4DAVA

The structure of pyrococcus furiosus sfsa in complex with dna
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
231
structure length
231
Chain Sequence
AMKLMEVSPLFPCIFLRRVNRFVGLVRIKERIERALITNTGRLNEFMIPGRIGYCTPKAGGKTRYILLGFEDHGKIAIIDTRLQGKAFEKIIEKELLPELEGCRIIKREPRVGESRLDYLIECSKGEIFVETKSAVLREGEYAMYPDCPSVRGQRHIKELIKLARDGKRAMIVFIGALPNVSKFKPYKKGDPKIAELLKEALEAGVEIRALGLHMELSGEIIYRGELGVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Sugar fermentation stimulation protein homolog
publication title The structure of SfsA and its DNA complex; A DNA/RNA nuclease with a novel domain combination
rcsb
source organism Pyrococcus furiosus
total genus 63
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03749 SfsA Sugar fermentation stimulation protein RE domain
A PF17746 SfsA_N SfsA N-terminal OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.580 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4davA01
3.40.1350.60 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 4davA02
4DA2A 4DAPA 4DAVA
chains in the Genus database with same CATH superfamily
2A69D 1HNXL 3NWSA 5FLMG 2CHBD 2Q2HA 2F0SA 1KAWA 1YNND 4LUOA 4UP8A 5C3WA 4A3MH 1N34L 1WTWA 4K5XA 4DR1L 1UE6A 2G9DA 1EWIA 3J80c 2LS01 4Y7NH 2K14A 3ULLA 1ENAA 2VQFL 2P5ZX 5JEAJ 3IFTA 4A3DH 3PO2H 3EBEA 2CW0C 3ND9A 2FLCA 2A6ED 2ASBA 5CV6A 3TMEA 1Y1OA 4ODGA 2TSSA 1CHQD 4CKEA 4FF3A 3RLNA 2IT1A 3S1QH 1JMCA 3S1RH 5EPLA 1VQMA 3TDQA 3SE0A 2Z1CA 1LTLA 1C7YA 3Q22A 1FYCA 1N36L 1PRTD 3MTSA 3ERQA 3S15H 1TS4A 1Y14B 2N3SA 1QZHA 1HNWQ 2NVXB 1PRTF 3CCLA 4GKJL 1HR0W 4CKBA 3GTPB 1UE5A 1WFQA 3Q0AA 1CA5A 5KRUA 2FMMA 3NTHA 4BY1G 4KKUA 2GVAA 4TKOB 4HJAA 1B3QA 3KBGA 3D4WA 5IWAQ 2GA4B 4XDXA 3NELA 4MTKA 4NPSA 4GNXB 4LAAA 2GN5A 3CKIB 1I4RA 1TS2A 3ITPA 4C3IG 4IFDH 4TKKA 5BN4A 1XNQL 4J8QA 3BVGA 4R4OA 3SK6A 1KNEA 3OIPA 4DUZQ 4FP5D 1X3QA 4K8IA 1HPCA 3U58A 1PXUA 1PVOA 2Q8RE 3W5OA 2PPBC 4OXPA 3TP7A 2C5CA 2I5HA 1EY9A 3HFZB 3A5ZB 4NKLA 3F2CA 4YCUA 1PH8A 1PDQA 1CI3M 2FFKB 3J7AV 1CKNA 4CJ1B 1Y1VB 2VB2X 1E0BA 1UEBA 1X9NA 2K5HA 1A3VA 1F2YA 2KBNA 4RH6A 5GAHC 1VF7A 2EPBA 4DR6L 1XPUA 3P1HA 1PFSA 4EQNA 1BNZA 2FJ2A 3AJVB 1U4LA 3MA2B 4LF7Q 1LTRD 2VW9A 4QY7A 2LFNA 1BOSA 4JI2L 2KQ3A 3NTKA 5IP9H 2IX0A 2NVQB 1TY0A 3AMUA 2VUMH 2K05A 2L55A 4GOPB 2Z0RA 4X64L 5E7NA 2QDBA 5K36H 1PYSB 2UUAL 4A3IB 3IAYA 1E24A 4DK1A 4GS3A 4B3MQ 1Y8OB 4QQBX 1LTTD 1LTBD 4G6VA 1SEBD 1V1PA 1I6HH 1DCZA 3E3XA 1QZGA 1G8ZD 1D5MC 3IEYA 1RTNA 1SN8A 1CK1A 3GTMH 2F4VL 4YCVA 3CCEA 3K5LA 2MFIA 2WIIB 5D3IB 3QJYA 1NE3A 3KBXA 5FJ8H 2OTLA 2ICEC 2K5NA 1EYDA 2NTTA 1HUNA 1BVSA 3A5UA 3HGBA 1I4XA 1X56A 4KHVA 4WORA 2A69C 3EQLC 3TRZA 2F0FA 4HJ5A 2F0JA 1C8CA 2WV6D 3NWTA 1CKMA 2B2VA 3Q8DA 5FLXE 1QNUA 3F2BA 2YTYA 2HT1A 3BZCA 3HOXG 1X3FA 2QDLA 3E6ZX 4L8JA 1FGBD 1SYGA 1CHPD 1UWVA 3BYYB 1DXMA 4DFAA 2FMCA 2A68C 3VR5A 3MXPA 2PZTA 3ULJA 2NVYH 2E75C 3K8AA 3TSSA 4S3SA 2NVXH 3LX0A 4QL5A 3OW7A 1IBLQ 2WCWA 2IJ0A 2EYOA 2WJ0A 1H9JA 1ASYA 2F03A 3M3YH 2R6GA 2UUCQ 2PI2E 4ME3A 4DAYA 4MN3A 4I65A 1AEXA 3K5OA 1RHPA 1TWHB 4MTNA 2R7DA 2E2IH 4C56C 5FOBB 1HNWL 1I50B 3BZKA 2N88A 1XTDA 4HJ7A 5LMUQ 1QE6A 2UXCQ 2RQXA 2HQEA 1SNMA 1GHKA 2FHTA 5C44B 3NUCA 3VDYA 4PG3A 2ZXOA 4HEDA 1PH4A 3QOJA 1BF4A 4K5WA 4HJ9A 5IWAL 5M3FB 2VY3A 4BBRB 2XWBB 1JJGA 3F1ZA 3MFGA 1VQ7A 5BR8Q 3ZJYC 2M9VA 1PMRA 5LMNW 2F0OA 4DUZL 3J80i 2Y0SE 1S5DD 3E9IA 3CXCA 1SFOH 2B2TC 5BN5A 1D1IA 1PH2A 1EU3A 3QIAA 5JJLA 4BY7G 4XQNA 1VQ9A 3OTOQ 4KHZA 1EEFD 5C3EB 4GN4B 2NZ1D 2PMZB 2CH4W 4LFCQ 3J81L 1VQPA 1R4PB 1V1PB 2NTSA 2OTJA 2YYZA 1D5XC 1XWEA 2CQOA 4ZAIA 5C4XB 1SE3A 1L0XB 2NVQH 3F2UA 4ZK9B 1R9TH 2R93B 5C0XG 4JV5Q 1XXGA 4IPCA 3RLOA 4J15A 1CSQA 4A3FB 4JI0Q 1QVCA 4QIWE 3HOYG 1HR0Q 3HOUG 4LF7L 3T13A 3S2DH 3FP9A 1JJCB 2IX1A 1VQIA 1M8AA 3WWVA 5M5WB 1EL0A 2JA7G 4A3BB 5LL6X 4OONA 2E76C 1WTXA 2R7ZH 3K80C 2K5WA 5J22A 1B53A 2ZXPA 3CU7A 3GTGH 5ELCA 1WTHA 4RKBA 1XPRA 1T9HA 5FK9C 4ZYSA 4B3ML 1P8LA 3I4LA 3PGZA 3IF0X 1ZP7A 2F0PA 3LGJA 2PCFB 4JPBW 4LJZC 4APVA 4RKLA 2JA8G 4ZCKA 4EX5A 1ICWA 1S72A 3STBC 4M1UB 1ML0D 1C9OA 4EQPA 1EY5A 1F2MA 2PQAA 1U4PA 3UE0A 1A6XA 1Y1WB 3HOZB 3NENA 2O4XA 3I4MB 3FKIH 1B1ZA 3J7YW 4A3KB 1SMYC 3NE5B 1K8GA 4X62Q 1DJRD 1K3RA 2EQSA 4OWWB 5EQ0A 4LUZA 3TREA 2UU9Q 4ZQ3A 1FNVA 2XVSA 4BY1H 1A2TA 1BBUA 2VL6A 3PCOB 3PIPA 1OB9A 1C0AA 4YCWA 4CKCA 4G7OC 2QA4A 3K7UC 3TEHB 2KCCA 2B63B 4C3IH 1E1OA 2NVTB 3HOVG 3I72A 2ZJRA 1IW7C 1SNCA 5GROA 3ZYYX 4OGQC 5EKLA 1J6QA 3HZXA 5C5LA 1Y88A 2PZWA 1I4PA 2EXZA 2M00A 3MXGA 5G3LF 4KV6A 3L2PA 1TWHH 3I56A 1CFMA 3MC0B 1VQFA 2F0DA 1O7ZA 1IBLL 5ELOA 3DUZA 1RD9D 2UUCL 4Q0FA 3RZOH 5IIFA 4EGVA 3GTLH 2D0OA 5C3XA 4DV0Q 3I4NG 4JK1C 5E4WC 3HKZB 1SE4A 1KHIA 2YV5A 3RR5A 1HZ9A 4CDCC 5LMUL 1VQBA 2UXCL 4RCOA 2EXDA 4AYBG 2LKVA 1RF2D 1LT6D 4Z9CB 3S16B 3S17B 2H1EA 2MGSA 4FO2A 1KABA 1DOKA 2R3ZA 2F3IA 2INBA 1TWFH 4BBSH 4L5SA 1R11A 5BR8L 2CW0D 1GOZA 2LXKA 5C3EH 4QMGA 4GNXC 2G9HD 4R8IA 1EQQA 4OELB 3DEOA 4Y7NB 4DK6C 4GN3B 1IPIA 3VYSA 4A3DB 2L4NA 4RGOS 4XQQA 3CPFA 2UXBQ 1EZ8A 3DWQA 3HP3A 1UNSA 4YHHQ 3H15A 4QBOA 2N8NA 3TP6A 1P16A 5AFWA 1SJHD 3OTOL 2MJ8A 5ELNA 4C3JH 3S1QB 1IBMQ 3S1RB 3P1ZA 2ENBA 4LFCL 4KMUC 5T1IA 2AUJD 3EA6A 4K2LA 2LMCB 4UDUC 3UDXA 4HJ8A 1KL9A 1I4QA 3U9SA 2E2HH 5I9PA 4A3CG 5J39A 1TQOA 3CCMA 3S15B 1FD7D 1FVIA 4JV5L 2PQAB 2CH4A 1RDPD 1BCPC 4JI0L 2UXDQ 2MHVA 4MHEA 1HR0L 4H0LC 1F9QA 2K5DA 2Z8LA 1WTQA 4IALA 4K6LA 3BVMA 5M9OA 4X66Q 1TWAH 3SK4A 1G51A 1SNQA 2L15A 1LTID 1X65A 3TS0A 1H9SA 5KEEA 4IFDI 5FLXL 1LV9A 2HIVA 3AFPA 3HS0C 1XX8A 1NBWA 1IHZA 1YNJC 5LMNQ 2RDFA 3CW2C 3W2DA 2J4XA 2KEEA 3A54A 1GKHA 3ER0A 1MKHA 2RSNA 1D7QA 2JEBI 5HGTA 1DD2A 2NN6H 4C3HH 5JJZA 2FKCA 1Z9FA 2JSOA 1QCBD 1V43A 1HTPA 2OT2A 4X62L 1JWSD 4TVAB 5KYLA 3CC7A 2O5JC 2RKSA 1F9SA 1HTLD 4WFN3 3N6RA 2UU9L 4JI3Q 1AW7A 1CKOA 4H7BA 4FDBA 4AIMA 4JI1Q 2BDNA 2KEDA 4WJWA 5CV4A 1E22A 3L3OC 1VF5C 2VLDA 1WI5A 3GTQH 3FPUB 3JAML 1BR9A 2F0NA 1I3QH 4KN7C 1XTCD 3J81E 3ONAB 1M1KC 1SE8A 1STGA 2VUMB 2Q8TA 3CCVA 4DK0A 2IHFA 3D0FA 3PQIA 3DMUA 2Z4HA 2CQAA 1C4QA 3DM1A 1TXYA 1JOKA 3PO3G 1I6HB 4BY7H 1Y1VG 1YNMA 1D5ZC 1F2LA 2E2JH 4DV0L 3GTMB 1YJWA 3SK8A 1HH1A 2KHJA 1T0FA 4DUYQ 1YJ9A 5CC4A 1BBWA 2QKIC 2SNMA 3RN2A 3A0JA 3NHHA 2HDMA 1K9MC 2B2YC 1QUQB 5L37A 4BS9A 1JT8A 3GDEA 2ID0A 2JEAI 1KAAA 4KK7A 1S5FD 3P1ZB 5C0XH 4A3JG 3A7LA 4I7AA 5IT9L 3HOYH 5EKKA 1I5FA 1CSPA 1NAPA 1QNKA 3T51B 3K58A 1V1QA 1WTVA 2D9UA 5CBAE 4KY6A 1JJ2A 1ET9A 4A3IG 4LMQD 2QCPX 2BA1A 2A68D 4NXMQ 1GUOA 3NBHB 2WACA 4HN7A 1NTGA 5GAGC 4U673 4PZ7A 1L1OC 4KHPQ 3K5NA 1JOQA 2EY5A 1EZ6A 2UXBL 2EVBA 4YHHL 5H1SE 1K0RA 2L9HA 4OO1H 1WYDA 5IE8A 3M85A 2JN4A 4J6HA 1JORA 4RGMA 1H9SB 1B9MA 2PW5A 2NVYB 3P75A 4DR5Q 1IBML 1MJEA 4F87A 3EFXD 1Q90A 3T16A 1TVXA 5D14A 2F52A 1TY2A 2F0VA 1VQ4A 3M3YB 1U5KA 4U68A 1VQEA 2F0WA 2X69A 2PMZE 4ZLTF 4HR7B 3VR6A 3NTIA 2OXPA 5JPMC 2E2IB 3TP8A 2OQKA 1KDBA 2K28A 3VR4A 3GP7A 3FPPA 3MXUA 1G6ZA 2UXDL 1OO9B 1KNAA 1PLFA 1U9RA 1EWCA 4XIGS 5BN3A 3CCUA 1VQ5A 1MSGA 1KLUD 5ELBA 4ID6A 1V1OA 4XT3B 3RN5A 4H13C 4X66L 1K73C 5J1ZA 3J7ZC 1F2ZA 4EQOA 2PW7A 1DZ1A 2NZOA 5CGKA 3AQQA 1GUGA 2EYLA 3QWNA 4OX9Q 5LMNL 2HDLA 1FJGQ 4FF4A 4IUUA 1ZEQX 2FXQA 2H5XA 3S14B 3FRPB 2W8MA 1UE1A 3S9WA 2JXMB 3VA7A 1MJCA 1EQVA 2BH2A 2EJMA 4IUVA 4DAMA 1SFOB 2B8FA 4ME5A 5AJ3Q 1AFPA 5M3MH 3HOWG 3S2HB 1HFGA 4UP9A 4CHTB 3I4NH 2CKZB 5C44G 1E2WA 4IPGA 3DXJC 1WD1A 1KQSA 4K0KQ 2B2UC 1SYCA 2I46A 3W1BA 2N55A 1KLGD 4X3SA 4CJ0B 2R92H 5M3FG 4OWXB 4HMJA 3K6OA 2XSCA 2EDGA 3A8KE 3L9AX 4JI3L 4BBRG 1R9TB 3S1MH 5J3BA 3M4OB 2B29A 1LT3D 4FVMA 1GO3E 2DNCA 3NPPA 4JI1L 2EYJA 4KN4C 5D65A 1X3PA 2DJFC 3U4VA 4MNOA 4O2DA 3G48A 1OXUA 1L1OA 3PMFA 1TWCH 2ZJPA 3S2DB 2IWHA 1PTOC 1STBA 2NWGA 4FXDA 2WCZA 1K3BC 1Q7YC 2GVBA 1O7IA 2R7ZB 4NXNQ 4R4TA 1DOLA 4JYAQ 1WCMH 4KD4A 3STBD 4QUFA 4P73A 4HCEA 3GTGB 2KHSA 1W3SA 3BYTB 3H0GH 2DY7A 4DGZA 5KYIA 3JC66 2IY5B 5FO9B 1YNXA 4R8NA 1SMYD 4X3UA 3D8GA 1PFBA 4Y52H 1VMPA 4PNYA 3M7NA 4DUYL 1LO5D 1N9WA 4A3FG 4MIUA 1AP0A 3FKIB 3DWPA 2XWJB 3NXWA 1IZ6A 1F1ZA 3DEPA 1K0SA 3HKZE 3MEHA 1ONLA 3LWUA 3Q6SA 1JB7A 3S24A 3EVQA 2MNAA 2JQOA 4HSPA 2Z6KC 5C0XJ 3CMEA 4BY1B 2HCCA 1IW7D 4QBLA 5CV5A 2JA5G 2VNUD 1S5BD 5GQOA 3NEMA 2UUBQ 1AZQA 3QG1A 3KLRA 4NXML 4IUTA 1KDAA 2ATWA 1IYUA 1EY7A 3X3NA 4C3IB 4A3EG 4KHPL 2M2LA 4DN4M 1EIGA 1VQLA 1VQ6A 