4DAVA

The structure of pyrococcus furiosus sfsa in complex with dna
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
231
structure length
231
Chain Sequence
AMKLMEVSPLFPCIFLRRVNRFVGLVRIKERIERALITNTGRLNEFMIPGRIGYCTPKAGGKTRYILLGFEDHGKIAIIDTRLQGKAFEKIIEKELLPELEGCRIIKREPRVGESRLDYLIECSKGEIFVETKSAVLREGEYAMYPDCPSVRGQRHIKELIKLARDGKRAMIVFIGALPNVSKFKPYKKGDPKIAELLKEALEAGVEIRALGLHMELSGEIIYRGELGVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of SfsA and its DNA complex; A DNA/RNA nuclease with a novel domain combination
rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase/dna
molecule keywords Sugar fermentation stimulation protein homolog
total genus 63
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03749 SfsA Sugar fermentation stimulation protein RE domain
A PF17746 SfsA_N SfsA N-terminal OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.580 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4davA01
3.40.1350.60 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 4davA02
4DAVA 4DA2A 4DAPA
chains in the Genus database with same CATH superfamily
4L5TA 3TS2A 1GKHA 4OELB 2DUDA 4UAIA 1KXLA 2EJFC 2R92G 3J81i 1U4LA 4BY7B 1XTDA 3T4AC 1Y88A 3S1RB 2R93H 3N52A 5GQOA 1GUTA 4C3JG 4DUYQ 2Z6KA 2UXDL 2G9HD 4XTCS 4DF7A 1V43A 4P75A 1IL8A 4F7XA 4IPDA 3KLSX 4B08A 3A55A 1X55A 3HOZH 1RTNA 3ER0A 3O13A 2KCTA 4LQEA 4DR4Q 4DXGA 3T1HQ 4L63B 4RMFA 2VL6A 3OOCA 1CK1A 1Q1BA 1XMOL 4RHRA 4C3HH 2B3GA 4O42A 4DV6Q 1CKMA 4KHZA 2OKFA 3HOUH 1J5EL 2WCWA 3UDXA 4RWSC 2BA1A 3RMHA 1EEFD 1C8CA 1Z47A 4IO9A 3M4OH 3CW2C 1ET9A 2E74C 4AIMA 1VQAA 2DY8A 4DK0A 2WAQG 3CCJA 2EIFA 2CVRA 2Z6BA 3GV6A 1F2MA 2K28A 3GTJH 5DAUA 4HEDA 4JI8Q 2PZUA 2UU9Q 5FOBB 5FLMH 2QKIC 3GTMH 4H44C 5IGBA 3STBC 4DV3Q 3PO3G 1LABA 4A3GB 2VS1A 1LO5D 5IGEA 4C3IB 1B2TA 4A3GG 1EYCA 1SMYD 2AWOA 2UXDQ 3I72A 2G5DA 2ZJQA 1XMOQ 4IFDH 4HMIA 3H91A 3ZYYX 4Q5VA 5AFWA 4V190 1HH2P 2SOBA 1UAPA 5LMUQ 4K5VA 1PTOH 1O7ZA 2YTYA 3TQYA 4DN4M 1EIFA 1STNA 4DR4L 5LMNL 1EZ8A 5M3FH 1RKNA 1OXVA 1SNDA 1SMXA 4R4TA 1VMPA 3R8BA 1HTLD 2NVXB 1WTXA 2WB1E 1ZYRC 2J4XA 5J3BA 5I2YA 3A8JE 3C1EA 3I4OA 3Q8DA 4CKBA 1LACA 2ZM6Q 2A6HC 2SEBD 2BCOA 1X65A 5M3FG 1KHIA 2VY3A 3T13A 4JI4Q 3U9OA 4IUPA 2ZJRA 3UDFA 3J80E 1XYIA 5COYA 3K8AA 2NZHA 4DFAA 3K58A 1K83H 1XMQL 4XQJA 4BBSG 3EJIA 1JE4A 4CJ2C 4CDDC 5C4XH 4A3JB 1NY4A 1WVLA 2E2HH 3I4MH 3PO2B 4A3DH 4IFDI 3CXCA 4A3IG 2O2LD 4K8IA 2PQAA 2DNCA 5E3FA 1WCMH 4A3KH 3S1RH 3HOVB 2R93B 5ELEA 3CF5A 2GA4B 1ZYRD 1VQJA 2F0KA 4A3IH 3E3XA 2VQFL 1JCKB 3H94A 2V4DA 2FCOA 1JB7A 3T53B 4B3MQ 2INBA 1GO3E 1LTTD 4JI6L 3SVMA 4JI3L 2EYOA 2ZYZA 5I6YA 1VQHA 4TRDA 1HNZQ 3SK4A 4DV7L 1NNXA 2WIWA 2PI2A 2JA6B 1R4PB 3C3LA 1EY0A 1SYGA 1B1ZA 1VQ9A 1CM9A 2JQOA 3S16H 4KJNA 4GZYC 3QOLA 2R92H 3HFZB 1D7QA 3HOXH 3FDTA 2CH4A 4IALA 1R9TH 2OSTA 2M9VA 2F4IA 4BS9A 3KFUA 1MSGA 3MEFA 2WACA 2ASBA 1B9MA 2F0DA 4YIJA 2EVBA 1WYDA 2B63H 3MXPA 1JC7A 1BVSA 2WIZA 5H1SE 3CCRA 1S4ZA 4BY1G 1SYFA 3S14B 2ATWA 5CBAE 4WFN3 2UUBQ 2IW3A 1P8LA 1HA5A 2HUGA 1EFID 2Q8IB 3GV3A 1PTOB 1I4HA 5FO8B 1H9SB 4I65A 2HHHQ 1QVGA 2BA0A 5JEAH 4DR5Q 2A68D 3PUXA 4NKLA 5CC4A 4QGUA 4R8NA 1PYSB 4DK6C 4LAAA 4ME3A 2HT1A 1H9KA 1PH3A 4MN3A 4AQYL 4JBKA 3DM1A 4BXXG 2IT1A 4PZ7A 3SXHA 2VB3X 1HR0Q 2IX1A 1PH2A 2NWGA 2KCMA 4JBJA 2XWBB 3GTLB 2B2VC 4DR3L 4BA2I 3J7AF 3TSSA 4X64Q 2L55A 1Q7YC 2EYHA 2MO0A 1PZID 4C3JH 1YVCA 1U9RA 4HTHA 1M90C 2E2IB 5J22A 1BCPC 1VQCA 2RSOA 1EWHA 1E7ZA 1O80A 2R61A 2Y0SG 2GVBA 2ENBA 4J8QA 1ONLA 4NPSA 4CJ0B 1YNJC 1CQFA 3E5SA 2H5XA 1K73C 1B9NA 1AE3A 1TS2A 1L1OB 1IPIA 2JA7B 1VQ7A 3DHQA 2A68C 1VQOA 5IGGA 3X3MA 5M3MG 3GTOH 2KJXA 2HIXA 1ILQA 1QUQA 3OWEB 4DR2Q 1VCIA 1H9RA 2YU9H 3OTOQ 1H9JA 5HURA 1JJGA 4QIWB 3GO5A 1MJEA 3AJVA 1T5EA 4HMJA 3KJOA 1C48A 1MHWC 4FXGC 1Q3LA 1D6EC 4A3BB 1YZ6A 4A3JG 3S16B 2IXSA 1N34Q 1VQ8A 3K7AH 5I2XA 2F0LA 1CA5A 5M3MH 1SNPA 4QY7A 1A3TA 5FJ8H 5G3LF 1WD1A 4JI3Q 2RVLA 3PIPA 2VQEQ 5IT9E 3S1QB 2ZXRA 2EZVA 1L1OC 5C6AA 5D65A 2X6LA 4R4QA 1CKOA 4FF3A 1NTGA 1GD7A 1Y8PB 2KOLA 3RR5A 5IP7H 4C3HB 2ID0A 2HCCA 1ZEQX 2M2LA 1YJ9A 1IBKQ 3P1YA 3K81C 1LUZA 2CH4W 4POFA 3PIP3 4HSPA 4QL5A 2UUCQ 3V2TA 1G6PA 3G6JB 1TXYA 5BR8Q 2F3VA 1M8AA 1JJ2A 3VR6A 1ASZA 1BOSA 4B3TQ 4QF4A 2KQ3A 3QJYA 4KD4A 3NTHA 4KMUC 3OWFA 2JA8H 1EZ6A 5EBDA 4ZLTF 1ESRA 3J7AV 4R4OA 2NBFA 4BWGB 1SXTA 4J6HA 5J39A 1WTVA 3UDGA 4ZAIA 5GAHC 5D3DA 2WFWA 1LTSD 2TSSA 3BZKA 4OIKA 2R6GA 2E2JH 4DV0L 4WJ3M 1A79A 3KF8B 1OB8A 4LF4L 3L9AX 1MGSA 1FL0A 1NUCA 4YY3Q 1QG7A 5C0XG 4IURA 2ZM6L 2F4VQ 1CFMA 5FO7B 3WWVA 5EKKA 3GTQB 1UEAB 3S15B 4KHPQ 4PV1C 3OW7A 3R3OA 3RZOH 1LT3D 1PRTF 1U4MA 3MXUA 5HY6A 5M5XB 4DR2L 4A3EG 2J7ZA 3NSWA 1YNJD 2NTTA 4MIUA 1YHQA 4K14A 3S9WA 3M85A 4AYBB 2F0OA 3S17H 4G7OC 3HRZC 3TMEA 2GN5A 1BCPB 1VF7A 1JOQA 4OIJA 4A76A 1EQVA 3M7NA 1IBML 1F9PA 5E4WC 5FKAC 1RIPA 1TWFB 2A69C 2B8GA 3W5OA 2K1BA 3NXWA 3DMUA 2MFIA 3R2IA 3JAML 2MJ8A 2BH2A 2E2HB 4K2LA 1PYWD 1S72A 4JYAQ 3QWNA 4GOPC 1RHPA 4N9TA 3K0XA 4KHPL 1F2LA 1CKNB 4ABNA 2CV8A 5IYCG 1LT6D 3EIVA 1IHZA 3HOVH 3PIOA 2LXKA 4ODGA 2HHHL 1J8IA 2A69D 2Q2IA 1IKLA 5HGTA 4WORA 2PQAB 3RLNA 3CCSA 1VQEA 4JI0L 1C4QA 2EQSA 2NTSA 5KNBA 3P1ZA 1UE1A 4ZQUA 2OT2A 4ALPA 3KUPA 3I4NG 4RCOA 1Y1VH 2RHSB 1PFSA 5C44G 1LTGD 3I90A 4X64L 1XPRA 4CDEC 2NN6H 1UE5A 3K5NA 4K5WA 3WOEA 1ICFB 4ZCKA 3BZCA 5TSSA 4TVAB 1B44D 4DV5Q 1XPUA 2RQXA 5BN5A 3S2HH 2X69A 3E9IA 3T16A 3VA7A 2AKWB 4A3BG 3A8KE 5IWAL 1D8LA 2EYMA 2UUBL 3HOXB 3BS1A 3HS0C 4PNYA 2AQ1B 1OO9B 4HAEA 3H15A 2OTLA 5CV6A 3KLSA 4DR6L 4JI1L 4JI2L 1ASYA 4KTAA 3LWUA 1BQQT 2K6AA 1S5BD 2K33A 1B50A 