 3PO2G 1NUCA 2JA6H 1XMOQ 2A68D 5JPMC 4I7ZC 2IWHA 5GAGC 4G7OC 2WAQB 1F2YA 4JI7Q 1OXXK 1YHAA 3K58A 1NR4A 1LABA 3M85A 2UXCQ 1HH1A 3CPWA 2JA5G 3WWVA 3J81L 3G48A 1B53A 5DM63 4AYBG 2KEDA 4BBSG 3S1RH 3EN2A 4AQYQ 2KCTA 5C44B 1XPRA 1D8LA 1WI5A 4XIGS 3G4SA 2JEBI 2K5HA 1KRTA 3SEBA 3GTJH 4KMUC 4GNXA 2B63B 2NWGA 3KF6A 1HTLD 2F0OA 3MWYW 5FO8B 2EQSA 2SNSA 2XWJB 5JEAH 2WIWA 2IY5B 2I07B 2KJXA 1X32A 4NXMQ 1SEBD 1SN8A 2E2IH 3GTMH 4MNOA 4ZUIA 3GTQH 1R9TH 2TSSA 4CDCC 4H02A 3A8JE 4X65Q 2E5LL 2Q2UA 1ZEQX 1I6HH 4FXKC 3BT7A 2BH2A 1A63A 4QJFA 2R7DA 2AWNA 4FO2A 5IGFA 3A7AB 2K04A 2RSNA 5EBDA 1V8QA 2A68C 1BCPD 4DV2Q 4C3JH 1PRTC 4LF7Q 3P20A 3I4MB 3L7ZC 1VMCA 3KUPA 4MZ9A 3QO2A 2FKCA 4ZQ3A 4LFBL 2JQOA 2L5TA 2K5DA 3H0GH 1NY4A 1P8LA 3GTKH 3FRPB 4A3KB 4ZKBB 2IX1A 2K1BA 1Q81C 3PIOA 1XNRL 3TBIB 3X3MA 3HKZG 1AW7A 2F0MA 3C1FA 1N34L 3RZOH 2Z9HA 1K8GA 3STBD 3CCUA 1QUQA 3TQYA 1G291 1TWAB 4KHVA 1JJCB 5T1GA 3GTPH 3E9HA 2VQFL 3PF5A 3MEHA 3O13A 3Q0AA 1K0RA 3OYYA 4KHPL 4ID6A 5M5YH 1QNUA 1XMQL 4R4IA 3FHWA 4DU9A 1K3BC 1ZYRD 4HTHA 4UP9A 2A6ED 3HOVB 2F4VL 3NQIA 4OHJA 3F2CA 1LT5D 3I4OA 2LS01 3BZKA 4X3KA 2SDFA 5C3EH 5FJ8H 1EYGA 4OIKA 2JE6I 3KF6B 4B9XA 5ELDA 5C6AA 3NTKA 1K83B 1YNND 3C2PA 4ODGA 1JWUD 3S14H 4AH6A 4L5TA 1MHWC 4GN5A 3PSIA 2Z1CA 1PVOA 1TQOA 3H0GG 3HOXB 4JI5L 4C3HH 1JE4A 3I73A 1NMGA 2B39A 2GVBA 2N3SA 3MXNB 3GTGB 3RMHA 2YV5A 4R4TA 4BY1H 1SDFA 1BQQT 4DR4L 2JA7H 3LWUA 1A8VA 2PI2A 4GKKQ 2L4NA 3K7AH 4A3KG 2JN4A 1CKNB 1F2ZA 3CCLA 3EVQA 2PNHA 1RTNA 1CKMA 1AZPA 3A74A 5I9OA 5D65A 4JI4Q 1FNVA 3J80E 3P7JA 3K6OA 1UE6A 1D6EC 3UE0A 4C3IH 3S16B 3S2HB 1X3FA 2AHOB 1UE5A 5E4XA 1I94Q 1GKHA 2A6HD 1SYEA 1L2FA 1HFGA 3MTSA 2N49A 1DYQA 2QILA 1UUPA 4JW0A 1Y1VG 1GO3E 2F0FA 4JI0L 4IO9A 1A6XA 3HOYH 2AMCB 1RTOA 2K52A 3HZXA 2UUCL 3Q8DA 1WTOA 4DK3C 4C2MH 2JA8H 5CV7A 4B3ML 4K0KQ 4C3HG 4A3MH 1LT3D 2EYLA 3F2DA 4B3TQ 1EIFA 5EPLA 1XTCD 2K03A 1J5EL 2F0JA 4GN4B 5M3FH 1XYIA 2G5DA 3R93A 3CCQA 3H15A 1PFSA 1MJCA 2B2YC 1S4ZA 4WFN3 4KD4A 1KRSA 4H13C 1XMXA 5IT9E 1CHQD 1YZ6A 3KBGA 3QOLA 2IHEA 1E1TA 1TS2A 2G9HD 1GHKA 1EIYB 4A3CH 3J7A5 4WORA 1SMYC 4FDBA 3L0OA 1HQRD 1Y8PB 3ER0A 3I91A 4PG3A 3RLFA 5IE8A 1UEAB 2HHHL 2CVRA 2PW7A 3FEWX 2UXDL 5LMUL 4CKBA 1K73C 3S15H 3G6JB 4KKTA 2FL3A 1CKOA 1J5EQ 1SE8A 2PNRC 1Q1EA 5E3FA 3HOZH 1KC8C 2F0UA 3PCOB 3JAMi 4OO1G 4B3MQ 1X9NA 1BKBA 3TEHB 5K36G 4HJ9A 1VQ8A 1VMPA 3NSWA 4IUPA 4DPGA 3CCMA 2ASBA 1LTGD 2MJ8A 1XMOL 4DV4Q 3OHXC 4IPHA 3AB9A 4A3FH 4V0BA 3S2DH 3DUZA 4YHHQ 3VYTA 1NJIC 2KQ3A 4R8NA 3SK6A 4A3GH 1G8ZD 4DNTB 2JA8G 1TXYA 4CGYB 2F0NA 1GUNA 3AMUA 1FD7D 4B3SQ 3NTIA 2NN6G 1XX8A 3SR1A 2KHJA 3K0XA 2K01A 4IQZA 4JI1Q 3S1MB 2ZM6L 1TKWB 3MXGA 1G6PA 1GXDC 3S24A 1RZNA 3GP7A 2O5JC 2UU9Q 1JE5A 2K28A 1JT8A 1BVSA 1STNA 1HNZL 1RHPA 3DXJC 4K5WA 4JYAL 4UP8A 1STGA 4JI3Q 3SXHA 2E2JH 3VR6A 2CV8A 4JI6L 3EIVA 3GD7A 1I3QH 3TP7A 3PIP3 3OMCA 5JVG3 1M90C 4RFBA 1EWIA 3M7GA 4J15A 1KDBA 1EY4A 2XSCA 3GTOH 4A3DH 4F88A 4K0KL 1ICWA 1U4PA 4K2LA 1A0IA 1BOSA 3ITPA 4DV7Q 2Q8RE 1X3PA 4DA2A 3LWEA 1OO9B 5CV4A 1OB8A 1TWCB 1E2VA 3NPPA 4O42A 4RGMA 3RLNA 1IBKL 4A3BB 1E2ZA 1OXUA 2TMPA 2R93H 4CKEA 1Q8IA 4GKJL 4OGQC 4KY7A 1PFMA 3GTLB 2B2WA 3SK5A 4J6HA 2Q2TA 2Y0SE 2WAQG 1WOCA 1HR0L 2IXSA 2VS1A 3IEYA 5BN3A 4OX9Q 2GN5A 2ALYB 3BDCA 4N9PA 4DNRB 1ASYA 3CRLC 1HR0W 1WJJA 3HRZC 1BCPC 3D6WA 1HRJA 2XRQD 2XN9C 2AQ3B 1VQ4A 3M4QA 4A75A 4BBSB 3M3YB 1Y1OA 3QG1A 4LF9L 4X3UA 1A2UA 4QBOA 2JA5B 2PMZB 2MP1A 1C8CA 2F0DA 5JJLA 5I9PA 1MIUA 3FKIB 2OQ0A 2B2UC 1I94L 2IT1A 1LTRD 2MO1A 2QW7A 1R4QB 1SXTA 4IPCA 4X3TA 1JJGA 1BUVT 3TS2A 1CM9A 1FR3A 1I50H 1LTAD 5GROA 1RODA 4IOCA 5A2QL 5IYBG 1BCPB 2HDMA 2VUMH 2QKIC 3VA7A 1Q8KA 3K5NA 3BVZA 4ZRZA 3AJVB 1QWYA 3MAQA 3CQZB 4JI7L 4GKKL 4NPSA 2A6HC 1KLGD 2K5NA 2OCEA 2CH4A 4DN4M 3PO3B 4FXDA 1EWHA 1PH7A 2R93G 1AE2A 3MA2B 3D0FA 3G7LA 3SGIA 2EXZA 3IKJA 2SNMA 3ULJA 2E5LQ 1EQQA 4DUZL 2NZOA 2F0EA 2UXBL 4QL5A 3TP5A 4DV5Q 3K8AA 3K57A 4K6LA 2EZVA 3CW2C 5D3IB 4JI6Q 3FKIG 4H7BA 4IPDA 3MXNA 2RVLA 4UHVA 4Y7NB 3S1NB 3DWPA 4JBJA 4TKOB 4XQNA 1X54A 4K5XA 4FYDA 4JBMA 5LL6S 4C3JG 2F0GA 1B7YB 2L55A 1A3UA 2V1CC 3BG3A 2XWBB 4HIDA 2IX0A 1IL2A 1WTQA 3IRBA 1A79A 5BR8L 3KYHC 2NN6I 1B3AA 1E2WA 1HZCA 1DOMA 1L1OB 2NBFA 4M1UB 4DR3Q 3GQBA 2RF4A 5IYDH 1HNXQ 2LKVA 3CD6A 1U4LA 1U0LA 4KHZA 1WD1A 4RMFA 1X65A 1X6OA 5GADC 1DOLA 2EY1A 4MTNA 3HOVG 1YITA 3I72A 2RSOA 1O7YA 1SE3A 5IYCG 2NVTH 3PUWA 4DV4L 1PRTD 4E6IA 1KIXA 1CA6A 2UXCL 1X3QA 3HOWH 1DD2A 5KNDA 4EGVA 4ZLTF 1KDCA 1T5EA 4LFBQ 2L11A 2N88A 5ISRA 2NVQB 2K33A 3E0JA 5IGDA 3M4PA 4NXNL 4OIJA 1JICA 3SE0A 2EYHA 5M3MG 2H5XA 4L8JA 3WOEA 1RF2D 3OWEB 1PTOC 3HOZG 3I4LA 1C4QA 3UDXA 3SK8A 5IP9H 1ICFB 4CKCA 2GA4B 3MZ5A 2R92H 1B9NA 1EOVA 1ENCA 3ICEA 5J1ZA 1GVPA 5C0XG 3NBHB 4OWTB 3BZDB 2UUAL 2O4XA 3GV3A 4M8AA 1Y1WB 5CV8A 2KBNA 1A2TA 5CBAE 1Q1BA 4FNFA 1V43A 4C3IG 1B50A 4QBLA 1K8OA 5C4JH 3MXUA 1MSHA 2AKWB 1EIGA 5ELNA 2KENA 4HSPA 4B3TL 1VF7A 1XXGA 3VDYA 1Y1VH 4A3EH 2L15A 3D4WA 2I5HA 4N8X1 4LNQA 3J80L 1LV9A 1TWGB 3R8BA 2F0SA 4HJ5A 3UDGA 4IN3A 3PIO3 1E7ZA 1C0AA 1WCMG 2PZUA 1S5DD 2RCNA 1LTBD 2E2HB 1NR2A 5IGCA 3V05A 2XRSD 4RKLA 3J81E 4E6ZA 3LGJA 2H1EA 1AN8A 2QEXA 2UUBL 3CP0A 1RD9D 2KEEA 3MXPA 5BR8Q 3OPOA 1EYCA 1JR0D 1WVLA 1GEFA 4YWMA 1UE1A 2MPMA 1JWMD 3IFTA 4BBRH 2IX3A 4QUFA 2EVBA 2X6GA 1DOKA 3HOYG 2Z0SA 1B2TA 2O5IC 4HSVA 1A3VA 3NEMA 1FYCA 1V1OA 1MD2D 2V4DA 2EY5A 3B6YA 2EY6A 1TWHH 2NVYH 4A3IH 2JXMB 4DV6L 1J8IA 3M7NA 2K4KA 2AUJD 3G6EA 2NVXH 5DEHA 1TY2A 5GAEC 5C0XI 3I2ZA 1B1ZA 1IZ6A 1HZAA 5M3MH 1FVIA 1TWFB 2O2LD 4JVZA 4G7ZC 2YTXA 1IBLQ 5ELBA 2CQOA 4JOIA 4FF1A 2ZXPA 1WCMB 2A74C 2R7FA 2XGTA 5GQOA 3F8TA 2PZTA 5IP7G 3PQIA 4R4QA 4LMQD 2F0PA 2WP8J 2CH4W 2MQHA 3PUXA 1II3A 2YU9B 1YNJD 1JOQA 1CZWA 1LTSD 2X69A 3CCSA 2WAQE 1EIHA 1I6VC 3RZDB 1PTOH 1PMRA 1QZGA 1N36Q 1C48A 2K32A 4IFDH 4LQEA 2Q8IB 1SRUA 3HKZE 3ZYYX 3I4NB 3FOVA 1H95A 2YYZA 4NB3A 5M5XH 4OO1H 2DNEA 2ZXRA 1TU2B 1VQCA 1CI3M 4YCVA 1D1KA 2K50A 3R2IA 4DR7L 1D5MC 1QE6A 4BA1I 2K5QA 4C1NK 3NWTA 3S17B 5E7NA 2N8NA 1QG7A 1G51A 3KLRA 3SDZA 4DR2Q 1YHBA 5C4ZA 1EOTA 4JI5Q 5C5LA 1UE7A 4JI8L 4DAPA 2UUBQ 1GUTA 4X6AH 4YHHL 3H3VH 3URYA 4ULLA 2E76C 1KD1C 2ZT9C 1YNXA 3JAMc 5JJKA 2HCIA 1YNMA 2K14A 4JCVE 3D3RA 1JQYD 4RHRA 4RHSA 2QGQA 4X62L 3KFUA 3DWAA 4DUZQ 3QIAA 1V1QA 1WYDA 1YI2A 2LSSA 2R3ZA 2WINB 4RKBA 4IUNA 4LJZC 1U9RA 3A54A 5GAHC 4DR6Q 4A3CG 4HMJA 2Z6KC 3HEJA 5JJIA 3UDFA 4JYAQ 5CBEE 4H44C 1STBA 1YJ9A 1JB3A 1CTMA 3ERQA 1KQSA 2L9HA 5C4XH 3M4YA 2B8FA 1Q46A 2LY7A 2OEOA 3EQLC 4HR7B 1F2MA 4QQBX 3GTJB 4H0LC 1KHIA 2XTIA 2B63H 5FO9B 2JEAI 4A3JH 4U673 1JOKA 3WDNA 3J7ZC 1H9SB 2CWPA 5CC4A 2HIXA 1T5XD 2K6AA 5CORA 2EYMA 5IY0A 3GTQB 2JA6G 1N36L 4TSSA 1CSPA 1TS5A 3PO2B 5IGEA 2R92G 1EY7A 3J7AF 1AEXA 1VF5C 2PZWA 4FF3A 1J6QA 1I6HB 2HQLA 2VLDA 2OSTA 1HZ9A 1KL9A 1Q86C 4UP7A 3BVGA 1HZBA 1ENAA 3K7UC 3I4MH 3E5SA 3PUZA 1HNWL 1F1ZA 1DGSA 3PUVA 3VR2A 3OMGA 2C9OA 1ZP7A 2OT2A 1SROA 5AJ3Q 1OTCA 4DR2L 5JOBA 4IFDI 2IJ0A 1STAA 4QB4A 3X3NA 3GTKB 1E1OA 3U9OA 4BBRG 3CF5A 3RNUA 3G71A 3CC2A 3RLOA 3PF4A 2JJQA 1T9HA 2G9DA 3M4OB 4A3DG 4F7XA 4EX5A 3RZOB 2J7ZA 2F0WA 4PZ6A 4IFDJ 4IUTA 1FGBD 4V190 3AEVA 4NXML 3GTPB 1TIID 2FMCA 2CKZB 4YCWA 4YCUA 4LF5L 1PH2A 1X55A 3NBIA 5EPJA 1V1PA 5F2DA 3J7YW 1KABA 2D0OA 2RDFA 1H9KA 1XNRQ 1STYA 5T1IA 4R9WA 4TKDA 2OXPA 5M5YB 5COYA 2DN8A 3IL8A 5IT9L 1S5ED 1AH9A 4MHEA 2F0KA 3RN5A 1EEFD 3J81j 4GOPC 3HOVH 3Q22A 4OX9L 3S1QH 1GUWA 5C3EB 3T1YL 3PMFA 3TN2A 2A19A 1PZJD 3I4NG 2Z6KA 1Y8OB 5KIXA 3WOFA 5M3FG 2WFWA 1CA5A 2BOSA 2OTLA 3A5ZB 1SNQA 4YIJA 4HIOA 1JWSD 3T1HL 1I4PA 4U68A 3S14B 2K75A 2VNUD 3BYTB 4EQNA 1VQMA 1EUJA 2FINB 4UY8C 1SAPA 2D9UA 3PIPA 1N32L 1QJOA 1FNWA 3FVQA 2CHBD 2JK8A 1H9JA 5IP7H 2RQXA 2BH8A 4JOIC 2M2LA 1EY9A 1E0BA 2RHQB 5C0XJ 2ZTCA 