5DLQE 5CORA 1EUJA 3BDLA 5IGFA 2MO0A 1MIUA 1Y1WG 5IY0A 1A0IA 2IX3A 3GTJH 1JWUD 3I4MG 4LW1A 2K5VA 1S3OA 4DR5L 5A35A 2B2UA 4FF1A 2NUCA 1E1TA 2K01A 3RZOB 4IURA 4DV4Q 2QF7A 1CKNB 3JAME 3F8TA 3GTLB 1O7YA 3DLLA 1SYBA 3K5MA 1SMXA 2KENA 4OWTB 3J80L 4K2KA 4L5TA 3R3OA 1TIID 4G57A 4ZKBB 4CDDC 4I7ZC 4A76A 3SVMA 1Q1BA 1MHWC 1GUNA 2VZAA 2AWNA 5IP7H 2ZTCA 3KDFA 4NB3A 1RL2A 3H09A 1QOHA 3S14H 3R8BA 1CM9A 2CVRA 2NZHA 3HEJA 4HCSA 4R4CA 2QEXA 1SJED 1TWFB 4P75A 4BBSB 2DUDA 2FINB 3QB3A 5M5XH 2A5HA 4A3LH 2EOTA 2XRSD 3S2HH 2ZYZA 1HUMA 4OX9L 1AN8A 1FJGL 4NW2A 2HD3A 2F0HA 1LABA 3WDNA 4GLXA 1GEFA 5EAYA 4ZKCB 4IPDA 5NUCA 2MUYA 1B4OA 1I4GA 1X3GA 1H95A 3PO3H 4A3GG 5AJ3L 5IT9E 5EJWA 3R93A 3TQYA 2EZVA 4GKKQ 4DR4Q 3IEYB 5GAEC 5T1GA 4C3JB 3M4OH 3I73A 3GV6A 5IYDH 2I0QA 1BCPD 5CR3A 5FLMH 4AQYQ 4POFA 2Z6KA 3I4OA 1NR4A 4K0KL 2A6HC 2MP1A 2E2HB 4A93G 3NQTA 3H3VI 2JP1A 5JJKA 2ZT9C 1BCPF 1EFWA 1MGSA 3TZDA 4DPGA 4A3MG 4P74A 1PH1A 1TU2B 2RSOA 4DV6Q 2JA6G 3SK5A 1BO0A 3KJPA 4QGUA 3CC4A 2F0UA 1WD0A 3J81i 3H6MA 3T56B 5TSSA 1U4MA 3C1FA 4EVOA 1JOOA 1TWAB 1YNJD 3A8JE 5JPNC 1PA6A 2WAQB 2CWPA 4A3DG 1AH9A 1FL0A 3PO2G 4NXNL 4JYAL 3HOXB 4DR3Q 1CT1D 3NSWA 4C1NK 1E7ZA 1EYAA 5CV9A 4IN3A 1HHVA 5IGCA 2NB0A 3PIO3 5EPKA 2LSSA 2NN6I 4X3TA 4IOAA 2FCOA 1V8QA 1HA5A 2L12A 2QILA 1EY8A 4C3HB 3DWAA 4DAYB 1ILPA 3BT7A 5F2DA 1D6EC 4HMIA 3KLWA 2YU9H 5HY6A 1LT5D 4HAEA 3I3CA 3IL8A 1CTMA 2HUGA 1X6OA 2Y0SG 3OMGA 3CCSA 4AH6A 1ZXTA 1HRJA 1LYLA 2F0QA 5M5YH 3R2TA 1B7YB 2B2TA 4GZYC 1PH9A 3BU2A 4KJNA 1S5ED 3R2IA 2ZTDA 1M4VA 4IFDG 3W1GA 2UUBL 1Z47A 2K6AA 1YZ6A 1S4ZA 3G71A 1Q86C 3GTQB 3S1NH 2XNAC 3T53B 4GLAC 4EQ5A 1B3AA 1I3QB 2OKFA 3I90A 3KDFB 3UI2A 3HKSA 5E1FA 5I9OA 1D8LA 2RHSB 1RCVD 5LHY1 2EYPA 4P72A 1IKLA 5CV8A 4LF9Q 2RVLA 4TSSA 1DONA 2RCFA 3HOWH 3CRLC 4BY7B 1O7LA 4DF7A 3CQZB 1NMFA 1SE2A 4DV4L 4ALPA 5I2YA 2C35B 2E2JB 3SGIA 4V0BA 2QEJC 3OSOA 3CF5A 5C4JH 2VQEQ 1IYVA 3KLSA 2DNEA 3P7JA 2AWOA 4HTHA 1VMCA 1YHAA 5KGUA 1PZKD 3M9BA 2CFMA 3HOYB 5CV7A 5IP9G 3MXNA 4JOIC 1OXSC 2IW3A 3T1HQ 5K36G 3J81j 1I6VC 3MWYW 3A74A 2JA7B 3K0XA 4JBMA 4RAUC 1RODA 4IUQA 1MSHA 5KNDA 4DV2Q 3CCRA 1GHJA 3SHLA 3G6JB 1VQGA 3K7AH 4HIMA 1YJNA 1XNRQ 3KF6A 1PRTB 2B2WC 5HGQA 5C4ZA 4LQEA 4UPAA 1NMGA 2D0PA 4GKKL 4DR4L 3NBIA 2DY8A 3GTKH 2X6GA 4LFBQ 2XTIA 4BXXG 3RZDH 1LT4D 4AQYL 4KLKA 1W6KA 1EEID 1YI2A 2N49A 4ZUIA 1L2FA 3OW2A 5C5MA 1B44D 1BXTA 1F77A 1J8IA 2F1MA 4L6TB 2FL3A 4B9WA 3OYYA 1F9RA 4B3SQ 3HOXH 4DV6L 5DAUA 4B9XA 4GOPC 2JA5H 4ZQUA 4PV1C 2CV8A 2WIWA 4F88A 4N8FA 2AUKA 1LACA 4O42A 2SDFA 2EYFA 3AFQA 1YITA 1NR2A 3CMAA 4DR3L 2BE5C 3DHQA 3J80E 1HQRD 1T5XD 4M8AA 2HHHQ 4GN5A 4IZ8A 4R4IA 2F0EA 3FMCA 4X65Q 1XMQQ 5IGDA 1JCKB 3RNUA 5M3MB 2KOLA 3ULPA 5E4XA 2YTXA 1KIXA 1XPOA 5IYBG 3PF5A 3I4NB 4GNXA 1WJJA 4IJLA 1IKMA 1SYEA 3SR1A 3Q23A 2YTVA 2KHIA 2ZM6Q 2R92B 2RDHA 4R4QA 1ESRA 1FR3A 4AYBB 4G7HC 3V96A 1PTOD 1ASZA 2GJWA 3FDTA 2XN9C 2XRQD 1X3EA 2D5DA 2F0MA 2A74C 3KFUA 3GV3A 4HIOA 3S1MB 4WJ3M 3E9HA 1VQCA 1I94Q 1CQVA 2BDOA 1RLVA 1PTOF 1RJTA 4JBJA 2AQ1B 2I5MX 1XYIA 1QWYA 1QVGA 1TWCB 2AQ2B 5JOBA 2B2WA 2WKCA 1NSNS 3G6EA 3GTOH 3KF8A 3CQZH 4PZ6A 1Q3LA 3UDGA 2PYKA 1SYFA 5ELFA 1WCMB 2CWAA 4LF4Q 4QF4A 1Q82C 2WB1B 2PQEA 1K83B 5EBDA 3H0GB 2BOSA 4A3GH 4LF9L 2K7VA 4FNFA 1HH2P 1TKWB 3SDZA 1IL2A 3D6WA 3JAMi 4IUPA 1H9KA 4KTAA 1RZNA 1EIHA 4OIKA 4PMBA 2RBMA 3C46A 3KF6B 1U4RA 5JAVA 2I07B 1D2BA 3VYUA 3HOUH 1PFMA 2VQEL 2K03A 4RGNA 3VA5A 4A93H 1ZKOA 4F7XA 2EYHA 1B9NA 3HG9A 5HURA 3RMHA 4Q5VA 2Z6BA 5C4HA 2JA7H 4DV5Q 4HSVA 4LF5Q 2E5LQ 1XMXA 4UP7A 2JA6H 4JI4Q 1D1KA 4ZRZA 1HA6A 3GD7A 3C3LA 4ZUJA 3L0OA 3V05A 2R7ZG 3T1HL 1PH7A 3LNNA 4XT1B 3WOEA 1IL8A 2EE1A 3D6CA 4V190 1SNPA 1B50A 3BDOA 1K8OA 2JA8H 1HNZQ 3J7A5 1X54A 2EJFC 2O5IC 4DV2L 1Z6HA 4JI7Q 2C9OA 4OEMB 4ABNA 2PNRC 1XNRL 4IO9A 3PSIA 2FKHB 1KC8C 1II3A 4L5RC 1JE4A 1OXVA 3KUPA 1W6JA 3NP8A 3FHWA 5I6YA 1PH5A 3GTJB 3FKIG 5FDKA 1EIYB 3J81c 1KXLA 3PV0A 1DOMA 5DNFA 2Q2TA 4LFBL 1EU4A 2ZTEA 1NUCA 4DV1Q 1N32Q 5CYUA 1U0LA 4OHJA 3CC2A 1K28A 1TWGH 5CMDA 1Z7TA 3D3RA 1FNWA 1NY4A 3PUVA 1Q1EA 1J5EQ 4LFAQ 5DM73 4TKDA 2OF1A 2I5LX 3OPOA 3W3AA 4B3SL 5FO7B 3HOVH 3H3VC 2DBSA 4EV1A 3PUXA 4FXGC 4LF8Q 2H4OA 1SXTA 2OEOA 2HIXA 4O0AA 3FVQA 1EIFA 3BG3A 1Y8NB 1G6PA 1O78A 2RHQB 4H44C 2DN8A 4DXGA 2B2VC 1WTOA 1SYDA 4E6IA 3SXHA 3U50C 5M5XB 2KCMA 2B39A 2B2YA 2AMCB 4K6DA 2WAQE 5D3DA 2HHHL 4JG2A 5E3FA 1XMOQ 2WKDA 4JW0A 1A62A 1LTAD 3P20A 3AB9A 4X65L 1XMQL 4JBKA 4DU9A 2A6HD 3KF8B 5EKIA 3B6YA 3PO3B 1STHA 1DYQA 3MHBA 2DGYA 4QUCA 3E5SA 1QILA 3BZDB 4JBWA 4RHSA 3MZ5A 1BCPB 2RDGA 1LLRD 1R4QB 2D62A 4DNRB 1V9PA 1BDOA 3OOCA 5JEAG 3CAMA 1M90C 3I91A 2ZM6L 3J7AF 1SLJA 2K52A 1GUTA 4FXKC 1NNXA 3BJUA 4A3JB 1PH6A 4RFBA 5KNCA 4BBSG 3PIP3 3PUYA 1I94L 4H02A 2Q2IA 1A3UA 1IYJB 5C3EG 1K83H 4DAPA 3C1EA 1SNDA 2N78A 1TT2A 4KY5A 1VS0A 1HCZA 5I2XA 4MZ9A 4PZ8A 1Y69U 1TR5A 2K50A 4JVZA 1A3TA 4ULLA 5EPJA 1AE2A 2B3GA 5A2QL 5C4XG 1HZBA 2MO1A 1MBYA 4LF4L 2R93G 2KUMA 3UE1A 4C3JG 5IYCG 4A3CH 4LUVA 1GUWA 2BA0A 1YVCA 3IKJA 3MEFA 2K5QA 4CGYB 2DJGC 4CBVA 3K57A 1SBBB 5K5PA 4BXXH 1N8RC 3C2PA 1ZYRC 4NP5A 4A3BG 5IGBA 2ALYB 4UHVA 1PV4A 4RMFA 1PYWD 3BS1A 2CZRA 2F0GA 2YU9B 1OXTA 1VQDA 4DV5L 1YNNC 1YIJA 4BA1I 4WRDA 2WIZA 4LF5L 4RG1A 2E5LL 1IXRA 4XQJA 2B8GA 3I7FA 4JI4L 2KECA 2WAQG 5M5YB 4DV7Q 1TS3A 2EO0A 1OB8A 5IGGA 4ILWA 2JK8A 1B70B 1PZJD 3HOZG 3RUZA 1HNZL 4XTCS 2OQ0A 2A6EC 4G6UA 3S1NB 4DV3Q 4C1NI 3AYHB 3DNXA 1E2VA 3RLFA 4A3KG 4JI7L 4KKTA 2PO4A 4JCVE 4LF6Q 1HZCA 2NN6G 1GM5A 3GTPH 2A1AA 3T1YQ 5DM63 5EGTA 4C3HG 1AZPA 1GVPA 1GXDC 2OCEA 2IHEA 4J1MA 1PRTC 4DNTB 4K8JA 4GLVB 4P2CB 3O13A 3G4SA 2F4IA 2A8VA 3TZUA 3A56A 4RCNA 4DV1L 2ES2A 1N33Q 4A4IA 1O80A 3MAQA 2WINB 3HOWB 1N32L 2B63G 4OIJA 3CRKC 1CZWA 5C6AA 5IYBH 5ELEA 2QW7A 4QB4A 4RGTA 1VCIA 3A7AB 1ENCA 1J5EL 4LFAL 4N9PA 3T4AC 1EOTA 1EWHA 5C4JB 4G7ZC 1B8AA 3HRZC 4LF8L 1VQAA 2O2LD 4CDEC 3E0EA 5JVG3 1IBKQ 2SEBD 1F9PA 2Z0SA 4E6ZA 2E2DC 1L0WA 2K32A 4B3TQ 3MFYA 1L1OB 2XIWA 5JVH3 1LTGD 2AHOB 2SNSA 3OWFA 4KKSA 4IFDJ 1ESFA 5EBCA 2MPMA 3NK9A 1PFNA 1Y1VH 3HKZG 2EYMA 5FLXc 2V1CC 2KA7A 4DR2Q 2XGTA 4PMWA 2K04A 3I8ZA 1UAPA 1X55A 2OWOA 3M4PA 3EN2A 1XMOL 1A2UA 1PZID 1JC7A 3AU7A 3K7AB 1T5EA 4L5QA 3A55A 4QJFA 2PNHA 1STNA 4DK3C 1AE3A 1G2SA 4K14A 4JI5Q 4A3JH 1S5CD 3P1YA 4N8X1 3V2TA 3GTKB 2RA4A 3VYTA 4DAVA 3RZDB 2AQ3B 5IYDG 2L1BA 4FF2A 4A3IH 4K5VA 4F8MA 1UE7A 2PI2A 1RIPA 4KI0A 4IQZA 4YY3Q 3GO5A 4YWMA 3UDIA 4IUNA 4B3RQ 2K75A 1JB3A 1SR3A 1HXYD 3IRBA 2RF4A 4AYBE 1VQKA 1OXXK 3EROA 2BE5D 2EIFA 3QR8A 4CJ2C 4NDXA 1C48A 3JAMc 2JA5B 4BWGB 1VQOA 4RA8A 4LNQA 1UUPA 4TQUS 1HQMC 4DKAC 1CZGA 4A3EB 2LY7A 1BBXC 3M4QA 3QO2A 1EY4A 4OO1G 3OMCA 2BH8A 3PF4A 2EY2A 1EQRA 3H91A 3D4DA 3LWEA 4XYQA 3M4YA 2GW6A 3N52A 2V4DA 3EJIA 1PHJA 1JICA 2WB1E 4B08A 1GD7A 2R61A 1Q8KA 4PMCA 2KCNA 5ISRA 3OIQA 1KDCA 2KVMA 3I70A 4JI8Q 1VQNA 3CCJA 1CA6A 4QCLA 3CP0A 2PZUA 4HIDA 2F3WA 3EIVA 1LTSD 3WOFA 2IPKD 1PTOB 3H94A 5IT9c 4DR7Q 4R9WA 2LXJA 2BCOA 4DV7L 1G291 1G2TA 4C2MB 1JR0D 5G3LD 2MQHA 2HCIA 4R1JA 1CUKA 1ENFA 1JQYD 1W2BA 4DV3L 4KY7A 4JI6Q 1SAPA 1VQHA 4KD3A 5LL6S 3AEVA 4DXFA 2ZYZB 1I50H 3CHBD 2F0IA 3GTOB 1Y8PB 1TS5A 4LF6L 1QVFA 1FNUA 3A8IE 1K8MA 3KLSX 3OHXC 3T1YL 2HQLA 1WOCA 5C44H 2L11A 2WP8J 4XXEA 1I4HA 5M3MG 1R0VA 4LK1C 3SEBA 1E2ZA 2D2CC 3URYA 1H9RA 4A3GB 2NYZD 3TS2A 5M3FH 4IJHA 4XYOA 1HNXQ 1MD2D 5IGEA 1SRUA 4BBRH 1N33L 3K0YA 3PUZA 5C0XI 2KCTA 1STYA 2R92G 1Q46A 1N34Q 3CD6A 1EOVA 4DR1Q 2L0CA 1A15A 5JEAH 1DGSA 2VUMG 3HOUB 5GADC 1QB5D 4A93B 5A2QE 1EFID 3K59A 3F2DA 3I2ZA 3G7LA 1FGUA 3MVVA 2X6LA 2VQFQ 3UDFA 1IBKL 4FYDA 4A3MB 4B3TL 2JA6B 4WJ4A 3BVZA 3U4ZA 1ICFB 3KYHC 4RHRA 2JE6I 2VS1A 2AKWB 5I6WA 1L0YB 3FOVA 5FO8B 1Q81C 1WCMG 3ND8A 2WB1G 3X3MA 1SNOA 4OO1I 4DR2L 2JA8B 3H0GG 1EQTA 1N36Q 3PO2B 4G4KA 4JC0A 3NQIA 1JE5A 5C4XH 2EJGC 5FJ8G 3KOJA 2R93H 1QUQA 3RD4A 3E0JA 1EY0A 5IYCH 1OTCA 5KIXA 4A3FH 3OWEB 4GKJQ 1BUVT 2K33A 4JI5L 1SSOA 1EYCA 3K81C 1RKNA 1ET6A 3H3VH 5M5WH 1STAA 2E8GA 4OL7A 5JJIA 4A3BH 2A73B 1LUZA 3KK7A 3KJOA 2L5TA 1HJPA 2Z9HA 1JWMD 1WTRA 3GQBA 2CCZA 4UY8C 1TWGB 2F0LA 3NBHA 4RWSC 1H9MA 4YY3L 1XNQQ 4HIKA 2Y0SB 4B3RL 1SROA 2ZXRA 4A3EH 3HOVB 3DM3A 2ZJQA 1STEA 3TN2A 4DNIA 3CCQA 4LWCA 4KJOA 4O1NA 4A75A 1WTPA 1J9OA 4BA2I 2Q2UA 2KJXA 1Y1WH 3D4RA 3HOZH 2F0KA 3I55A 1HZAA 4N9TA 3I4MH 2IL8A 4A3KH 5FKAC 4X3KA 1VQJA 3BDCA 2F3VA 4UAIA 1VDZA 1PH3A 1HFNA 5I4DA 1GJXA 1DM0B 4QIWB 3FEWX 5DEHA 1K8AC 1MI2A 1YHBA 1LM0A 1QJOA 2NBFA 1CQFA 1RTOA 1EYGA 3L7ZC 4DR6Q 1EY6A 2SOBA 2VB3X 4YWLA 1YHQA 4JOIA 2K1BA 1KTKA 1PTOH 2RCNA 1E3PA 4JI8L 2JYOA 3QOLA 1KRTA 3TBIB 3M7GA 1S40A 2B63H 2NVTH 2VXWA 4JI2Q 4C2MH 2Z4IA 1GUSA 2J7ZA 2QGQA 5CBEE 2OSTA 2EY1A 1BQQT 4P71A 3Q24A 1B2TA 5IODA 1X32A 1KRSA 4X64Q 2TMPA 5IP7G 1A8VA 5COYA 4IOCA 4CDFC 2A19A 1A79A 2UUAQ 2F0TA 2IXSA 1QG7A 5KNBA 1SDFA 4DR7L 1PYBA 1KD1C 5IOCA 1YBYA 4NMZA 1NJIC 1Q8IA 3PUWA 1UEAB 2EY6A 2J0TD 1VQ8A 2R7FA 3MXNB 3VR3A 2Q8IB 4PQXA 1WVLA 4POGA 2E74C 1Q12A 2JA9A 4A3LG 3PIOA 2WFWA 4YIJA 3TP5A 2JJQA 3VYRA 1ILQA 2ICIA 1YEZA 3ERSX 2K4KA 1NCVA 1XJVA 2F4VQ 4JI6L 1A63A 1G91A 3CPWA 4X6AH 3U9OA 5ELDA 2G5DA 3VR2A 1BKBA 3AJVA 4QBNA 4TRDA 4DA2A 3S16H 3ICEA 1ZYRD 4YWKA 3S17H 3IFDA 3D31A 4IPHA 4L63B 4GOPA