4ZKCB 2Q2TA 5JJLA 4HJAA 3NQTA 4X65L 2EYPA 3PUZA 1EYAA 4RFBA 4G4KA 5IGDA 1CTMA 3DEOA 3KOJA 3QIAA 4OONA 4DKAC 1RCVD 3MXNB 4MNOA 3I56A 4KK7A 1ILPA 3S15H 4EV1A 3IF0X 1CZWA 4M1UB 1KLUD 2F0JA 3MXGA 3D4RA 2FMCA 3CU7A 3CC4A 1SR3A 1EU3A 1I94L 2B2WA 2C9OA 1G291 4A3MB 4LF8L 4HJ9A 1GUSA 3K80C 3MEHA 1QZHA 1SNOA 4OWTB 4J1MA 1DYQA 1VQBA 4IUUA 4CGYB 1STBA 4PG3A 5DNFA 3SGIA 2Q2UA 1B53A 3T1YL 5JJKA 4KD3A 4NW2A 2XRSD 5C4JH 2F0GA 4MHEA 1QNUA 2NN6G 4Y52H 1GUNA 3H6MA 3I4MG 3J81c 4OHJA 2K5NA 1H95A 3VDYA 5IOCA 3HOYH 3H0GG 1D5MC 1HJPA 1R4QB 2SNMA 1PFBA 4LUZA 3S1NH 3DUZA 3FMCA 4P2CB 1X3EA 5J1ZA 1B3AA 3F2CA 4JI0Q 1GUWA 4HSVA 2I5MX 1TWHH 3F8TA 1MSHA 4WJ4A 3CHBD 4B9WA 3MZ5A 5LMUL 1GVPA 3I3CA 2H4OA 2CW0D 2NVQH 2I5HA 3NEMA 2RHQB 2CKZB 5IYDG 5C5MA 1Q81C 5JJIA 5EPKA 1N34L 3P7JA 4DAYA 2D62A 1STAA 1JE5A 3FP9A 4R4IA 4LFCL 1OTCA 2YYZA 3FKIH 1UE7A 5IY0A 5FLMG 4LF9Q 4QJFA 2PNRC 3SE0A 2WB1G 4GOPB 1SFOH 2RCNA 4TQUS 5AJ3Q 2KEEA 2Z4IA 2G9DA 2IX3A 3CC7A 1SYDA 1A3UA 5CV5A 1KNEA 3JC66 3TBIB 4PZ6A 1PH6A 2Z4HA 3HOWG 4Y7NB 4DV0Q 2N55A 2WINB 2JJQA 1PA6A 1W3SA 1VQIA 5E4XA 1LTID 3K7AB 2R3ZA 1SE8A 1YBYA 3I2ZA 1JR0D 4IPGA 1XJVA 3S1MH 4X3TA 1F1ZA 5A35A 2VNUD 3SK5A 1EFWA 5C3EH 4H13C 2YTXA 5LL6X 1GHKA 4EQNA 2F0SA 5L37A 2CHBD 3BYTB 3MFGA 2KVMA 3D3RA 4R4CA 1NMFA 3I73A 1EY8A 2XVSA 2CQOA 3T1HL 4C1NK 2V1CC 1DD2A 2K75A 4NXML 1AFPA 1G2TA 4QUFA 1UNSA 1NCVA 3AB9A 4ZRZA 4YCWA 4YCUA 2IX0A 5FLXc 2K52A 3K7UC 1I50B 4CBVA 4F87A 4HIKA 2R93G 4LNQA 2K5QA 4HIMA 1G8ZD 5ELCA 4DAPA 5M5YB 1AP0A 1K0RA 2QILA 3SHLA 3BT7A 4A3MH 2JSOA 3A74A 4GLAC 1LTRD 3ND8A 3KDFA 1XPOA 2VB2X 1GM5A 3CCMA 4DNTB 1K8AC 2FKCA 1PRTD 1ENAA 3CAMA 1F2ZA 3FOVA 3I4LA 3LNNA 4DAYB 1ML0D 1YHAA 3LWEA 2F52A 1TWCH 4QBLA 3R2TA 3GTQH 2ICIA 1KIXA 1IBMQ 1JB3A 2TMPA 4CJ1B 1P16A 2BH8A 4U68A 1CKNA 4RGMA 5K36G 4ZUIA 4A93H 2Z9HA 1G2SA 3U58A 1QILA 4OWWB 2I0QA 4LF5L 3L0OA 1HPCA 1V1QA 2PNHA 2N3SA 2B8FA 4B9XA 1K3BC 1TS5A 5FO9B 5FK9C 1HFNA 1EIHA 1MIUA 4KHVA 5C3WA 1O7YA 2B2VA 1A2TA 1TWFH 2KHJA 1I6HH 4CDFC 4L6TB 1G51A 3R93A 1EWIA 3Q22A 4DR1L 3GTKB 4JI4L 1SYCA 3DEPA 1GEFA 3KYHC 1RLVA 2HCIA 3C1FA 1TWAB 3W3AA 2GW6A 2R7DA 1K0SA 2DY7A 1G91A 2WAQB 2ZXOA 4BY1H 3E0EA 4O2DA 4LF8Q 3RUZA 2GVAA 2F0WA 4KV6A 1IYJB 1IW7C 1V1PA 3NELA 4LF5Q 1QB5D 3BJUA 1RF2D 5C3EG 1DJRD 5IP9H 3K5OA 3CQZH 3AFPA 5IIFA 3DM3A 5IT9c 4FXKC 2E8GA 4BBSH 1TKWB 1TR5A 4DV4L 3U4VA 1KABA 2QGQA 2WKCA 4DV1Q 1D5ZC 1D5XC 4DGZA 1N9WA 1KRTA 5KNDA 2B39A 2VZAA 1QWYA 1QNKA 4IOCA 2UXCQ 4BXXH 3G6EA 3NHHA 5EBCA 5EJWA 5K5PA 5DLQE 4QCLA 1SE2A 1DGSA 2Z0RA 1X54A 4O1NA 5ELOA 1PZKD 1TWGH 1SYEA 4BBRB 4LK1C 4BBRG 3EFXD 2E2DC 3TZDA 2VLDA 1XWEA 3A56A 3NK9A 4YWKA 4S3SA 3IL8A 5G3LD 3U4ZA 2NVYB 3AFQA 2IPKD 3M9BA 3S24A 3GTGH 3AU7A 4DR6Q 4UP7A 2DN8A 4XQNA 1KDCA 2JYOA 3OMGA 1PZJD 1IXRA 4QB4A 4DAMA 4X3SA 1AZPA 1T9HA 5C44H 3J81j 1EY9A 4LFCQ 2L12A 4FF1A 3J7ZC 1E2WA 3I4NH 4BY7H 1J9OA 1TIID 2M00A 4YHHQ 1MBYA 2QCPX 3RLFA 3W1BA 3IAYA 2ZJPA 5ELNA 1NE3A 3IFDA 1XMQQ 1HR0W 4FYDA 3L3OC 5BN3A 2ZYZB 1M1KC 2F0PA 4A3DG 5ELDA 3MWYW 4DNRB 2ZTCA 3PSIA 2X6GA 4C3HG 3KBGA 3G71A 4WJWA 4X3KA 3RZDH 4MTKA 1EQTA 3GTKH 3D8GA 3RD4A 4ZKBB 2L1BA 2Q2HA 4C2MB 3HOYB 4K6LA 1E1TA 3H0GB 2LFNA 2XWJB 1HUNA 2A19A 2VQFQ 4HIOA 1VMCA 1UE6A 3TEHB 2UU9L 2Q8RE 4X66Q 3A5UA 1D2BA 2UXBL 4JW0A 3LGJA 4DR7L 2DGYA 3M4OB 4NXMQ 2PI2E 1E0BA 4DXFA 1DOLA 2KCCA 1A2UA 1E22A 1T0FA 1NAPA 4B3SL 2NVQB 3DNXA 1UUPA 4PMBA 4UP9A 3JAMc 3GTJB 2F0UA 3CQZB 3VYRA 5M5WH 4X65Q 4MZ9A 3I7FA 2K01A 4ULLA 4DV1L 5IYBG 2FL3A 4IFDG 4G6UA 1PH5A 3PO3B 1C7YA 1Y1VG 1JMCA 4DV3L 1CA6A 4A3GH 1V1PB 4DV7Q 1E3PA 2EO0A 2MQHA 4LJZC 4NB3A 3Q6SA 4GNXB 1SN8A 1TVXA 3EQLC 2UXCL 4RKBA 3UDIA 2PMZE 5CV4A 2EJMA 2LY7A 1K3RA 3FPPA 4DR3Q 4MTNA 3SR1A 1Q8KA 4LFBL 3BDLA 1Q82C 2E76C 1CQVA 4UPAA 4JOIC 2Y0SB 1K8GA 4OO1H 1HNXQ 3PGZA 5C4HA 1KRSA 4XYQA 4HJ7A 3CCVA 2WV6D 3BG3A 1DOKA 2EY1A 4CKEA 1BBWA 1RTOA 2BDNA 5C4XB 5EAYA 4TSSA 4A3DB 2EY6A 2IY5B 4L8JA 5E1FA 2MPMA 1A62A 2F0HA 3KLRA 1N32L 3EVQA 2CZRA 2F1MA 1STGA 2K50A 2F0TA 3GTPB 4A3KB 1Z6HA 5T1GA 2FHTA 3I8ZA 4K5XA 3EN2A 3GQBA 1PTOF 1R0VA 2NYZD 4DV6L 1JWSD 1HCZA 4GLVB 4QBNA 1GXDC 5DEHA 4YY3L 1FVIA 1WCMG 2PZWA 4KKSA 3P75A 5M5YH 4GN5A 1D1KA 4P74A 4FF4A 4JI2Q 1I4RA 5BN4A 3STBD 4IJLA 3U50C 3KJPA 3G48A 3MA2B 3J81L 1YNNC 1Q90A 1R11A 2BOSA 2K4KA 1FD7D 1QCBD 4A3FG 3PF4A 1G6ZA 2BE5C 3J80c 4IUNA 2FMMA 1PTOC 1BUVT 4DV2Q 3RZDB 3KBXA 2KENA 4DK1A 1TWCB 2LKVA 3SEBA 3HKSA 4RGNA 1N32Q 2PQEA 3G4SA 3PF5A 1IYUA 5EGTA 5JPNC 5KYLA 3PUWA 1K8OA 1Q86C 2K32A 2JP1A 1S5ED 4X66L 3DXJC 1CSPA 1KNAA 4JI6Q 3IFTA 1IKMA 3B6YA 1PVOA 3AMUA 2RDHA 3VA5A 1VQ6A 3GD7A 3EBEA 2K5VA 1TT2A 4O0AA 1IZ6A 1Z9FA 5CGKA 5IP9G 1FNWA 2R92B 2ZT9C 2XSCA 3M4YA 1Y69U 2EJGC 3CP0A 1CZGA 3HOUB 1L0XB 3K5MA 1LT4D 1VQFA 1GUGA 2Q8TA 3HOZB 4DAVA 3CD6A 4LWCA 3PMFA 3A7AB 3VYUA 1B70B 1CUKA 2VXWA 2I46A 1EEID 1MKHA 3J7A5 4B3SQ 4G57A 3S14H 5CBEE 1SJED 1RL2A 4FXDA 5F2DA 1STEA 1K28A 1CI3M 2CWAA 1AE2A 3HOWH 2LSSA 1OB9A 3GTMB 1LT5D 4RA8A 2SNSA 4H02A 4X6AH 5JAVA 3BYYB 3VR2A 4JI1Q 3UE0A 4PQXA 3CRKC 3H3VH 5D3IB 1MD2D 2C35B 4GS3A 3FVQA 4RCNA 2R7ZG 3M3YB 1BXTA 3NBHA 1SAPA 4BBSB 4UY8C 5IODA 1T5XD 4PZ8A 1U4PA 3V05A 4C3IH 4X62L 1WD0A 1Q12A 1X3FA 5M3FB 5DM63 4XXEA 3K57A 3UI2A 1OXUA 4KI0A 1YJNA 4HCEA 1EY7A 4QQBX 3J81E 3GTLH 1XTCD 1QOHA 1AEXA 1EYGA 1JT8A 4YWLA 3K0YA 4JYAL 1QE6A 4FP5D 4LFAL 2A6EC 3D6CA 3BVGA 5NUCA 1I4PA 1O7IA 1HZAA 2RBMA 5CYUA 4GN3B 2Y0SE 1I3QH 3X3NA 2VUMB 4KJOA 4G7ZC 1PH4A 1Q8IA 1K83B 4AH6A 2F0QA 5KEEA 1Y1WB 1ENCA 4FO2A 2FXQA 3TP7A 1N8RC 3PO2H 5A2QL 1VQNA 5KGUA 4GKJL 1PFNA 3HOXG 2YU9B 5CV7A 2FLCA 2O5JC 