3S9WA 4BY1B 3A8KE 3AYHB 3H91A 5E1FA 3A55A 5IP9G 4LF5Q 3T4AC 1VS0A 3QOJA 4GS3A 4LFAQ 4B3RQ 2JA7B 2OTJA 3K7AB 2NZ1D 4ALPA 3E6ZX 2L1BA 4IJHA 3MFGA 4JI3L 2VY3A 1Q7YC 3NQTA 3S16H 1HNZQ 4LF8L 5C3XA 3S2HH 4KKSA 4NP5A 1U4MA 2R7ZH 1KNAA 4EQ5A 2CQAA 3CXCA 4NXNQ 1B3QA 2NTSA 4LF7L 1YJWA 4KY6A 3ERSX 1N8RC 3HOYB 1QVFA 2UXBQ 3HOUB 2KA7A 5J39A 5G3LD 2F0TA 2QDBA 1XPUA 1V1PB 4IPGA 1NCVA 1T0FA 1Y88A 2JP1A 1GJXA 2M00A 5M9OA 2HCCA 2K5WA 4X66Q 1PLFA 2W8MA 1PZKD 2VL6A 3W1BA 3NWSA 1LTLA 1QCBD 1WTXA 1N34Q 4AYBB 4RGOS 3U4ZA 4X3SA 4NW2A 4KTAA 1HNXL 4LUZA 1R11A 2L0CA 1KAAA 2RBMA 1JC7A 1SYDA 3CKIB 2I46A 1IW7D 2F0VA 1D7QA 2AWOA 1RCVD 5KEEA 1LACA 3BVMA 1EL0A 1OXSC 5IGBA 3A56A 2E8GA 2F03A 4A3JG 4BY7H 1NSNS 3HFZB 4DR1Q 2AUKA 1K9MC 2MO0A 1QOHA 1ESFA 3CC4A 3CCEA 3P1ZB 3H94A 1BR9A 3V96A 2NYZD 5D14A 3TMEA 2CCZA 4Y52H 2R7ZG 4YWLA 4GZYC 1N32Q 4C1NI 1VQDA 2D5DA 1EFID 3HOZB 2QCPX 3LX0A 1O7LA 1GD7A 1HNWQ 1SJHD 4LF6Q 5L37A 1VQFA 1EWCA 5FLXc 1STEA 4DUYL 1B9MA 3TRZA 3KBXA 4PV1C 4A3FB 2ES2A 3S2DB 1PXUA 5IT9c 3F2BA 3KJPA 1EY0A 1JCKB 3C46A 1W2BA 4B9WA 4DKAC 1SFOH 2WB1G 4KHPQ 2IPKD 4HN7A 1W6KA 4PQXA 5BN5A 3S1MH 2F52A 4Q5VA 4A4IA 1PYBA 3CAMA 5IOCA 4DV6Q 1Y69U 1CT1D 2RCFA 1BO0A 2K05A 1K8MA 2LXKA 2PI2E 2DJFC 2ZJQA 2Z6BA 1IXRA 1I4RA 2EYOA 3OSOA 2EXDA 1PH5A 2J4XA 2E2JB 3IFDA 4IFDG 2ZM6Q 1CFMA 1I3QB 3N6RA 5CR3A 4XYOA 4K8JA 2EE1A 3V2TA 1GM5A 3EFXD 2B2TC 2INBA 1BDOA 4FF4A 3GTOB 1QILA 4A3DB 2D0PA 2CFMA 1SNOA 4QY7A 4DUYQ 3SK4A 4JBKA 2ZJRA 1CKNA 5KRUA 5I6WA 2PPBC 3I8ZA 3BS1A 4DGZA 3HKZB 3DM1A 4OELB 4A3BH 1DONA 4KN4C 4BS9A 1S5CD 4JI2Q 5M5WB 3AU7A 4GOPA 4XXEA 2EJMA 1XWEA 1M4VA 4LFCL 4CDEC 2KECA 4LAAA 3GDEA 1PH4A 4LW1A 3GTLH 2VB2X 3GO5A 2QDLA 4L6TB 4LUOA 4QIWB 1D2BA 2XNAC 4G57A 4P2CB 2YTYA 4DV3Q 1XPOA 4A76A 1DJRD 3MEFA 4PMCA 2F4VQ 1VQAA 1LTTD 4A93H 4G6VA 3CCJA 2XIWA 4A3EG 4JI4L 3T13A 4G6UA 1NTGA 2KOLA 3QJYA 5HGTA 3U58A 1ZXTA 3M3YH 5CV5A 2HHHQ 4RG1A 2CZRA 3JAME 2CW0C 2JA5H 1O78A 1PTOD 3D6CA 1O7IA 1QVCA 2F4IA 5EKIA 4K14A 2F0IA 3ONAB 1CHPD 1ML0D 1TT2A 3PGZA 3VYUA 5KYLA 4HAEA 1E24A 4KLKA 2ZXOA 5ELCA 1FGUA 4ME3A 4EQPA 5LMNL 1IPIA 1PTOF 1EYDA 1KNEA 2VXWA 1XNQQ 3NTHA 2VUMB 2JSOA 2Z4IA 2WJ0A 2EO0A 1F9QA 4P71A 3QB3A 1YBYA 2FLCA 4TQUS 3R3OA 1V9PA 3EA6A 5CYUA 3KOJA 2JA6B 4J8QA 5FLMG 3PO3H 1G91A 4ABNA 4HMIA 1CSQA 1MSGA 4JG2A 5E4WC 1EY8A 4GLXA 2F1MA 3I90A 4HJAA 2ICIA 1CZGA 2LFNA 5ELFA 3ZJYC 4LF8Q 2B2VC 1S5FD 4IOAA 3KF8A 2ENBA 1PH8A 1VQKA 4KN7C 1LUZA 2JYOA 1L0YB 1SMXA 3S1RB 4FP5D 5C44H 1K8AC 4C56C 3P1HA 4Y7NH 2RHSB 1XJVA 1PYSB 3D4DA 3HGBA 1ZKOA 2EY2A 1LYLA 1I4QA 1RKNA 1I4GA 1SNCA 2BE5C 4A3LH 3NENA 2KCCA 3MHBA 2LXJA 1RL2A 1YEZA 4O2DA 3H6MA 5KNCA 4FXGC 5G3LF 3GTMB 2E2IB 5EJWA 1RIPA 2X6LA 4KKUA 4DV5L 4S3SA 1R9TB 2ZYZA 1ENFA 4K8IA 4R4OA 4FVMA 1S3OA 5ELOA 4B3SL 1BNZA 4XDXA 3C1EA 2OWOA 4C3JB 1IYVA 2IHFA 2NVTB 4PNYA 5J3BA 4RH6A 2ID0A 1STHA 2FJ2A 1VQ5A 1B8AA 3T56B 3Q24A 2UUCQ 2MUYA 1SNDA 3D4RA 4HJ8A 3HOWB 1IW7C 4OONA 4KJNA 3KDFB 3I3CA 2Y0SG 3U50C 1BBWA 3H0GB 3HOXG 3R2TA 2B2WC 2EJGC 3KJOA 2RDGA 1P16A 1LT6D 5K36H 1D5ZC 2B2TA 4A3KH 1VQIA 1PRTF 1SNPA 1DM0B 4JI0Q 2HDLA 5LMNQ 2B2UA 1OXTA 2IW3A 1M8AA 1CQVA 1L0WA 4XYQA 1PV4A 4OEMB 5FLMH 3PO3G 1HA5A 1ESRA 1TWAH 2WB1B 3J7AV 2WKDA 4F8MA 1YVCA 1W6JA 4AYBE 1HJPA 2JA9A 5IYDG 2F0QA 3JC66 3H3VI 5KGUA 4RGNA 1EEID 3P1ZA 4YY3L 5IIFA 5H1SE 3BZCA 4UPAA 3IAYA 4KD3A 1HCZA 1B44D 2DJGC 1Y1WH 1EZ8A 2XVSA 3CCVA 2EYFA 4EVOA 1LM0A 1F9SA 1I5FA 1G6ZA 5C44G 3HOWG 5C4JB 3I4MG 1KXLA 4DFAA 1L1OA 1PH6A 4JI2L 5JJZA 4J1MA 2B2VA 1X3GA 1Y1VB 3E3XA 1K83H 1TS3A 1SJED 3I56A 1R4PB 4LF6L 1CUKA 4DV3L 1G2TA 4RWSC 4HEDA 3Q6SA 2NUCA 2BDOA 3HOXH 4DV0Q 4C3HB 5HGQA 5C5MA 5BN4A 2LMCB 3CMAA 1O80A 1JJ2A 4HCSA 4YWKA 1H9MA 5A2QE 1MBYA 1PHJA 3GTGH 4R8IA 4MIUA 1YIJA 4OXPA 1LO5D 4QCLA 5EPKA 4DR1L 3BJUA 1H9RA 4BBRB 3L2PA 4YY3Q 2NB0A 2VQEL 1EQVA 4R4CA 1WTVA 4I65A 3TS0A 3C3LA 4JV5Q 1FL0A 5HURA 3HS0C 1A15A 4JI1L 3NHHA 4LF4Q 1TWHB 2NVYB 5J22A 4A3IB 4C3IB 3DEOA 1Y8NB 3TSSA 1VQPA 3OWFA 3EJIA 1TY0A 3OIPA 1Y1WG 4L5RC 5AFWA 4BY7G 5C4XG 1PH9A 3DHQA 5JEAJ 1TWFH 5FKAC 1MGSA 2A69D 1RJTA 1PH3A 3HOUG 3NK9A 4EV1A 1WCMH 3KLSX 1WFQA 2PQAA 1OB9A 1EYAA 2MGSA 3CMEA 1UAPA 4I7AA 3W5OA 2N55A 4POFA 2HD3A 2OF1A 2A1AA 4C2MB 2VUMG 2E2DC 4WJ4A 2CW0D 2JA8B 1Z9FA 3DWQA 1SE4A 4A3MB 3F2UA 2CWAA 3LNNA 5M3FB 1PTOB 4X65L 2Z4HA 3NUCA 1PH1A 4A3BG 4ME5A 4K2KA 1HA6A 2HT1A 3A5UA 3A8IE 4HIMA 4F87A 1LLRD 5M5XB 4DAVA 3AJVA 5EKKA 3FP9A 2EIFA 1JMCA 2KVMA 2RKSA 4LF9Q 2Q8TA 4N9TA 4DK0A 4QGUA 4GOPB 2NN6H 5CMDA 1ILQA 2B2YA 4GLAC 2PCFB 5EBCA 1KLUD 4R1JA 3S17H 1FNUA 4IZ8A 1K28A 1K3RA 4TRDA 1EZ6A 5K5PA 4K5VA 3ND9A 4DAYA 3S15B 3NP8A 3MFYA 4DV0L 2B29A 1I4XA 2BDNA 3OTOQ 2A69C 1H9SA 5FDKA 1EQTA 2GW6A 4CDFC 1MKHA 2RA4A 1D5XC 3JAML 4ZYSA 5I6YA 1HH2P 1NAPA 4LK1C 4X64L 1KTKA 4DV2L 4A3GB 1M1KC 3BU2A 1JB7A 4RA8A 1N33L 1RLVA 4KK7A 1ILPA 3EBEA 4RGTA 1S40A 4CHTB 3E9IA 5TSSA 1Z7TA 1CK1A 3DM3A 1L0XB 1SBBB 5C3WA 3KK7A 4DV1L 5C4XB 1VQLA 4BWGB 1IHZA 1AZQA 3N52A 4NDXA 1PDQA 4WRDA 2ZYZB 1I4HA 2HIVA 2MFIA 4QF4A 1O7ZA 2DY8A 4B3RL 1JORA 2KUMA 1J9OA 5EGTA 4A3JB 1PA6A 1UNSA 4CBVA 1IL8A 5C0XH 2FMMA 2FCOA 2QEJC 3P75A 3CPFA 1YNJC 1HUNA 1SR3A 4BXXG 3ULPA 4DR5L 1TWCH
chains in the Genus database with same CATH topology
1RDPD 3K5OA 4IUQA 2Z0RA 3W2DA 5C4HA 4DXGA 2D62A 2R93B 4ZQUA 4RCNA 1SMYD 4O1NA 2KHSA 3Q23A 4JBWA 1HHVA 3EROA 5FO7B 1ET9A 3CHBD 2PO4A 1EY6A 3T16A 4DXFA 3L9AX 4XQQA 2WACA 1EU3A 5A35A 2A6EC 2F0LA 4KJOA 1A3TA 4K6DA 1GUSA 2WV6D 3A7LA 3TDQA 3U9SA 1I50B 4RCOA 1BXTA 2DNCA 3VYSA 3FMCA 4IURA 1F77A 2A73B 2EYPA 2WCWA 1BBXC 3TP6A 1UWVA 4XQJA 2WKCA 5DNFA 2J0TD 2SEBD 2OKFA 3S1QB 3NXWA 3BDOA 2FHTA 3VYRA 4ILWA 3TZDA 3FDTA 5FLXL 1GHJA 4IALA 4FF2A 5DAUA 2IL8A 2WIZA 3NE5B 1S5BD 2WCZA 2D2CC 4IUVA 3MC0B 3SVMA 5LHY1 3VR5A 3T51B 2F0HA 4CJ2C 2NTTA 1AP0A 4JK1C 5NUCA 4PMWA 1IKLA 5EKLA 3GV6A 5CV6A 4KY5A 1WTRA 1F9PA 4NKLA 1SSOA 3T53B 1TS4A 5FK9C 3TP8A 4HCEA 1Q90A 2K7VA 2BA1A 2R7ZB 3VR3A 1HXYD 1MI2A 1PRTB 1WTWA 2WIIB 3BYYB 1R0VA 4PMBA 2ICEC 3K0YA 3UI2A 1SYCA 2E74C 4NMZA 1PFNA 4QMGA 2PW5A 3D8GA 1ET6A 3ND8A 3VR4A 4OO1I 3P1YA 4XTCS 2R92B 1SE2A 3FPUB 4Q0FA 2PYKA 4QBNA 2RDHA 4KI0A 3K59A 2DBSA 5KYIA 1HTPA 5JPNC 5I4DA 2A5HA 2EDGA 3W3AA 2L12A 4KV6A 1IKMA 5CGKA 2R61A 2M9VA 4CJ0B 5JEAG 1VDZA 4OL7A 4IUUA 3IEYB 3QWNA 1Z47A 3CRKC 3OW7A 4BY7B 3VA5A 1VCIA 4UAIA 1D1IA 3KLSA 2F3WA 1Z6HA 4A3EB 3CU7A 4BA2I 2FFKB 3HP3A 4ZAIA 1KDAA 5LL6X 5FLXE 3NBHA 1HPCA 4Z9CB 4G7HC 1LT4D 1SYFA 5IODA 1YNNC 5I2YA 3L3OC 1ONLA 1DCZA 2Y0SB 2PQEA 2VB3X 4ZKCB 1AFPA 2E75C 5I2XA 3RUZA 3K5MA 1DXMA 3DEPA 1WTPA 3BDLA 4QUCA 4DK1A 1SFOB 3H09A 1CQFA 2BCOA 3PV0A 1WD0A 4UDUC 2EJFC 2DY7A 2EPBA 1SYBA 1GOZA 5IGGA 2HQEA 2NVXB 5CV9A 2FKHB 5M3MB 2R6GA 2C5CA 3HG9A 3RD4A 3H3VC 1HFNA 2F3VA 4DF7A 3MVVA 4XT3B 3IF0X 1F9RA 4L63B 1BF4A 1BCPF 4ZK9B 1JOOA 3TZUA 1HUMA 1EU4A 5KNBA 3FPPA 1Q12A 4EQOA 2QF7A 1GUOA 4CJ1B 3PUYA 4XT1B 1EY5A 2BE5D 5DM73 1F2LA 3I70A 2AQ2B 2HUGA 1SYGA 1DZ1A 1GUGA 5JVH3 1TVXA 2MHVA 1IYUA 4ZUJA 1OXVA 5D3DA 2B8GA 4A93B 1G2SA 3SHLA 2KCNA 1Q3LA 5JAVA 5ELEA 1PYWD 1HQMC 1ZYRC 2AQ1B 2H4OA 1PZID 3D31A 1PFBA 5EQ0A 4RAUC 2SOBA 3DMUA 2EOTA 1QB5D 4G4KA 3K5LA 2EYJA 3OOCA 3DNXA 1B4OA 1SNMA 2Z8LA 4TKKA 4B08A 2BA0A 2GJWA 4WJWA 1QNKA 1U4RA 5FOBB 1TR5A 3OIQA 4MN3A 1LTID 1NUCA 2A68D 5JPMC 4I7ZC 2IWHA 4G7OC 2WAQB 1F2YA 1OXXK 3K58A 1NR4A 1LABA 3M85A 1HH1A 3J81L 1B53A 5DM63 2KEDA 5C44B 4XIGS 2JEBI 3SEBA 4KMUC 2B63B 2NWGA 1HTLD 2F0OA 3MWYW 5FO8B 2SNSA 2XWJB 5JEAH 2WIWA 2I07B 2KJXA 1X32A 1SEBD 4ZUIA 2TSSA 3A8JE 1ZEQX 4FXKC 3BT7A 2BH2A 2AWNA 4FO2A 5IGFA 3A7AB 2K04A 2RSNA 5EBDA 1V8QA 2A68C 1BCPD 1PRTC 3P20A 3I4MB 3L7ZC 1VMCA 3KUPA 3QO2A 2FKCA 4ZQ3A 2L5TA 2K5DA 3FRPB 4A3KB 4ZKBB 2IX1A 2K1BA 3TBIB 3X3MA 1AW7A 