chains in the Genus database with same CATH topology
2A69D 3NWSA 2CHBD 2F0SA 1YNND 5C3WA 1WTWA 4K5XA 2G9DA 2LS01 1ENAA 5JEAJ 3IFTA 2CW0C 3ND9A 2FLCA 2A6ED 1Y1OA 5CV6A 3TMEA 4ODGA 2TSSA 1CHQD 4CKEA 4FF3A 2IT1A 5EPLA 3TDQA 3SE0A 2Z1CA 3Q22A 1FYCA 1PRTD 3MTSA 3ERQA 1TS4A 2NVXB 1PRTF 4CKBA 3GTPB 3Q0AA 1CA5A 5KRUA 2FMMA 3NTHA 4KKUA 4TKOB 3KBGA 3D4WA 2GA4B 4XDXA 4LAAA 3CKIB 1I4RA 1TS2A 3ITPA 4C3IG 4IFDH 4TKKA 5BN4A 4J8QA 3BVGA 3SK6A 1KNEA 3OIPA 4FP5D 1X3QA 4K8IA 1HPCA 1PXUA 2Q8RE 2PPBC 3TP7A 2C5CA 1EY9A 4NKLA 1PDQA 1CI3M 2FFKB 3J7AV 4CJ1B 1Y1VB 2VB2X 1E0BA 1A3VA 1F2YA 4RH6A 1VF7A 2EPBA 3P1HA 4EQNA 1BNZA 2FJ2A 3AJVB 1U4LA 3MA2B 1LTRD 2LFNA 1BOSA 2KQ3A 3NTKA 2IX0A 2NVQB 1TY0A 3AMUA 2K05A 2L55A 2Z0RA 2QDBA 5K36H 4A3IB 3IAYA 4DK1A 1Y8OB 1LTTD 1LTBD 4G6VA 1SEBD 1V1PA 1DCZA 1G8ZD 1D5MC 3IEYA 1RTNA 1CK1A 3K5LA 2WIIB 5D3IB 3QJYA 3KBXA 2ICEC 1EYDA 2NTTA 1HUNA 3HGBA 1I4XA 4KHVA 4WORA 2A69C 3EQLC 2F0FA 2F0JA 1C8CA 2WV6D 3NWTA 2B2VA 5FLXE 1QNUA 3E6ZX 4L8JA 1FGBD 1SYGA 1CHPD 3BYYB 1UWVA 1DXMA 4DFAA 2FMCA 2A68C 3VR5A 3MXPA 2PZTA 2E75C 3TSSA 4S3SA 3LX0A 3OW7A 2WCWA 2IJ0A 2EYOA 2WJ0A 1H9JA 2F03A 2R6GA 4DAYA 4MN3A 4I65A 1AEXA 3K5OA 1RHPA 1TWHB 4C56C 5FOBB 1I50B 2N88A 1QE6A 2RQXA 2HQEA 1SNMA 1GHKA 2FHTA 5C44B 3NUCA 2ZXOA 4HEDA 3QOJA 1BF4A 4K5WA 5M3FB 4BBRB 2XWBB 3MFGA 2M9VA 1PMRA 2F0OA 1S5DD 2B2TC 5BN5A 1D1IA 1EU3A 3QIAA 4XQNA 4KHZA 1EEFD 5C3EB 2NZ1D 2PMZB 3J81L 1R4PB 1V1PB 2NTSA 2YYZA 1D5XC 1XWEA 4ZAIA 5C4XB 1SE3A 1L0XB 3F2UA 4ZK9B 2R93B 5C0XG 1XXGA 4A3FB 3T13A 2IX1A 1M8AA 5M5WB 1EL0A 4A3BB 5LL6X 2E76C 1WTXA 2K5WA 5J22A 1B53A 2ZXPA 3CU7A 5ELCA 4RKBA 5FK9C 4ZYSA 3I4LA 3IF0X 1ZP7A 2F0PA 2PCFB 4LJZC 4RKLA 1ICWA 4M1UB 1ML0D 4EQPA 1EY5A 1F2MA 1U4PA 1A6XA 1Y1WB 3HOZB 2O4XA 3I4MB 1B1ZA 3J7YW 4A3KB 1SMYC 3NE5B 1DJRD 5EQ0A 4ZQ3A 1FNVA 2XVSA 1A2TA 1OB9A 4CKCA 4G7OC 2KCCA 2B63B 2NVTB 3I72A 1SNCA 1IW7C 3ZYYX 4OGQC 5EKLA 3HZXA 5C5LA 1Y88A 2PZWA 1I4PA 2EXZA 2M00A 3MXGA 5G3LF 4KV6A 1CFMA 3MC0B 2F0DA 1O7ZA 3DUZA 1RD9D 4Q0FA 5IIFA 4EGVA 5C3XA 4JK1C 5E4WC 3HKZB 1SE4A 4RCOA 2LKVA 1RF2D 1LT6D 4Z9CB 3S16B 3S17B 2H1EA 2MGSA 4FO2A 1KABA 1DOKA 2R3ZA 2INBA 1R11A 2CW0D 1GOZA 4QMGA 2G9HD 4R8IA 4Y7NB 3DEOA 1IPIA 3VYSA 4A3DB 2L4NA 4RGOS 4XQQA 1EZ8A 3DWQA 3HP3A 1UNSA 4QBOA 3TP6A 5AFWA 1SJHD 2MJ8A 3S1QB 3S1RB 3P1ZA 2ENBA 4KMUC 5T1IA 2AUJD 3EA6A 4K2LA 2LMCB 4UDUC 1I4QA 3U9SA 5I9PA 5J39A 1TQOA 3S15B 1FD7D 1RDPD 1BCPC 2MHVA 4MHEA 4H0LC 1F9QA 2K5DA 2Z8LA 1WTQA 4IALA 4K6LA 3BVMA 5M9OA 3SK4A 1SNQA 1LTID 1H9SA 5KEEA 4IFDI 5FLXL 1LV9A 3HS0C 1XX8A 1IHZA 1YNJC 2RDFA 3W2DA 2J4XA 2KEEA 3A54A 2RSNA 1DD2A 2JEBI 5HGTA 2NN6H 5JJZA 2FKCA 2JSOA 1QCBD 1V43A 1HTPA 2OT2A 1JWSD 5KYLA 2O5JC 2RKSA 1F9SA 1HTLD 4WFN3 3N6RA 1AW7A 4H7BA 2BDNA 2KEDA 4WJWA 5CV4A 3L3OC 1VF5C 2VLDA 3FPUB 3JAML 1BR9A 2F0NA 4KN7C 1XTCD 3J81E 3ONAB 1STGA 2VUMB 2Q8TA 4DK0A 3DMUA 2Z4HA 2CQAA 1C4QA 3DM1A 1JOKA 1I6HB 1YNMA 1D5ZC 1F2LA 3GTMB 3SK8A 1HH1A 1T0FA 5CC4A 2QKIC 2SNMA 3NHHA 2HDMA 2B2YC 4BS9A 2ID0A 2JEAI 1KAAA 4KK7A 1S5FD 3P1ZB 5C0XH 3A7LA 5IT9L 5EKKA 1NAPA 1QNKA 3K58A 3T51B 1WTVA 2D9UA 5CBAE 4KY6A 1ET9A 4LMQD 2QCPX 2BA1A 2A68D 1GUOA 2WACA 4HN7A 4U673 3K5NA 1JOQA 2EY5A 1EZ6A 2EVBA 2L9HA 4OO1H 3M85A 4J6HA 1JORA 4RGMA 1H9SB 1B9MA 2PW5A 2NVYB 3P75A 4F87A 3EFXD 1Q90A 3T16A 1TVXA 5D14A 1TY2A 2F0VA 3M3YB 4U68A 2F0WA 2X69A 4ZLTF 4HR7B 3VR6A 3NTIA 2OXPA 5JPMC 2E2IB 3TP8A 1KDBA 2K28A 3VR4A 3GP7A 3FPPA 3MXUA 1G6ZA 1OO9B 1KNAA 1PLFA 1U9RA 1EWCA 4XIGS 5BN3A 1MSGA 1KLUD 5ELBA 4ID6A 1V1OA 4XT3B 4H13C 5J1ZA 1F2ZA 4EQOA 2PW7A 1DZ1A 5CGKA 1GUGA 2EYLA 3QWNA 2HDLA 4FF4A 4IUUA 1ZEQX 3S14B 3FRPB 2W8MA 3S9WA 2JXMB 3VA7A 1EQVA 2BH2A 2EJMA 4IUVA 1SFOB 2B8FA 4ME5A 1AFPA 3S2HB 1HFGA 4CHTB 1E2WA 3DXJC 1WD1A 2B2UC 1SYCA 2I46A 2N55A 1KLGD 4X3SA 4CJ0B 4HMJA 3K6OA 2XSCA 2EDGA 3A8KE 3L9AX 1R9TB 3M4OB 1LT3D 2DNCA 4FVMA 5IODA 3NPPA 2EYJA 4KN4C 5D65A 1X3PA 1OXUA 3PMFA 3S2DB 2IWHA 1PTOC 1STBA 2NWGA 4FXDA 2WCZA 2R7ZB 1DOLA 4KD4A 4QUFA 4HCEA 3GTGB 2KHSA 3BYTB 4DGZA 2DY7A 5KYIA 5FO9B 4R8NA 1SMYD 4X3UA 3D8GA 1PFBA 1VMPA 4PNYA 3M7NA 1LO5D 4MIUA 1AP0A 3FKIB 3DWPA 2XWJB 3NXWA 1F1ZA 3DEPA 3MEHA 1ONLA 3LWUA 3Q6SA 3EVQA 4HSPA 5C0XJ 4BY1B 2HCCA 1IW7D 4QBLA 5CV5A 2VNUD 1S5BD 1AZQA 3QG1A 3KLRA 4IUTA 1KDAA 1IYUA 1EY7A 3X3NA 4C3IB 2M2LA 4DN4M 1EIGA 5CORA 3BDLA 5IGFA 2IX3A 1JWUD 5A35A 2B2UA 4FF1A 2NUCA 2K01A 3RZOB 4IURA 2QF7A 3JAME 3GTLB 1O7YA 1SYBA 3K5MA 3J80L 4K2KA 3R3OA 1TIID 4G57A 4ZKBB 4I7ZC 3SVMA 1Q1BA 1GUNA 2AWNA 3H09A 1QOHA 3R8BA 1CM9A 2CVRA 4HCSA 3HEJA 1SJED 1TWFB 4BBSB 2FINB 3QB3A 2A5HA 2EOTA 2XRSD 2ZYZA 1HUMA 1AN8A 4NW2A 2F0HA 1LABA 3WDNA 1GEFA 4ZKCB 5NUCA 2MUYA 1B4OA 1I4GA 5IT9E 5EJWA 3R93A 2EZVA 3IEYB 5T1GA 4C3JB 3I73A 3GV6A 1BCPD 5CR3A 1NR4A 2A6HC 2MP1A 2E2HB 3NQTA 2JP1A 2ZT9C 1BCPF 1MGSA 3TZDA 1TU2B 2RSOA 3SK5A 1BO0A 2F0UA 1WD0A 3H6MA 3T56B 5TSSA 1U4MA 3C1FA 4EVOA 1JOOA 1TWAB 1YNJD 3A8JE 5JPNC 2WAQB 3HOXB 1CT1D 3NSWA 4C1NK 1EYAA 5CV9A 4IN3A 1HHVA 5IGCA 2NB0A 3PIO3 5EPKA 2NN6I 4X3TA 2FCOA 1V8QA 1HA5A 2L12A 2QILA 1EY8A 4C3HB 3DWAA 1ILPA 3BT7A 5F2DA 1D6EC 4HMIA 1LT5D 4HAEA 3I3CA 3IL8A 1CTMA 2HUGA 3OMGA 1ZXTA 1HRJA 2F0QA 3R2TA 2B2TA 4GZYC 4KJNA 1S5ED 3R2IA 1M4VA 4IFDG 1Z47A 2K6AA 1S4ZA 3GTQB 2XNAC 3T53B 1B3AA 1I3QB 2OKFA 3I90A 3UI2A 5E1FA 5I9OA 1RCVD 5LHY1 2EYPA 1IKLA 5CV8A 2RVLA 4TSSA 1DONA 3CRLC 4BY7B 1O7LA 4DF7A 3CQZB 1SE2A 5I2YA 2E2JB 4V0BA 2QEJC 3OSOA 1IYVA 3KLSA 2DNEA 3P7JA 2AWOA 4HTHA 1VMCA 5KGUA 1PZKD 3HOYB 5CV7A 3MXNA 1OXSC 2IW3A 5K36G 1I6VC 3MWYW 2JA7B 4RAUC 1RODA 4IUQA 1MSHA 5KNDA 1GHJA 3SHLA 3G6JB 1PRTB 2B2WC 5C4ZA 4LQEA 3NBIA 2DY8A 2X6GA 1LT4D 1W6KA 1EEID 4ZUIA 5C5MA 1B44D 1BXTA 1F77A 1J8IA 2F1MA 4L6TB 2FL3A 4B9WA 1F9RA 5DAUA 4B9XA 4ZQUA 4PV1C 2CV8A 2WIWA 4F88A 2AUKA 1LACA 4O42A 2SDFA 2EYFA 1NR2A 2BE5C 3DHQA 3J80E 1HQRD 1T5XD 4M8AA 4IZ8A 2F0EA 3FMCA 5IGDA 1JCKB 5M3MB 2KOLA 5E4XA 3I4NB 1IKMA 1SYEA 3SR1A 3Q23A 2R92B 2RDHA 1ESRA 1FR3A 4AYBB 4G7HC 3V96A 1PTOD 2GJWA 3FDTA 2XN9C 2XRQD 2D5DA 2F0MA 2A74C 3S1MB 3GV3A 1CQVA 2BDOA 1RLVA 1PTOF 1RJTA 2AQ1B 1XYIA 1QWYA 1TWCB 2AQ2B 5JOBA 2B2WA 2WKCA 1NSNS 3KF8A 1Q3LA 2PYKA 1SYFA 5ELFA 1WCMB 4QF4A 2WB1B 2PQEA 1K83B 5EBDA 3H0GB 2BOSA 2K7VA 4FNFA 1TKWB 3SDZA 3D6WA 4IUPA 1H9KA 4KTAA 1RZNA 1EIHA 4OIKA 4PMBA 2RBMA 3C46A 1U4RA 5JAVA 2I07B 1D2BA 3VYUA 1PFMA 2K03A 4RGNA 3VA5A 1ZKOA 4F7XA 2EYHA 1B9NA 3HG9A 5HURA 3RMHA 4Q5VA 5C4HA 4HSVA 1XMXA 1D1KA 4ZRZA 1HA6A 3GD7A 3C3LA 4ZUJA 3V05A 3LNNA 4XT1B 3WOEA 1IL8A 2EE1A 3D6CA 4V190 1SNPA 1B50A 3BDOA 1K8OA 2EJFC 2O5IC 1Z6HA 2C9OA 4ABNA 2PNRC 2FKHB 1II3A 1JE4A 1OXVA 3KUPA 1W6JA 3NP8A 5I6YA 3GTJB 5FDKA 3PV0A 1DOMA 5DNFA 1EU4A 1NUCA 5CYUA 4OHJA 5CMDA 1Z7TA 3D3RA 1FNWA 3PUVA 1Q1EA 5DM73 4TKDA 2OF1A 3OPOA 3W3AA 5FO7B 3H3VC 2DBSA 4EV1A 3PUXA 4FXGC 2H4OA 1SXTA 2OEOA 3FVQA 3BG3A 1Y8NB 1O78A 4H44C 2DN8A 4DXGA 2B2VC 1WTOA 1SYDA 4E6IA 3SXHA 5M5XB 2B39A 2B2YA 4K6DA 5D3DA 5E3FA 2WKDA 1LTAD 3P20A 3AB9A 4DU9A 2A6HD 5EKIA 3PO3B 1STHA 1DYQA 3MHBA 4QUCA 3E5SA 1QILA 3BZDB 4JBWA 4RHSA 3MZ5A 1BCPB 2RDGA 1LLRD 1R4QB 2D62A 4DNRB 1BDOA 3OOCA 5JEAG 3I91A 3J7AF 4FXKC 1GUTA 4A3JB 4RFBA 5KNCA 3PIP3 3PUYA 1A3UA 4DAPA 3C1EA 1SNDA 1TT2A 4KY5A 5I2XA 1HCZA 1Y69U 1TR5A 1A3TA 4ULLA 5EPJA 5A2QL 1MBYA 2KUMA 4C3JG 1GUWA 2BA0A 3IKJA 2K5QA 4CGYB 4CBVA 3K57A 1SBBB 5K5PA 3C2PA 1ZYRC 4NP5A 5IGBA 1PYWD 3BS1A 2CZRA 2F0GA 2YU9B 1OXTA 1YNNC 4BA1I 4WRDA 2WIZA 4XQJA 2B8GA 