4QMGA 3TP5A 4XT3B 4HJ8A 1S40A 3GTGB 3CCQA 3F1ZA 1ET6A 4NXNQ 1ICWA 4P72A 5IWAQ 4ID6A 1XNQL 4NP5A 4KY5A 1A63A 4A3JH 3NWTA 1S5FD 3RNUA 3NPPA 4A3LG 1O7LA 5C44B 2EPBA 2OQKA 4RH6A 3ICEA 3NUCA 3IKJA 2KBNA 3BDOA 3I4NB 2YV5A 3DWQA 4JVZA 1H9SA 2PZTA 4K6DA 4KN7C 2A8VA 2DJFC 4I7ZC 2D0OA 2JK8A 3EROA 1JWMD 2AQ3B 1MI2A 2N8NA 2VUMG 3KLWA 1I4QA 3EA6A 1KD1C 2B29A 1X3PA 1HUMA 1EWCA 3I70A 2JA6H 5JEAG 3PIO3 2EDGA 1LYLA 2QDBA 4NXNL 3OW2A 3A54A 5CORA 4ZQ3A 1L0WA 1O78A 2RDGA 3H0GH 4FVMA 2DBSA 1B4OA 1Y8OB 3P1HA 4DR1Q 1H9MA 3HOWB 2MNAA 2XN9C 5EPJA 2JA5G 1PV4A 1Y8NB 1PHJA 4X62Q 3BU2A 1VF5C 2B63B 3NENA 4OX9Q 2L5TA 5LMNW 3P1ZB 1LTAD 1WTPA 4KLKA 4OGQC 5I9OA 2E2JB 4TKOB 2B63G 1X56A 2OCEA 1VDZA 3M3YH 3MVVA 1EU4A 2IJ0A 4NDXA 5EPLA 2JA8B 4A3EB 3E6ZX 4TKKA 1S3OA 3ZJYC 3IEYA 2NUCA 4HN7A 4H0LC 5KIXA 1AH9A 5JVG3 2ICEC 4DR7Q 3TDQA 1CSQA 1CHQD 4DV2L 4IOAA 3RLOA 3VR3A 3RZOB 4GNXC 5KNCA 2KEDA 4EGVA 3HKZG 1D1IA 1L1OA 2WIIB 4JCVE 4RKLA 3T51B 3TZUA 3ULJA 3L2PA 2AUKA 4IUTA 3TS0A 5M5XH 2XGTA 1QUQB 3BZDB 3HKZB 3NE5B 4LF7L 2QEXA 1A3VA 1QVCA 1PDQA 2MUYA 2HQEA 4R9WA 2MHVA 5LHY1 4ZK9B 1C0AA 1F9RA 1LLRD 2K5DA 1KC8C 2L4NA 2EXDA 2E5LQ 5ISRA 4LF6Q 1FGUA 1I3QB 1V1OA 4EQ5A 5FLXL 1Y1WH 1FR3A 1IBKL 2PYKA 2JA9A 3FHWA 1PH1A 3RN2A 1VQDA 1SEBD 2Z1CA 2Z0SA 5IE8A 2K05A 4QBOA 3HG9A 2A6HD 2VQEL 3D4DA 2QW7A 1I94Q 2RSNA 4DUZL 3CRLC 1E2VA 2JA6G 4DK3C 1JJCB 4FDBA 2NZ1D 2QEJC 1EY4A 4RGOS 2A5HA 4A3CG 4TKDA 2B2YC 5I4DA 4OO1I 1XXGA 2WP8J 1A0IA 2Z8LA 2OF1A 4C56C 3A0JA 4RAUC 3Q23A 4JV5L 5I6WA 3DWAA 2PW5A 5C0XH 5DM73 2AQ2B 4ZUJA 3KF8A 4B3TL 3GTOB 1XNRL 3FRPB 3K5LA 1EIYB 1BF4A 3JAMi 1VQMA 3URYA 4P71A 2CW0C 2DNEA 2B2WC 4AYBE 4DNIA 1YEZA 2A1AA 2AUJD 2F0MA 3NWSA 1HZ9A 4A3BH 1EY5A 3L7ZC 1ZP7A 2JA7H 3D0FA 1KAWA 1Y1VB 2RCFA 1YI2A 1PH7A 4CKCA 5C3XA 4L5RC 4JBWA 4M8AA 2JN4A 2JA5H 5M3MB 4A3KG 2RA4A 3PO2G 1DCZA 1JWUD 5CV9A 1PFMA 4CDCC 1SNMA 2F4VL 4KKUA 1F9QA 2JXMB 4U673 3S2HB 4K0KQ 5IGFA 2NVTB 1NR2A 5C0XI 1SSOA 1RODA 5KRUA 1FNUA 1GHJA 1ZXTA 5CMDA 4LF9L 4A3EH 3ND9A 3LX0A 1NJIC 3D6WA 1TS3A 3S1QH 4GOPA 3VYTA 1WI5A 3C46A 1J6QA 2HD3A 4JV5Q 1A8VA 4JI7L 4DA2A 1YNXA 4UHVA 1PRTB 3J80L 4IUVA 1XX8A 4XDXA 1SLJA 5E7NA 2SDFA 2EYLA 1JICA 5FLXE 1QZGA 1IYVA 2F3IA 2UUCL 2UUAQ 3M4PA 1U5KA 1K9MC 1TY2A 4EQOA 1DM0B 5AJ3L 1NR4A 5C4ZA 3PCOB 1I5FA 1SE3A 3E9HA 3NTKA 1BDOA 4FNFA 5IYCH 2HIVA 3H09A 1J5EQ 1BCPD 4OXPA 4HJ5A 2XRQD 2EY2A 1W6JA 3FPUB 3C2PA 2PCFB 4V0BA 1Q46A 4BY7G 3A8IE 2EYFA 4LUVA 1PXUA 2CCZA 3PUVA 3NBHB 4R8IA 4DR5L 3AEVA 4N8X1 1X3GA 1PRTC 3DLLA 1BNZA 4IPCA 3T1YQ 3N6RA 3JAME 5ELBA 2FKHB 1TWHB 4A3FB 3HKZE 1SDFA 3W1GA 4AQYQ 4P73A 4XIGS 4OX9L 4H7BA 1BO0A 3QOJA 4KN4C 1IBLL 1V8QA 2RF4A 1WTQA 2UUAL 5IP7G 3HP3A 5JJZA 2ZXPA 3HEJA 3S1NB 1PH9A 2VUMH 1UEBA 2N88A 2P5ZX 1Z7TA 4G6VA 3FEWX 1ZKOA 3MTSA 4N9PA 3FKIB 2F3WA 1VQKA 5ELFA 1SNCA 1YJWA 2YTVA 1KDAA 3QR8A 4FF2A 2NZOA 2B2UA 3RN5A 3S17B 3MXNA 3Q24A 5GAGC 1HZBA 2WKDA 3NTIA 2R7ZH 2EXZA 1GOZA 4L5QA 2DJGC 3FKIG 4JBMA 2NN6I 4XYOA 4Y7NH 3S2DH 2B2TC 3CCLA 3QO2A 2UXBQ 1FJGQ 3F2BA 2R7FA 1IBLQ 2PMZB 2OTJA 1PMRA 1VQ4A 5A2QE 5C3EB 3NP8A 4A3CH 2WJ0A 2HDMA 4IZ8A 2D2CC 2NVTH 1ESFA 4EVOA 1TQOA 3P20A 4JC0A 2I5LX 3S1MB 3SDZA 4HIDA 1BBUA 3IEYB 1RJTA 5GADC 1KTKA 4GLXA 1AZQA 1EL0A 2F0NA 2ES2A 4LF6L 4JPBW 2K14A 4DUZQ 2LMCB 5JEAJ 1YIJA 3PQIA 5JOBA 4JI5Q 2IWHA 1DONA 1HHVA 4A3MG 4DU9A 2K5HA 5IYDH 3QB3A 4LFAQ 4APVA 1AW7A 2CQAA 5EKIA 3SK6A 4IUQA 3H3VC 3T56B 3OYYA 1I4GA 1Y14B 4LMQD 3KF6A 5GROA 4GKJQ 3DWPA 4JI7Q 1NMGA 2JA7G 2QDLA 2A74C 1W6KA 2H1EA 2KHIA 3IRBA 2LS01 4OL7A 1KAAA 3UE1A 4LUOA 2J0TD 4HR7B 1SRUA 4KY6A 3W2DA 4YWMA 1HNXL 1VQ5A 1MJCA 2AWNA 2AHOB 1EOTA 2XTIA 3KK7A 2OXPA 2KUMA 4A93B 1XNQQ 3CPFA 2ALYB 2A73B 3PV0A 4F8MA 1RD9D 2I07B 2AMCB 4IN3A 1EYDA 1WJJA 2ZTEA 4A3FH 1TY0A 1KLGD 1RDPD 3MAQA 1X3QA 3OPOA 1U4RA 5I9PA 1STYA 1HFGA 1FNVA 2MGSA 1B7YB 1S5CD 3VYSA 1OXTA 4B3ML 1YNND 1EQRA 1SBBB 1FYCA 1WTHA 3ULLA 3WOFA 1JQYD 1BBXC 1WOCA 4JK1C 1HQMC 3NBIA 2L9HA 3HZXA 4HCSA 1S5DD 1BR9A 3I91A 1HNWL 5JVH3 4JI8L 1X9NA 2R7ZB 2HDLA 2N49A 5EQ0A 3F2DA 1XNRQ 4IPHA 2KHSA 2OWOA 1I6HB 5C4JB 3HOYG 1HZCA 1N33Q 4LFBQ 4PMCA 1JOKA 4NMZA 4UDUC 1C9OA 3MC0B 2EYJA 2RDFA 1M4VA 3TRZA 3J7YW 4XT1B 2EE1A 4OO1G 4YCVA 1FGBD 1HXYD 1N36Q 1GUOA 3ERSX 3MFYA 2VW9A 1PH8A 1NBWA 4WRDA 3BDCA 5GAEC 4BY1B 1YITA 1HH1A 2PW7A 2B2YA 4CHTB 4DPGA 4GNXA 4ILWA 1KDBA 1E24A 1PTOD 2A6ED 1IW7D 1HNWQ 2QA4A 3OHXC 2RKSA 2EOTA 1Y1OA 4N8FA 3GP7A 2WB1B 4RG1A 3CCUA 4GKKL 1HRJA 1I4XA 2CFMA 2F0VA 5HGQA 1LTLA 2L11A 5IYBH 2JA5B 4F88A 1EUJA 2KA7A 1SFOB 5BR8L 1UWVA 5IGCA 1LM0A 2Z6KC 1U0LA 2NVXH 2E75C 3AJVB 2CWPA 2XNAC 3U9SA 3F2UA 1HTPA 2JEAI 3G7LA 3OTOL 1JORA 3SK8A 1SMYC 1OXSC 1SROA 3H3VI 4LW1A 1SYBA 2MP1A 1X32A 1PLFA 4KKTA 5D14A 4POGA 4I7AA 1DXMA 4OEMB 4BBRH 1JOOA 1SNQA 1SJHD 4GN4B 5JPMC 1I50H 3OMCA 2K03A 1YHBA 4LF4Q 2D9UA 3I4MB 2JA8G 4Q0FA 4RGTA 1EOVA 2OQ0A 1EY6A 4GKKQ 2W8MA 4C1NI 2NVYH 1WCMB 3HOVG 4KY7A 1NSNS 2BDOA 1WTWA 5EKLA 1HR0L 4E6ZA 1B8AA 2OEOA 3CMEA 1IL2A 4L5SA 4JOIA 1XMXA 3AQQA 2K04A 1F77A 4K2KA 3MHBA 4A3IB 4DV4Q 3ERQA 1OXXK 1WFQA 1EQQA 3M4QA 1A6XA 4ZYSA 2HQLA 5C0XJ 1RZNA 1L0YB 2D5DA 1LV9A 3CCEA 1E2ZA 4Z9CB 1II3A 2O5IC 4B3RQ 1Y1WG 5C4XG 3OSOA 3D31A 2XIWA 4EQPA 4PMWA 2GJWA 2WAQE 2C5CA 1N33L 4JI5L 3TREA 1SE4A 2JE6I 3TN2A 1KQSA 5IT9L 3BVZA 5C5LA 5CR3A 5KYIA 4JG2A 1L2FA 4C2MH 2BE5D 2JEBI 5FJ8G 1BKBA 4IQZA 1VQGA 5M5WB 2FJ2A 1R9TB 3QG1A 1VQPA 2F0IA 3HGBA 4QUCA 1TU2B 2IHEA 1TS4A 1BCPF 1WTRA 2L15A 4DV5L 4B3RL 1B3QA 3V96A 3ITPA 2ZTDA 3BVMA 4C3IG 2D0PA 1TWAH 4A4IA 1CHPD 3VR4A 3WDNA 4DUYL 3CC2A 2E5LL 1E1OA 4A75A 4IJHA 3CKIB 4EX5A 3S2DB 3VR5A 1STHA 3PO3H 4IFDJ 4RHSA 4A93G 1F2YA 4OWXB 4YHHL 3K6OA 1VS0A 4E6IA 2KECA 1ENFA 2FFKB 1CT1D 3ONAB 1HQRD 2KCNA 4UP8A 3J80i 3D4WA 3I55A 1DOMA 2FINB 1X6OA 1GJXA 1HNZL 3KF6B 3K59A 1QJOA 3HOZG 1KL9A 3OIPA 3PUYA 4J15A 3KDFB 1FJGL 3GTPH 3HOUG 1K8MA 1LTBD 1V9PA 1Q1EA 4BA1I 3TP6A 4K8JA 2F03A 2MO1A 1VQLA 1A15A 2IL8A 5T1IA 2F0EA 5CV8A 4G7HC 5FDKA 1I6VC 2B2UC 4LF7Q 1EIGA 2NB0A 2IHFA 3CMAA 2LXJA 2B2TA 2F0FA 1QVFA 4C3JB 5LMNQ 4A3LH 3CPWA 4X3UA 3E0JA 3TP8A 4K0KL 1W2BA 2K7VA 2PPBC 2PO4A 4AYBG 3M7GA 1N36L 3NQIA 2E2IH 2O4XA 2WCZA 3A5ZB 1F9SA 3A7LA 3OIQA 5LL6S 5M9OA 1PYBA 3Q0AA 1HA6A 4XQQA 1WTOA 4QIWE 1YNMA 1TWGB 3AYHB 4R1JA 1DZ1A 4ME5A 2N78A 5K36H 1AN8A 2K5WA 2EY5A 3ULPA 3GDEA 2L0CA 2QF7A