2F0MA 3C1FA 1G291 1TWAB 4KHVA 5T1GA 3MEHA 3O13A 3Q0AA 4ID6A 1QNUA 4DU9A 1ZYRD 4HTHA 2A6ED 3HOVB 3NQIA 4OHJA 1LT5D 2LS01 4X3KA 2SDFA 4OIKA 2JE6I 4B9XA 5ELDA 5C6AA 3NTKA 1K83B 1YNND 3C2PA 4ODGA 1JWUD 2Z1CA 1TQOA 3HOXB 1JE4A 3I73A 2B39A 3GTGB 3RMHA 1SDFA 1BQQT 3LWUA 2L4NA 1F2ZA 3EVQA 1RTNA 1AZPA 5I9OA 5D65A 1FNVA 3J80E 3P7JA 3K6OA 1D6EC 3S16B 3S2HB 5E4XA 2A6HD 1SYEA 1HFGA 3MTSA 1DYQA 2QILA 1UUPA 2F0FA 1A6XA 1RTOA 3HZXA 1WTOA 5CV7A 4C3HG 1LT3D 2EYLA 5EPLA 1XTCD 2K03A 2F0JA 1XYIA 3R93A 2B2YC 1S4ZA 4WFN3 4KD4A 4H13C 1XMXA 5IT9E 1CHQD 3KBGA 3QOLA 1TS2A 2G9HD 1GHKA 4WORA 1SMYC 1HQRD 1Y8PB 3I91A 3RLFA 1UEAB 2CVRA 2PW7A 3FEWX 4CKBA 3G6JB 4KKTA 2FL3A 2PNRC 1Q1EA 5E3FA 2F0UA 4OO1G 5K36G 1VMPA 3NSWA 4IUPA 1LTGD 2MJ8A 3OHXC 3AB9A 4V0BA 3DUZA 3VYTA 2KQ3A 4R8NA 3SK6A 1G8ZD 4DNTB 4CGYB 2F0NA 1GUNA 3AMUA 1FD7D 3NTIA 2NN6G 1XX8A 3SR1A 4IQZA 2K01A 3S1MB 1TKWB 3MXGA 1GXDC 1RZNA 3GP7A 2O5JC 2K28A 1STNA 1RHPA 3DXJC 4K5WA 1STGA 3SXHA 3VR6A 2CV8A 3GD7A 3TP7A 3PIP3 3OMCA 5JVG3 4RFBA 3M7GA 1KDBA 1EY4A 2XSCA 4F88A 1ICWA 1U4PA 4K2LA 1BOSA 3ITPA 2Q8RE 1X3PA 4DA2A 3LWEA 1OO9B 5CV4A 1OB8A 1TWCB 1E2VA 3NPPA 4O42A 4RGMA 4A3BB 1E2ZA 1OXUA 2TMPA 4CKEA 1Q8IA 4OGQC 4KY7A 1PFMA 3GTLB 2B2WA 3SK5A 4J6HA 2IXSA 2VS1A 3IEYA 5BN3A 3BDCA 4N9PA 4DNRB 3CRLC 3HRZC 1BCPC 3D6WA 1HRJA 2XRQD 2XN9C 2AQ3B 4BBSB 3M3YB 1Y1OA 3QG1A 4X3UA 1A2UA 4QBOA 2JA5B 2PMZB 2MP1A 1C8CA 2F0DA 5I9PA 3FKIB 2B2UC 2IT1A 1LTRD 1R4QB 1SXTA 4X3TA 1BUVT 1CM9A 1FR3A 1LTAD 1RODA 5A2QL 1BCPB 2HDMA 2QKIC 3VA7A 3K5NA 4ZRZA 3BVZA 3AJVB 3MAQA 1QWYA 3CQZB 2A6HC 1KLGD 4DN4M 3PO3B 4FXDA 1EWHA 3MA2B 3G7LA 2EXZA 3IKJA 2SNMA 2F0EA 3TP5A 3K57A 4K6LA 2EZVA 5D3IB 4H7BA 3MXNA 2RVLA 4Y7NB 3S1NB 3DWPA 4TKOB 4XQNA 4K5XA 4FYDA 5LL6S 4C3JG 2F0GA 2L55A 1A3UA 3BG3A 2XWBB 2IX0A 1WTQA 1A79A 2NN6I 1B3AA 1E2WA 1DOMA 2NBFA 4M1UB 3GQBA 2LKVA 1U4LA 4KHZA 1WD1A 1DOLA 2EY1A 3I72A 2RSOA 1O7YA 1SE3A 3PUWA 1PRTD 4E6IA 1CA6A 1X3QA 1DD2A 5KNDA 4EGVA 4ZLTF 1KDCA 1T5EA 2L11A 2N88A 5ISRA 2NVQB 2K33A 3E0JA 5IGDA 4OIJA 1JICA 3SE0A 2EYHA 4L8JA 3WOEA 1RF2D 3OWEB 1PTOC 3I4LA 1C4QA 3SK8A 4CKCA 2GA4B 3MZ5A 1B9NA 1ENCA 5J1ZA 5C0XG 3BZDB 2O4XA 3GV3A 4M8AA 1Y1WB 5CV8A 1A2TA 5CBAE 1Q1BA 4FNFA 1V43A 4C3IG 1B50A 4QBLA 1K8OA 3MXUA 1MSHA 1EIGA 4HSPA 1VF7A 1XXGA 3D4WA 3J80L 1LV9A 1TWGB 3R8BA 2F0SA 4IN3A 3PIO3 2PZUA 2E2HB 1S5DD 1LTBD 1NR2A 5IGCA 3V05A 2XRSD 4RKLA 3J81E 4E6ZA 2H1EA 1AN8A 1RD9D 2KEEA 3MXPA 3OPOA 1EYCA 1JR0D 1WVLA 1GEFA 2MPMA 1JWMD 3IFTA 2IX3A 4QUFA 2EVBA 2X6GA 1DOKA 1B2TA 2O5IC 4HSVA 1A3VA 1FYCA 1V1OA 1MD2D 2V4DA 2EY5A 2EY6A 2JXMB 1J8IA 3M7NA 2AUJD 5DEHA 1TY2A 5C0XI 1B1ZA 1TWFB 2O2LD 4G7ZC 5ELBA 4FF1A 2ZXPA 1WCMB 2A74C 2PZTA 4LMQD 2F0PA 2WP8J 3PUXA 1II3A 2YU9B 1YNJD 1JOQA 1CZWA 1LTSD 2X69A 1EIHA 1I6VC 3RZDB 1PTOH 1PMRA 1C48A 2K32A 4IFDH 4LQEA 2Q8IB 3ZYYX 3I4NB 3FOVA 2YYZA 4OO1H 2DNEA 2ZXRA 1TU2B 1CI3M 1D1KA 3R2IA 1D5MC 1QE6A 4BA1I 2K5QA 4C1NK 3NWTA 3S17B 1QG7A 3KLRA 3SDZA 5C4ZA 1EOTA 5C5LA 4DAPA 1GUTA 3URYA 4ULLA 2E76C 2ZT9C 2HCIA 1YNMA 3D3RA 1JQYD 4RHRA 4RHSA 3DWAA 3QIAA 2WINB 2R3ZA 4RKBA 4IUNA 4LJZC 1U9RA 3A54A 4HMJA 3HEJA 5CBEE 4H44C 1STBA 1JB3A 1CTMA 3ERQA 2L9HA 3M4YA 2B8FA 2LY7A 2OEOA 3EQLC 4HR7B 1F2MA 3GTJB 4H0LC 5FO9B 2JEAI 4U673 1JOKA 3WDNA 1H9SB 5CC4A 1T5XD 2K6AA 5CORA 2EYMA 3GTQB 4TSSA 1TS5A 3PO2B 5IGEA 1EY7A 3J7AF 1AEXA 1VF5C 2PZWA 4FF3A 1I6HB 2VLDA 2OSTA 3BVGA 1ENAA 3E5SA 3PUZA 1F1ZA 3PUVA 3VR2A 3OMGA 2C9OA 1ZP7A 2OT2A 4IFDI 5JOBA 2IJ0A 1STAA 4QB4A 3X3NA 3GTKB 3U9OA 2JJQA 2G9DA 3M4OB 4F7XA 3RZOB 2J7ZA 2F0WA 4IFDJ 4IUTA 1FGBD 4V190 3GTPB 1TIID 2FMCA 3NBIA 5EPJA 1V1PA 5F2DA 3J7YW 1KABA 2RDFA 1H9KA 1STYA 5T1IA 4R9WA 4TKDA 2OXPA 5M5YB 5COYA 2DN8A 3IL8A 5IT9L 1S5ED 4MHEA 2F0KA 1EEFD 3Q22A 1GUWA 5C3EB 3PMFA 3TN2A 1PZJD 1Y8OB 5KIXA 3WOFA 1CA5A 2BOSA 1SNQA 4YIJA 1JWSD 1I4PA 4U68A 3S14B 2VNUD 3BYTB 4EQNA 2FINB 1SAPA 2D9UA 1QJOA 1FNWA 3FVQA 2CHBD 1H9JA 2RQXA 2M2LA 1EY9A 1E0BA 5C0XJ 3S9WA 4BY1B 3A8KE 3H91A 5E1FA 3A55A 3T4AC 3QOJA 2JA7B 3K7AB 2NZ1D 3E6ZX 2L1BA 3MFGA 3NQTA 5C3XA 4KKSA 4NP5A 1U4MA 1KNAA 2CQAA 2NTSA 4KY6A 3HOYB 3HOUB 2KA7A 5J39A 5G3LD 2F0TA 2QDBA 1V1PB 1NCVA 1T0FA 1Y88A 2JP1A 1GJXA 2M00A 5M9OA 2HCCA 2K5WA 2W8MA 1PLFA 1PZKD 3NWSA 1QCBD 1WTXA 4AYBB 4RGOS 4X3SA 4NW2A 4KTAA 1R11A 2L0CA 1KAAA 2RBMA 1JC7A 1SYDA 3CKIB 2I46A 1IW7D 2F0VA 2AWOA 1RCVD 5KEEA 1LACA 3BVMA 1EL0A 5IGBA 1OXSC 3A56A 2F03A 1NSNS 2AUKA 1QOHA 1ESFA 3P1ZB 3H94A 1BR9A 3V96A 2NYZD 5D14A 3TMEA 4GZYC 4C1NI 2D5DA 1EFID 3HOZB 2QCPX 3LX0A 1O7LA 1SJHD 1EWCA 1STEA 1B9MA 3KBXA 4PV1C 4A3FB 3S2DB 1PXUA 1EY0A 1JCKB 3C46A 4B9WA 2IPKD 4HN7A 1W6KA 4PQXA 5BN5A 4Q5VA 5IOCA 1Y69U 1CT1D 1BO0A 2K05A 1K8MA 1I4RA 2EYOA 3OSOA 2J4XA 2E2JB 3IFDA 4IFDG 1CFMA 1I3QB 3N6RA 5CR3A 4XYOA 4K8JA 2EE1A 3V2TA 3EFXD 2B2TC 2INBA 1BDOA 4FF4A 3GTOB 1QILA 4A3DB 1SNOA 3SK4A 5KRUA 5I6WA 2PPBC 3I8ZA 3BS1A 4DGZA 3HKZB 3DM1A 1DONA 4KN4C 4BS9A 1S5CD 5M5WB 3AU7A 4XXEA 2EJMA 1XWEA 1M4VA 2KECA 4LAAA 2VB2X 3GO5A 4L6TB 4QIWB 1D2BA 2XNAC 4G57A 4P2CB 1DJRD 4PMCA 1LTTD 4G6VA 2XIWA 3T13A 4G6UA 2KOLA 3QJYA 5HGTA 1ZXTA 5CV5A 2CZRA 3JAME 2CW0C 1O78A 1PTOD 3D6CA 2F4IA 5EKIA 4K14A 2F0IA 3ONAB 1CHPD 1ML0D 1TT2A 3VYUA 5KYLA 4HAEA 2ZXOA 5ELCA 4EQPA 1IPIA 1PTOF 1EYDA 1KNEA 2VXWA 3NTHA 2VUMB 2JSOA 2Z4IA 2WJ0A 2EO0A 1F9QA 2FLCA 3QB3A 4TQUS 3R3OA 3EA6A 5CYUA 2JA6B 4J8QA 1G91A 4ABNA 4HMIA 1MSGA 5E4WC 1EY8A 2F1MA 3I90A 2ICIA 1CZGA 2LFNA 5ELFA 2B2VC 1S5FD 3KF8A 2ENBA 4KN7C 2JYOA 1L0YB 3S1RB 4FP5D 4C56C 3P1HA 3HGBA 3D4DA 1ZKOA 2EY2A 1RKNA 1I4QA 1I4GA 1SNCA 2BE5C 2KCCA 3MHBA 3H6MA 5KNCA 4FXGC 5G3LF 3GTMB 2E2IB 5EJWA 2X6LA 4KKUA 4S3SA 1R9TB 2ZYZA 1ENFA 4K8IA 4FVMA 1BNZA 4XDXA 3C1EA 4C3JB 1IYVA 2NVTB 4PNYA 4RH6A 2ID0A 1STHA 2FJ2A 3T56B 3Q24A 2MUYA 1SNDA 3D4RA 3HOWB 1IW7C 4KJNA 3I3CA 3H0GB 3R2TA 2B2WC 2EJGC 2RDGA 1LT6D 5K36H 1D5ZC 2B2TA 1PRTF 1SNPA 1DM0B 2HDLA 2B2UA 1OXTA 2IW3A 1M8AA 1CQVA 4XYQA 1HA5A 1ESRA 2WB1B 3J7AV 2WKDA 4F8MA 1W6JA 2F0QA 5KGUA 4RGNA 1EEID 3P1ZA 5IIFA 3IAYA 4KD3A 1HCZA 1B44D 1EZ8A 2XVSA 2EYFA 4EVOA 1F9SA 1G6ZA 5C4JB 4DFAA 5JJZA 4J1MA 2B2VA 1Y1VB 1TS3A 1SJED 1R4PB 1G2TA 4RWSC 4HEDA 3Q6SA 2NUCA 2BDOA 4C3HB 5C5MA 5BN4A 2LMCB 1O80A 4HCSA 1H9MA 5A2QE 1MBYA 4R8IA 4MIUA 1LO5D 4QCLA 5EPKA 1H9RA 4BBRB 2NB0A 1EQVA 1WTVA 4I65A 3C3LA 5HURA 3HS0C 1A15A 3NHHA 4A3IB 1TWHB 2NVYB 5J22A 4C3IB 3DEOA 1Y8NB 3TSSA 3OWFA 3EJIA 1TY0A 3OIPA 5AFWA 3DHQA 5JEAJ 5FKAC 1MGSA 2A69D 1RJTA 3NK9A 4EV1A 3KLSX 1OB9A 1EYAA 2MGSA 1UAPA 2N55A 2OF1A 4C2MB 2E2DC 2CW0D 2JA8B 3DWQA 1SE4A 4A3MB 3F2UA 3LNNA 5M3FB 1PTOB 2Z4HA 3NUCA 4ME5A 4K2KA 1HA6A 3A8IE 4F87A 1LLRD 5M5XB 4DAVA 3AJVA 5EKKA 2KVMA 2RKSA 2Q8TA 4N9TA 4DK0A 2NN6H 5CMDA 1ILQA 2B2YA 2PCFB 5EBCA 1KLUD 1FNUA 4IZ8A 4TRDA 1EZ6A 5K5PA 4K5VA 3ND9A 4DAYA 3S15B 3NP8A 3MFYA 1I4XA 2BDNA 2A69C 1H9SA 5FDKA 1EQTA 2GW6A 2RA4A 1D5XC 3JAML 4ZYSA 5I6YA 1NAPA 4LK1C 1KTKA 4A3GB 4RA8A 1RLVA 4KK7A 1ILPA 4RGTA 4CHTB 5TSSA 1Z7TA 1CK1A 1L0XB 1SBBB 5C3WA 3KK7A 5C4XB 4BWGB 1IHZA 1AZQA 3N52A 4NDXA 1PDQA 4WRDA 2ZYZB 1I4HA 4QF4A 1O7ZA 2DY8A 1JORA 2KUMA 1J9OA 5EGTA 4A3JB 1UNSA 4CBVA 1IL8A 5C0XH 2FMMA 2FCOA 2QEJC 3P75A 1YNJC 1HUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DA2 A;  4DAV A;  4DAP A; 
#chains in the Genus database with same CATH topology