2KECA 5M5YB 1TS3A 2EO0A 1OB8A 5IGGA 4ILWA 1PZJD 3RUZA 4XTCS 2A6EC 4G6UA 3S1NB 4C1NI 3DNXA 1E2VA 3RLFA 4KKTA 2PO4A 2NN6G 5DM63 5EGTA 4C3HG 1AZPA 1GXDC 4J1MA 1PRTC 4DNTB 4K8JA 4P2CB 3O13A 2F4IA 3TZUA 3A56A 4RCNA 3MAQA 1O80A 3HOWB 2WINB 4OIJA 3CRKC 1CZWA 5C6AA 5ELEA 4QB4A 4RGTA 1VCIA 3A7AB 1ENCA 4N9PA 3T4AC 1EOTA 1EWHA 5C4JB 4G7ZC 3HRZC 2O2LD 5JVG3 2SEBD 1F9PA 4E6ZA 2E2DC 2K32A 3MFYA 2XIWA 5JVH3 1LTGD 2SNSA 3OWFA 4KKSA 4IFDJ 1ESFA 5EBCA 2MPMA 3NK9A 1PFNA 2EYMA 2KA7A 4PMWA 2K04A 3I8ZA 1UAPA 1A2UA 1PZID 1JC7A 3AU7A 3K7AB 1T5EA 3A55A 1STNA 1G2SA 4K14A 1S5CD 3P1YA 3V2TA 3GTKB 2RA4A 3VYTA 4DAVA 3RZDB 2AQ3B 2L1BA 4FF2A 4K5VA 4F8MA 4KI0A 4IQZA 3GO5A 4IUNA 1JB3A 1HXYD 1OXXK 3EROA 2BE5D 4CJ2C 4NDXA 1C48A 2JA5B 4BWGB 4RA8A 1UUPA 4TQUS 1HQMC 1CZGA 4A3EB 2LY7A 1BBXC 3QO2A 1EY4A 4OO1G 3OMCA 2EY2A 3H91A 3LWEA 3D4DA 4XYQA 3M4YA 2GW6A 3N52A 2V4DA 3EJIA 1JICA 4B08A 2R61A 4PMCA 2KCNA 5ISRA 3OIQA 1KDCA 2KVMA 3I70A 1CA6A 4QCLA 2PZUA 2F3WA 1LTSD 3WOFA 2IPKD 1PTOB 3H94A 4R9WA 2BCOA 1G291 1G2TA 4C2MB 1JR0D 5G3LD 2HCIA 1ENFA 1JQYD 4KY7A 1SAPA 4KD3A 5LL6S 2ZYZB 4DXFA 3CHBD 2F0IA 3GTOB 1Y8PB 1TS5A 1FNUA 3A8IE 1K8MA 3KLSX 3OHXC 2L11A 2WP8J 4XXEA 1I4HA 1R0VA 4LK1C 3SEBA 1E2ZA 2D2CC 3URYA 1H9RA 4A3GB 2NYZD 4XYOA 1MD2D 5IGEA 3K0YA 3PUZA 5C0XI 1STYA 2L0CA 1A15A 5JEAH 3HOUB 1QB5D 4A93B 5A2QE 1EFID 3K59A 3G7LA 3MVVA 2X6LA 4FYDA 4A3MB 2JA6B 3BVZA 4RHRA 2JE6I 5I6WA 2VS1A 1L0YB 3FOVA 5FO8B 3ND8A 3X3MA 1SNOA 4OO1I 2JA8B 1EQTA 3PO2B 4G4KA 3NQIA 2EJGC 3RD4A 3E0JA 1EY0A 5KIXA 3OWEB 1BUVT 2K33A 1SSOA 1EYCA 1RKNA 1ET6A 1STAA 4OL7A 2A73B 3KK7A 2L5TA 1JWMD 1WTRA 3GQBA 1TWGB 2F0LA 3NBHA 4RWSC 1H9MA 2Y0SB 2ZXRA 3HOVB 1STEA 3TN2A 4KJOA 4O1NA 1WTPA 1J9OA 4BA2I 2KJXA 3D4RA 2F0KA 4N9TA 2IL8A 5FKAC 4X3KA 3BDCA 2F3VA 4UAIA 1VDZA 1HFNA 5I4DA 1GJXA 1DM0B 4QIWB 3FEWX 5DEHA 1MI2A 1QJOA 2NBFA 1CQFA 1RTOA 3L7ZC 1EY6A 2SOBA 2VB3X 2K1BA 1KTKA 1PTOH 2JYOA 3QOLA 3TBIB 3M7GA 2VXWA 2Z4IA 1GUSA 2J7ZA 5CBEE 2OSTA 2EY1A 1BQQT 3Q24A 1B2TA 1X32A 2TMPA 5COYA 1A79A 2F0TA 2IXSA 1QG7A 5KNBA 1SDFA 5IOCA 4NMZA 1Q8IA 3PUWA 1UEAB 2EY6A 2J0TD 3VR3A 2Q8IB 4PQXA 1WVLA 2E74C 1Q12A 4YIJA 3TP5A 3VYRA 2JJQA 1ILQA 2ICIA 1NCVA 1G91A 3U9OA 5ELDA 3VR2A 3AJVA 4QBNA 4TRDA 4DA2A 1ZYRD 3IFDA 3D31A 4L63B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DA2 A;  4DAP A;  4DAV A; 
#chains in the Genus database with same CATH topology
 2A69 D;  1HNX L;  3NWS A;  5FLM G;  2CHB D;  2Q2H A;  2F0S A;  1KAW A;  1YNN D;  4LUO A;  4UP8 A;  5C3W A;  4A3M H;  1N34 L;  1WTW A;  4K5X A;  4DR1 L;  1UE6 A;  2G9D A;  1EWI A;  3J80 c;  2LS0 1;  4Y7N H;  2K14 A;  3ULL A;  1ENA A;  2VQF L;  2P5Z X;  5JEA J;  3IFT A;  4A3D H;  3PO2 H;  3EBE A;  2CW0 C;  3ND9 A;  2FLC A;  2A6E D;  2ASB A;  5CV6 A;  3TME A;  1Y1O A;  4ODG A;  2TSS A;  1CHQ D;  4CKE A;  4FF3 A;  3RLN A;  2IT1 A;  3S1Q H;  1JMC A;  3S1R H;  5EPL A;  1VQM A;  3TDQ A;  3SE0 A;  2Z1C A;  1LTL A;  1C7Y A;  3Q22 A;  1FYC A;  1N36 L;  1PRT D;  3MTS A;  3ERQ A;  3S15 H;  1TS4 A;  1Y14 B;  2N3S A;  1QZH A;  1HNW Q;  2NVX B;  1PRT F;  3CCL A;  4GKJ L;  1HR0 W;  4CKB A;  3GTP B;  1UE5 A;  1WFQ A;  3Q0A A;  1CA5 A;  5KRU A;  2FMM A;  3NTH A;  4BY1 G;  4KKU A;  2GVA A;  4TKO B;  4HJA A;  1B3Q A;  3KBG A;  3D4W A;  5IWA Q;  2GA4 B;  4XDX A;  3NEL A;  4MTK A;  4NPS A;  4GNX B;  4LAA A;  2GN5 A;  3CKI B;  1I4R A;  1TS2 A;  3ITP A;  4C3I G;  4IFD H;  4TKK A;  5BN4 A;  1XNQ L;  4J8Q A;  3BVG A;  4R4O A;  3SK6 A;  1KNE A;  3OIP A;  4DUZ Q;  4FP5 D;  1X3Q A;  4K8I A;  1HPC A;  3U58 A;  1PXU A;  1PVO A;  2Q8R E;  3W5O A;  2PPB C;  4OXP A;  3TP7 A;  2C5C A;  2I5H A;  1EY9 A;  3HFZ B;  3A5Z B;  4NKL A;  3F2C A;  4YCU A;  1PH8 A;  1PDQ A;  1CI3 M;  2FFK B;  3J7A V;  1CKN A;  4CJ1 B;  1Y1V B;  2VB2 X;  1E0B A;  1UEB A;  1X9N A;  2K5H A;  1A3V A;  1F2Y A;  2KBN A;  4RH6 A;  5GAH C;  1VF7 A;  2EPB A;  4DR6 L;  1XPU A;  3P1H A;  1PFS A;  4EQN A;  1BNZ A;  2FJ2 A;  3AJV B;  1U4L A;  3MA2 B;  4LF7 Q;  1LTR D;  2VW9 A;  4QY7 A;  2LFN A;  1BOS A;  4JI2 L;  2KQ3 A;  3NTK A;  5IP9 H;  2IX0 A;  2NVQ B;  1TY0 A;  3AMU A;  2VUM H;  2K05 A;  2L55 A;  4GOP B;  2Z0R A;  4X64 L;  5E7N A;  2QDB A;  5K36 H;  1PYS B;  2UUA L;  4A3I B;  3IAY A;  1E24 A;  4DK1 A;  4GS3 A;  4B3M Q;  1Y8O B;  4QQB X;  1LTT D;  1LTB D;  4G6V A;  1SEB D;  1V1P A;  1I6H H;  1DCZ A;  3E3X A;  1QZG A;  1G8Z D;  1D5M C;  3IEY A;  1RTN A;  1SN8 A;  1CK1 A;  3GTM H;  2F4V L;  4YCV A;  3CCE A;  3K5L A;  2MFI A;  2WII B;  5D3I B;  3QJY A;  1NE3 A;  3KBX A;  5FJ8 H;  2OTL A;  2ICE C;  2K5N A;  1EYD A;  2NTT A;  1HUN A;  1BVS A;  3A5U A;  3HGB A;  1I4X A;  1X56 A;  4KHV A;  4WOR A;  2A69 C;  3EQL C;  3TRZ A;  2F0F A;  4HJ5 A;  2F0J A;  1C8C A;  2WV6 D;  3NWT A;  1CKM A;  2B2V A;  3Q8D A;  5FLX E;  1QNU A;  3F2B A;  2YTY A;  2HT1 A;  3BZC A;  3HOX G;  1X3F A;  2QDL A;  3E6Z X;  4L8J A;  1FGB D;  1SYG A;  1CHP D;  1UWV A;  3BYY B;  1DXM A;  4DFA A;  2FMC A;  2A68 C;  3VR5 A;  3MXP A;  2PZT A;  3ULJ A;  2NVY H;  2E75 C;  3K8A A;  3TSS A;  4S3S A;  2NVX H;  3LX0 A;  4QL5 A;  3OW7 A;  1IBL Q;  2WCW A;  2IJ0 A;  2EYO A;  2WJ0 A;  1H9J A;  1ASY A;  2F03 A;  3M3Y H;  2R6G A;  2UUC Q;  2PI2 E;  4ME3 A;  4DAY A;  4MN3 A;  4I65 A;  1AEX A;  3K5O A;  1RHP A;  1TWH B;  4MTN A;  2R7D A;  2E2I H;  4C56 C;  5FOB B;  1HNW L;  1I50 B;  3BZK A;  2N88 A;  1XTD A;  4HJ7 A;  5LMU Q;  1QE6 A;  2UXC Q;  2RQX A;  2HQE A;  1SNM A;  1GHK A;  2FHT A;  5C44 B;  3NUC A;  3VDY A;  4PG3 A;  2ZXO A;  4HED A;  1PH4 A;  3QOJ A;  1BF4 A;  4K5W A;  4HJ9 A;  5IWA L;  5M3F B;  2VY3 A;  4BBR B;  2XWB B;  1JJG A;  3F1Z A;  3MFG A;  1VQ7 A;  5BR8 Q;  3ZJY C;  2M9V A;  1PMR A;  5LMN W;  2F0O A;  4DUZ L;  3J80 i;  2Y0S E;  1S5D D;  3E9I A;  3CXC A;  1SFO H;  2B2T C;  5BN5 A;  1D1I A;  1PH2 A;  1EU3 A;  3QIA A;  5JJL A;  4BY7 G;  4XQN A;  1VQ9 A;  3OTO Q;  4KHZ A;  1EEF D;  5C3E B;  4GN4 B;  2NZ1 D;  2PMZ B;  2CH4 W;  4LFC Q;  3J81 L;  1VQP A;  1R4P B;  1V1P B;  2NTS A;  2OTJ A;  2YYZ A;  1D5X C;  1XWE A;  2CQO A;  4ZAI A;  5C4X B;  1SE3 A;  1L0X B;  2NVQ H;  3F2U A;  4ZK9 B;  1R9T H;  2R93 B;  5C0X G;  4JV5 Q;  1XXG A;  4IPC A;  3RLO A;  4J15 A;  1CSQ A;  4A3F B;  4JI0 Q;  1QVC A;  4QIW E;  3HOY G;  1HR0 Q;  3HOU G;  4LF7 L;  3T13 A;  3S2D H;  3FP9 A;  1JJC B;  2IX1 A;  1VQI A;  1M8A A;  3WWV A;  5M5W B;  1EL0 A;  2JA7 G;  4A3B B;  5LL6 X;  4OON A;  2E76 C;  1WTX A;  2R7Z H;  3K80 C;  2K5W A;  5J22 A;  1B53 A;  2ZXP A;  3CU7 A;  3GTG H;  5ELC A;  1WTH A;  4RKB A;  1XPR A;  1T9H A;  5FK9 C;  4ZYS A;  4B3M L;  1P8L A;  3I4L A;  3PGZ A;  3IF0 X;  1ZP7 A;  2F0P A;  3LGJ A;  2PCF B;  4JPB W;  4LJZ C;  4APV A;  4RKL A;  2JA8 G;  4ZCK A;  4EX5 A;  1ICW A;  1S72 A;  3STB C;  4M1U B;  1ML0 D;  1C9O A;  4EQP A;  1EY5 A;  1F2M A;  2PQA A;  1U4P A;  3UE0 A;  1A6X A;  1Y1W B;  3HOZ B;  3NEN A;  2O4X A;  3I4M B;  3FKI H;  1B1Z A;  3J7Y W;  4A3K B;  1SMY C;  3NE5 B;  1K8G A;  4X62 Q;  1DJR D;  1K3R A;  2EQS A;  4OWW B;  5EQ0 A;  4LUZ A;  3TRE A;  2UU9 Q;  4ZQ3 A;  1FNV A;  2XVS A;  4BY1 H;  1A2T A;  1BBU A;  2VL6 A;  3PCO B;  3PIP A;  1OB9 A;  1C0A A;  4YCW A;  4CKC A;  4G7O C;  2QA4 A;  3K7U C;  3TEH B;  2KCC A;  2B63 B;  4C3I H;  1E1O A;  2NVT B;  3HOV G;  3I72 A;  2ZJR A;  1IW7 C;  1SNC A;  5GRO A;  3ZYY X;  4OGQ C;  5EKL A;  1J6Q A;  3HZX A;  5C5L A;  1Y88 A;  2PZW A;  1I4P A;  2EXZ A;  2M00 A;  3MXG A;  5G3L F;  4KV6 A;  3L2P A;  1TWH H;  3I56 A;  1CFM A;  3MC0 B;  1VQF A;  2F0D A;  1O7Z A;  1IBL L;  5ELO A;  3DUZ A;  1RD9 D;  2UUC L;  4Q0F A;  3RZO H;  5IIF A;  4EGV A;  3GTL H;  2D0O A;  5C3X A;  4DV0 Q;  3I4N G;  4JK1 C;  5E4W C;  3HKZ B;  1SE4 A;  1KHI A;  2YV5 A;  3RR5 A;  1HZ9 A;  4CDC C;  5LMU L;  1VQB A;  2UXC L;  4RCO A;  2EXD A;  4AYB G;  2LKV A;  1RF2 D;  1LT6 D;  4Z9C B;  3S16 B;  3S17 B;  2H1E A;  2MGS A;  4FO2 A;  1KAB A;  1DOK A;  2R3Z A;  2F3I A;  2INB A;  1TWF H;  4BBS H;  4L5S A;  1R11 A;  5BR8 L;  2CW0 D;  1GOZ A;  2LXK A;  5C3E H;  4QMG A;  4GNX C;  2G9H D;  4R8I A;  1EQQ A;  4OEL B;  3DEO A;  4Y7N B;  4DK6 C;  4GN3 B;  1IPI A;  3VYS A;  4A3D B;  2L4N A;  4RGO S;  4XQQ A;  3CPF A;  2UXB Q;  1EZ8 A;  3DWQ A;  3HP3 A;  1UNS A;  4YHH Q;  