chains in the Genus database with same CATH topology
4UAIA 2EJFC 1U4LA 4BY7B 3T4AC 1Y88A 3S1RB 3N52A 1GUTA 4C3JG 2G9HD 4XTCS 4DF7A 1V43A 1IL8A 4F7XA 3KLSX 4B08A 3A55A 1RTNA 3O13A 4LQEA 4DXGA 4L63B 3OOCA 1CK1A 1Q1BA 4RHRA 4O42A 4KHZA 2OKFA 2WCWA 4RWSC 2BA1A 3RMHA 1EEFD 1C8CA 1Z47A 1ET9A 2E74C 2DY8A 4DK0A 2CVRA 3GV6A 1F2MA 2K28A 5DAUA 4HEDA 2PZUA 5FOBB 2QKIC 4H44C 5IGBA 1LABA 4A3GB 2VS1A 1LO5D 5IGEA 4C3IB 1B2TA 1EYCA 1SMYD 2AWOA 3I72A 4IFDH 4HMIA 3H91A 3ZYYX 4Q5VA 5AFWA 4V190 2SOBA 1UAPA 4K5VA 1PTOH 1O7ZA 4DN4M 1STNA 1EZ8A 1RKNA 1SNDA 1VMPA 3R8BA 1HTLD 2NVXB 1WTXA 1ZYRC 2J4XA 5I2YA 3A8JE 3C1EA 4CKBA 1LACA 2A6HC 2SEBD 2BCOA 3T13A 3U9OA 4IUPA 3J80E 1XYIA 5COYA 4DFAA 3K58A 4XQJA 3EJIA 1JE4A 4CJ2C 4A3JB 1WVLA 4IFDI 3PO2B 2O2LD 4K8IA 2DNCA 5E3FA 2R93B 3HOVB 5ELEA 2GA4B 1ZYRD 2F0KA 1JCKB 3H94A 2V4DA 2FCOA 3T53B 2INBA 1LTTD 3SVMA 2EYOA 2ZYZA 5I6YA 4TRDA 3SK4A 2WIWA 2JA6B 1R4PB 3C3LA 1EY0A 1SYGA 1B1ZA 1CM9A 4KJNA 4GZYC 3QOLA 3FDTA 4IALA 2OSTA 2M9VA 2F4IA 4BS9A 1MSGA 2WACA 1B9MA 2F0DA 4YIJA 2EVBA 3MXPA 1JC7A 2WIZA 1S4ZA 1SYFA 3S14B 5CBAE 4WFN3 2IW3A 1HA5A 2HUGA 1EFID 2Q8IB 3GV3A 1PTOB 1I4HA 5FO8B 1H9SB 4I65A 2BA0A 5JEAH 2A68D 3PUXA 4NKLA 5CC4A 4R8NA 4LAAA 1H9KA 4MN3A 3DM1A 2IT1A 3SXHA 2VB3X 2IX1A 2NWGA 2XWBB 3GTLB 2B2VC 4BA2I 3J7AF 3TSSA 2L55A 2EYHA 1PZID 1U9RA 4HTHA 2E2IB 5J22A 1BCPC 2RSOA 1EWHA 1O80A 2R61A 2ENBA 4J8QA 1ONLA 4CJ0B 1YNJC 1CQFA 3E5SA 1B9NA 1TS2A 1IPIA 2JA7B 3DHQA 2A68C 5IGGA 3X3MA 2KJXA 1ILQA 3OWEB 1VCIA 1H9RA 1H9JA 5HURA 4QIWB 3GO5A 3AJVA 1T5EA 4HMJA 1C48A 4FXGC 1Q3LA 1D6EC 4A3BB 3S16B 2IXSA 5I2XA 2F0LA 1CA5A 1SNPA 1A3TA 5G3LF 1WD1A 2RVLA 5IT9E 3S1QB 2ZXRA 2EZVA 5C6AA 5D65A 2X6LA 4FF3A 1Y8PB 2KOLA 4C3HB 2ID0A 2HCCA 1ZEQX 2M2LA 3P1YA 3PIP3 4HSPA 3V2TA 3G6JB 2F3VA 1M8AA 3VR6A 1BOSA 4QF4A 2KQ3A 3QJYA 4KD4A 3NTHA 4KMUC 3OWFA 1EZ6A 5EBDA 4ZLTF 1ESRA 3J7AV 2NBFA 4BWGB 1SXTA 4J6HA 5J39A 1WTVA 4ZAIA 5D3DA 1LTSD 2TSSA 4OIKA 2R6GA 1A79A 1OB8A 3L9AX 1MGSA 1NUCA 1QG7A 5C0XG 4IURA 1CFMA 5FO7B 5EKKA 3GTQB 1UEAB 3S15B 4PV1C 3OW7A 3R3OA 1LT3D 1PRTF 1U4MA 3MXUA 5M5XB 2J7ZA 3NSWA 1YNJD 2NTTA 4MIUA 4K14A 3S9WA 3M85A 4AYBB 2F0OA 4G7OC 3HRZC 3TMEA 1BCPB 1VF7A 1JOQA 4OIJA 3M7NA 1EQVA 1F9PA 5E4WC 5FKAC 1TWFB 2A69C 2B8GA 2K1BA 3NXWA 3DMUA 2BH2A 3R2IA 3JAML 2MJ8A 2E2HB 4K2LA 1PYWD 3QWNA 1RHPA 4N9TA 1F2LA 4ABNA 2CV8A 1LT6D 1IHZA 4ODGA 1J8IA 2A69D 1IKLA 5HGTA 4WORA 1C4QA 2NTSA 5KNBA 3P1ZA 4ZQUA 2OT2A 3KUPA 4RCOA 1LTGD 3I90A 2NN6H 3K5NA 4K5WA 3WOEA 5TSSA 1B44D 2RQXA 5BN5A 2X69A 3T16A 3VA7A 3A8KE 2EYMA 3HOXB 3BS1A 3HS0C 4PNYA 2AQ1B 1OO9B 4HAEA 5CV6A 3KLSA 4KTAA 3LWUA 1BQQT 2K6AA 1S5BD 2K33A 1B50A 4ZKCB 3NQTA 2EYPA 3PUZA 1EYAA 4RFBA 4G4KA 5IGDA 1CTMA 3DEOA 3QIAA 1RCVD 4KK7A 1ILPA 4EV1A 3IF0X 1CZWA 4M1UB 1KLUD 2F0JA 3MXGA 3D4RA 2FMCA 3CU7A 1EU3A 2B2WA 2C9OA 1G291 4A3MB 1GUSA 3MEHA 1SNOA 4J1MA 1DYQA 4CGYB 4IUUA 1STBA 5DNFA 1B53A 4KD3A 4NW2A 2XRSD 2F0GA 4MHEA 1QNUA 2NN6G 1GUNA 3H6MA 4OHJA 5IOCA 1D5MC 1R4QB 2SNMA 1PFBA 3DUZA 3FMCA 4P2CB 5J1ZA 1B3AA 1GUWA 4HSVA 1MSHA 3CHBD 4B9WA 3MZ5A 3I3CA 2H4OA 2CW0D 5C5MA 5EPKA 3P7JA 4DAYA 2D62A 1STAA 2YYZA 2PNRC 3SE0A 4TQUS 2KEEA 2Z4IA 2G9DA 2IX3A 1SYDA 1A3UA 5CV5A 1KNEA 3TBIB 2Z4HA 4Y7NB 2N55A 2WINB 2JJQA 5E4XA 1LTID 3K7AB 2R3ZA 1JR0D 4X3TA 1F1ZA 5A35A 2VNUD 3SK5A 4H13C 5LL6X 1GHKA 4EQNA 2F0SA 2CHBD 3BYTB 3MFGA 2KVMA 3D3RA 3I73A 1EY8A 2XVSA 4C1NK 1DD2A 1AFPA 1G2TA 4QUFA 1UNSA 1NCVA 3AB9A 4ZRZA 2IX0A 1I50B 4CBVA 4F87A 2K5QA 1G8ZD 5ELCA 4DAPA 5M5YB 1AP0A 2QILA 3SHLA 3BT7A 2JSOA 1LTRD 3ND8A 2VB2X 4DNTB 2FKCA 1PRTD 1ENAA 1F2ZA 3FOVA 3I4LA 3LNNA 1ML0D 3LWEA 4QBLA 3R2TA 2ICIA 1JB3A 2TMPA 4CJ1B 4U68A 4RGMA 5K36G 4ZUIA 1G2SA 1QILA 1HPCA 2B8FA 4B9XA 1TS5A 5FO9B 5FK9C 1HFNA 1EIHA 4KHVA 5C3WA 1O7YA 2B2VA 1A2TA 4L6TB 3R93A 3Q22A 3GTKB 1SYCA 3DEPA 1GEFA 1RLVA 2HCIA 3C1FA 1TWAB 3W3AA 2GW6A 2DY7A 1G91A 2WAQB 2ZXOA 3RUZA 2F0WA 4KV6A 1V1PA 1IW7C 1QB5D 1RF2D 1DJRD 3K5OA 5IIFA 4FXKC 1TKWB 1TR5A 1KABA 2WKCA 1D5ZC 1D5XC 4DGZA 5KNDA 2B39A 1QWYA 1QNKA 3NHHA 5EBCA 5EJWA 5K5PA 4QCLA 1SE2A 2Z0RA 4O1NA 1PZKD 1SYEA 4BBRB 4LK1C 3EFXD 2E2DC 3TZDA 2VLDA 1XWEA 3A56A 3NK9A 4S3SA 3IL8A 5G3LD 2NVYB 2IPKD 3AU7A 2DN8A 4XQNA 1KDCA 2JYOA 3OMGA 1PZJD 4QB4A 4X3SA 1AZPA 1EY9A 2L12A 4FF1A 1E2WA 1J9OA 1TIID 2M00A 1MBYA 2QCPX 3RLFA 3IAYA 3IFDA 4FYDA 3L3OC 5BN3A 2ZYZB 2F0PA 5ELDA 3MWYW 4DNRB 2X6GA 4C3HG 3KBGA 4WJWA 4X3KA 1EQTA 3D8GA 3RD4A 4ZKBB 2L1BA 4C2MB 3HOYB 4K6LA 3H0GB 2LFNA 2XWJB 1HUNA 1VMCA 2Q8RE 1D2BA 3M4OB 1E0BA 4DXFA 1DOLA 2KCCA 1A2UA 1T0FA 1NAPA 2NVQB 3DNXA 1UUPA 4PMBA 3GTJB 2F0UA 3CQZB 3VYRA 2K01A 4ULLA 2FL3A 4IFDG 4G6UA 3PO3B 1CA6A 1V1PB 2EO0A 4LJZC 3Q6SA 1TVXA 3EQLC 4RKBA 5CV4A 2EJMA 2LY7A 3FPPA 3SR1A 3BDLA 2E76C 1CQVA 2Y0SB 4OO1H 5C4HA 4XYQA 2WV6D 3BG3A 1DOKA 2EY1A 4CKEA 1RTOA 2BDNA 5C4XB 4TSSA 4A3DB 2EY6A 4L8JA 