 1RDP D;  3K5O A;  4IUQ A;  2Z0R A;  3W2D A;  3A0J A;  5C4H A;  4DXG A;  2D62 A;  2R93 B;  3PO2 H;  2VZA A;  4ZQU A;  4PZ8 A;  3J81 i;  4RCN A;  1SMY D;  4L5Q A;  2ATW A;  1XMQ Q;  4O1N A;  2KHS A;  3Q23 A;  3AQQ A;  2NZH A;  4JBW A;  1QVG A;  1HHV A;  1EFW A;  3ERO A;  1VQ9 A;  5FO7 B;  1ET9 A;  3CHB D;  2PO4 A;  1UEB A;  1EY6 A;  3T16 A;  4DXF A;  3K81 C;  2A8V A;  4BBS H;  3L9A X;  4XQQ A;  2WAC A;  1VQB A;  1EU3 A;  4MTK A;  5A35 A;  4LF4 L;  2A6E C;  3KLW A;  2F0L A;  4KJO A;  1A3T A;  3FKI H;  4K6D A;  1FJG L;  1IBL L;  3M4O H;  1GUS A;  2WV6 D;  1YJN A;  3A7L A;  3TDQ A;  3U9S A;  1MJE A;  4PZ7 A;  3CCR A;  1I50 B;  4DR4 Q;  4RCO A;  1BXT A;  2DNC A;  2I5M X;  3VYS A;  3FMC A;  4X62 Q;  4IUR A;  4AQY L;  1F77 A;  3CQZ H;  4LFA L;  2A73 B;  2EYP A;  2WCW A;  3QR8 A;  1BBX C;  2P5Z X;  3TP6 A;  1UWV A;  4XQJ A;  2WKC A;  5DNF A;  4BXX H;  5LMN W;  2B3G A;  4OWW B;  2J0T D;  2SEB D;  4X64 Q;  4LUV A;  2OKF A;  4LFC Q;  3S1Q B;  3NXW A;  3BDO A;  2FHT A;  3VYR A;  4ILW A;  3TZD A;  3FDT A;  3UDI A;  5FLX L;  3J80 c;  1C7Y A;  4JPB W;  1U5K A;  1GHJ A;  4IAL A;  1L1O C;  4FF2 A;  5DAU A;  2IL8 A;  4N8F A;  2WIZ A;  3NE5 B;  1S5B D;  4IJL A;  2WCZ A;  2D2C C;  4P73 A;  4IUV A;  3MC0 B;  3SVM A;  5LHY 1;  3VR5 A;  3T1Y Q;  3S1N H;  3T51 B;  2F0H A;  4APV A;  1E22 A;  2PQA B;  4DR3 L;  5DLQ E;  2VQF Q;  3K80 C;  3HKS A;  4CJ2 C;  3CC7 A;  2NTT A;  1AP0 A;  4JK1 C;  3AFQ A;  5NUC A;  4DR5 Q;  1VQH A;  5C3E G;  4PMW A;  1IKL A;  1B70 B;  5EKL A;  4GNX B;  3GV6 A;  2KCM A;  3I7F A;  1NNX A;  5CV6 A;  4KY5 A;  4CDD C;  1KAW A;  5IWA L;  1WTR A;  1F9P A;  1IBM Q;  4POG A;  4JV5 L;  3F1Z A;  4NKL A;  1SSO A;  2C35 B;  1TS4 A;  3T53 B;  4HIK A;  1X56 A;  5FK9 C;  1X3E A;  4HCE A;  3TP8 A;  4DR6 L;  1Q90 A;  2F3I A;  2K7V A;  4AIM A;  2BA1 A;  2R7Z B;  3VR3 A;  1HXY D;  1MI2 A;  1PRT B;  1WTW A;  4GKJ Q;  1K0S A;  5IYB H;  2WII B;  3BYY B;  1R0V A;  1QUQ B;  4PMB A;  3RR5 A;  3T1H Q;  1N33 Q;  2NVQ H;  1W3S A;  2ICE C;  3K0Y A;  3HOU H;  3UI2 A;  4GLV B;  1SYC A;  2E74 C;  3STB C;  4NMZ A;  1PFN A;  4QMG A;  4DK6 C;  2PW5 A;  2WB1 E;  3D8G A;  1ET6 A;  3ND8 A;  4JC0 A;  3VR4 A;  4A3L G;  4OO1 I;  4QIW E;  2ZTE A;  3P1Y A;  4XTC S;  2DGY A;  2R92 B;  1SE2 A;  3FPU B;  4Q0F A;  2PYK A;  4QBN A;  2RDH A;  4KI0 A;  1EQR A;  3K59 A;  2DBS A;  1IYJ B;  5KYI A;  1BBU A;  1HTP A;  5JPN C;  1AE3 A;  5I4D A;  2A5H A;  1IBM L;  2EDG A;  3W3A A;  4KV6 A;  2L12 A;  1IKM A;  4DR7 Q;  1Y14 B;  5CGK A;  2R61 A;  2M9V A;  4DAY B;  5HY6 A;  4CJ0 B;  5JEA G;  1VDZ A;  4OL7 A;  4O0A A;  4IUU A;  3IEY B;  3QWN A;  1Z47 A;  3CRK C;  3OW7 A;  2VQE Q;  4BY7 B;  1XTD A;  2GVA A;  3VA5 A;  1VCI A;  4A3M G;  1ASZ A;  4UAI A;  1D1I A;  3KLS A;  2F3W A;  1Z6H A;  4A3I G;  4A3E B;  3CU7 A;  4BA2 I;  2FFK B;  3HP3 A;  4WJ3 M;  2QA4 A;  1TWG H;  4ZAI A;  1KDA A;  4TVA B;  5LL6 X;  1Q82 C;  5FLX E;  2ZJP A;  1VQ6 A;  4HJ7 A;  2I5L X;  1HPC A;  3NBH A;  2E2H H;  1NBW A;  3M9B A;  4BY1 G;  4Z9C B;  4G7H C;  1LT4 D;  4A93 G;  2Q2H A;  1SYF A;  3I55 A;  5IOD A;  4DV7 L;  1YNN C;  5I2Y A;  3L3O C;  1ONL A;  1DCZ A;  2Y0S B;  4JI8 Q;  4DNI A;  2MNA A;  2OQK A;  2PQE A;  2VB3 X;  3TRE A;  4ZKC B;  1AFP A;  2E75 C;  5I2X A;  3RUZ A;  3K5M A;  1DXM A;  2Q2I A;  4LWC A;  2K5V A;  3DEP A;  3BDL A;  3J80 i;  1WTP A;  4QUC A;  4GNX C;  4DK1 A;  1SFO B;  3H09 A;  3W1G A;  1FJG Q;  1CQF A;  2BCO A;  3PV0 A;  1WD0 A;  3NEL A;  1A62 A;  4UDU C;  2UUA Q;  2EJF C;  2DY7 A;  2UXD Q;  2EPB A;  5IWA Q;  1SYB A;  1GOZ A;  5IGG A;  1VQE A;  2HQE A;  2NVX B;  5CV9 A;  1QZH A;  2FKH B;  5AJ3 L;  5M3M B;  2R6G A;  2C5C A;  3HG9 A;  3RD4 A;  3H3V C;  1HFN A;  3AFP A;  4A3G G;  2F3V A;  4DF7 A;  2UU9 L;  3OW2 A;  3MVV A;  4P75 A;  4ZCK A;  4XT3 B;  3IF0 X;  1F9R A;  4L63 B;  1BF4 A;  1BCP F;  1JOO A;  4ZK9 B;  3TZU A;  1VQO A;  4X66 L;  2I0Q A;  1HUM A;  1EU4 A;  5KNB A;  1WTH A;  2DUD A;  5FJ8 G;  3FPP A;  1Q12 A;  2YU9 H;  1VQG A;  4EQO A;  2QF7 A;  1GUO A;  4CJ1 B;  3UE1 A;  3PUY A;  5EAY A;  4XT1 B;  1EY5 A;  4A3F G;  2BE5 D;  5M5W H;  5DM7 3;  1F2L A;  3RZD H;  3I70 A;  3U4V A;  3OTO L;  2AQ2 B;  1NMF A;  2VW9 A;  1XNQ L;  1IBK Q;  2HUG A;  1SYG A;  3I4N H;  1GUG A;  1DZ1 A;  5JVH 3;  1TVX A;  1NE3 A;  2MHV A;  2KHI A;  5LMU Q;  1IYU A;  4ZUJ A;  4DAM A;  1OXV A;  1SLJ A;  5D3D A;  2B8G A;  4A93 B;  1G2S A;  3SHL A;  3KF8 B;  2JA7 G;  2KCN A;  1Q3L A;  3E0E A;  5JAV A;  5ELE A;  5IYC H;  1VQJ A;  3ULL A;  1PYW D;  1HQM C;  1ZYR C;  2N78 A;  2AQ1 B;  2PMZ E;  2H4O A;  2FXQ A;  1PZI D;  1N9W A;  3D31 A;  1PFB A;  1S72 A;  4DV1 Q;  5EQ0 A;  4RAU C;  2SOB A;  2YTV A;  3DMU A;  3KDF A;  1E3P A;  2EOT A;  4P74 A;  1QB5 D;  4P72 A;  4G4K A;  3J81 c;  3K5L A;  3DLL A;  4GN3 B;  2EYJ A;  3OOC A;  3DNX A;  1B4O A;  1VQN A;  1SNM A;  2Z8L A;  3RN2 A;  2B63 G;  4B08 A;  4TKK A;  2BA0 A;  1HR0 Q;  1YHQ A;  1C9O A;  2GJW A;  4WJW A;  2ZTD A;  1QNK A;  4OWX B;  1U4R A;  1VQ7 A;  5FOB B;  1TR5 A;  3OIQ A;  4MN3 A;  4L5S A;  1LTI D;  3PO2 G;  1NUC A;  2JA6 H;  1XMO Q;  2A68 D;  5JPM C;  4I7Z C;  2IWH A;  5GAG C;  4G7O C;  2WAQ B;  1F2Y A;  4JI7 Q;  1OXX K;  1YHA A;  3K58 A;  1NR4 A;  1LAB A;  3M85 A;  2UXC Q;  1HH1 A;  3CPW A;  2JA5 G;  3WWV A;  3J81 L;  3G48 A;  1B53 A;  5DM6 3;  4AYB G;  2KED A;  4BBS G;  3S1R H;  3EN2 A;  4AQY Q;  2KCT A;  5C44 B;  1XPR A;  1D8L A;  1WI5 A;  4XIG S;  3G4S A;  2JEB I;  2K5H A;  1KRT A;  3SEB A;  3GTJ H;  4KMU C;  4GNX A;  2B63 B;  2NWG A;  3KF6 A;  1HTL D;  2F0O A;  3MWY W;  5FO8 B;  2EQS A;  2SNS A;  2XWJ B;  5JEA H;  2WIW A;  2IY5 B;  2I07 B;  2KJX A;  1X32 A;  4NXM Q;  1SEB D;  1SN8 A;  2E2I H;  3GTM H;  4MNO A;  4ZUI A;  3GTQ H;  1R9T H;  2TSS A;  4CDC C;  4H02 A;  3A8J E;  4X65 Q;  2E5L L;  2Q2U A;  1ZEQ X;  1I6H H;  4FXK C;  3BT7 A;  2BH2 A;  1A63 A;  4QJF A;  2R7D A;  2AWN A;  4FO2 A;  5IGF A;  3A7A B;  2K04 A;  2RSN A;  5EBD A;  1V8Q A;  2A68 C;  1BCP D;  4DV2 Q;  4C3J H;  1PRT C;  4LF7 Q;  3P20 A;  3I4M B;  3L7Z C;  1VMC A;  3KUP A;  4MZ9 A;  3QO2 A;  2FKC A;  4ZQ3 A;  4LFB L;  2JQO A;  2L5T A;  2K5D A;  3H0G H;  1NY4 A;  1P8L A;  3GTK H;  3FRP B;  4A3K B;  4ZKB B;  2IX1 A;  2K1B A;  1Q81 C;  3PIO A;  1XNR L;  3TBI B;  3X3M A;  3HKZ G;  1AW7 A;  2F0M A;  3C1F A;  1N34 L;  3RZO H;  2Z9H A;  1K8G A;  3STB D;  3CCU A;  1QUQ A;  3TQY A;  1G29 1;  1TWA B;  4KHV A;  1JJC B;  5T1G A;  3GTP H;  3E9H A;  2VQF L;  3PF5 A;  3MEH A;  3O13 A;  3Q0A A;  1K0R A;  3OYY A;  4KHP L;  4ID6 A;  5M5Y H;  1QNU A;  1XMQ L;  4R4I A;  3FHW A;  4DU9 A;  1K3B C;  1ZYR D;  4HTH A;  4UP9 A;  2A6E D;  3HOV B;  2F4V L;  3NQI A;  4OHJ A;  3F2C A;  1LT5 D;  3I4O A;  2LS0 1;  3BZK A;  4X3K A;  2SDF A;  5C3E H;  5FJ8 H;  1EYG A;  4OIK A;  2JE6 I;  3KF6 B;  4B9X A;  5ELD A;  5C6A A;  3NTK A;  1K83 B;  1YNN D;  3C2P A;  4ODG A;  1JWU D;  3S14 H;  4AH6 A;  4L5T A;  1MHW C;  4GN5 A;  3PSI A;  2Z1C A;  1PVO A;  1TQO A;  3H0G G;  3HOX B;  4JI5 L;  4C3H H;  1JE4 A;  3I73 A;  1NMG A;  2B39 A;  2GVB A;  2N3S A;  3MXN B;  3GTG B;  3RMH A;  2YV5 A;  4R4T A;  4BY1 H;  1SDF A;  1BQQ T;  4DR4 L;  2JA7 H;  3LWU A;  1A8V A;  2PI2 A;  4GKK Q;  2L4N A;  3K7A H;  4A3K G;  2JN4 A;  1CKN B;  1F2Z A;  3CCL A;  3EVQ A;  2PNH A;  1RTN A;  1CKM A;  1AZP A;  3A74 A;  5I9O A;  5D65 A;  4JI4 Q;  1FNV A;  3J80 E;  3P7J A;  3K6O A;  1UE6 A;  1D6E C;  3UE0 A;  4C3I H;  3S16 B;  3S2H B;  1X3F A;  2AHO B;  1UE5 A;  5E4X A;  1I94 Q;  1GKH A;  2A6H D;  1SYE A;  1L2F A;  1HFG A;  3MTS A;  2N49 A;  1DYQ A;  2QIL A;  1UUP A;  4JW0 A;  1Y1V G;  1GO3 E;  2F0F A;  4JI0 L;  4IO9 A;  1A6X A;  3HOY H;  2AMC B;  1RTO A;  2K52 A;  3HZX A;  2UUC L;  3Q8D A;  1WTO A;  4DK3 C;  4C2M H;  2JA8 H;  5CV7 A;  4B3M L;  4K0K Q;  4C3H G;  4A3M H;  1LT3 D;  2EYL A;  3F2D A;  4B3T Q;  1EIF A;  5EPL A;  1XTC D;  2K03 A;  1J5E L;  2F0J A;  4GN4 B;  5M3F H;  1XYI A;  2G5D A;  3R93 A;  3CCQ A;  3H15 A;  1PFS A;  1MJC A;  2B2Y C;  1S4Z A;  4WFN 3;  4KD4 A;  1KRS A;  4H13 C;  1XMX A;  