3H15 A;  4QBO A;  2N8N A;  3TP6 A;  1P16 A;  5AFW A;  1SJH D;  3OTO L;  2MJ8 A;  5ELN A;  4C3J H;  3S1Q B;  1IBM Q;  3S1R B;  3P1Z A;  2ENB A;  4LFC L;  4KMU C;  5T1I A;  2AUJ D;  3EA6 A;  4K2L A;  2LMC B;  4UDU C;  3UDX A;  4HJ8 A;  1KL9 A;  1I4Q A;  3U9S A;  2E2H H;  5I9P A;  4A3C G;  5J39 A;  1TQO A;  3CCM A;  3S15 B;  1FD7 D;  1FVI A;  4JV5 L;  2PQA B;  2CH4 A;  1RDP D;  1BCP C;  4JI0 L;  2UXD Q;  2MHV A;  4MHE A;  1HR0 L;  4H0L C;  1F9Q A;  2K5D A;  2Z8L A;  1WTQ A;  4IAL A;  4K6L A;  3BVM A;  5M9O A;  4X66 Q;  1TWA H;  3SK4 A;  1G51 A;  1SNQ A;  2L15 A;  1LTI D;  1X65 A;  3TS0 A;  1H9S A;  5KEE A;  4IFD I;  5FLX L;  1LV9 A;  2HIV A;  3AFP A;  3HS0 C;  1XX8 A;  1NBW A;  1IHZ A;  1YNJ C;  5LMN Q;  2RDF A;  3CW2 C;  3W2D A;  2J4X A;  2KEE A;  3A54 A;  1GKH A;  3ER0 A;  1MKH A;  2RSN A;  1D7Q A;  2JEB I;  5HGT A;  1DD2 A;  2NN6 H;  4C3H H;  5JJZ A;  2FKC A;  1Z9F A;  2JSO A;  1QCB D;  1V43 A;  1HTP A;  2OT2 A;  4X62 L;  1JWS D;  4TVA B;  5KYL A;  3CC7 A;  2O5J C;  2RKS A;  1F9S A;  1HTL D;  4WFN 3;  3N6R A;  2UU9 L;  4JI3 Q;  1AW7 A;  1CKO A;  4H7B A;  4FDB A;  4AIM A;  4JI1 Q;  2BDN A;  2KED A;  4WJW A;  5CV4 A;  1E22 A;  3L3O C;  1VF5 C;  2VLD A;  1WI5 A;  3GTQ H;  3FPU B;  3JAM L;  1BR9 A;  2F0N A;  1I3Q H;  4KN7 C;  1XTC D;  3J81 E;  3ONA B;  1M1K C;  1SE8 A;  1STG A;  2VUM B;  2Q8T A;  3CCV A;  4DK0 A;  2IHF A;  3D0F A;  3PQI A;  3DMU A;  2Z4H A;  2CQA A;  1C4Q A;  3DM1 A;  1TXY A;  1JOK A;  3PO3 G;  1I6H B;  4BY7 H;  1Y1V G;  1YNM A;  1D5Z C;  1F2L A;  2E2J H;  4DV0 L;  3GTM B;  1YJW A;  3SK8 A;  1HH1 A;  2KHJ A;  1T0F A;  4DUY Q;  1YJ9 A;  5CC4 A;  1BBW A;  2QKI C;  2SNM A;  3RN2 A;  3A0J A;  3NHH A;  2HDM A;  1K9M C;  2B2Y C;  1QUQ B;  5L37 A;  4BS9 A;  1JT8 A;  3GDE A;  2ID0 A;  2JEA I;  1KAA A;  4KK7 A;  1S5F D;  3P1Z B;  5C0X H;  4A3J G;  3A7L A;  4I7A A;  5IT9 L;  3HOY H;  5EKK A;  1I5F A;  1CSP A;  1NAP A;  1QNK A;  3T51 B;  3K58 A;  1V1Q A;  1WTV A;  2D9U A;  5CBA E;  4KY6 A;  1JJ2 A;  1ET9 A;  4A3I G;  4LMQ D;  2QCP X;  2BA1 A;  2A68 D;  4NXM Q;  1GUO A;  3NBH B;  2WAC A;  4HN7 A;  1NTG A;  5GAG C;  4U67 3;  4PZ7 A;  1L1O C;  4KHP Q;  3K5N A;  1JOQ A;  2EY5 A;  1EZ6 A;  2UXB L;  2EVB A;  4YHH L;  5H1S E;  1K0R A;  2L9H A;  4OO1 H;  1WYD A;  5IE8 A;  3M85 A;  2JN4 A;  4J6H A;  1JOR A;  4RGM A;  1H9S B;  1B9M A;  2PW5 A;  2NVY B;  3P75 A;  4DR5 Q;  1IBM L;  1MJE A;  4F87 A;  3EFX D;  1Q90 A;  3T16 A;  1TVX A;  5D14 A;  2F52 A;  1TY2 A;  2F0V A;  1VQ4 A;  3M3Y B;  1U5K A;  4U68 A;  1VQE A;  2F0W A;  2X69 A;  2PMZ E;  4ZLT F;  4HR7 B;  3VR6 A;  3NTI A;  2OXP A;  5JPM C;  2E2I B;  3TP8 A;  2OQK A;  1KDB A;  2K28 A;  3VR4 A;  3GP7 A;  3FPP A;  3MXU A;  1G6Z A;  2UXD L;  1OO9 B;  1KNA A;  1PLF A;  1U9R A;  1EWC A;  4XIG S;  5BN3 A;  3CCU A;  1VQ5 A;  1MSG A;  1KLU D;  5ELB A;  4ID6 A;  1V1O A;  4XT3 B;  3RN5 A;  4H13 C;  4X66 L;  1K73 C;  5J1Z A;  3J7Z C;  1F2Z A;  4EQO A;  2PW7 A;  1DZ1 A;  2NZO A;  5CGK A;  3AQQ A;  1GUG A;  2EYL A;  3QWN A;  4OX9 Q;  5LMN L;  2HDL A;  1FJG Q;  4FF4 A;  4IUU A;  1ZEQ X;  2FXQ A;  2H5X A;  3S14 B;  3FRP B;  2W8M A;  1UE1 A;  3S9W A;  2JXM B;  3VA7 A;  1MJC A;  1EQV A;  2BH2 A;  2EJM A;  4IUV A;  4DAM A;  1SFO B;  2B8F A;  4ME5 A;  5AJ3 Q;  1AFP A;  5M3M H;  3HOW G;  3S2H B;  1HFG A;  4UP9 A;  4CHT B;  3I4N H;  2CKZ B;  5C44 G;  1E2W A;  4IPG A;  3DXJ C;  1WD1 A;  1KQS A;  4K0K Q;  2B2U C;  1SYC A;  2I46 A;  3W1B A;  2N55 A;  1KLG D;  4X3S A;  4CJ0 B;  2R92 H;  5M3F G;  4OWX B;  4HMJ A;  3K6O A;  2XSC A;  2EDG A;  3A8K E;  3L9A X;  4JI3 L;  4BBR G;  1R9T B;  3S1M H;  5J3B A;  3M4O B;  2B29 A;  1LT3 D;  4FVM A;  1GO3 E;  2DNC A;  3NPP A;  4JI1 L;  2EYJ A;  4KN4 C;  5D65 A;  1X3P A;  2DJF C;  3U4V A;  4MNO A;  4O2D A;  3G48 A;  1OXU A;  1L1O A;  3PMF A;  1TWC H;  2ZJP A;  3S2D B;  2IWH A;  1PTO C;  1STB A;  2NWG A;  4FXD A;  2WCZ A;  1K3B C;  1Q7Y C;  2GVB A;  1O7I A;  2R7Z B;  4NXN Q;  4R4T A;  1DOL A;  4JYA Q;  1WCM H;  4KD4 A;  3STB D;  4QUF A;  4P73 A;  4HCE A;  3GTG B;  2KHS A;  1W3S A;  3BYT B;  3H0G H;  2DY7 A;  4DGZ A;  5KYI A;  3JC6 6;  2IY5 B;  5FO9 B;  1YNX A;  4R8N A;  1SMY D;  4X3U A;  3D8G A;  1PFB A;  4Y52 H;  1VMP A;  4PNY A;  3M7N A;  4DUY L;  1LO5 D;  1N9W A;  4A3F G;  4MIU A;  1AP0 A;  3FKI B;  3DWP A;  2XWJ B;  3NXW A;  1IZ6 A;  1F1Z A;  3DEP A;  1K0S A;  3HKZ E;  3MEH A;  1ONL A;  3LWU A;  3Q6S A;  1JB7 A;  3S24 A;  3EVQ A;  2MNA A;  2JQO A;  4HSP A;  2Z6K C;  5C0X J;  3CME A;  4BY1 B;  2HCC A;  1IW7 D;  4QBL A;  5CV5 A;  2JA5 G;  2VNU D;  1S5B D;  5GQO A;  3NEM A;  2UUB Q;  1AZQ A;  3QG1 A;  3KLR A;  4NXM L;  4IUT A;  1KDA A;  2ATW A;  1IYU A;  1EY7 A;  3X3N A;  4C3I B;  4A3E G;  4KHP L;  2M2L A;  4DN4 M;  1EIG A;  1VQL A;  1VQ6 A;  5DLQ E;  5COR A;  1EUJ A;  3BDL A;  5IGF A;  2MO0 A;  1MIU A;  1Y1W G;  5IY0 A;  1A0I A;  2IX3 A;  3GTJ H;  1JWU D;  3I4M G;  4LW1 A;  2K5V A;  1S3O A;  4DR5 L;  5A35 A;  2B2U A;  4FF1 A;  2NUC A;  1E1T A;  2K01 A;  3RZO B;  4IUR A;  4DV4 Q;  2QF7 A;  1CKN B;  3JAM E;  3F8T A;  3GTL B;  1O7Y A;  3DLL A;  1SYB A;  3K5M A;  1SMX A;  2KEN A;  4OWT B;  3J80 L;  4K2K A;  4L5T A;  3R3O A;  1TII D;  4G57 A;  4ZKB B;  4CDD C;  4I7Z C;  4A76 A;  3SVM A;  1Q1B A;  1MHW C;  1GUN A;  2VZA A;  2AWN A;  5IP7 H;  2ZTC A;  3KDF A;  4NB3 A;  1RL2 A;  3H09 A;  1QOH A;  3S14 H;  3R8B A;  1CM9 A;  2CVR A;  2NZH A;  3HEJ A;  4HCS A;  4R4C A;  2QEX A;  1SJE D;  1TWF B;  4P75 A;  4BBS B;  2DUD A;  2FIN B;  3QB3 A;  5M5X H;  2A5H A;  4A3L H;  2EOT A;  2XRS D;  3S2H H;  2ZYZ A;  1HUM A;  4OX9 L;  1AN8 A;  1FJG L;  4NW2 A;  2HD3 A;  2F0H A;  1LAB A;  3WDN A;  4GLX A;  1GEF A;  5EAY A;  4ZKC B;  4IPD A;  5NUC A;  2MUY A;  1B4O A;  1I4G A;  1X3G A;  1H95 A;  3PO3 H;  4A3G G;  5AJ3 L;  5IT9 E;  5EJW A;  3R93 A;  3TQY A;  2EZV A;  4GKK Q;  4DR4 Q;  3IEY B;  5GAE C;  5T1G A;  4C3J B;  3M4O H;  3I73 A;  3GV6 A;  5IYD H;  2I0Q A;  1BCP D;  5CR3 A;  5FLM H;  4AQY Q;  4POF A;  2Z6K A;  3I4O A;  1NR4 A;  4K0K L;  2A6H C;  2MP1 A;  2E2H B;  4A93 G;  3NQT A;  3H3V I;  2JP1 A;  5JJK A;  2ZT9 C;  1BCP F;  1EFW A;  1MGS A;  3TZD A;  4DPG A;  4A3M G;  4P74 A;  1PH1 A;  1TU2 B;  2RSO A;  4DV6 Q;  2JA6 G;  3SK5 A;  1BO0 A;  3KJP A;  4QGU A;  3CC4 A;  2F0U A;  1WD0 A;  3J81 i;  3H6M A;  3T56 B;  5TSS A;  1U4M A;  3C1F A;  4EVO A;  1JOO A;  1TWA B;  1YNJ D;  3A8J E;  5JPN C;  1PA6 A;  2WAQ B;  2CWP A;  4A3D G;  1AH9 A;  1FL0 A;  3PO2 G;  4NXN L;  4JYA L;  3HOX B;  4DR3 Q;  1CT1 D;  3NSW A;  4C1N K;  1E7Z A;  1EYA A;  5CV9 A;  4IN3 A;  1HHV A;  5IGC A;  2NB0 A;  3PIO 3;  5EPK A;  2LSS A;  2NN6 I;  4X3T A;  4IOA A;  2FCO A;  1V8Q A;  1HA5 A;  2L12 A;  2QIL A;  1EY8 A;  4C3H B;  3DWA A;  4DAY B;  1ILP A;  3BT7 A;  5F2D A;  1D6E C;  4HMI A;  3KLW A;  2YU9 H;  5HY6 A;  1LT5 D;  4HAE A;  3I3C A;  3IL8 A;  1CTM A;  2HUG A;  1X6O A;  2Y0S G;  3OMG A;  3CCS A;  4AH6 A;  1ZXT A;  1HRJ A;  1LYL A;  2F0Q A;  5M5Y H;  3R2T A;  1B7Y B;  2B2T A;  4GZY C;  1PH9 A;  3BU2 A;  4KJN A;  1S5E D;  3R2I A;  2ZTD A;  1M4V A;  4IFD G;  3W1G A;  2UUB L;  1Z47 A;  2K6A A;  1YZ6 A;  1S4Z A;  3G71 A;  1Q86 C;  3GTQ B;  3S1N H;  2XNA C;  3T53 B;  4GLA C;  4EQ5 A;  1B3A A;  1I3Q B;  2OKF A;  3I90 A;  3KDF B;  3UI2 A;  3HKS A;  5E1F A;  5I9O A;  1D8L A;  2RHS B;  1RCV D;  5LHY 1;  2EYP A;  4P72 A;  1IKL A;  5CV8 A;  4LF9 Q;  2RVL A;  4TSS A;  1DON A;  2RCF A;  3HOW H;  3CRL C;  4BY7 B;  1O7L A;  4DF7 A;  3CQZ B;  1NMF A;  1SE2 A;  4DV4 L;  4ALP A;  5I2Y A;  2C35 B;  2E2J B;  3SGI A;  4V0B A;  2QEJ C;  3OSO A;  3CF5 A;  5C4J H;  2VQE Q;  1IYV A;  3KLS A;  2DNE A;  3P7J A;  2AWO A;  4HTH A;  1VMC A;  1YHA A;  5KGU A;  1PZK D;  3M9B A;  2CFM A;  3HOY B;  5CV7 A;  5IP9 G;  3MXN A;  4JOI C;  1OXS C;  2IW3 A;  3T1H Q;  5K36 G;  3J81 j;  1I6V C;  3MWY W;  3A74 A;  2JA7 B;  3K0X A;  4JBM A;  4RAU C;  1ROD A;  4IUQ A;  1MSH A;  5KND A;  4DV2 Q;  3CCR A;  1GHJ A;  3SHL A;  3G6J B;  1VQG A;  3K7A H;  4HIM A;  1YJN A;  1XNR Q;  3KF6 A;  1PRT B;  2B2W C;  5HGQ A;  5C4Z A;  4LQE A;  4UPA A;  1NMG A;  2D0P A;  4GKK L;  4DR4 L;  3NBI A;  2DY8 A;  3GTK H;  2X6G A;  4LFB Q;  