5E1FA 2MPMA 2F0HA 3KLRA 3EVQA 2CZRA 2F1MA 1STGA 2F0TA 3GTPB 4A3KB 1Z6HA 5T1GA 2FHTA 3I8ZA 4K5XA 3GQBA 1PTOF 1R0VA 2NYZD 1JWSD 1HCZA 4QBNA 1GXDC 5DEHA 2PZWA 4KKSA 3P75A 1D1KA 4FF4A 1I4RA 5BN4A 3MA2B 3J81L 1YNNC 1Q90A 1R11A 2BOSA 1FD7D 1QCBD 1G6ZA 2BE5C 4IUNA 2FMMA 1PTOC 1BUVT 3RZDB 3KBXA 4DK1A 1TWCB 2LKVA 3SEBA 4RGNA 2PQEA 1IYUA 5EGTA 5JPNC 5KYLA 3PUWA 1K8OA 2K32A 2JP1A 1S5ED 3DXJC 1KNAA 3IFTA 1IKMA 3AMUA 2RDHA 3VA5A 3GD7A 1TT2A 5CGKA 1FNWA 2R92B 2ZT9C 2XSCA 3M4YA 1Y69U 2EJGC 3HOUB 1CZGA 1L0XB 3K5MA 1LT4D 1GUGA 2Q8TA 3HOZB 4DAVA 3PMFA 3A7AB 3VYUA 2VXWA 2I46A 1EEID 4FXDA 4G57A 5CBEE 1SJED 5F2DA 1STEA 1CI3M 1OB9A 3GTMB 1LT5D 4RA8A 2SNSA 5JAVA 3BYYB 3VR2A 4PQXA 3CRKC 5D3IB 1MD2D 4RCNA 3FVQA 3M3YB 1BXTA 3NBHA 1SAPA 4BBSB 5IODA 1T5XD 1U4PA 3V05A 1WD0A 1Q12A 5M3FB 5DM63 4XXEA 3K57A 3UI2A 1OXUA 4KI0A 4HCEA 1EY7A 3J81E 1XTCD 1QOHA 1AEXA 3K0YA 1QE6A 4FP5D 2A6EC 3D6CA 3BVGA 5NUCA 1I4PA 2RBMA 5CYUA 3X3NA 2VUMB 4KJOA 4G7ZC 1Q8IA 1K83B 2F0QA 5KEEA 1Y1WB 1ENCA 4FO2A 3TP7A 5A2QL 5KGUA 1PFNA 2YU9B 5CV7A 2FLCA 2O5JC 4QMGA 3TP5A 4XT3B 3GTGB 1ET6A 1ICWA 4ID6A 4NP5A 4KY5A 3NWTA 1S5FD 3NPPA 1O7LA 5C44B 2EPBA 4RH6A 3NUCA 3IKJA 3I4NB 3BDOA 3DWQA 1H9SA 2PZTA 4K6DA 4KN7C 4I7ZC 3EROA 1JWMD 2AQ3B 1MI2A 1I4QA 3EA6A 1X3PA 1HUMA 1EWCA 3I70A 5JEAG 3PIO3 2EDGA 2QDBA 3A54A 5CORA 4ZQ3A 1O78A 2RDGA 4FVMA 2DBSA 1B4OA 1Y8OB 3P1HA 1H9MA 3HOWB 2XN9C 5EPJA 1Y8NB 1VF5C 2B63B 2L5TA 3P1ZB 1LTAD 1WTPA 4OGQC 5I9OA 2E2JB 4TKOB 1VDZA 3MVVA 1EU4A 2IJ0A 4NDXA 5EPLA 2JA8B 4A3EB 3E6ZX 4TKKA 3IEYA 2NUCA 4HN7A 4H0LC 5KIXA 5JVG3 2ICEC 3TDQA 1CHQD 3VR3A 3RZOB 5KNCA 2KEDA 4EGVA 1D1IA 2WIIB 4RKLA 3T51B 3TZUA 2AUKA 4IUTA 3BZDB 3HKZB 3NE5B 1A3VA 1PDQA 2MUYA 2HQEA 4R9WA 2MHVA 5LHY1 4ZK9B 1F9RA 1LLRD 2K5DA 2L4NA 5ISRA 1I3QB 1V1OA 5FLXL 1FR3A 2PYKA 2Z1CA 1SEBD 2K05A 4QBOA 3HG9A 2A6HD 3D4DA 2RSNA 3CRLC 1E2VA 2NZ1D 2QEJC 1EY4A 4RGOS 2A5HA 4TKDA 2B2YC 5I4DA 4OO1I 1XXGA 2WP8J 2Z8LA 2OF1A 4C56C 3Q23A 4RAUC 5I6WA 3DWAA 2PW5A 5C0XH 5DM73 2AQ2B 4ZUJA 3KF8A 3GTOB 3FRPB 3K5LA 1BF4A 3URYA 2CW0C 2DNEA 2B2WC 2AUJD 2F0MA 3NWSA 1EY5A 3L7ZC 1ZP7A 1Y1VB 4CKCA 5C3XA 4JBWA 4M8AA 5M3MB 2RA4A 1DCZA 1JWUD 5CV9A 1PFMA 1SNMA 4KKUA 1F9QA 2JXMB 4U673 3S2HB 5IGFA 2NVTB 1NR2A 5C0XI 1SSOA 1RODA 5KRUA 1FNUA 1GHJA 1ZXTA 5CMDA 3ND9A 3LX0A 3D6WA 1TS3A 3VYTA 3C46A 4DA2A 1PRTB 3J80L 4IUVA 1XX8A 4XDXA 2SDFA 2EYLA 1JICA 5FLXE 1IYVA 1TY2A 4EQOA 1DM0B 1NR4A 5C4ZA 1SE3A 3NTKA 1BDOA 4FNFA 3H09A 1BCPD 2XRQD 2EY2A 1W6JA 3FPUB 3C2PA 2PCFB 4V0BA 3A8IE 2EYFA 1PXUA 3PUVA 4R8IA 1PRTC 1BNZA 3N6RA 3JAME 5ELBA 2FKHB 1TWHB 4A3FB 1SDFA 4XIGS 4H7BA 1BO0A 3QOJA 4KN4C 1V8QA 1WTQA 3HP3A 5JJZA 2ZXPA 3HEJA 3S1NB 2N88A 1Z7TA 4G6VA 3FEWX 1ZKOA 3MTSA 4N9PA 3FKIB 2F3WA 5ELFA 1SNCA 4FF2A 1KDAA 3S17B 2B2UA 3MXNA 3Q24A 2WKDA 3NTIA 2EXZA 1GOZA 2NN6I 4XYOA 2B2TC 3QO2A 2PMZB 1PMRA 5A2QE 5C3EB 3NP8A 2WJ0A 2HDMA 4IZ8A 2D2CC 1ESFA 4EVOA 1TQOA 3P20A 3S1MB 3SDZA 3IEYB 1RJTA 1KTKA 1AZQA 1EL0A 2F0NA 2LMCB 5JEAJ 5JOBA 2IWHA 1DONA 1HHVA 4DU9A 3QB3A 1AW7A 2CQAA 5EKIA 3SK6A 4IUQA 3H3VC 3T56B 1I4GA 4LMQD 3DWPA 2A74C 1W6KA 2H1EA 2LS01 4OL7A 1KAAA 2J0TD 4HR7B 4KY6A 3W2DA 2AWNA 1EOTA 3KK7A 2OXPA 2KUMA 4A93B 2A73B 3PV0A 4F8MA 1RD9D 2I07B 4IN3A 1EYDA 1TY0A 1KLGD 1RDPD 3MAQA 1X3QA 3OPOA 1U4RA 5I9PA 1STYA 1HFGA 1FNVA 2MGSA 1S5CD 3VYSA 1OXTA 1YNND 1SBBB 1FYCA 3WOFA 1JQYD 1BBXC 4JK1C 1HQMC 3NBIA 2L9HA 3HZXA 4HCSA 1S5DD 1BR9A 3I91A 5JVH3 2R7ZB 2HDLA 5EQ0A 2KHSA 1I6HB 5C4JB 4PMCA 1JOKA 4NMZA 4UDUC 3MC0B 2EYJA 2RDFA 1M4VA 3J7YW 4XT1B 2EE1A 4OO1G 1FGBD 1HXYD 1GUOA 3MFYA 4WRDA 3BDCA 4BY1B 1HH1A 2PW7A 2B2YA 4CHTB 4ILWA 1KDBA 2A6ED 1PTOD 1IW7D 3OHXC 2RKSA 2EOTA 1Y1OA 3GP7A 2WB1B 1HRJA 1I4XA 2F0VA 2L11A 2JA5B 4F88A 2KA7A 1SFOB 1UWVA 5IGCA 2E75C 3AJVB 2XNAC 3U9SA 3F2UA 1HTPA 2JEAI 3G7LA 1JORA 3SK8A 1SMYC 1OXSC 1SYBA 2MP1A 1X32A 1PLFA 4KKTA 5D14A 1DXMA 1JOOA 1SNQA 1SJHD 5JPMC 3OMCA 2K03A 2D9UA 3I4MB 4Q0FA 4RGTA 1EY6A 2W8MA 4C1NI 1WCMB 4KY7A 1NSNS 2BDOA 1WTWA 5EKLA 4E6ZA 2OEOA 1XMXA 2K04A 1F77A 4A3IB 3MHBA 4K2KA 3ERQA 1OXXK 1A6XA 4ZYSA 5C0XJ 1RZNA 1L0YB 2D5DA 1LV9A 1E2ZA 4Z9CB 1II3A 2O5IC 3OSOA 3D31A 2XIWA 4EQPA 4PMWA 2GJWA 2C5CA 1SE4A 2JE6I 3TN2A 5IT9L 3BVZA 5C5LA 5CR3A 5KYIA 2BE5D 2JEBI 4IQZA 5M5WB 2FJ2A 1R9TB 3QG1A 2F0IA 3HGBA 4QUCA 1TU2B 1TS4A 1BCPF 1WTRA 3V96A 3ITPA 3BVMA 4C3IG 1CHPD 3VR4A 3WDNA 3CKIB 3S2DB 3VR5A 1STHA 4IFDJ 4RHSA 1F2YA 3K6OA 4E6IA 2KECA 1ENFA 2FFKB 1CT1D 3ONAB 1HQRD 2KCNA 3D4WA 1DOMA 2FINB 1GJXA 3K59A 1QJOA 3OIPA 3PUYA 1K8MA 1LTBD 1Q1EA 4BA1I 3TP6A 4K8JA 2F03A 1A15A 2IL8A 5T1IA 2F0EA 5CV8A 4G7HC 5FDKA 1I6VC 2B2UC 1EIGA 2NB0A 2B2TA 2F0FA 4C3JB 4X3UA 3E0JA 3TP8A 2K7VA 2PPBC 2PO4A 3M7GA 3NQIA 2O4XA 2WCZA 1F9SA 3A7LA 3OIQA 5LL6S 5M9OA 3Q0AA 1HA6A 4XQQA 1WTOA 1YNMA 1TWGB 1DZ1A 4ME5A 5K36H 1AN8A 2K5WA 2EY5A 1OXVA 2L0CA 2QF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DAV A;  4DA2 A;  4DAP A; 
#chains in the Genus database with same CATH topology