5IT9 E;  1CHQ D;  1YZ6 A;  3KBG A;  3QOL A;  2IHE A;  1E1T A;  1TS2 A;  2G9H D;  1GHK A;  1EIY B;  4A3C H;  3J7A 5;  4WOR A;  1SMY C;  4FDB A;  3L0O A;  1HQR D;  1Y8P B;  3ER0 A;  3I91 A;  4PG3 A;  3RLF A;  5IE8 A;  1UEA B;  2HHH L;  2CVR A;  2PW7 A;  3FEW X;  2UXD L;  5LMU L;  4CKB A;  1K73 C;  3S15 H;  3G6J B;  4KKT A;  2FL3 A;  1CKO A;  1J5E Q;  1SE8 A;  2PNR C;  1Q1E A;  5E3F A;  3HOZ H;  1KC8 C;  2F0U A;  3PCO B;  3JAM i;  4OO1 G;  4B3M Q;  1X9N A;  1BKB A;  3TEH B;  5K36 G;  4HJ9 A;  1VQ8 A;  1VMP A;  3NSW A;  4IUP A;  4DPG A;  3CCM A;  2ASB A;  1LTG D;  2MJ8 A;  1XMO L;  4DV4 Q;  3OHX C;  4IPH A;  3AB9 A;  4A3F H;  4V0B A;  3S2D H;  3DUZ A;  4YHH Q;  3VYT A;  1NJI C;  2KQ3 A;  4R8N A;  3SK6 A;  4A3G H;  1G8Z D;  4DNT B;  2JA8 G;  1TXY A;  4CGY B;  2F0N A;  1GUN A;  3AMU A;  1FD7 D;  4B3S Q;  3NTI A;  2NN6 G;  1XX8 A;  3SR1 A;  2KHJ A;  3K0X A;  2K01 A;  4IQZ A;  4JI1 Q;  3S1M B;  2ZM6 L;  1TKW B;  3MXG A;  1G6P A;  1GXD C;  3S24 A;  1RZN A;  3GP7 A;  2O5J C;  2UU9 Q;  1JE5 A;  2K28 A;  1JT8 A;  1BVS A;  1STN A;  1HNZ L;  1RHP A;  3DXJ C;  4K5W A;  4JYA L;  4UP8 A;  1STG A;  4JI3 Q;  3SXH A;  2E2J H;  3VR6 A;  2CV8 A;  4JI6 L;  3EIV A;  3GD7 A;  1I3Q H;  3TP7 A;  3PIP 3;  3OMC A;  5JVG 3;  1M90 C;  4RFB A;  1EWI A;  3M7G A;  4J15 A;  1KDB A;  1EY4 A;  2XSC A;  3GTO H;  4A3D H;  4F88 A;  4K0K L;  1ICW A;  1U4P A;  4K2L A;  1A0I A;  1BOS A;  3ITP A;  4DV7 Q;  2Q8R E;  1X3P A;  4DA2 A;  3LWE A;  1OO9 B;  5CV4 A;  1OB8 A;  1TWC B;  1E2V A;  3NPP A;  4O42 A;  4RGM A;  3RLN A;  1IBK L;  4A3B B;  1E2Z A;  1OXU A;  2TMP A;  2R93 H;  4CKE A;  1Q8I A;  4GKJ L;  4OGQ C;  4KY7 A;  1PFM A;  3GTL B;  2B2W A;  3SK5 A;  4J6H A;  2Q2T A;  2Y0S E;  2WAQ G;  1WOC A;  1HR0 L;  2IXS A;  2VS1 A;  3IEY A;  5BN3 A;  4OX9 Q;  2GN5 A;  2ALY B;  3BDC A;  4N9P A;  4DNR B;  1ASY A;  3CRL C;  1HR0 W;  1WJJ A;  3HRZ C;  1BCP C;  3D6W A;  1HRJ A;  2XRQ D;  2XN9 C;  2AQ3 B;  1VQ4 A;  3M4Q A;  4A75 A;  4BBS B;  3M3Y B;  1Y1O A;  3QG1 A;  4LF9 L;  4X3U A;  1A2U A;  4QBO A;  2JA5 B;  2PMZ B;  2MP1 A;  1C8C A;  2F0D A;  5JJL A;  5I9P A;  1MIU A;  3FKI B;  2OQ0 A;  2B2U C;  1I94 L;  2IT1 A;  1LTR D;  2MO1 A;  2QW7 A;  1R4Q B;  1SXT A;  4IPC A;  4X3T A;  1JJG A;  1BUV T;  3TS2 A;  1CM9 A;  1FR3 A;  1I50 H;  1LTA D;  5GRO A;  1ROD A;  4IOC A;  5A2Q L;  5IYB G;  1BCP B;  2HDM A;  2VUM H;  2QKI C;  3VA7 A;  1Q8K A;  3K5N A;  3BVZ A;  4ZRZ A;  3AJV B;  1QWY A;  3MAQ A;  3CQZ B;  4JI7 L;  4GKK L;  4NPS A;  2A6H C;  1KLG D;  2K5N A;  2OCE A;  2CH4 A;  4DN4 M;  3PO3 B;  4FXD A;  1EWH A;  1PH7 A;  2R93 G;  1AE2 A;  3MA2 B;  3D0F A;  3G7L A;  3SGI A;  2EXZ A;  3IKJ A;  2SNM A;  3ULJ A;  2E5L Q;  1EQQ A;  4DUZ L;  2NZO A;  2F0E A;  2UXB L;  4QL5 A;  3TP5 A;  4DV5 Q;  3K8A A;  3K57 A;  4K6L A;  2EZV A;  3CW2 C;  5D3I B;  4JI6 Q;  3FKI G;  4H7B A;  4IPD A;  3MXN A;  2RVL A;  4UHV A;  4Y7N B;  3S1N B;  3DWP A;  4JBJ A;  4TKO B;  4XQN A;  1X54 A;  4K5X A;  4FYD A;  4JBM A;  5LL6 S;  4C3J G;  2F0G A;  1B7Y B;  2L55 A;  1A3U A;  2V1C C;  3BG3 A;  2XWB B;  4HID A;  2IX0 A;  1IL2 A;  1WTQ A;  3IRB A;  1A79 A;  5BR8 L;  3KYH C;  2NN6 I;  1B3A A;  1E2W A;  1HZC A;  1DOM A;  1L1O B;  2NBF A;  4M1U B;  4DR3 Q;  3GQB A;  2RF4 A;  5IYD H;  1HNX Q;  2LKV A;  3CD6 A;  1U4L A;  1U0L A;  4KHZ A;  1WD1 A;  4RMF A;  1X65 A;  1X6O A;  5GAD C;  1DOL A;  2EY1 A;  4MTN A;  3HOV G;  1YIT A;  3I72 A;  2RSO A;  1O7Y A;  1SE3 A;  5IYC G;  2NVT H;  3PUW A;  4DV4 L;  1PRT D;  4E6I A;  1KIX A;  1CA6 A;  2UXC L;  1X3Q A;  3HOW H;  1DD2 A;  5KND A;  4EGV A;  4ZLT F;  1KDC A;  1T5E A;  4LFB Q;  2L11 A;  2N88 A;  5ISR A;  2NVQ B;  2K33 A;  3E0J A;  5IGD A;  3M4P A;  4NXN L;  4OIJ A;  1JIC A;  3SE0 A;  2EYH A;  5M3M G;  2H5X A;  4L8J A;  3WOE A;  1RF2 D;  3OWE B;  1PTO C;  3HOZ G;  3I4L A;  1C4Q A;  3UDX A;  3SK8 A;  5IP9 H;  1ICF B;  4CKC A;  2GA4 B;  3MZ5 A;  2R92 H;  1B9N A;  1EOV A;  1ENC A;  3ICE A;  5J1Z A;  1GVP A;  5C0X G;  3NBH B;  4OWT B;  3BZD B;  2UUA L;  2O4X A;  3GV3 A;  4M8A A;  1Y1W B;  5CV8 A;  2KBN A;  1A2T A;  5CBA E;  1Q1B A;  4FNF A;  1V43 A;  4C3I G;  1B50 A;  4QBL A;  1K8O A;  5C4J H;  3MXU A;  1MSH A;  2AKW B;  1EIG A;  5ELN A;  2KEN A;  4HSP A;  4B3T L;  1VF7 A;  1XXG A;  3VDY A;  1Y1V H;  4A3E H;  2L15 A;  3D4W A;  2I5H A;  4N8X 1;  4LNQ A;  3J80 L;  1LV9 A;  1TWG B;  3R8B A;  2F0S A;  4HJ5 A;  3UDG A;  4IN3 A;  3PIO 3;  1E7Z A;  1C0A A;  1WCM G;  2PZU A;  1S5D D;  2RCN A;  1LTB D;  2E2H B;  1NR2 A;  5IGC A;  3V05 A;  2XRS D;  4RKL A;  3J81 E;  4E6Z A;  3LGJ A;  2H1E A;  1AN8 A;  2QEX A;  2UUB L;  3CP0 A;  1RD9 D;  2KEE A;  3MXP A;  5BR8 Q;  3OPO A;  1EYC A;  1JR0 D;  1WVL A;  1GEF A;  4YWM A;  1UE1 A;  2MPM A;  1JWM D;  3IFT A;  4BBR H;  2IX3 A;  4QUF A;  2EVB A;  2X6G A;  1DOK A;  3HOY G;  2Z0S A;  1B2T A;  2O5I C;  4HSV A;  1A3V A;  3NEM A;  1FYC A;  1V1O A;  1MD2 D;  2V4D A;  2EY5 A;  3B6Y A;  2EY6 A;  1TWH H;  2NVY H;  4A3I H;  2JXM B;  4DV6 L;  1J8I A;  3M7N A;  2K4K A;  2AUJ D;  3G6E A;  2NVX H;  5DEH A;  1TY2 A;  5GAE C;  5C0X I;  3I2Z A;  1B1Z A;  1IZ6 A;  1HZA A;  5M3M H;  1FVI A;  1TWF B;  2O2L D;  4JVZ A;  4G7Z C;  2YTX A;  1IBL Q;  5ELB A;  2CQO A;  4JOI A;  4FF1 A;  2ZXP A;  1WCM B;  2A74 C;  2R7F A;  2XGT A;  5GQO A;  3F8T A;  2PZT A;  5IP7 G;  3PQI A;  4R4Q A;  4LMQ D;  2F0P A;  2WP8 J;  2CH4 W;  2MQH A;  3PUX A;  1II3 A;  2YU9 B;  1YNJ D;  1JOQ A;  1CZW A;  1LTS D;  2X69 A;  3CCS A;  2WAQ E;  1EIH A;  1I6V C;  3RZD B;  1PTO H;  1PMR A;  1QZG A;  1N36 Q;  1C48 A;  2K32 A;  4IFD H;  4LQE A;  2Q8I B;  1SRU A;  3HKZ E;  3ZYY X;  3I4N B;  3FOV A;  1H95 A;  2YYZ A;  4NB3 A;  5M5X H;  4OO1 H;  2DNE A;  2ZXR A;  1TU2 B;  1VQC A;  1CI3 M;  4YCV A;  1D1K A;  2K50 A;  3R2I A;  4DR7 L;  1D5M C;  1QE6 A;  4BA1 I;  2K5Q A;  4C1N K;  3NWT A;  3S17 B;  5E7N A;  2N8N A;  1QG7 A;  1G51 A;  3KLR A;  3SDZ A;  4DR2 Q;  1YHB A;  5C4Z A;  1EOT A;  4JI5 Q;  5C5L A;  1UE7 A;  4JI8 L;  4DAP A;  2UUB Q;  1GUT A;  4X6A H;  4YHH L;  3H3V H;  3URY A;  4ULL A;  2E76 C;  1KD1 C;  2ZT9 C;  1YNX A;  3JAM c;  5JJK A;  2HCI A;  1YNM A;  2K14 A;  4JCV E;  3D3R A;  1JQY D;  4RHR A;  4RHS A;  2QGQ A;  4X62 L;  3KFU A;  3DWA A;  4DUZ Q;  3QIA A;  1V1Q A;  1WYD A;  1YI2 A;  2LSS A;  2R3Z A;  2WIN B;  4RKB A;  4IUN A;  4LJZ C;  1U9R A;  3A54 A;  5GAH C;  4DR6 Q;  4A3C G;  4HMJ A;  2Z6K C;  3HEJ A;  5JJI A;  3UDF A;  4JYA Q;  5CBE E;  4H44 C;  1STB A;  1YJ9 A;  1JB3 A;  1CTM A;  3ERQ A;  1KQS A;  2L9H A;  5C4X H;  3M4Y A;  2B8F A;  1Q46 A;  2LY7 A;  2OEO A;  3EQL C;  4HR7 B;  1F2M A;  4QQB X;  3GTJ B;  4H0L C;  1KHI A;  2XTI A;  2B63 H;  5FO9 B;  2JEA I;  4A3J H;  4U67 3;  1JOK A;  3WDN A;  3J7Z C;  1H9S B;  2CWP A;  5CC4 A;  2HIX A;  1T5X D;  2K6A A;  5COR A;  2EYM A;  5IY0 A;  3GTQ B;  2JA6 G;  1N36 L;  4TSS A;  1CSP A;  1TS5 A;  3PO2 B;  5IGE A;  2R92 G;  1EY7 A;  3J7A F;  1AEX A;  1VF5 C;  2PZW A;  4FF3 A;  1J6Q A;  1I6H B;  2HQL A;  2VLD A;  2OST A;  1HZ9 A;  1KL9 A;  1Q86 C;  4UP7 A;  3BVG A;  1HZB A;  1ENA A;  3K7U C;  3I4M H;  3E5S A;  3PUZ A;  1HNW L;  1F1Z A;  1DGS A;  3PUV A;  3VR2 A;  3OMG A;  2C9O A;  1ZP7 A;  2OT2 A;  1SRO A;  5AJ3 Q;  1OTC A;  4DR2 L;  5JOB A;  4IFD I;  2IJ0 A;  1STA A;  4QB4 A;  3X3N A;  3GTK B;  1E1O A;  3U9O A;  4BBR G;  3CF5 A;  3RNU A;  3G71 A;  3CC2 A;  3RLO A;  3PF4 A;  2JJQ A;  1T9H A;  2G9D A;  3M4O B;  4A3D G;  4F7X A;  4EX5 A;  3RZO B;  2J7Z A;  2F0W A;  4PZ6 A;  4IFD J;  4IUT A;  1FGB D;  4V19 0;  3AEV A;  4NXM L;  3GTP B;  1TII D;  2FMC A;  2CKZ B;  4YCW A;  4YCU A;  4LF5 L;  1PH2 