2XTI A;  4BXX G;  3RZD H;  1LT4 D;  4AQY L;  4KLK A;  1W6K A;  1EEI D;  1YI2 A;  2N49 A;  4ZUI A;  1L2F A;  3OW2 A;  5C5M A;  1B44 D;  1BXT A;  1F77 A;  1J8I A;  2F1M A;  4L6T B;  2FL3 A;  4B9W A;  3OYY A;  1F9R A;  4B3S Q;  3HOX H;  4DV6 L;  5DAU A;  4B9X A;  4GOP C;  2JA5 H;  4ZQU A;  4PV1 C;  2CV8 A;  2WIW A;  4F88 A;  4N8F A;  2AUK A;  1LAC A;  4O42 A;  2SDF A;  2EYF A;  3AFQ A;  1YIT A;  1NR2 A;  3CMA A;  4DR3 L;  2BE5 C;  3DHQ A;  3J80 E;  1HQR D;  1T5X D;  4M8A A;  2HHH Q;  4GN5 A;  4IZ8 A;  4R4I A;  2F0E A;  3FMC A;  4X65 Q;  1XMQ Q;  5IGD A;  1JCK B;  3RNU A;  5M3M B;  2KOL A;  3ULP A;  5E4X A;  2YTX A;  1KIX A;  1XPO A;  5IYB G;  3PF5 A;  3I4N B;  4GNX A;  1WJJ A;  4IJL A;  1IKM A;  1SYE A;  3SR1 A;  3Q23 A;  2YTV A;  2KHI A;  2ZM6 Q;  2R92 B;  2RDH A;  4R4Q A;  1ESR A;  1FR3 A;  4AYB B;  4G7H C;  3V96 A;  1PTO D;  1ASZ A;  2GJW A;  3FDT A;  2XN9 C;  2XRQ D;  1X3E A;  2D5D A;  2F0M A;  2A74 C;  3KFU A;  3GV3 A;  4HIO A;  3S1M B;  4WJ3 M;  3E9H A;  1VQC A;  1I94 Q;  1CQV A;  2BDO A;  1RLV A;  1PTO F;  1RJT A;  4JBJ A;  2AQ1 B;  2I5M X;  1XYI A;  1QWY A;  1QVG A;  1TWC B;  2AQ2 B;  5JOB A;  2B2W A;  2WKC A;  1NSN S;  3G6E A;  3GTO H;  3KF8 A;  3CQZ H;  4PZ6 A;  1Q3L A;  3UDG A;  2PYK A;  1SYF A;  5ELF A;  1WCM B;  2CWA A;  4LF4 Q;  4QF4 A;  1Q82 C;  2WB1 B;  2PQE A;  1K83 B;  5EBD A;  3H0G B;  2BOS A;  4A3G H;  4LF9 L;  2K7V A;  4FNF A;  1HH2 P;  1TKW B;  3SDZ A;  1IL2 A;  3D6W A;  3JAM i;  4IUP A;  1H9K A;  4KTA A;  1RZN A;  1EIH A;  4OIK A;  4PMB A;  2RBM A;  3C46 A;  3KF6 B;  1U4R A;  5JAV A;  2I07 B;  1D2B A;  3VYU A;  3HOU H;  1PFM A;  2VQE L;  2K03 A;  4RGN A;  3VA5 A;  4A93 H;  1ZKO A;  4F7X A;  2EYH A;  1B9N A;  3HG9 A;  5HUR A;  3RMH A;  4Q5V A;  2Z6B A;  5C4H A;  2JA7 H;  4DV5 Q;  4HSV A;  4LF5 Q;  2E5L Q;  1XMX A;  4UP7 A;  2JA6 H;  4JI4 Q;  1D1K A;  4ZRZ A;  1HA6 A;  3GD7 A;  3C3L A;  4ZUJ A;  3L0O A;  3V05 A;  2R7Z G;  3T1H L;  1PH7 A;  3LNN A;  4XT1 B;  3WOE A;  1IL8 A;  2EE1 A;  3D6C A;  4V19 0;  1SNP A;  1B50 A;  3BDO A;  1K8O A;  2JA8 H;  1HNZ Q;  3J7A 5;  1X54 A;  2EJF C;  2O5I C;  4DV2 L;  1Z6H A;  4JI7 Q;  2C9O A;  4OEM B;  4ABN A;  2PNR C;  1XNR L;  4IO9 A;  3PSI A;  2FKH B;  1KC8 C;  1II3 A;  4L5R C;  1JE4 A;  1OXV A;  3KUP A;  1W6J A;  3NP8 A;  3FHW A;  5I6Y A;  1PH5 A;  3GTJ B;  3FKI G;  5FDK A;  1EIY B;  3J81 c;  1KXL A;  3PV0 A;  1DOM A;  5DNF A;  2Q2T A;  4LFB L;  1EU4 A;  2ZTE A;  1NUC A;  4DV1 Q;  1N32 Q;  5CYU A;  1U0L A;  4OHJ A;  3CC2 A;  1K28 A;  1TWG H;  5CMD A;  1Z7T A;  3D3R A;  1FNW A;  1NY4 A;  3PUV A;  1Q1E A;  1J5E Q;  4LFA Q;  5DM7 3;  4TKD A;  2OF1 A;  2I5L X;  3OPO A;  3W3A A;  4B3S L;  5FO7 B;  3HOV H;  3H3V C;  2DBS A;  4EV1 A;  3PUX A;  4FXG C;  4LF8 Q;  2H4O A;  1SXT A;  2OEO A;  2HIX A;  4O0A A;  3FVQ A;  1EIF A;  3BG3 A;  1Y8N B;  1G6P A;  1O78 A;  2RHQ B;  4H44 C;  2DN8 A;  4DXG A;  2B2V C;  1WTO A;  1SYD A;  4E6I A;  3SXH A;  3U50 C;  5M5X B;  2KCM A;  2B39 A;  2B2Y A;  2AMC B;  4K6D A;  2WAQ E;  5D3D A;  2HHH L;  4JG2 A;  5E3F A;  1XMO Q;  2WKD A;  4JW0 A;  1A62 A;  1LTA D;  3P20 A;  3AB9 A;  4X65 L;  1XMQ L;  4JBK A;  4DU9 A;  2A6H D;  3KF8 B;  5EKI A;  3B6Y A;  3PO3 B;  1STH A;  1DYQ A;  3MHB A;  2DGY A;  4QUC A;  3E5S A;  1QIL A;  3BZD B;  4JBW A;  4RHS A;  3MZ5 A;  1BCP B;  2RDG A;  1LLR D;  1R4Q B;  2D62 A;  4DNR B;  1V9P A;  1BDO A;  3OOC A;  5JEA G;  3CAM A;  1M90 C;  3I91 A;  2ZM6 L;  3J7A F;  1SLJ A;  2K52 A;  1GUT A;  4FXK C;  1NNX A;  3BJU A;  4A3J B;  1PH6 A;  4RFB A;  5KNC A;  4BBS G;  3PIP 3;  3PUY A;  1I94 L;  4H02 A;  2Q2I A;  1A3U A;  1IYJ B;  5C3E G;  1K83 H;  4DAP A;  3C1E A;  1SND A;  2N78 A;  1TT2 A;  4KY5 A;  1VS0 A;  1HCZ A;  5I2X A;  4MZ9 A;  4PZ8 A;  1Y69 U;  1TR5 A;  2K50 A;  4JVZ A;  1A3T A;  4ULL A;  5EPJ A;  1AE2 A;  2B3G A;  5A2Q L;  5C4X G;  1HZB A;  2MO1 A;  1MBY A;  4LF4 L;  2R93 G;  2KUM A;  3UE1 A;  4C3J G;  5IYC G;  4A3C H;  4LUV A;  1GUW A;  2BA0 A;  1YVC A;  3IKJ A;  3MEF A;  2K5Q A;  4CGY B;  2DJG C;  4CBV A;  3K57 A;  1SBB B;  5K5P A;  4BXX H;  1N8R C;  3C2P A;  1ZYR C;  4NP5 A;  4A3B G;  5IGB A;  2ALY B;  4UHV A;  1PV4 A;  4RMF A;  1PYW D;  3BS1 A;  2CZR A;  2F0G A;  2YU9 B;  1OXT A;  1VQD A;  4DV5 L;  1YNN C;  1YIJ A;  4BA1 I;  4WRD A;  2WIZ A;  4LF5 L;  4RG1 A;  2E5L L;  1IXR A;  4XQJ A;  2B8G A;  3I7F A;  4JI4 L;  2KEC A;  2WAQ G;  5M5Y B;  4DV7 Q;  1TS3 A;  2EO0 A;  1OB8 A;  5IGG A;  4ILW A;  2JK8 A;  1B70 B;  1PZJ D;  3HOZ G;  3RUZ A;  1HNZ L;  4XTC S;  2OQ0 A;  2A6E C;  4G6U A;  3S1N B;  4DV3 Q;  4C1N I;  3AYH B;  3DNX A;  1E2V A;  3RLF A;  4A3K G;  4JI7 L;  4KKT A;  2PO4 A;  4JCV E;  4LF6 Q;  1HZC A;  2NN6 G;  1GM5 A;  3GTP H;  2A1A A;  3T1Y Q;  5DM6 3;  5EGT A;  4C3H G;  1AZP A;  1GVP A;  1GXD C;  2OCE A;  2IHE A;  4J1M A;  1PRT C;  4DNT B;  4K8J A;  4GLV B;  4P2C B;  3O13 A;  3G4S A;  2F4I A;  2A8V A;  3TZU A;  3A56 A;  4RCN A;  4DV1 L;  2ES2 A;  1N33 Q;  4A4I A;  1O80 A;  3MAQ A;  2WIN B;  3HOW B;  1N32 L;  2B63 G;  4OIJ A;  3CRK C;  1CZW A;  5C6A A;  5IYB H;  5ELE A;  2QW7 A;  4QB4 A;  4RGT A;  1VCI A;  3A7A B;  1ENC A;  1J5E L;  4LFA L;  4N9P A;  3T4A C;  1EOT A;  1EWH A;  5C4J B;  4G7Z C;  1B8A A;  3HRZ C;  4LF8 L;  1VQA A;  2O2L D;  4CDE C;  3E0E A;  5JVG 3;  1IBK Q;  2SEB D;  1F9P A;  2Z0S A;  4E6Z A;  2E2D C;  1L0W A;  2K32 A;  4B3T Q;  3MFY A;  1L1O B;  2XIW A;  5JVH 3;  1LTG D;  2AHO B;  2SNS A;  3OWF A;  4KKS A;  4IFD J;  1ESF A;  5EBC A;  2MPM A;  3NK9 A;  1PFN A;  1Y1V H;  3HKZ G;  2EYM A;  5FLX c;  2V1C C;  2KA7 A;  4DR2 Q;  2XGT A;  4PMW A;  2K04 A;  3I8Z A;  1UAP A;  1X55 A;  2OWO A;  3M4P A;  3EN2 A;  1XMO L;  1A2U A;  1PZI D;  1JC7 A;  3AU7 A;  3K7A B;  1T5E A;  4L5Q A;  3A55 A;  4QJF A;  2PNH A;  1STN A;  4DK3 C;  1AE3 A;  1G2S A;  4K14 A;  4JI5 Q;  4A3J H;  1S5C D;  3P1Y A;  4N8X 1;  3V2T A;  3GTK B;  2RA4 A;  3VYT A;  4DAV A;  3RZD B;  2AQ3 B;  5IYD G;  2L1B A;  4FF2 A;  4A3I H;  4K5V A;  4F8M A;  1UE7 A;  2PI2 A;  1RIP A;  4KI0 A;  4IQZ A;  4YY3 Q;  3GO5 A;  4YWM A;  3UDI A;  4IUN A;  4B3R Q;  2K75 A;  1JB3 A;  1SR3 A;  1HXY D;  3IRB A;  2RF4 A;  4AYB E;  1VQK A;  1OXX K;  3ERO A;  2BE5 D;  2EIF A;  3QR8 A;  4CJ2 C;  4NDX A;  1C48 A;  3JAM c;  2JA5 B;  4BWG B;  1VQO A;  4RA8 A;  4LNQ A;  1UUP A;  4TQU S;  1HQM C;  4DKA C;  1CZG A;  4A3E B;  2LY7 A;  1BBX C;  3M4Q A;  3QO2 A;  1EY4 A;  4OO1 G;  3OMC A;  2BH8 A;  3PF4 A;  2EY2 A;  1EQR A;  3H91 A;  3D4D A;  3LWE A;  4XYQ A;  3M4Y A;  2GW6 A;  3N52 A;  2V4D A;  3EJI A;  1PHJ A;  1JIC A;  2WB1 E;  4B08 A;  1GD7 A;  2R61 A;  1Q8K A;  4PMC A;  2KCN A;  5ISR A;  3OIQ A;  1KDC A;  2KVM A;  3I70 A;  4JI8 Q;  1VQN A;  3CCJ A;  1CA6 A;  4QCL A;  3CP0 A;  2PZU A;  4HID A;  2F3W A;  3EIV A;  1LTS D;  3WOF A;  2IPK D;  1PTO B;  3H94 A;  5IT9 c;  4DR7 Q;  4R9W A;  2LXJ A;  2BCO A;  4DV7 L;  1G29 1;  1G2T A;  4C2M B;  1JR0 D;  5G3L D;  2MQH A;  2HCI A;  4R1J A;  1CUK A;  1ENF A;  1JQY D;  1W2B A;  4DV3 L;  4KY7 A;  4JI6 Q;  1SAP A;  1VQH A;  4KD3 A;  5LL6 S;  3AEV A;  4DXF A;  2ZYZ B;  1I50 H;  3CHB D;  2F0I A;  3GTO B;  1Y8P B;  1TS5 A;  4LF6 L;  1QVF A;  1FNU A;  3A8I E;  1K8M A;  3KLS X;  3OHX C;  3T1Y L;  2HQL A;  1WOC A;  5C44 H;  2L11 A;  2WP8 J;  4XXE A;  1I4H A;  5M3M G;  1R0V A;  4LK1 C;  3SEB A;  1E2Z A;  2D2C C;  3URY A;  1H9R A;  4A3G B;  2NYZ D;  3TS2 A;  5M3F H;  4IJH A;  4XYO A;  1HNX Q;  1MD2 D;  5IGE A;  1SRU A;  4BBR H;  1N33 L;  3K0Y A;  3PUZ A;  5C0X I;  2KCT A;  1STY A;  2R92 G;  1Q46 A;  1N34 Q;  3CD6 A;  1EOV A;  4DR1 Q;  2L0C A;  1A15 A;  5JEA H;  1DGS A;  2VUM G;  3HOU B;  5GAD C;  1QB5 D;  4A93 B;  5A2Q E;  1EFI D;  3K59 A;  3F2D A;  3I2Z A;  3G7L A;  1FGU A;  3MVV A;  2X6L A;  2VQF Q;  3UDF A;  1IBK L;  4FYD A;  4A3M B;  4B3T L;  2JA6 B;  4WJ4 A;  3BVZ A;  3U4Z A;  1ICF B;  3KYH C;  4RHR A;  2JE6 I;  2VS1 A;  2AKW B;  5I6W A;  1L0Y B;  3FOV A;  5FO8 B;  1Q81 C;  1WCM G;  3ND8 A;  2WB1 G;  3X3M A;  1SNO A;  4OO1 I;  4DR2 L;  2JA8 B;  3H0G G;  1EQT A;  1N36 Q;  3PO2 B;  4G4K A;  4JC0 A;  3NQI A;  1JE5 A;  5C4X H;  2EJG C;  5FJ8 G;  3KOJ A;  2R93 H;  1QUQ A;  3RD4 A;  3E0J A;  1EY0 A;  5IYC