 4L5T A;  3TS2 A;  1GKH A;  4OEL B;  2DUD A;  4UAI A;  1KXL A;  2EJF C;  2R92 G;  3J81 i;  1U4L A;  4BY7 B;  1XTD A;  3T4A C;  1Y88 A;  3S1R B;  2R93 H;  3N52 A;  5GQO A;  1GUT A;  4C3J G;  4DUY Q;  2Z6K A;  2UXD L;  2G9H D;  4XTC S;  4DF7 A;  1V43 A;  4P75 A;  1IL8 A;  4F7X A;  4IPD A;  3KLS X;  4B08 A;  3A55 A;  1X55 A;  3HOZ H;  1RTN A;  3ER0 A;  3O13 A;  2KCT A;  4LQE A;  4DR4 Q;  4DXG A;  3T1H Q;  4L63 B;  4RMF A;  2VL6 A;  3OOC A;  1CK1 A;  1Q1B A;  1XMO L;  4RHR A;  4C3H H;  2B3G A;  4O42 A;  4DV6 Q;  1CKM A;  4KHZ A;  2OKF A;  3HOU H;  1J5E L;  2WCW A;  3UDX A;  4RWS C;  2BA1 A;  3RMH A;  1EEF D;  1C8C A;  1Z47 A;  4IO9 A;  3M4O H;  3CW2 C;  1ET9 A;  2E74 C;  4AIM A;  1VQA A;  2DY8 A;  4DK0 A;  2WAQ G;  3CCJ A;  2EIF A;  2CVR A;  2Z6B A;  3GV6 A;  1F2M A;  2K28 A;  3GTJ H;  5DAU A;  4HED A;  4JI8 Q;  2PZU A;  2UU9 Q;  5FOB B;  5FLM H;  2QKI C;  3GTM H;  4H44 C;  5IGB A;  3STB C;  4DV3 Q;  3PO3 G;  1LAB A;  4A3G B;  2VS1 A;  1LO5 D;  5IGE A;  4C3I B;  1B2T A;  4A3G G;  1EYC A;  1SMY D;  2AWO A;  2UXD Q;  3I72 A;  2G5D A;  2ZJQ A;  1XMO Q;  4IFD H;  4HMI A;  3H91 A;  3ZYY X;  4Q5V A;  5AFW A;  4V19 0;  1HH2 P;  2SOB A;  1UAP A;  5LMU Q;  4K5V A;  1PTO H;  1O7Z A;  2YTY A;  3TQY A;  4DN4 M;  1EIF A;  1STN A;  4DR4 L;  5LMN L;  1EZ8 A;  5M3F H;  1RKN A;  1OXV A;  1SND A;  1SMX A;  4R4T A;  1VMP A;  3R8B A;  1HTL D;  2NVX B;  1WTX A;  2WB1 E;  1ZYR C;  2J4X A;  5J3B A;  5I2Y A;  3A8J E;  3C1E A;  3I4O A;  3Q8D A;  4CKB A;  1LAC A;  2ZM6 Q;  2A6H C;  2SEB D;  2BCO A;  1X65 A;  5M3F G;  1KHI A;  2VY3 A;  3T13 A;  4JI4 Q;  3U9O A;  4IUP A;  2ZJR A;  3UDF A;  3J80 E;  1XYI A;  5COY A;  3K8A A;  2NZH A;  4DFA A;  3K58 A;  1K83 H;  1XMQ L;  4XQJ A;  4BBS G;  3EJI A;  1JE4 A;  4CJ2 C;  4CDD C;  5C4X H;  4A3J B;  1NY4 A;  1WVL A;  2E2H H;  3I4M H;  3PO2 B;  4A3D H;  4IFD I;  3CXC A;  4A3I G;  2O2L D;  4K8I A;  2PQA A;  2DNC A;  5E3F A;  1WCM H;  4A3K H;  3S1R H;  3HOV B;  2R93 B;  5ELE A;  3CF5 A;  2GA4 B;  1ZYR D;  1VQJ A;  2F0K A;  4A3I H;  3E3X A;  2VQF L;  1JCK B;  3H94 A;  2V4D A;  2FCO A;  1JB7 A;  3T53 B;  4B3M Q;  2INB A;  1GO3 E;  1LTT D;  4JI6 L;  3SVM A;  4JI3 L;  2EYO A;  2ZYZ A;  5I6Y A;  1VQH A;  4TRD A;  1HNZ Q;  3SK4 A;  4DV7 L;  1NNX A;  2WIW A;  2PI2 A;  2JA6 B;  1R4P B;  3C3L A;  1EY0 A;  1SYG A;  1B1Z A;  1VQ9 A;  1CM9 A;  2JQO A;  3S16 H;  4KJN A;  4GZY C;  3QOL A;  2R92 H;  3HFZ B;  1D7Q A;  3HOX H;  3FDT A;  2CH4 A;  4IAL A;  1R9T H;  2OST A;  2M9V A;  2F4I A;  4BS9 A;  3KFU A;  1MSG A;  3MEF A;  2WAC A;  2ASB A;  1B9M A;  2F0D A;  4YIJ A;  2EVB A;  1WYD A;  2B63 H;  3MXP A;  1JC7 A;  1BVS A;  2WIZ A;  5H1S E;  3CCR A;  1S4Z A;  4BY1 G;  1SYF A;  3S14 B;  2ATW A;  5CBA E;  4WFN 3;  2UUB Q;  2IW3 A;  1P8L A;  1HA5 A;  2HUG A;  1EFI D;  2Q8I B;  3GV3 A;  1PTO B;  1I4H A;  5FO8 B;  1H9S B;  4I65 A;  2HHH Q;  1QVG A;  2BA0 A;  5JEA H;  4DR5 Q;  2A68 D;  3PUX A;  4NKL A;  5CC4 A;  4QGU A;  4R8N A;  1PYS B;  4DK6 C;  4LAA A;  4ME3 A;  2HT1 A;  1H9K A;  1PH3 A;  4MN3 A;  4AQY L;  4JBK A;  3DM1 A;  4BXX G;  2IT1 A;  4PZ7 A;  3SXH A;  2VB3 X;  1HR0 Q;  2IX1 A;  1PH2 A;  2NWG A;  2KCM A;  4JBJ A;  2XWB B;  3GTL B;  2B2V C;  4DR3 L;  4BA2 I;  3J7A F;  3TSS A;  4X64 Q;  2L55 A;  1Q7Y C;  2EYH A;  2MO0 A;  1PZI D;  4C3J H;  1YVC A;  1U9R A;  4HTH A;  1M90 C;  2E2I B;  5J22 A;  1BCP C;  1VQC A;  2RSO A;  1EWH A;  1E7Z A;  1O80 A;  2R61 A;  2Y0S G;  2GVB A;  2ENB A;  4J8Q A;  1ONL A;  4NPS A;  4CJ0 B;  1YNJ C;  1CQF A;  3E5S A;  2H5X A;  1K73 C;  1B9N A;  1AE3 A;  1TS2 A;  1L1O B;  1IPI A;  2JA7 B;  1VQ7 A;  3DHQ A;  2A68 C;  1VQO A;  5IGG A;  3X3M A;  5M3M G;  3GTO H;  2KJX A;  2HIX A;  1ILQ A;  1QUQ A;  3OWE B;  4DR2 Q;  1VCI A;  1H9R A;  2YU9 H;  3OTO Q;  1H9J A;  5HUR A;  1JJG A;  4QIW B;  3GO5 A;  1MJE A;  3AJV A;  1T5E A;  4HMJ A;  3KJO A;  1C48 A;  1MHW C;  4FXG C;  1Q3L A;  1D6E C;  4A3B B;  1YZ6 A;  4A3J G;  3S16 B;  2IXS A;  1N34 Q;  1VQ8 A;  3K7A H;  5I2X A;  2F0L A;  1CA5 A;  5M3M H;  1SNP A;  4QY7 A;  1A3T A;  5FJ8 H;  5G3L F;  1WD1 A;  4JI3 Q;  2RVL A;  3PIP A;  2VQE Q;  5IT9 E;  3S1Q B;  2ZXR A;  2EZV A;  1L1O C;  5C6A A;  5D65 A;  2X6L A;  4R4Q A;  1CKO A;  4FF3 A;  1NTG A;  1GD7 A;  1Y8P B;  2KOL A;  3RR5 A;  5IP7 H;  4C3H B;  2ID0 A;  2HCC A;  1ZEQ X;  2M2L A;  1YJ9 A;  1IBK Q;  3P1Y A;  3K81 C;  1LUZ A;  2CH4 W;  4POF A;  3PIP 3;  4HSP A;  4QL5 A;  2UUC Q;  3V2T A;  1G6P A;  3G6J B;  1TXY A;  5BR8 Q;  2F3V A;  1M8A A;  1JJ2 A;  3VR6 A;  1ASZ A;  1BOS A;  4B3T Q;  4QF4 A;  2KQ3 A;  3QJY A;  4KD4 A;  3NTH A;  4KMU C;  3OWF A;  2JA8 H;  1EZ6 A;  5EBD A;  4ZLT F;  1ESR A;  3J7A V;  4R4O A;  2NBF A;  4BWG B;  1SXT A;  4J6H A;  5J39 A;  1WTV A;  3UDG A;  4ZAI A;  5GAH C;  5D3D A;  2WFW A;  1LTS D;  2TSS A;  3BZK A;  4OIK A;  2R6G A;  2E2J H;  4DV0 L;  4WJ3 M;  1A79 A;  3KF8 B;  1OB8 A;  4LF4 L;  3L9A X;  1MGS A;  1FL0 A;  1NUC A;  4YY3 Q;  1QG7 A;  5C0X G;  4IUR A;  2ZM6 L;  2F4V Q;  1CFM A;  5FO7 B;  3WWV A;  5EKK A;  3GTQ B;  1UEA B;  3S15 B;  4KHP Q;  4PV1 C;  3OW7 A;  3R3O A;  3RZO H;  1LT3 D;  1PRT F;  1U4M A;  3MXU A;  5HY6 A;  5M5X B;  4DR2 L;  4A3E G;  2J7Z A;  3NSW A;  1YNJ D;  2NTT A;  4MIU A;  1YHQ A;  4K14 A;  3S9W A;  3M85 A;  4AYB B;  2F0O A;  3S17 H;  4G7O C;  3HRZ C;  3TME A;  2GN5 A;  1BCP B;  1VF7 A;  1JOQ A;  4OIJ A;  4A76 A;  1EQV A;  3M7N A;  1IBM L;  1F9P A;  5E4W C;  5FKA C;  1RIP A;  1TWF B;  2A69 C;  2B8G A;  3W5O A;  2K1B A;  3NXW A;  3DMU A;  2MFI A;  3R2I A;  3JAM L;  2MJ8 A;  2BH2 A;  2E2H B;  4K2L A;  1PYW D;  1S72 A;  4JYA Q;  3QWN A;  4GOP C;  1RHP A;  4N9T A;  3K0X A;  4KHP L;  1F2L A;  1CKN B;  4ABN A;  2CV8 A;  5IYC G;  1LT6 D;  3EIV A;  1IHZ A;  3HOV H;  3PIO A;  2LXK A;  4ODG A;  2HHH L;  1J8I A;  2A69 D;  2Q2I A;  1IKL A;  5HGT A;  4WOR A;  2PQA B;  3RLN A;  3CCS A;  1VQE A;  4JI0 L;  1C4Q A;  2EQS A;  2NTS A;  5KNB A;  3P1Z A;  1UE1 A;  4ZQU A;  2OT2 A;  4ALP A;  3KUP A;  3I4N G;  4RCO A;  1Y1V H;  2RHS B;  1PFS A;  5C44 G;  1LTG D;  3I90 A;  4X64 L;  1XPR A;  4CDE