A;  1X55 A;  3NBI A;  5EPJ A;  1V1P A;  5F2D A;  3J7Y W;  1KAB A;  2D0O A;  2RDF A;  1H9K A;  1XNR Q;  1STY A;  5T1I A;  4R9W A;  4TKD A;  2OXP A;  5M5Y B;  5COY A;  2DN8 A;  3IL8 A;  5IT9 L;  1S5E D;  1AH9 A;  4MHE A;  2F0K A;  3RN5 A;  1EEF D;  3J81 j;  4GOP C;  3HOV H;  3Q22 A;  4OX9 L;  3S1Q H;  1GUW A;  5C3E B;  3T1Y L;  3PMF A;  3TN2 A;  2A19 A;  1PZJ D;  3I4N G;  2Z6K A;  1Y8O B;  5KIX A;  3WOF A;  5M3F G;  2WFW A;  1CA5 A;  2BOS A;  2OTL A;  3A5Z B;  1SNQ A;  4YIJ A;  4HIO A;  1JWS D;  3T1H L;  1I4P A;  4U68 A;  3S14 B;  2K75 A;  2VNU D;  3BYT B;  4EQN A;  1VQM A;  1EUJ A;  2FIN B;  4UY8 C;  1SAP A;  2D9U A;  3PIP A;  1N32 L;  1QJO A;  1FNW A;  3FVQ A;  2CHB D;  2JK8 A;  1H9J A;  5IP7 H;  2RQX A;  2BH8 A;  4JOI C;  2M2L A;  1EY9 A;  1E0B A;  2RHQ B;  5C0X J;  2ZTC A;  3S9W A;  4BY1 B;  3A8K E;  3AYH B;  3H91 A;  5E1F A;  3A55 A;  5IP9 G;  4LF5 Q;  3T4A C;  1VS0 A;  3QOJ A;  4GS3 A;  4LFA Q;  4B3R Q;  2JA7 B;  2OTJ A;  3K7A B;  2NZ1 D;  4ALP A;  3E6Z X;  2L1B A;  4IJH A;  3MFG A;  4JI3 L;  2VY3 A;  1Q7Y C;  3NQT A;  3S16 H;  1HNZ Q;  4LF8 L;  5C3X A;  3S2H H;  4KKS A;  4NP5 A;  1U4M A;  2R7Z H;  1KNA A;  4EQ5 A;  2CQA A;  3CXC A;  4NXN Q;  1B3Q A;  2NTS A;  4LF7 L;  1YJW A;  4KY6 A;  3ERS X;  1N8R C;  3HOY B;  1QVF A;  2UXB Q;  3HOU B;  2KA7 A;  5J39 A;  5G3L D;  2F0T A;  2QDB A;  1XPU A;  1V1P B;  4IPG A;  1NCV A;  1T0F A;  1Y88 A;  2JP1 A;  1GJX A;  2M00 A;  5M9O A;  2HCC A;  2K5W A;  4X66 Q;  1PLF A;  2W8M A;  1PZK D;  2VL6 A;  3W1B A;  3NWS A;  1LTL A;  1QCB D;  1WTX A;  1N34 Q;  4AYB B;  4RGO S;  3U4Z A;  4X3S A;  4NW2 A;  4KTA A;  1HNX L;  4LUZ A;  1R11 A;  2L0C A;  1KAA A;  2RBM A;  1JC7 A;  1SYD A;  3CKI B;  2I46 A;  1IW7 D;  2F0V A;  1D7Q A;  2AWO A;  1RCV D;  5KEE A;  1LAC A;  3BVM A;  1EL0 A;  1OXS C;  5IGB A;  3A56 A;  2E8G A;  2F03 A;  4A3J G;  4BY7 H;  1NSN S;  3HFZ B;  4DR1 Q;  2AUK A;  1K9M C;  2MO0 A;  1QOH A;  1ESF A;  3CC4 A;  3CCE A;  3P1Z B;  3H94 A;  1BR9 A;  3V96 A;  2NYZ D;  5D14 A;  3TME A;  2CCZ A;  4Y52 H;  2R7Z G;  4YWL A;  4GZY C;  1N32 Q;  4C1N I;  1VQD A;  2D5D A;  1EFI D;  3HOZ B;  2QCP X;  3LX0 A;  1O7L A;  1GD7 A;  1HNW Q;  1SJH D;  4LF6 Q;  5L37 A;  1VQF A;  1EWC A;  5FLX c;  1STE A;  4DUY L;  1B9M A;  3TRZ A;  3KBX A;  4PV1 C;  4A3F B;  2ES2 A;  3S2D B;  1PXU A;  5IT9 c;  3F2B A;  3KJP A;  1EY0 A;  1JCK B;  3C46 A;  1W2B A;  4B9W A;  4DKA C;  1SFO H;  2WB1 G;  4KHP Q;  2IPK D;  4HN7 A;  1W6K A;  4PQX A;  5BN5 A;  3S1M H;  2F52 A;  4Q5V A;  4A4I A;  1PYB A;  3CAM A;  5IOC A;  4DV6 Q;  1Y69 U;  1CT1 D;  2RCF A;  1BO0 A;  2K05 A;  1K8M A;  2LXK A;  2PI2 E;  2DJF C;  2ZJQ A;  2Z6B A;  1IXR A;  1I4R A;  2EYO A;  3OSO A;  2EXD A;  1PH5 A;  2J4X A;  2E2J B;  3IFD A;  4IFD G;  2ZM6 Q;  1CFM A;  1I3Q B;  3N6R A;  5CR3 A;  4XYO A;  4K8J A;  2EE1 A;  3V2T A;  1GM5 A;  3EFX D;  2B2T C;  2INB A;  1BDO A;  4FF4 A;  3GTO B;  1QIL A;  4A3D B;  2D0P A;  2CFM A;  1SNO A;  4QY7 A;  4DUY Q;  3SK4 A;  4JBK A;  2ZJR A;  1CKN A;  5KRU A;  5I6W A;  2PPB C;  3I8Z A;  3BS1 A;  4DGZ A;  3HKZ B;  3DM1 A;  4OEL B;  4A3B H;  1DON A;  4KN4 C;  4BS9 A;  1S5C D;  4JI2 Q;  5M5W B;  3AU7 A;  4GOP A;  4XXE A;  2EJM A;  1XWE A;  1M4V A;  4LFC L;  4CDE C;  2KEC A;  4LAA A;  3GDE A;  1PH4 A;  4LW1 A;  3GTL H;  2VB2 X;  3GO5 A;  2QDL A;  4L6T B;  4LUO A;  4QIW B;  1D2B A;  2XNA C;  4G57 A;  4P2C B;  2YTY A;  4DV3 Q;  1XPO A;  4A76 A;  1DJR D;  3MEF A;  4PMC A;  2F4V Q;  1VQA A;  1LTT D;  4A93 H;  4G6V A;  3CCJ A;  2XIW A;  4A3E G;  4JI4 L;  3T13 A;  4G6U A;  1NTG A;  2KOL A;  3QJY A;  5HGT A;  3U58 A;  1ZXT A;  3M3Y H;  5CV5 A;  2HHH Q;  4RG1 A;  2CZR A;  3JAM E;  2CW0 C;  2JA5 H;  1O78 A;  1PTO D;  3D6C A;  1O7I A;  1QVC A;  2F4I A;  5EKI A;  4K14 A;  2F0I A;  3ONA B;  1CHP D;  1ML0 D;  1TT2 A;  3PGZ A;  3VYU A;  5KYL A;  4HAE A;  1E24 A;  4KLK A;  2ZXO A;  5ELC A;  1FGU A;  4ME3 A;  4EQP A;  5LMN L;  1IPI A;  1PTO F;  1EYD A;  1KNE A;  2VXW A;  1XNQ Q;  3NTH A;  2VUM B;  2JSO A;  2Z4I A;  2WJ0 A;  2EO0 A;  1F9Q A;  4P71 A;  3QB3 A;  1YBY A;  2FLC A;  4TQU S;  3R3O A;  1V9P A;  3EA6 A;  5CYU A;  3KOJ A;  2JA6 B;  4J8Q A;  5FLM G;  3PO3 H;  1G91 A;  4ABN A;  4HMI A;  1CSQ A;  1MSG A;  4JG2 A;  5E4W C;  1EY8 A;  4GLX A;  2F1M A;  3I90 A;  4HJA A;  2ICI A;  1CZG A;  2LFN A;  5ELF A;  3ZJY C;  4LF8 Q;  2B2V C;  1S5F D;  4IOA A;  3KF8 A;  2ENB A;  1PH8 A;  1VQK A;  4KN7 C;  1LUZ A;  2JYO A;  1L0Y B;  1SMX A;  3S1R B;  4FP5 D;  5C44 H;  1K8A C;  4C56 C;  3P1H A;  4Y7N H;  2RHS B;  1XJV A;  1PYS B;  3D4D A;  3HGB A;  1ZKO A;  2EY2 A;  1LYL A;  1I4Q A;  1RKN A;  1I4G A;  1SNC A;  2BE5 C;  4A3L H;  3NEN A;  2KCC A;  3MHB A;  2LXJ A;  1RL2 A;  1YEZ A;  4O2D A;  3H6M A;  5KNC A;  4FXG C;  5G3L F;  3GTM B;  2E2I B;  5EJW A;  1RIP A;  2X6L A;  4KKU A;  4DV5 L;  4S3S A;  1R9T B;  2ZYZ A;  1ENF A;  4K8I A;  4R4O A;  4FVM A;  1S3O A;  5ELO A;  4B3S L;  1BNZ A;  4XDX A;  3C1E A;  2OWO A;  4C3J B;  1IYV A;  2IHF A;  2NVT B;  4PNY A;  5J3B A;  4RH6 A;  2ID0 A;  1STH A;  2FJ2 A;  1VQ5 A;  1B8A A;  3T56 B;  3Q24 A;  2UUC Q;  2MUY A;  1SND A;  3D4R A;  4HJ8 A;  3HOW B;  1IW7 C;  4OON A;  4KJN A;  3KDF B;  3I3C A;  2Y0S G;  3U50 C;  1BBW A;  3H0G B;  3HOX G;  3R2T A;  2B2W C;  2EJG C;  3KJO A;  2RDG A;  1P16 A;  1LT6 D;  5K36 H;  1D5Z C;  2B2T A;  4A3K H;  1VQI A;  1PRT F;  1SNP A;  1DM0 B;  4JI0 Q;  2HDL A;  5LMN Q;  2B2U A;  1OXT A;  2IW3 A;  1M8A A;  1CQV A;  1L0W A;  4XYQ A;  1PV4 A;  4OEM B;  5FLM H;  3PO3 G;  1HA5 A;  1ESR A;  1TWA H;  2WB1 B;  3J7A V;  2WKD A;  4F8M A;  1YVC A;  1W6J A;  4AYB E;  1HJP A;  2JA9 A;  5IYD G;  2F0Q A;  3JC6 6;  3H3V I;  5KGU A;  4RGN A;  1EEI D;  3P1Z A;  4YY3 L;  5IIF A;  5H1S E;  3BZC A;  4UPA A;  3IAY A;  4KD3 A;  1HCZ A;  1B44 D;  2DJG C;  1Y1W H;  1EZ8 A;  2XVS A;  3CCV A;  2EYF A;  4EVO A;  1LM0 A;  1F9S A;  1I5F A;  1G6Z A;  5C44 G;  3HOW G;  5C4J B;  3I4M G;  1KXL A;  4DFA A;  1L1O A;  1PH6 A;  4JI2 L;  5JJZ A;  4J1M A;  2B2V A;  1X3G A;  1Y1V B;  3E3X A;  1K83 H;  1TS3 A;  1SJE D;  3I56 A;  1R4P B;  4LF6 L;  1CUK A;  4DV3 L;  1G2T A;  4RWS C;  4HED A;  3Q6S A;  2NUC A;  2BDO A;  3HOX H;  4DV0 Q;  4C3H B;  5HGQ A;  5C5M A;  5BN4 A;  2LMC B;  3CMA A;  1O80 A;  1JJ2 A;  4HCS A;  4YWK A;  1H9M A;  5A2Q E;  1MBY A;  1PHJ A;  3GTG H;  4R8I A;  4MIU A;  1YIJ A;  4OXP A;  1LO5 D;  4QCL A;  5EPK A;  4DR1 L;  3BJU A;  1H9R A;  4BBR B;  3L2P A;  4YY3 Q;  2NB0 A;  2VQE L;  1EQV A;  4R4C A;  1WTV A;  4I65 A;  3TS0 A;  3C3L A;  4JV5 Q;  1FL0 A;  5HUR A;  3HS0 C;  1A15 A;  4JI1 L;  3NHH A;  4LF4 Q;  1TWH B;  2NVY B;  5J22 A;  4A3I B;  4C3I B;  3DEO A;  1Y8N B;  3TSS A;  1VQP A;  3OWF A;  3EJI A;  1TY0 A;  3OIP A;  1Y1W G;  4L5R C;  5AFW A;  4BY7 G;  5C4X G;  1PH9 A;  3DHQ A;  5JEA J;  1TWF H;  5FKA C;  1MGS A;  2A69 D;  1RJT A;  1PH3 A;  3HOU G;  3NK9 A;  4EV1 A;  1WCM H;  3KLS X;  1WFQ A;  2PQA A;  1OB9 A;  1EYA A;  2MGS A;  3CME A;  1UAP A;  4I7A A;  3W5O A;  2N55 A;  4POF A;  2HD3 A;  2OF1 A;  2A1A A;  4C2M B;  2VUM G;  2E2D C;  4WJ4 A;  2CW0 D;  2JA8 B;  1Z9F A;  3DWQ A;  1SE4 A;  4A3M B;  3F2U A;  2CWA A;  3LNN A;  5M3F B;  1PTO B;  4X65 L;  2Z4H A;  3NUC A;  1PH1 A;  4A3B G;  4ME5 A;  4K2K A;  1HA6 A;  2HT1 A;  3A5U A;  3A8I E;  4HIM A;  4F87 A;  1LLR D;  5M5X B;  4DAV A;  3AJV A;  5EKK A;  3FP9 A;  2EIF A;  1JMC A;  2KVM A;  2RKS A;  4LF9 Q;  2Q8T A;  4N9T A;  4DK0 A;  4QGU A;  4GOP B;  2NN6 H;  5CMD A;  1ILQ A;  2B2Y A;  4GLA C;  2PCF B;  5EBC A;  1KLU D;  4R1J A;  3S17 H;  1FNU A;  4IZ8 A;  1K28 A;  1K3R A;  4TRD A;  1EZ6 A;  5K5P A;  4K5V A;  3ND9 A;  4DAY A;  3S15 B;  3NP8 A;  3MFY A;  4DV0 L;  2B29 A;  1I4X A;  2BDN A;  3OTO Q;  2A69 C;  1H9S A;  5FDK A;  1EQT A;  2GW6 A;  4CDF C;  1MKH A;  2RA4 A;  1D5X C;  3JAM L;  4ZYS A;  5I6Y A;  1HH2 P;  1NAP A;  4LK1 C;  4X64 L;  1KTK A;  4DV2 L;  4A3G B;  1M1K C;  3BU2 A;  1JB7 A;  4RA8 A;  1N33 L;  1RLV A;  4KK7 A;  1ILP A;  3EBE A;  4RGT A;  1S40 A;  4CHT B;  3E9I A;  5TSS A;  1Z7T A;  1CK1 A;  3DM3 A;  1L0X B;  1SBB B;  5C3W A;  3KK7 A;  4DV1 L;  5C4X B;  1VQL A;  4BWG B;  1IHZ A;  1AZQ A;  3N52 A;  4NDX A;  1PDQ A;  4WRD A;  2ZYZ B;  1I4H A;  2HIV A;  2MFI A;  4QF4 A;  1O7Z A;  2DY8 A;  4B3R L;  1JOR A;  2KUM A;  1J9O A;  5EGT A;  4A3J B;  1PA6 A;  1UNS A;  4CBV A;  1IL8 A;  5C0X H;  2FMM A;  2FCO A;  2QEJ C;  3P75 A;  3CPF A;  1YNJ C;  1HUN A;  1SR3 A;  4BXX G;  3ULP A;  4DR5 L;  1TWC H; 