H;  1OTC A;  5KIX A;  4A3F H;  3OWE B;  4GKJ Q;  1BUV T;  2K33 A;  4JI5 L;  1SSO A;  1EYC A;  3K81 C;  1RKN A;  1ET6 A;  3H3V H;  5M5W H;  1STA A;  2E8G A;  4OL7 A;  5JJI A;  4A3B H;  2A73 B;  1LUZ A;  3KK7 A;  3KJO A;  2L5T A;  1HJP A;  2Z9H A;  1JWM D;  1WTR A;  3GQB A;  2CCZ A;  4UY8 C;  1TWG B;  2F0L A;  3NBH A;  4RWS C;  1H9M A;  4YY3 L;  1XNQ Q;  4HIK A;  2Y0S B;  4B3R L;  1SRO A;  2ZXR A;  4A3E H;  3HOV B;  3DM3 A;  2ZJQ A;  1STE A;  3TN2 A;  4DNI A;  3CCQ A;  4LWC A;  4KJO A;  4O1N A;  4A75 A;  1WTP A;  1J9O A;  4BA2 I;  2Q2U A;  2KJX A;  1Y1W H;  3D4R A;  3HOZ H;  2F0K A;  3I55 A;  1HZA A;  4N9T A;  3I4M H;  2IL8 A;  4A3K H;  5FKA C;  4X3K A;  1VQJ A;  3BDC A;  2F3V A;  4UAI A;  1VDZ A;  1PH3 A;  1HFN A;  5I4D A;  1GJX A;  1DM0 B;  4QIW B;  3FEW X;  5DEH A;  1K8A C;  1MI2 A;  1YHB A;  1LM0 A;  1QJO A;  2NBF A;  1CQF A;  1RTO A;  1EYG A;  3L7Z C;  4DR6 Q;  1EY6 A;  2SOB A;  2VB3 X;  4YWL A;  1YHQ A;  4JOI A;  2K1B A;  1KTK A;  1PTO H;  2RCN A;  1E3P A;  4JI8 L;  2JYO A;  3QOL A;  1KRT A;  3TBI B;  3M7G A;  1S40 A;  2B63 H;  2NVT H;  2VXW A;  4JI2 Q;  4C2M H;  2Z4I A;  1GUS A;  2J7Z A;  2QGQ A;  5CBE E;  2OST A;  2EY1 A;  1BQQ T;  4P71 A;  3Q24 A;  1B2T A;  5IOD A;  1X32 A;  1KRS A;  4X64 Q;  2TMP A;  5IP7 G;  1A8V A;  5COY A;  4IOC A;  4CDF C;  2A19 A;  1A79 A;  2UUA Q;  2F0T A;  2IXS A;  1QG7 A;  5KNB A;  1SDF A;  4DR7 L;  1PYB A;  1KD1 C;  5IOC A;  1YBY A;  4NMZ A;  1NJI C;  1Q8I A;  3PUW A;  1UEA B;  2EY6 A;  2J0T D;  1VQ8 A;  2R7F A;  3MXN B;  3VR3 A;  2Q8I B;  4PQX A;  1WVL A;  4POG A;  2E74 C;  1Q12 A;  2JA9 A;  4A3L G;  3PIO A;  2WFW A;  4YIJ A;  3TP5 A;  2JJQ A;  3VYR A;  1ILQ A;  2ICI A;  1YEZ A;  3ERS X;  2K4K A;  1NCV A;  1XJV A;  2F4V Q;  4JI6 L;  1A63 A;  1G91 A;  3CPW A;  4X6A H;  3U9O A;  5ELD A;  2G5D A;  3VR2 A;  1BKB A;  3AJV A;  4QBN A;  4TRD A;  4DA2 A;  3S16 H;  3ICE A;  1ZYR D;  4YWK A;  3S17 H;  3IFD A;  3D31 A;  4IPH A;  4L63 B;  4GOP A; 
#chains in the Genus database with same CATH homology
 2A69 D;  3NWS A;  2CHB D;  2F0S A;  1YNN D;  5C3W A;  1WTW A;  4K5X A;  2G9D A;  2LS0 1;  1ENA A;  5JEA J;  3IFT A;  2CW0 C;  3ND9 A;  2FLC A;  2A6E D;  1Y1O A;  5CV6 A;  3TME A;  4ODG A;  2TSS A;  1CHQ D;  4CKE A;  4FF3 A;  2IT1 A;  5EPL A;  3TDQ A;  3SE0 A;  2Z1C A;  3Q22 A;  1FYC A;  1PRT D;  3MTS A;  3ERQ A;  1TS4 A;  2NVX B;  1PRT F;  4CKB A;  3GTP B;  3Q0A A;  1CA5 A;  5KRU A;  2FMM A;  3NTH A;  4KKU A;  4TKO B;  3KBG A;  3D4W A;  2GA4 B;  4XDX A;  4LAA A;  3CKI B;  1I4R A;  1TS2 A;  3ITP A;  4C3I G;  4IFD H;  4TKK A;  5BN4 A;  4J8Q A;  3BVG A;  3SK6 A;  1KNE A;  3OIP A;  4FP5 D;  1X3Q A;  4K8I A;  1HPC A;  1PXU A;  2Q8R E;  2PPB C;  3TP7 A;  2C5C A;  1EY9 A;  4NKL A;  1PDQ A;  1CI3 M;  2FFK B;  3J7A V;  4CJ1 B;  1Y1V B;  2VB2 X;  1E0B A;  1A3V A;  1F2Y A;  4RH6 A;  1VF7 A;  2EPB A;  3P1H A;  4EQN A;  1BNZ A;  2FJ2 A;  3AJV B;  1U4L A;  3MA2 B;  1LTR D;  2LFN A;  1BOS A;  2KQ3 A;  3NTK A;  2IX0 A;  2NVQ B;  1TY0 A;  3AMU A;  2K05 A;  2L55 A;  2Z0R A;  2QDB A;  5K36 H;  4A3I B;  3IAY A;  4DK1 A;  1Y8O B;  1LTT D;  1LTB D;  4G6V A;  1SEB D;  1V1P A;  1DCZ A;  1G8Z D;  1D5M C;  3IEY A;  1RTN A;  1CK1 A;  3K5L A;  2WII B;  5D3I B;  3QJY A;  3KBX A;  2ICE C;  1EYD A;  2NTT A;  1HUN A;  3HGB A;  1I4X A;  4KHV A;  4WOR A;  2A69 C;  3EQL C;  2F0F A;  2F0J A;  1C8C A;  2WV6 D;  3NWT A;  2B2V A;  5FLX E;  1QNU A;  3E6Z X;  4L8J A;  1FGB D;  1SYG A;  1CHP D;  3BYY B;  1UWV A;  1DXM A;  4DFA A;  2FMC A;  2A68 C;  3VR5 A;  3MXP A;  2PZT A;  2E75 C;  3TSS A;  4S3S A;  3LX0 A;  3OW7 A;  2WCW A;  2IJ0 A;  2EYO A;  2WJ0 A;  1H9J A;  2F03 A;  2R6G A;  4DAY A;  4MN3 A;  4I65 A;  1AEX A;  3K5O A;  1RHP A;  1TWH B;  4C56 C;  5FOB B;  1I50 B;  2N88 A;  1QE6 A;  2RQX A;  2HQE A;  1SNM A;  1GHK A;  2FHT A;  5C44 B;  3NUC A;  2ZXO A;  4HED A;  3QOJ A;  1BF4 A;  4K5W A;  5M3F B;  4BBR B;  2XWB B;  3MFG A;  2M9V A;  1PMR A;  2F0O A;  1S5D D;  2B2T C;  5BN5 A;  1D1I A;  1EU3 A;  3QIA A;  4XQN A;  4KHZ A;  1EEF D;  5C3E B;  2NZ1 D;  2PMZ B;  3J81 L;  1R4P B;  1V1P B;  2NTS A;  2YYZ A;  1D5X C;  1XWE A;  4ZAI A;  5C4X B;  1SE3 A;  1L0X B;  3F2U A;  4ZK9 B;  2R93 B;  5C0X G;  1XXG A;  4A3F B;  3T13 A;  2IX1 A;  1M8A A;  5M5W B;  1EL0 A;  4A3B B;  5LL6 X;  2E76 C;  1WTX A;  2K5W A;  5J22 A;  1B53 A;  2ZXP A;  3CU7 A;  5ELC A;  4RKB A;  5FK9 C;  4ZYS A;  3I4L A;  3IF0 X;  1ZP7 A;  2F0P A;  2PCF B;  4LJZ C;  4RKL A;  1ICW A;  4M1U B;  1ML0 D;  4EQP A;  1EY5 A;  1F2M A;  1U4P A;  1A6X A;  1Y1W B;  3HOZ B;  2O4X A;  3I4M B;  1B1Z A;  3J7Y W;  4A3K B;  1SMY C;  3NE5 B;  1DJR D;  5EQ0 A;  4ZQ3 A;  1FNV A;  2XVS A;  1A2T A;  1OB9 A;  4CKC A;  4G7O C;  2KCC A;  2B63 B;  2NVT B;  3I72 A;  1SNC A;  1IW7 C;  3ZYY X;  4OGQ C;  5EKL A;  3HZX A;  5C5L A;  1Y88 A;  2PZW A;  1I4P A;  2EXZ A;  2M00 A;  3MXG A;  5G3L F;  4KV6 A;  1CFM A;  3MC0 B;  2F0D A;  1O7Z A;  3DUZ A;  1RD9 D;  4Q0F A;  5IIF A;  4EGV A;  5C3X A;  4JK1 C;  5E4W C;  3HKZ B;  1SE4 A;  4RCO A;  2LKV A;  1RF2 D;  1LT6 D;  4Z9C B;  3S16 B;  3S17 B;  2H1E A;  2MGS A;  4FO2 A;  1KAB A;  1DOK A;  2R3Z A;  2INB A;  1R11 A;  2CW0 D;  1GOZ A;  4QMG A;  2G9H D;  4R8I A;  4Y7N B;  3DEO A;  1IPI A;  3VYS A;  4A3D B;  2L4N A;  4RGO S;  4XQQ A;  1EZ8 A;  3DWQ A;  3HP3 A;  1UNS A;  4QBO A;  3TP6 A;  5AFW A;  1SJH D;  2MJ8 A;  3S1Q B;  3S1R B;  3P1Z A;  2ENB A;  4KMU C;  5T1I A;  2AUJ D;  3EA6 A;  4K2L A;  2LMC B;  4UDU C;  1I4Q A;  3U9S A;  5I9P A;  5J39 A;  1TQO A;  3S15 B;  1FD7 D;  1RDP D;  1BCP C;  2MHV A;  4MHE A;  4H0L C;  1F9Q A;  2K5D A;  2Z8L A;  1WTQ A;  4IAL A;  4K6L A;  3BVM A;  5M9O A;  3SK4 A;  1SNQ A;  1LTI D;  1H9S A;  5KEE A;  4IFD I;  5FLX L;  1LV9 A;  3HS0 C;  1XX8 A;  1IHZ A;  1YNJ C;  2RDF A;  3W2D A;  2J4X A;  2KEE A;  3A54 A;  2RSN A;  1DD2 A;  2JEB I;  5HGT A;  2NN6 H;  5JJZ A;  2FKC A;  2JSO A;  1QCB D;  1V43 A;  1HTP A;  2OT2 A;  1JWS D;  5KYL A;  2O5J C;  2RKS A;  1F9S A;  1HTL D;  4WFN 3;  3N6R A;  1AW7 A;  4H7B A;  2BDN A;  2KED A;  4WJW A;  5CV4 A;  3L3O C;  1VF5 C;  2VLD A;  3FPU B;  3JAM L;  1BR9 A;  2F0N A;  4KN7 C;  1XTC D;  3J81 E;  3ONA B;  1STG A;  2VUM B;  2Q8T A;  4DK0 A;  3DMU A;  2Z4H A;  2CQA A;  1C4Q A;  3DM1 A;  1JOK A;  1I6H B;  1YNM A;  1D5Z C;  1F2L A;  3GTM B;  3SK8 A;  1HH1 A;  1T0F A;  5CC4 A;  2QKI C;  2SNM A;  3NHH A;  2HDM A;  2B2Y C;  4BS9 A;  2ID0 A;  2JEA I;  1KAA A;  4KK7 A;  1S5F D;  3P1Z B;  5C0X H;  3A7L A;  5IT9 L;  5EKK A;  1NAP A;  1QNK A;  3K58 A;  3T51 B;  1WTV A;  2D9U A;  5CBA E;  4KY6 A;  1ET9 A;  4LMQ D;  2QCP X;  2BA1 A;  2A68 D;  1GUO A;  2WAC A;  4HN7 A;  4U67 3;  3K5N A;  1JOQ A;  2EY5 A;  1EZ6 A;  2EVB A;  2L9H A;  4OO1 H;  3M85 A;  4J6H A;  1JOR A;  4RGM A;  1H9S B;  1B9M A;  2PW5 A;  2NVY B;  3P75 A;  4F87 A;  3EFX D;  1Q90 A;  3T16 A;  1TVX A;  5D14 A;  1TY2 A;  2F0V A;  3M3Y B;  4U68 A;  2F0W A;  2X69 A;  4ZLT F;  4HR7 B;  3VR6 A;  3NTI A;  2OXP A;  5JPM C;  2E2I B;  3TP8 A;  1KDB A;  2K28 A;  3VR4 A;  3GP7 A;  3FPP A;  3MXU A;  1G6Z A;  1OO9 B;  1KNA A;  1PLF A;  1U9R A;  1EWC A;  4XIG S;  5BN3 A;  1MSG A;  1KLU D;  5ELB A;  4ID6 A;  1V1O A;  4XT3 B;  4H13 C;  5J1Z A;  1F2Z A;  4EQO A;  2PW7 A;  1DZ1 A;  5CGK A;  1GUG A;  2EYL A;  3QWN A;  2HDL A;  4FF4 A;  4IUU A;  1ZEQ X;  3S14 B;  3FRP B;  2W8M A;  3S9W A;  2JXM B;  3VA7 A;  1EQV A;  2BH2 A;  2EJM A;  4IUV A;  1SFO B;  2B8F A;  4ME5 A;  1AFP A;  3S2H B;  1HFG A;  4CHT B;  1E2W A;  3DXJ C;  1WD1 A;  2B2U C;  1SYC A;  2I46 A;  2N55 A;  1KLG D;  4X3S A;  4CJ0 B;  4HMJ A;  3K6O A;  2XSC A;  2EDG A;  3A8K E;  3L9A X;  1R9T B;  3M4O B;  1LT3 D;  2DNC A;  4FVM A;  5IOD A;  3NPP A;  2EYJ A;  4KN4 C;  5D65 A;  1X3P A;  1OXU A;  3PMF A;  3S2D B;  2IWH A;  1PTO C;  1STB A;  2NWG A;  4FXD A;  2WCZ A;  2R7Z B;  1DOL A;  4KD4 A;  4QUF A;  4HCE A;  3GTG B;  2KHS A;  3BYT B;  4DGZ A;  2DY7 A;  5KYI A;  5FO9 B;  4R8N A;  1SMY D;  4X3U A;  3D8G A;  1PFB A;  1VMP A;  4PNY A;  3M7N A;  1LO5 D;  4MIU A;  1AP0 A;  3FKI B;  3DWP A;  2XWJ B;  3NXW A;  1F1Z A;  3DEP A;  3MEH A;  1ONL A;  3LWU A;  3Q6S A;  3EVQ A;  4HSP A;  5C0X J;  4BY1 