C;  2NN6 H;  1UE5 A;  3K5N A;  4K5W A;  3WOE A;  1ICF B;  4ZCK A;  3BZC A;  5TSS A;  4TVA B;  1B44 D;  4DV5 Q;  1XPU A;  2RQX A;  5BN5 A;  3S2H H;  2X69 A;  3E9I A;  3T16 A;  3VA7 A;  2AKW B;  4A3B G;  3A8K E;  5IWA L;  1D8L A;  2EYM A;  2UUB L;  3HOX B;  3BS1 A;  3HS0 C;  4PNY A;  2AQ1 B;  1OO9 B;  4HAE A;  3H15 A;  2OTL A;  5CV6 A;  3KLS A;  4DR6 L;  4JI1 L;  4JI2 L;  1ASY A;  4KTA A;  3LWU A;  1BQQ T;  2K6A A;  1S5B D;  2K33 A;  1B50 A;  4ZKC B;  2Q2T A;  5JJL A;  4HJA A;  3NQT A;  4X65 L;  2EYP A;  3PUZ A;  1EYA A;  4RFB A;  4G4K A;  5IGD A;  1CTM A;  3DEO A;  3KOJ A;  3QIA A;  4OON A;  4DKA C;  1RCV D;  3MXN B;  4MNO A;  3I56 A;  4KK7 A;  1ILP A;  3S15 H;  4EV1 A;  3IF0 X;  1CZW A;  4M1U B;  1KLU D;  2F0J A;  3MXG A;  3D4R A;  2FMC A;  3CU7 A;  3CC4 A;  1SR3 A;  1EU3 A;  1I94 L;  2B2W A;  2C9O A;  1G29 1;  4A3M B;  4LF8 L;  4HJ9 A;  1GUS A;  3K80 C;  3MEH A;  1QZH A;  1SNO A;  4OWT B;  4J1M A;  1DYQ A;  1VQB A;  4IUU A;  4CGY B;  1STB A;  4PG3 A;  5DNF A;  3SGI A;  2Q2U A;  1B53 A;  3T1Y L;  5JJK A;  4KD3 A;  4NW2 A;  2XRS D;  5C4J H;  2F0G A;  4MHE A;  1QNU A;  2NN6 G;  4Y52 H;  1GUN A;  3H6M A;  3I4M G;  3J81 c;  4OHJ A;  2K5N A;  1H95 A;  3VDY A;  5IOC A;  3HOY H;  3H0G G;  1D5M C;  1HJP A;  1R4Q B;  2SNM A;  1PFB A;  4LUZ A;  3S1N H;  3DUZ A;  3FMC A;  4P2C B;  1X3E A;  5J1Z A;  1B3A A;  3F2C A;  4JI0 Q;  1GUW A;  4HSV A;  2I5M X;  1TWH H;  3F8T A;  1MSH A;  4WJ4 A;  3CHB D;  4B9W A;  3MZ5 A;  5LMU L;  1GVP A;  3I3C A;  2H4O A;  2CW0 D;  2NVQ H;  2I5H A;  3NEM A;  2RHQ B;  2CKZ B;  5IYD G;  5C5M A;  1Q81 C;  5JJI A;  5EPK A;  1N34 L;  3P7J A;  4DAY A;  2D62 A;  1STA A;  1JE5 A;  3FP9 A;  4R4I A;  4LFC L;  1OTC A;  2YYZ A;  3FKI H;  1UE7 A;  5IY0 A;  5FLM G;  4LF9 Q;  4QJF A;  2PNR C;  3SE0 A;  2WB1 G;  4GOP B;  1SFO H;  2RCN A;  4TQU S;  5AJ3 Q;  2KEE A;  2Z4I A;  2G9D A;  2IX3 A;  3CC7 A;  1SYD A;  1A3U A;  5CV5 A;  1KNE A;  3JC6 6;  3TBI B;  4PZ6 A;  1PH6 A;  2Z4H A;  3HOW G;  4Y7N B;  4DV0 Q;  2N55 A;  2WIN B;  2JJQ A;  1PA6 A;  1W3S A;  1VQI A;  5E4X A;  1LTI D;  3K7A B;  2R3Z A;  1SE8 A;  1YBY A;  3I2Z A;  1JR0 D;  4IPG A;  1XJV A;  3S1M H;  4X3T A;  1F1Z A;  5A35 A;  2VNU D;  3SK5 A;  1EFW A;  5C3E H;  4H13 C;  2YTX A;  5LL6 X;  1GHK A;  4EQN A;  2F0S A;  5L37 A;  2CHB D;  3BYT B;  3MFG A;  2KVM A;  3D3R A;  4R4C A;  1NMF A;  3I73 A;  1EY8 A;  2XVS A;  2CQO A;  3T1H L;  4C1N K;  2V1C C;  1DD2 A;  2K75 A;  4NXM L;  1AFP A;  1G2T A;  4QUF A;  1UNS A;  1NCV A;  3AB9 A;  4ZRZ A;  4YCW A;  4YCU A;  2IX0 A;  5FLX c;  2K52 A;  3K7U C;  1I50 B;  4CBV A;  4F87 A;  4HIK A;  2R93 G;  4LNQ A;  2K5Q A;  4HIM A;  1G8Z D;  5ELC A;  4DAP A;  5M5Y B;  1AP0 A;  1K0R A;  2QIL A;  3SHL A;  3BT7 A;  4A3M H;  2JSO A;  3A74 A;  4GLA C;  1LTR D;  3ND8 A;  3KDF A;  1XPO A;  2VB2 X;  1GM5 A;  3CCM A;  4DNT B;  1K8A C;  2FKC A;  1PRT D;  1ENA A;  3CAM A;  1F2Z A;  3FOV A;  3I4L A;  3LNN A;  4DAY B;  1ML0 D;  1YHA A;  3LWE A;  2F52 A;  1TWC H;  4QBL A;  3R2T A;  3GTQ H;  2ICI A;  1KIX A;  1IBM Q;  1JB3 A;  2TMP A;  4CJ1 B;  1P16 A;  2BH8 A;  4U68 A;  1CKN A;  4RGM A;  5K36 G;  4ZUI A;  4A93 H;  2Z9H A;  1G2S A;  3U58 A;  1QIL A;  4OWW B;  2I0Q A;  4LF5 L;  3L0O A;  1HPC A;  1V1Q A;  2PNH A;  2N3S A;  2B8F A;  4B9X A;  1K3B C;  1TS5 A;  5FO9 B;  5FK9 C;  1HFN A;  1EIH A;  1MIU A;  4KHV A;  5C3W A;  1O7Y A;  2B2V A;  1A2T A;  1TWF H;  2KHJ A;  1I6H H;  4CDF C;  4L6T B;  1G51 A;  3R93 A;  1EWI A;  3Q22 A;  4DR1 L;  3GTK B;  4JI4 L;  1SYC A;  3DEP A;  1GEF A;  3KYH C;  1RLV A;  2HCI A;  3C1F A;  1TWA B;  3W3A A;  2GW6 A;  2R7D A;  1K0S A;  2DY7 A;  1G91 A;  2WAQ B;  2ZXO A;  4BY1 H;  3E0E A;  4O2D A;  4LF8 Q;  3RUZ A;  2GVA A;  2F0W A;  4KV6 A;  1IYJ B;  1IW7 C;  1V1P A;  3NEL A;  4LF5 Q;  1QB5 D;  3BJU A;  1RF2 D;  5C3E G;  1DJR D;  5IP9 H;  3K5O A;  3CQZ H;  3AFP A;  5IIF A;  3DM3 A;  5IT9 c;  4FXK C;  2E8G A;  4BBS H;  1TKW B;  1TR5 A;  4DV4 L;  3U4V A;  1KAB A;  2QGQ A;  2WKC A;  4DV1 Q;  1D5Z C;  1D5X C;  4DGZ A;  1N9W A;  1KRT A;  5KND A;  2B39 A;  2VZA A;  1QWY A;  1QNK A;  4IOC A;  2UXC Q;  4BXX H;  3G6E A;  3NHH A;  5EBC A;  5EJW A;  5K5P A;  5DLQ E;  4QCL A;  1SE2 A;  1DGS A;  2Z0R A;  1X54 A;  4O1N A;  5ELO A;  1PZK D;  1TWG H;  1SYE A;  4BBR B;  4LK1 C;  4BBR G;  3EFX D;  2E2D C;  3TZD A;  2VLD A;  1XWE A;  3A56 A;  3NK9 A;  4YWK A;  4S3S A;  3IL8 A;  5G3L D;  3U4Z A;  2NVY B;  3AFQ A;  2IPK D;  3M9B A;  3S24 A;  3GTG H;  3AU7 A;  4DR6 Q;  4UP7 A;  2DN8 A;  4XQN A;  1KDC A;  2JYO A;  3OMG A;  1PZJ D;  1IXR A;  4QB4 A;  4DAM A;  4X3S A;  1AZP A;  1T9H A;  5C44 H;  3J81 j;  1EY9 A;  4LFC Q;  2L12 A;  4FF1 A;  3J7Z C;  1E2W A;  3I4N H;  4BY7 H;  1J9O A;  1TII D;  2M00 A;  4YHH Q;  1MBY A;  2QCP X;  3RLF A;  3W1B A;  3IAY A;  2ZJP A;  5ELN A;  1NE3 A;  3IFD A;  1XMQ Q;  1HR0 W;  4FYD A;  3L3O C;  5BN3 A;  2ZYZ B;  1M1K C;  2F0P A;  4A3D G;  5ELD A;  3MWY W;  4DNR B;  2ZTC A;  3PSI A;  2X6G A;  4C3H G;  3KBG A;  3G71 A;  4WJW A;  4X3K A;  3RZD H;  4MTK A;  1EQT A;  3GTK H;  3D8G A;  3RD4 A;  4ZKB B;  2L1B A;  2Q2H A;  4C2M B;  3HOY B;  4K6L A;  1E1T A;  3H0G B;  2LFN A;  2XWJ B;  1HUN A;  2A19 A;  2VQF Q;  4HIO A;  1VMC A;  1UE6 A;  3TEH B;  2UU9 L;  2Q8R E;  4X66 Q;  3A5U A;  1D2B A;  2UXB L;  4JW0 A;  3LGJ A;  4DR7 L;  2DGY A;  3M4O B;  4NXM Q;  2PI2 E;  1E0B A;  4DXF A;  1DOL A;  2KCC A;  1A2U A;  1E22 A;  1T0F A;  1NAP A;  4B3S L;  2NVQ B;  3DNX A;  1UUP A;  4PMB A;  4UP9 