#chains in the Genus database with same CATH homology
 1RDP D;  3K5O A;  4IUQ A;  2Z0R A;  3W2D A;  5C4H A;  4DXG A;  2D62 A;  2R93 B;  4ZQU A;  4RCN A;  1SMY D;  4O1N A;  2KHS A;  3Q23 A;  4JBW A;  1HHV A;  3ERO A;  5FO7 B;  1ET9 A;  3CHB D;  2PO4 A;  1EY6 A;  3T16 A;  4DXF A;  3L9A X;  4XQQ A;  2WAC A;  1EU3 A;  5A35 A;  2A6E C;  2F0L A;  4KJO A;  1A3T A;  4K6D A;  1GUS A;  2WV6 D;  3A7L A;  3TDQ A;  3U9S A;  1I50 B;  4RCO A;  1BXT A;  2DNC A;  3VYS A;  3FMC A;  4IUR A;  1F77 A;  2A73 B;  2EYP A;  2WCW A;  1BBX C;  3TP6 A;  1UWV A;  4XQJ A;  2WKC A;  5DNF A;  2J0T D;  2SEB D;  2OKF A;  3S1Q B;  3NXW A;  3BDO A;  2FHT A;  3VYR A;  4ILW A;  3TZD A;  3FDT A;  5FLX L;  1GHJ A;  4IAL A;  4FF2 A;  5DAU A;  2IL8 A;  2WIZ A;  3NE5 B;  1S5B D;  2WCZ A;  2D2C C;  4IUV A;  3MC0 B;  3SVM A;  5LHY 1;  3VR5 A;  3T51 B;  2F0H A;  4CJ2 C;  2NTT A;  1AP0 A;  4JK1 C;  5NUC A;  4PMW A;  1IKL A;  5EKL A;  3GV6 A;  5CV6 A;  4KY5 A;  1WTR A;  1F9P A;  4NKL A;  1SSO A;  3T53 B;  1TS4 A;  5FK9 C;  3TP8 A;  4HCE A;  1Q90 A;  2K7V A;  2BA1 A;  2R7Z B;  3VR3 A;  1HXY D;  1MI2 A;  1PRT B;  1WTW A;  2WII B;  3BYY B;  1R0V A;  4PMB A;  2ICE C;  3K0Y A;  3UI2 A;  1SYC A;  2E74 C;  4NMZ A;  1PFN A;  4QMG A;  2PW5 A;  3D8G A;  1ET6 A;  3ND8 A;  3VR4 A;  4OO1 I;  3P1Y A;  4XTC S;  2R92 B;  1SE2 A;  3FPU B;  4Q0F A;  2PYK A;  4QBN A;  2RDH A;  4KI0 A;  3K59 A;  2DBS A;  5KYI A;  1HTP A;  5JPN C;  5I4D A;  2A5H A;  2EDG A;  3W3A A;  2L12 A;  4KV6 A;  1IKM A;  5CGK A;  2R61 A;  2M9V A;  4CJ0 B;  5JEA G;  1VDZ A;  4OL7 A;  4IUU A;  3IEY B;  3QWN A;  1Z47 A;  3CRK C;  3OW7 A;  4BY7 B;  3VA5 A;  1VCI A;  4UAI A;  1D1I A;  3KLS A;  2F3W A;  1Z6H A;  4A3E B;  3CU7 A;  4BA2 I;  2FFK B;  3HP3 A;  4ZAI A;  1KDA A;  5LL6 X;  5FLX E;  3NBH A;  1HPC A;  4Z9C B;  4G7H C;  1LT4 D;  1SYF A;  5IOD A;  1YNN C;  5I2Y A;  3L3O C;  1ONL A;  1DCZ A;  2Y0S B;  2PQE A;  2VB3 X;  4ZKC B;  1AFP A;  2E75 C;  5I2X A;  3RUZ A;  3K5M A;  1DXM A;  3DEP A;  1WTP A;  3BDL A;  4QUC A;  4DK1 A;  1SFO B;  3H09 A;  1CQF A;  2BCO A;  3PV0 A;  1WD0 A;  4UDU C;  2EJF C;  2DY7 A;  2EPB A;  1SYB A;  1GOZ A;  5IGG A;  2HQE A;  2NVX B;  5CV9 A;  2FKH B;  5M3M B;  2R6G A;  2C5C A;  3HG9 A;  3RD4 A;  3H3V C;  1HFN A;  2F3V A;  4DF7 A;  3MVV A;  4XT3 B;  3IF0 X;  1F9R A;  4L63 B;  1BF4 A;  1BCP F;  4ZK9 B;  1JOO A;  3TZU A;  1HUM A;  1EU4 A;  5KNB A;  3FPP A;  1Q12 A;  4EQO A;  2QF7 A;  1GUO A;  4CJ1 B;  3PUY A;  4XT1 B;  1EY5 A;  2BE5 D;  5DM7 3;  1F2L A;  3I70 A;  2AQ2 B;  2HUG A;  1SYG A;  1DZ1 A;  1GUG A;  5JVH 3;  1TVX A;  2MHV A;  1IYU A;  4ZUJ A;  1OXV A;  5D3D A;  2B8G A;  4A93 B;  1G2S A;  3SHL A;  2KCN A;  1Q3L A;  5JAV A;  5ELE A;  1PYW D;  1HQM C;  1ZYR C;  2AQ1 B;  2H4O A;  1PZI D;  3D31 A;  1PFB A;  5EQ0 A;  4RAU C;  2SOB A;  3DMU A;  2EOT A;  1QB5 D;  4G4K A;  3K5L A;  2EYJ A;  3OOC A;  3DNX A;  1B4O A;  1SNM A;  2Z8L A;  4TKK A;  4B08 A;  2BA0 A;  2GJW A;  4WJW A;  1QNK A;  1U4R A;  5FOB B;  1TR5 A;  3OIQ A;  4MN3 A;  1LTI D;  1NUC A;  2A68 D;  5JPM C;  4I7Z C;  2IWH A;  4G7O C;  2WAQ B;  1F2Y A;  1OXX K;  3K58 A;  1NR4 A;  1LAB A;  3M85 A;  1HH1 A;  3J81 L;  1B53 A;  5DM6 3;  2KED A;  5C44 B;  4XIG S;  2JEB I;  3SEB A;  4KMU C;  2B63 B;  2NWG A;  1HTL D;  2F0O A;  3MWY W;  5FO8 B;  2SNS A;  2XWJ B;  5JEA H;  2WIW A;  2I07 B;  2KJX A;  1X32 A;  1SEB D;  4ZUI A;  2TSS A;  3A8J E;  1ZEQ X;  4FXK C;  3BT7 A;  2BH2 A;  2AWN A;  4FO2 A;  5IGF A;  3A7A B;  2K04 A;  2RSN A;  5EBD A;  1V8Q A;  2A68 C;  1BCP D;  1PRT C;  3P20 A;  3I4M B;  3L7Z C;  1VMC A;  3KUP A;  3QO2 A;  2FKC A;  4ZQ3 A;  2L5T A;  2K5D A;  3FRP B;  4A3K B;  4ZKB B;  2IX1 A;  2K1B A;  3TBI B;  3X3M A;  1AW7 A;  2F0M A;  3C1F A;  1G29 1;  1TWA B;  4KHV A;  5T1G A;  3MEH A;  3O13 A;  3Q0A A;  4ID6 A;  1QNU A;  4DU9 A;  1ZYR D;  4HTH A;  2A6E D;  3HOV B;  3NQI A;  4OHJ A;  1LT5 D;  2LS0 1;  4X3K A;  2SDF A;  4OIK A;  2JE6 I;  4B9X A;  5ELD A;  5C6A A;  3NTK A;  1K83 B;  1YNN D;  3C2P A;  4ODG A;  1JWU D;  2Z1C A;  1TQO A;  3HOX B;  1JE4 A;  3I73 A;  2B39 A;  3GTG B;  3RMH A;  1SDF A;  1BQQ T;  3LWU A;  2L4N A;  1F2Z A;  3EVQ A;  1RTN A;  1AZP A;  5I9O A;  5D65 A;  1FNV A;  3J80 E;  3P7J A;  3K6O A;  1D6E C;  3S16 B;  3S2H B;  5E4X A;  2A6H D;  1SYE A;  1HFG A;  3MTS A;  1DYQ A;  2QIL A;  1UUP A;  2F0F A;  1A6X A;  1RTO A;  3HZX A;  1WTO A;  5CV7 A;  4C3H G;  1LT3 D;  2EYL A;  5EPL A;  1XTC D;  2K03 A;  2F0J A;  1XYI A;  3R93 A;  2B2Y C;  1S4Z A;  4WFN 3;  4KD4 A;  4H13 C;  1XMX A;  5IT9 E;  1CHQ D;  3KBG A;  3QOL A;  1TS2 A;  2G9H D;  1GHK A;  4WOR A;  1SMY C;  1HQR D;  1Y8P B;  3I91 A;  3RLF A;  1UEA B;  2CVR A;  2PW7 A;  3FEW X;  4CKB A;  3G6J B;  4KKT A;  2FL3 A;  2PNR C;  1Q1E A;  5E3F A;  2F0U A;  4OO1 G;  5K36 G;  1VMP A;  3NSW A;  4IUP A;  1LTG D;  2MJ8 A;  3OHX C;  3AB9 A;  4V0B A;  3DUZ A;  3VYT A;  2KQ3 A;  4R8N A;  3SK6 A;  1G8Z D;  4DNT B;  4CGY B;  2F0N A;  1GUN A;  3AMU A;  1FD7 D;  3NTI A;  2NN6 G;  1XX8 A;  3SR1 A;  4IQZ A;  2K01 A;  3S1M B;  1TKW B;  3MXG A;  1GXD C;  1RZN A;  3GP7 A;  2O5J C;  2K28 A;  1STN A;  1RHP A;  3DXJ C;  4K5W A;  1STG A;  3SXH A;  3VR6 A;  2CV8 A;  3GD7 A;  3TP7 A;  3PIP 3;  3OMC A;  5JVG 3;  4RFB A;  3M7G A;  1KDB A;  1EY4 A;  2XSC A;  4F88 A;  1ICW A;  1U4P A;  4K2L A;  1BOS A;  3ITP A;  2Q8R E;  1X3P A;  4DA2 A;  3LWE A;  1OO9 B;  5CV4 A;  1OB8 A;  1TWC B;  1E2V A;  3NPP A;  4O42 A;  4RGM A;  4A3B B;  1E2Z A;  1OXU A;  2TMP A;  4CKE A;  1Q8I A;  4OGQ C;  4KY7 A;  1PFM A;  3GTL B;  2B2W A;  3SK5 A;  4J6H A;  2IXS A;  2VS1 A;  3IEY A;  5BN3 A;  3BDC A;  4N9P A;  4DNR B;  3CRL C;  3HRZ C;  1BCP C;  3D6W A;  1HRJ A;  2XRQ D;  2XN9 C;  2AQ3 B;  4BBS B;  3M3Y B;  1Y1O A;  3QG1 A;  4X3U A;  1A2U A;  4QBO A;  2JA5 B;  2PMZ B;  2MP1 A;  1C8C A;  2F0D A;  5I9P A;  3FKI B;  2B2U C;  2IT1 A;  1LTR D;  1R4Q B;  1SXT A;  4X3T A;  1BUV T;  1CM9 A;  1FR3 A;  1LTA D;  1ROD A;  5A2Q L;  1BCP B;  2HDM A;  2QKI C;  3VA7 A;  3K5N A;  4ZRZ A;  3BVZ A;  3AJV B;  3MAQ A;  1QWY A;  3CQZ B;  2A6H C;  1KLG D;  4DN4 M;  3PO3 B;  4FXD A;  1EWH A;  3MA2 B;  3G7L A;  2EXZ A;  3IKJ A;  2SNM A;  2F0E A;  3TP5 A;  3K57 A;  4K6L A;  2EZV A;  5D3I B;  4H7B A;  3MXN A;  2RVL A;  4Y7N B;  3S1N B;  3DWP A;  4TKO B;  4XQN A;  4K5X A;  4FYD A;  5LL6 S;  4C3J G;  2F0G A;  2L55 A;  1A3U A;  3BG3 A;  2XWB B;  2IX0 A;  1WTQ A;  1A79 A;  2NN6 I;  1B3A A;  1E2W A;  1DOM A;  2NBF A;  4M1U B;  3GQB A;  2LKV A;  1U4L A;  4KHZ A;  1WD1 A;  1DOL A;  2EY1 A;  3I72 A;  2RSO A;  1O7Y A;  1SE3 A;  3PUW A;  1PRT D;  4E6I A;  1CA6 A;  1X3Q A;  1DD2 A;  5KND A;  4EGV A;  4ZLT F;  1KDC A;  1T5E A;  2L11 A;  2N88 A;  5ISR A;  2NVQ B;  2K33 A;  3E0J A;  