B;  2HCC A;  1IW7 D;  4QBL A;  5CV5 A;  2VNU D;  1S5B D;  1AZQ A;  3QG1 A;  3KLR A;  4IUT A;  1KDA A;  1IYU A;  1EY7 A;  3X3N A;  4C3I B;  2M2L A;  4DN4 M;  1EIG A;  5COR A;  3BDL A;  5IGF A;  2IX3 A;  1JWU D;  5A35 A;  2B2U A;  4FF1 A;  2NUC A;  2K01 A;  3RZO B;  4IUR A;  2QF7 A;  3JAM E;  3GTL B;  1O7Y A;  1SYB A;  3K5M A;  3J80 L;  4K2K A;  3R3O A;  1TII D;  4G57 A;  4ZKB B;  4I7Z C;  3SVM A;  1Q1B A;  1GUN A;  2AWN A;  3H09 A;  1QOH A;  3R8B A;  1CM9 A;  2CVR A;  4HCS A;  3HEJ A;  1SJE D;  1TWF B;  4BBS B;  2FIN B;  3QB3 A;  2A5H A;  2EOT A;  2XRS D;  2ZYZ A;  1HUM A;  1AN8 A;  4NW2 A;  2F0H A;  1LAB A;  3WDN A;  1GEF A;  4ZKC B;  5NUC A;  2MUY A;  1B4O A;  1I4G A;  5IT9 E;  5EJW A;  3R93 A;  2EZV A;  3IEY B;  5T1G A;  4C3J B;  3I73 A;  3GV6 A;  1BCP D;  5CR3 A;  1NR4 A;  2A6H C;  2MP1 A;  2E2H B;  3NQT A;  2JP1 A;  2ZT9 C;  1BCP F;  1MGS A;  3TZD A;  1TU2 B;  2RSO A;  3SK5 A;  1BO0 A;  2F0U A;  1WD0 A;  3H6M A;  3T56 B;  5TSS A;  1U4M A;  3C1F A;  4EVO A;  1JOO A;  1TWA B;  1YNJ D;  3A8J E;  5JPN C;  2WAQ B;  3HOX B;  1CT1 D;  3NSW A;  4C1N K;  1EYA A;  5CV9 A;  4IN3 A;  1HHV A;  5IGC A;  2NB0 A;  3PIO 3;  5EPK A;  2NN6 I;  4X3T A;  2FCO A;  1V8Q A;  1HA5 A;  2L12 A;  2QIL A;  1EY8 A;  4C3H B;  3DWA A;  1ILP A;  3BT7 A;  5F2D A;  1D6E C;  4HMI A;  1LT5 D;  4HAE A;  3I3C A;  3IL8 A;  1CTM A;  2HUG A;  3OMG A;  1ZXT A;  1HRJ A;  2F0Q A;  3R2T A;  2B2T A;  4GZY C;  4KJN A;  1S5E D;  3R2I A;  1M4V A;  4IFD G;  1Z47 A;  2K6A A;  1S4Z A;  3GTQ B;  2XNA C;  3T53 B;  1B3A A;  1I3Q B;  2OKF A;  3I90 A;  3UI2 A;  5E1F A;  5I9O A;  1RCV D;  5LHY 1;  2EYP A;  1IKL A;  5CV8 A;  2RVL A;  4TSS A;  1DON A;  3CRL C;  4BY7 B;  1O7L A;  4DF7 A;  3CQZ B;  1SE2 A;  5I2Y A;  2E2J B;  4V0B A;  2QEJ C;  3OSO A;  1IYV A;  3KLS A;  2DNE A;  3P7J A;  2AWO A;  4HTH A;  1VMC A;  5KGU A;  1PZK D;  3HOY B;  5CV7 A;  3MXN A;  1OXS C;  2IW3 A;  5K36 G;  1I6V C;  3MWY W;  2JA7 B;  4RAU C;  1ROD A;  4IUQ A;  1MSH A;  5KND A;  1GHJ A;  3SHL A;  3G6J B;  1PRT B;  2B2W C;  5C4Z A;  4LQE A;  3NBI A;  2DY8 A;  2X6G A;  1LT4 D;  1W6K A;  1EEI D;  4ZUI A;  5C5M A;  1B44 D;  1BXT A;  1F77 A;  1J8I A;  2F1M A;  4L6T B;  2FL3 A;  4B9W A;  1F9R A;  5DAU A;  4B9X A;  4ZQU A;  4PV1 C;  2CV8 A;  2WIW A;  4F88 A;  2AUK A;  1LAC A;  4O42 A;  2SDF A;  2EYF A;  1NR2 A;  2BE5 C;  3DHQ A;  3J80 E;  1HQR D;  1T5X D;  4M8A A;  4IZ8 A;  2F0E A;  3FMC A;  5IGD A;  1JCK B;  5M3M B;  2KOL A;  5E4X A;  3I4N B;  1IKM A;  1SYE A;  3SR1 A;  3Q23 A;  2R92 B;  2RDH A;  1ESR A;  1FR3 A;  4AYB B;  4G7H C;  3V96 A;  1PTO D;  2GJW A;  3FDT A;  2XN9 C;  2XRQ D;  2D5D A;  2F0M A;  2A74 C;  3S1M B;  3GV3 A;  1CQV A;  2BDO A;  1RLV A;  1PTO F;  1RJT A;  2AQ1 B;  1XYI A;  1QWY A;  1TWC B;  2AQ2 B;  5JOB A;  2B2W A;  2WKC A;  1NSN S;  3KF8 A;  1Q3L A;  2PYK A;  1SYF A;  5ELF A;  1WCM B;  4QF4 A;  2WB1 B;  2PQE A;  1K83 B;  5EBD A;  3H0G B;  2BOS A;  2K7V A;  4FNF A;  1TKW B;  3SDZ A;  3D6W A;  4IUP A;  1H9K A;  4KTA A;  1RZN A;  1EIH A;  4OIK A;  4PMB A;  2RBM A;  3C46 A;  1U4R A;  5JAV A;  2I07 B;  1D2B A;  3VYU A;  1PFM A;  2K03 A;  4RGN A;  3VA5 A;  1ZKO A;  4F7X A;  2EYH A;  1B9N A;  3HG9 A;  5HUR A;  3RMH A;  4Q5V A;  5C4H A;  4HSV A;  1XMX A;  1D1K A;  4ZRZ A;  1HA6 A;  3GD7 A;  3C3L A;  4ZUJ A;  3V05 A;  3LNN A;  4XT1 B;  3WOE A;  1IL8 A;  2EE1 A;  3D6C A;  4V19 0;  1SNP A;  1B50 A;  3BDO A;  1K8O A;  2EJF C;  2O5I C;  1Z6H A;  2C9O A;  4ABN A;  2PNR C;  2FKH B;  1II3 A;  1JE4 A;  1OXV A;  3KUP A;  1W6J A;  3NP8 A;  5I6Y A;  3GTJ B;  5FDK A;  3PV0 A;  1DOM A;  5DNF A;  1EU4 A;  1NUC A;  5CYU A;  4OHJ A;  5CMD A;  1Z7T A;  3D3R A;  1FNW A;  3PUV A;  1Q1E A;  5DM7 3;  4TKD A;  2OF1 A;  3OPO A;  3W3A A;  5FO7 B;  3H3V C;  2DBS A;  4EV1 A;  3PUX A;  4FXG C;  2H4O A;  1SXT A;  2OEO A;  3FVQ A;  3BG3 A;  1Y8N B;  1O78 A;  4H44 C;  2DN8 A;  4DXG A;  2B2V C;  1WTO A;  1SYD A;  4E6I A;  3SXH A;  5M5X B;  2B39 A;  2B2Y A;  4K6D A;  5D3D A;  5E3F A;  2WKD A;  1LTA D;  3P20 A;  3AB9 A;  4DU9 A;  2A6H D;  5EKI A;  3PO3 B;  1STH A;  1DYQ A;  3MHB A;  4QUC A;  3E5S A;  1QIL A;  3BZD B;  4JBW A;  4RHS A;  3MZ5 A;  1BCP B;  2RDG A;  1LLR D;  1R4Q B;  2D62 A;  4DNR B;  1BDO A;  3OOC A;  5JEA G;  3I91 A;  3J7A F;  4FXK C;  1GUT A;  4A3J B;  4RFB A;  5KNC A;  3PIP 3;  3PUY A;  1A3U A;  4DAP A;  3C1E A;  1SND A;  1TT2 A;  4KY5 A;  5I2X A;  1HCZ A;  1Y69 U;  1TR5 A;  1A3T A;  4ULL A;  5EPJ A;  5A2Q L;  1MBY A;  2KUM A;  4C3J G;  1GUW A;  2BA0 A;  3IKJ A;  2K5Q A;  4CGY B;  4CBV A;  3K57 A;  1SBB B;  5K5P A;  3C2P A;  1ZYR C;  4NP5 A;  5IGB A;  1PYW D;  3BS1 A;  2CZR A;  2F0G A;  2YU9 B;  1OXT A;  1YNN C;  4BA1 I;  4WRD A;  2WIZ A;  4XQJ A;  2B8G A;  2KEC A;  5M5Y B;  1TS3 A;  2EO0 A;  1OB8 A;  5IGG A;  4ILW A;  1PZJ D;  3RUZ A;  4XTC S;  2A6E C;  4G6U A;  3S1N B;  4C1N I;  3DNX A;  1E2V A;  3RLF A;  4KKT A;  2PO4 A;  2NN6 G;  5DM6 3;  5EGT A;  4C3H G;  1AZP A;  1GXD C;  4J1M A;  1PRT C;  4DNT B;  4K8J A;  4P2C B;  3O13 A;  2F4I A;  3TZU A;  3A56 A;  4RCN A;  3MAQ A;  1O80 A;  3HOW B;  2WIN B;  4OIJ A;  3CRK C;  1CZW A;  5C6A A;  5ELE A;  4QB4 A;  4RGT A;  1VCI A;  3A7A B;  1ENC A;  4N9P A;  3T4A C;  1EOT A;  1EWH A;  5C4J B;  4G7Z C;  3HRZ C;  2O2L D;  5JVG 3;  2SEB D;  1F9P A;  4E6Z A;  2E2D C;  2K32 A;  3MFY A;  2XIW A;  5JVH 3;  1LTG D;  2SNS A;  3OWF A;  4KKS A;  4IFD J;  1ESF A;  5EBC A;  2MPM A;  3NK9 A;  1PFN A;  2EYM A;  2KA7 A;  4PMW A;  2K04 A;  3I8Z A;  1UAP A;  1A2U A;  1PZI D;  1JC7 A;  3AU7 A;  3K7A B;  1T5E A;  3A55 A;  1STN A;  1G2S A;  4K14 A;  1S5C D;  3P1Y A;  3V2T A;  3GTK B;  2RA4 A;  3VYT A;  4DAV A;  3RZD B;  2AQ3 B;  2L1B A;  4FF2 A;  4K5V A;  4F8M A;  4KI0 A;  4IQZ A;  3GO5 A;  4IUN A;  1JB3 A;  1HXY D;  1OXX K;  3ERO A;  2BE5 D;  4CJ2 C;  4NDX A;  1C48 A;  2JA5 B;  4BWG B;  4RA8 A;  1UUP A;  4TQU S;  1HQM C;  1CZG A;  4A3E B;  2LY7 A;  1BBX C;  3QO2 A;  1EY4 A;  4OO1 G;  3OMC A;  2EY2 A;  3H91 A;  3LWE A;  3D4D A;  4XYQ A;  3M4Y A;  2GW6 A;  3N52 A;  2V4D A;  3EJI A;  1JIC A;  4B08 A;  2R61 A;  4PMC A;  2KCN A;  5ISR A;  3OIQ A;  1KDC A;  2KVM A;  3I70 A;  1CA6 A;  4QCL A;  2PZU A;  2F3W A;  1LTS D;  3WOF A;  2IPK D;  1PTO B;  3H94 A;  4R9W A;  2BCO A;  1G29 1;  1G2T A;  4C2M B;  1JR0 D;  5G3L D;  2HCI A;  1ENF A;  1JQY D;  4KY7 A;  1SAP A;  4KD3 A;  5LL6 S;  2ZYZ B;  4DXF A;  3CHB D;  2F0I A;  3GTO B;  1Y8P B;  1TS5 A;  1FNU A;  3A8I E;  1K8M A;  3KLS X;  3OHX C;  2L11 A;  2WP8 J;  4XXE A;  1I4H A;  1R0V A;  4LK1 C;  3SEB A;  1E2Z A;  2D2C C;  3URY A;  1H9R A;  4A3G B;  2NYZ D;  4XYO A;  1MD2 D;  5IGE A;  3K0Y A;  3PUZ A;  5C0X I;  1STY A;  2L0C A;  1A15 A;  5JEA H;  3HOU B;  1QB5 D;  4A93 B;  5A2Q E;  1EFI D;  3K59 A;  3G7L A;  3MVV A;  2X6L A;  4FYD A;  4A3M B;  2JA6 B;  3BVZ A;  4RHR A;  2JE6 I;  5I6W A;  2VS1 A;  1L0Y B;  3FOV A;  5FO8 B;  3ND8 A;  3X3M A;  1SNO A;  4OO1 I;  2JA8 B;  1EQT A;  3PO2 B;  4G4K A;  3NQI A;  2EJG C;  3RD4 A;  3E0J A;  1EY0 A;  5KIX A;  3OWE B;  1BUV T;  2K33 A;  1SSO A;  1EYC A;  1RKN A;  1ET6 A;  1STA A;  4OL7 A;  2A73 B;  3KK7 A;  2L5T A;  1JWM D;  1WTR A;  3GQB A;  1TWG B;  2F0L A;  3NBH A;  4RWS C;  1H9M A;  2Y0S B;  2ZXR A;  3HOV B;  1STE A;  3TN2 A;  4KJO A;  4O1N A;  1WTP A;  1J9O A;  4BA2 I;  2KJX A;  3D4R A;  2F0K A;  4N9T A;  2IL8 A;  5FKA C;  4X3K A;  3BDC A;  2F3V A;  4UAI A;  1VDZ A;  1HFN A;  5I4D A;  1GJX A;  1DM0 B;  4QIW B;  3FEW X;  5DEH A;  1MI2 A;  1QJO A;  2NBF A;  1CQF A;  1RTO A;  3L7Z C;  1EY6 A;  2SOB A;  2VB3 X;  2K1B A;  1KTK A;  1PTO H;  2JYO A;  3QOL A;  3TBI B;  3M7G A;  2VXW A;  2Z4I A;  1GUS A;  2J7Z A;  5CBE E;  2OST A;  2EY1 A;  1BQQ T;  3Q24 A;  1B2T A;  1X32 A;  2TMP A;  5COY A;  1A79 A;  2F0T A;  2IXS A;  1QG7 A;  5KNB A;  1SDF A;  5IOC A;  4NMZ A;  1Q8I A;  3PUW A;  1UEA B;  2EY6 A;  2J0T D;  3VR3 A;  2Q8I B;  4PQX A;  1WVL A;  2E74 C;  1Q12 A;  4YIJ A;  3TP5 A;  3VYR A;  2JJQ A;  1ILQ A;  2ICI A;  1NCV A;  1G91 A;  3U9O A;  5ELD A;  3VR2 A;  3AJV A;  4QBN A;  4TRD A;  4DA2 A;  1ZYR D;  3IFD A;  3D31 A;  4L63 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...