5IGD A;  4OIJ A;  1JIC A;  3SE0 A;  2EYH A;  4L8J A;  3WOE A;  1RF2 D;  3OWE B;  1PTO C;  3I4L A;  1C4Q A;  3SK8 A;  4CKC A;  2GA4 B;  3MZ5 A;  1B9N A;  1ENC A;  5J1Z A;  5C0X G;  3BZD B;  2O4X A;  3GV3 A;  4M8A A;  1Y1W B;  5CV8 A;  1A2T A;  5CBA E;  1Q1B A;  4FNF A;  1V43 A;  4C3I G;  1B50 A;  4QBL A;  1K8O A;  3MXU A;  1MSH A;  1EIG A;  4HSP A;  1VF7 A;  1XXG A;  3D4W A;  3J80 L;  1LV9 A;  1TWG B;  3R8B A;  2F0S A;  4IN3 A;  3PIO 3;  2PZU A;  2E2H B;  1S5D D;  1LTB D;  1NR2 A;  5IGC A;  3V05 A;  2XRS D;  4RKL A;  3J81 E;  4E6Z A;  2H1E A;  1AN8 A;  1RD9 D;  2KEE A;  3MXP A;  3OPO A;  1EYC A;  1JR0 D;  1WVL A;  1GEF A;  2MPM A;  1JWM D;  3IFT A;  2IX3 A;  4QUF A;  2EVB A;  2X6G A;  1DOK A;  1B2T A;  2O5I C;  4HSV A;  1A3V A;  1FYC A;  1V1O A;  1MD2 D;  2V4D A;  2EY5 A;  2EY6 A;  2JXM B;  1J8I A;  3M7N A;  2AUJ D;  5DEH A;  1TY2 A;  5C0X I;  1B1Z A;  1TWF B;  2O2L D;  4G7Z C;  5ELB A;  4FF1 A;  2ZXP A;  1WCM B;  2A74 C;  2PZT A;  4LMQ D;  2F0P A;  2WP8 J;  3PUX A;  1II3 A;  2YU9 B;  1YNJ D;  1JOQ A;  1CZW A;  1LTS D;  2X69 A;  1EIH A;  1I6V C;  3RZD B;  1PTO H;  1PMR A;  1C48 A;  2K32 A;  4IFD H;  4LQE A;  2Q8I B;  3ZYY X;  3I4N B;  3FOV A;  2YYZ A;  4OO1 H;  2DNE A;  2ZXR A;  1TU2 B;  1CI3 M;  1D1K A;  3R2I A;  1D5M C;  1QE6 A;  4BA1 I;  2K5Q A;  4C1N K;  3NWT A;  3S17 B;  1QG7 A;  3KLR A;  3SDZ A;  5C4Z A;  1EOT A;  5C5L A;  4DAP A;  1GUT A;  3URY A;  4ULL A;  2E76 C;  2ZT9 C;  2HCI A;  1YNM A;  3D3R A;  1JQY D;  4RHR A;  4RHS A;  3DWA A;  3QIA A;  2WIN B;  2R3Z A;  4RKB A;  4IUN A;  4LJZ C;  1U9R A;  3A54 A;  4HMJ A;  3HEJ A;  5CBE E;  4H44 C;  1STB A;  1JB3 A;  1CTM A;  3ERQ A;  2L9H A;  3M4Y A;  2B8F A;  2LY7 A;  2OEO A;  3EQL C;  4HR7 B;  1F2M A;  3GTJ B;  4H0L C;  5FO9 B;  2JEA I;  4U67 3;  1JOK A;  3WDN A;  1H9S B;  5CC4 A;  1T5X D;  2K6A A;  5COR A;  2EYM A;  3GTQ B;  4TSS A;  1TS5 A;  3PO2 B;  5IGE A;  1EY7 A;  3J7A F;  1AEX A;  1VF5 C;  2PZW A;  4FF3 A;  1I6H B;  2VLD A;  2OST A;  3BVG A;  1ENA A;  3E5S A;  3PUZ A;  1F1Z A;  3PUV A;  3VR2 A;  3OMG A;  2C9O A;  1ZP7 A;  2OT2 A;  4IFD I;  5JOB A;  2IJ0 A;  1STA A;  4QB4 A;  3X3N A;  3GTK B;  3U9O A;  2JJQ A;  2G9D A;  3M4O B;  4F7X A;  3RZO B;  2J7Z A;  2F0W A;  4IFD J;  4IUT A;  1FGB D;  4V19 0;  3GTP B;  1TII D;  2FMC A;  3NBI A;  5EPJ A;  1V1P A;  5F2D A;  3J7Y W;  1KAB A;  2RDF A;  1H9K A;  1STY A;  5T1I A;  4R9W A;  4TKD A;  2OXP A;  5M5Y B;  5COY A;  2DN8 A;  3IL8 A;  5IT9 L;  1S5E D;  4MHE A;  2F0K A;  1EEF D;  3Q22 A;  1GUW A;  5C3E B;  3PMF A;  3TN2 A;  1PZJ D;  1Y8O B;  5KIX A;  3WOF A;  1CA5 A;  2BOS A;  1SNQ A;  4YIJ A;  1JWS D;  1I4P A;  4U68 A;  3S14 B;  2VNU D;  3BYT B;  4EQN A;  2FIN B;  1SAP A;  2D9U A;  1QJO A;  1FNW A;  3FVQ A;  2CHB D;  1H9J A;  2RQX A;  2M2L A;  1EY9 A;  1E0B A;  5C0X J;  3S9W A;  4BY1 B;  3A8K E;  3H91 A;  5E1F A;  3A55 A;  3T4A C;  3QOJ A;  2JA7 B;  3K7A B;  2NZ1 D;  3E6Z X;  2L1B A;  3MFG A;  3NQT A;  5C3X A;  4KKS A;  4NP5 A;  1U4M A;  1KNA A;  2CQA A;  2NTS A;  4KY6 A;  3HOY B;  3HOU B;  2KA7 A;  5J39 A;  5G3L D;  2F0T A;  2QDB A;  1V1P B;  1NCV A;  1T0F A;  1Y88 A;  2JP1 A;  1GJX A;  2M00 A;  5M9O A;  2HCC A;  2K5W A;  2W8M A;  1PLF A;  1PZK D;  3NWS A;  1QCB D;  1WTX A;  4AYB B;  4RGO S;  4X3S A;  4NW2 A;  4KTA A;  1R11 A;  2L0C A;  1KAA A;  2RBM A;  1JC7 A;  1SYD A;  3CKI B;  2I46 A;  1IW7 D;  2F0V A;  2AWO A;  1RCV D;  5KEE A;  1LAC A;  3BVM A;  1EL0 A;  5IGB A;  1OXS C;  3A56 A;  2F03 A;  1NSN S;  2AUK A;  1QOH A;  1ESF A;  3P1Z B;  3H94 A;  1BR9 A;  3V96 A;  2NYZ D;  5D14 A;  3TME A;  4GZY C;  4C1N I;  2D5D A;  1EFI D;  3HOZ B;  2QCP X;  3LX0 A;  1O7L A;  1SJH D;  1EWC A;  1STE A;  1B9M A;  3KBX A;  4PV1 C;  4A3F B;  3S2D B;  1PXU A;  1EY0 A;  1JCK B;  3C46 A;  4B9W A;  2IPK D;  4HN7 A;  1W6K A;  4PQX A;  5BN5 A;  4Q5V A;  5IOC A;  1Y69 U;  1CT1 D;  1BO0 A;  2K05 A;  1K8M A;  1I4R A;  2EYO A;  3OSO A;  2J4X A;  2E2J B;  3IFD A;  4IFD G;  1CFM A;  1I3Q B;  3N6R A;  5CR3 A;  4XYO A;  4K8J A;  2EE1 A;  3V2T A;  3EFX D;  2B2T C;  2INB A;  1BDO A;  4FF4 A;  3GTO B;  1QIL A;  4A3D B;  1SNO A;  3SK4 A;  5KRU A;  5I6W A;  2PPB C;  3I8Z A;  3BS1 A;  4DGZ A;  3HKZ B;  3DM1 A;  1DON A;  4KN4 C;  4BS9 A;  1S5C D;  5M5W B;  3AU7 A;  4XXE A;  2EJM A;  1XWE A;  1M4V A;  2KEC A;  4LAA A;  2VB2 X;  3GO5 A;  4L6T B;  4QIW B;  1D2B A;  2XNA C;  4G57 A;  4P2C B;  1DJR D;  4PMC A;  1LTT D;  4G6V A;  2XIW A;  3T13 A;  4G6U A;  2KOL A;  3QJY A;  5HGT A;  1ZXT A;  5CV5 A;  2CZR A;  3JAM E;  2CW0 C;  1O78 A;  1PTO D;  3D6C A;  2F4I A;  5EKI A;  4K14 A;  2F0I A;  3ONA B;  1CHP D;  1ML0 D;  1TT2 A;  3VYU A;  5KYL A;  4HAE A;  2ZXO A;  5ELC A;  4EQP A;  1IPI A;  1PTO F;  1EYD A;  1KNE A;  2VXW A;  3NTH A;  2VUM B;  2JSO A;  2Z4I A;  2WJ0 A;  2EO0 A;  1F9Q A;  2FLC A;  3QB3 A;  4TQU S;  3R3O A;  3EA6 A;  5CYU A;  2JA6 B;  4J8Q A;  1G91 A;  4ABN A;  4HMI A;  1MSG A;  5E4W C;  1EY8 A;  2F1M A;  3I90 A;  2ICI A;  1CZG A;  2LFN A;  5ELF A;  2B2V C;  1S5F D;  3KF8 A;  2ENB A;  4KN7 C;  2JYO A;  1L0Y B;  3S1R B;  4FP5 D;  4C56 C;  3P1H A;  3HGB A;  3D4D A;  1ZKO A;  2EY2 A;  1RKN A;  1I4Q A;  1I4G A;  1SNC A;  2BE5 C;  2KCC A;  3MHB A;  3H6M A;  5KNC A;  4FXG C;  5G3L F;  3GTM B;  2E2I B;  5EJW A;  2X6L A;  4KKU A;  4S3S A;  1R9T B;  2ZYZ A;  1ENF A;  4K8I A;  4FVM A;  1BNZ A;  4XDX A;  3C1E A;  4C3J B;  1IYV A;  2NVT B;  4PNY A;  4RH6 A;  2ID0 A;  1STH A;  2FJ2 A;  3T56 B;  3Q24 A;  2MUY A;  1SND A;  3D4R A;  3HOW B;  1IW7 C;  4KJN A;  3I3C A;  3H0G B;  3R2T A;  2B2W C;  2EJG C;  2RDG A;  1LT6 D;  5K36 H;  1D5Z C;  2B2T A;  1PRT F;  1SNP A;  1DM0 B;  2HDL A;  2B2U A;  1OXT A;  2IW3 A;  1M8A A;  1CQV A;  4XYQ A;  1HA5 A;  1ESR A;  2WB1 B;  3J7A V;  2WKD A;  4F8M A;  1W6J A;  2F0Q A;  5KGU A;  4RGN A;  1EEI D;  3P1Z A;  5IIF A;  3IAY A;  4KD3 A;  1HCZ A;  1B44 D;  1EZ8 A;  2XVS A;  2EYF A;  4EVO A;  1F9S A;  1G6Z A;  5C4J B;  4DFA A;  5JJZ A;  4J1M A;  2B2V A;  1Y1V B;  1TS3 A;  1SJE D;  1R4P B;  1G2T A;  4RWS C;  4HED A;  3Q6S A;  2NUC A;  2BDO A;  4C3H B;  5C5M A;  5BN4 A;  2LMC B;  1O80 A;  4HCS A;  1H9M A;  5A2Q E;  1MBY A;  4R8I A;  4MIU A;  1LO5 D;  4QCL A;  5EPK A;  1H9R A;  4BBR B;  2NB0 A;  1EQV A;  1WTV A;  4I65 A;  3C3L A;  5HUR A;  3HS0 C;  1A15 A;  3NHH A;  4A3I B;  1TWH B;  2NVY B;  5J22 A;  4C3I B;  3DEO A;  1Y8N B;  3TSS A;  3OWF A;  3EJI A;  1TY0 A;  3OIP A;  5AFW A;  3DHQ A;  5JEA J;  5FKA C;  1MGS A;  2A69 D;  1RJT A;  3NK9 A;  4EV1 A;  3KLS X;  1OB9 A;  1EYA A;  2MGS A;  1UAP A;  2N55 A;  2OF1 A;  4C2M B;  2E2D C;  2CW0 D;  2JA8 B;  3DWQ A;  1SE4 A;  4A3M B;  3F2U A;  3LNN A;  5M3F B;  1PTO B;  2Z4H A;  3NUC A;  4ME5 A;  4K2K A;  1HA6 A;  3A8I E;  4F87 A;  1LLR D;  5M5X B;  4DAV A;  3AJV A;  5EKK A;  2KVM A;  2RKS A;  2Q8T A;  4N9T A;  4DK0 A;  2NN6 H;  5CMD A;  1ILQ A;  2B2Y A;  2PCF B;  5EBC A;  1KLU D;  1FNU A;  4IZ8 A;  4TRD A;  1EZ6 A;  5K5P A;  4K5V A;  3ND9 A;  4DAY A;  3S15 B;  3NP8 A;  3MFY A;  1I4X A;  2BDN A;  2A69 C;  1H9S A;  5FDK A;  1EQT A;  2GW6 A;  2RA4 A;  1D5X C;  3JAM L;  4ZYS A;  5I6Y A;  1NAP A;  4LK1 C;  1KTK A;  4A3G B;  4RA8 A;  1RLV A;  4KK7 A;  1ILP A;  4RGT A;  4CHT B;  5TSS A;  1Z7T A;  1CK1 A;  1L0X B;  1SBB B;  5C3W A;  3KK7 A;  5C4X B;  4BWG B;  1IHZ A;  1AZQ A;  3N52 A;  4NDX A;  1PDQ A;  4WRD A;  2ZYZ B;  1I4H A;  4QF4 A;  1O7Z A;  2DY8 A;  1JOR A;  2KUM A;  1J9O A;  5EGT A;  4A3J B;  1UNS A;  4CBV A;  1IL8 A;  5C0X H;  2FMM A;  2FCO A;  2QEJ C;  3P75 A;  1YNJ C;  1HUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...