A;  3JAM c;  3GTJ B;  2F0U A;  3CQZ B;  3VYR A;  5M5W H;  4X65 Q;  4MZ9 A;  3I7F A;  2K01 A;  4ULL A;  4DV1 L;  5IYB G;  2FL3 A;  4IFD G;  4G6U A;  1PH5 A;  3PO3 B;  1C7Y A;  1Y1V G;  1JMC A;  4DV3 L;  1CA6 A;  4A3G H;  1V1P B;  4DV7 Q;  1E3P A;  2EO0 A;  2MQH A;  4LJZ C;  4NB3 A;  3Q6S A;  4GNX B;  1SN8 A;  1TVX A;  3EQL C;  2UXC L;  4RKB A;  3UDI A;  2PMZ E;  5CV4 A;  2EJM A;  2LY7 A;  1K3R A;  3FPP A;  4DR3 Q;  4MTN A;  3SR1 A;  1Q8K A;  4LFB L;  3BDL A;  1Q82 C;  2E76 C;  1CQV A;  4UPA A;  4JOI C;  2Y0S B;  1K8G A;  4OO1 H;  1HNX Q;  3PGZ A;  5C4H A;  1KRS A;  4XYQ A;  4HJ7 A;  3CCV A;  2WV6 D;  3BG3 A;  1DOK A;  2EY1 A;  4CKE A;  1BBW A;  1RTO A;  2BDN A;  5C4X B;  5EAY A;  4TSS A;  4A3D B;  2EY6 A;  2IY5 B;  4L8J A;  5E1F A;  2MPM A;  1A62 A;  2F0H A;  3KLR A;  1N32 L;  3EVQ A;  2CZR A;  2F1M A;  1STG A;  2K50 A;  2F0T A;  3GTP B;  4A3K B;  1Z6H A;  5T1G A;  2FHT A;  3I8Z A;  4K5X A;  3EN2 A;  3GQB A;  1PTO F;  1R0V A;  2NYZ D;  4DV6 L;  1JWS D;  1HCZ A;  4GLV B;  4QBN A;  1GXD C;  5DEH A;  4YY3 L;  1FVI A;  1WCM G;  2PZW A;  4KKS A;  3P75 A;  5M5Y H;  4GN5 A;  1D1K A;  4P74 A;  4FF4 A;  4JI2 Q;  1I4R A;  5BN4 A;  3STB D;  4IJL A;  3U50 C;  3KJP A;  3G48 A;  3MA2 B;  3J81 L;  1YNN C;  1Q90 A;  1R11 A;  2BOS A;  2K4K A;  1FD7 D;  1QCB D;  4A3F G;  3PF4 A;  1G6Z A;  2BE5 C;  3J80 c;  4IUN A;  2FMM A;  1PTO C;  1BUV T;  4DV2 Q;  3RZD B;  3KBX A;  2KEN A;  4DK1 A;  1TWC B;  2LKV A;  3SEB A;  3HKS A;  4RGN A;  1N32 Q;  2PQE A;  3G4S A;  3PF5 A;  1IYU A;  5EGT A;  5JPN C;  5KYL A;  3PUW A;  1K8O A;  1Q86 C;  2K32 A;  2JP1 A;  1S5E D;  4X66 L;  3DXJ C;  1CSP A;  1KNA A;  4JI6 Q;  3IFT A;  1IKM A;  3B6Y A;  1PVO A;  3AMU A;  2RDH A;  3VA5 A;  1VQ6 A;  3GD7 A;  3EBE A;  2K5V A;  1TT2 A;  4O0A A;  1IZ6 A;  1Z9F A;  5CGK A;  5IP9 G;  1FNW A;  2R92 B;  2ZT9 C;  2XSC A;  3M4Y A;  1Y69 U;  2EJG C;  3CP0 A;  1CZG A;  3HOU B;  1L0X B;  3K5M A;  1LT4 D;  1VQF A;  1GUG A;  2Q8T A;  3HOZ B;  4DAV A;  3CD6 A;  4LWC A;  3PMF A;  3A7A B;  3VYU A;  1B70 B;  1CUK A;  2VXW A;  2I46 A;  1EEI D;  1MKH A;  3J7A 5;  4B3S Q;  4G57 A;  3S14 H;  5CBE E;  1SJE D;  1RL2 A;  4FXD A;  5F2D A;  1STE A;  1K28 A;  1CI3 M;  2CWA A;  1AE2 A;  3HOW H;  2LSS A;  1OB9 A;  3GTM B;  1LT5 D;  4RA8 A;  2SNS A;  4H02 A;  4X6A H;  5JAV A;  3BYY B;  3VR2 A;  4JI1 Q;  3UE0 A;  4PQX A;  3CRK C;  3H3V H;  5D3I B;  1MD2 D;  2C35 B;  4GS3 A;  3FVQ A;  4RCN A;  2R7Z G;  3M3Y B;  1BXT A;  3NBH A;  1SAP A;  4BBS B;  4UY8 C;  5IOD A;  1T5X D;  4PZ8 A;  1U4P A;  3V05 A;  4C3I H;  4X62 L;  1WD0 A;  1Q12 A;  1X3F A;  5M3F B;  5DM6 3;  4XXE A;  3K57 A;  3UI2 A;  1OXU A;  4KI0 A;  1YJN A;  4HCE A;  1EY7 A;  4QQB X;  3J81 E;  3GTL H;  1XTC D;  1QOH A;  1AEX A;  1EYG A;  1JT8 A;  4YWL A;  3K0Y A;  4JYA L;  1QE6 A;  4FP5 D;  4LFA L;  2A6E C;  3D6C A;  3BVG A;  5NUC A;  1I4P A;  1O7I A;  1HZA A;  2RBM A;  5CYU A;  4GN3 B;  2Y0S E;  1I3Q H;  3X3N A;  2VUM B;  4KJO A;  4G7Z C;  1PH4 A;  1Q8I A;  1K83 B;  4AH6 A;  2F0Q A;  5KEE A;  1Y1W B;  1ENC A;  4FO2 A;  2FXQ A;  3TP7 A;  1N8R C;  3PO2 H;  5A2Q L;  1VQN A;  5KGU A;  4GKJ L;  1PFN A;  3HOX G;  2YU9 B;  5CV7 A;  2FLC A;  2O5J C;  4QMG A;  3TP5 A;  4XT3 B;  4HJ8 A;  1S40 A;  3GTG B;  3CCQ A;  3F1Z A;  1ET6 A;  4NXN Q;  1ICW A;  4P72 A;  5IWA Q;  4ID6 A;  1XNQ L;  4NP5 A;  4KY5 A;  1A63 A;  4A3J H;  3NWT A;  1S5F D;  3RNU A;  3NPP A;  4A3L G;  1O7L A;  5C44 B;  2EPB A;  2OQK A;  4RH6 A;  3ICE A;  3NUC A;  3IKJ A;  2KBN A;  3BDO A;  3I4N B;  2YV5 A;  3DWQ A;  4JVZ A;  1H9S A;  2PZT A;  4K6D A;  4KN7 C;  2A8V A;  2DJF C;  4I7Z C;  2D0O A;  2JK8 A;  3ERO A;  1JWM D;  2AQ3 B;  1MI2 A;  2N8N A;  2VUM G;  3KLW A;  1I4Q A;  3EA6 A;  1KD1 C;  2B29 A;  1X3P A;  1HUM A;  1EWC A;  3I70 A;  2JA6 H;  5JEA G;  3PIO 3;  2EDG A;  1LYL A;  2QDB A;  4NXN L;  3OW2 A;  3A54 A;  5COR A;  4ZQ3 A;  1L0W A;  1O78 A;  2RDG A;  3H0G H;  4FVM A;  2DBS A;  1B4O A;  1Y8O B;  3P1H A;  4DR1 Q;  1H9M A;  3HOW B;  2MNA A;  2XN9 C;  5EPJ A;  2JA5 G;  1PV4 A;  1Y8N B;  1PHJ A;  4X62 Q;  3BU2 A;  1VF5 C;  2B63 B;  3NEN A;  4OX9 Q;  2L5T A;  5LMN W;  3P1Z B;  1LTA D;  1WTP A;  4KLK A;  4OGQ C;  5I9O A;  2E2J B;  4TKO B;  2B63 G;  1X56 A;  2OCE A;  1VDZ A;  3M3Y H;  3MVV A;  1EU4 A;  2IJ0 A;  4NDX A;  5EPL A;  2JA8 B;  4A3E B;  3E6Z X;  4TKK A;  1S3O A;  3ZJY C;  3IEY A;  2NUC A;  4HN7 A;  4H0L C;  5KIX A;  1AH9 A;  5JVG 3;  2ICE C;  4DR7 Q;  3TDQ A;  1CSQ A;  1CHQ D;  4DV2 L;  4IOA A;  3RLO A;  3VR3 A;  3RZO B;  4GNX C;  5KNC A;  2KED A;  4EGV A;  3HKZ G;  1D1I A;  1L1O A;  2WII B;  4JCV E;  4RKL A;  3T51 B;  3TZU A;  3ULJ A;  3L2P A;  2AUK A;  4IUT A;  3TS0 A;  5M5X H;  2XGT A;  1QUQ B;  3BZD B;  3HKZ B;  3NE5 B;  4LF7 L;  2QEX A;  1A3V A;  1QVC A;  1PDQ A;  2MUY A;  2HQE A;  4R9W A;  2MHV A;  5LHY 1;  4ZK9 B;  1C0A A;  1F9R A;  1LLR D;  2K5D A;  1KC8 C;  2L4N A;  2EXD A;  2E5L Q;  5ISR A;  4LF6 Q;  1FGU A;  1I3Q B;  1V1O A;  4EQ5 A;  5FLX L;  1Y1W H;  1FR3 A;  1IBK L;  2PYK A;  2JA9 A;  3FHW A;  1PH1 A;  3RN2 A;  1VQD A;  1SEB D;  2Z1C A;  2Z0S A;  5IE8 A;  2K05 A;  4QBO A;  3HG9 A;  2A6H D;  2VQE L;  3D4D A;  2QW7 A;  1I94 Q;  2RSN A;  4DUZ L;  3CRL C;  1E2V A;  2JA6 G;  4DK3 C;  1JJC B;  4FDB A;  2NZ1 D;  2QEJ C;  1EY4 A;  4RGO S;  2A5H A;  4A3C G;  4TKD A;  2B2Y C;  5I4D A;  4OO1 I;  1XXG A;  2WP8 J;  1A0I A;  2Z8L A;  2OF1 A;  4C56 C;  3A0J A;  4RAU C;  3Q23 A;  4JV5 L;  5I6W A;  3DWA A;  2PW5 A;  5C0X H;  5DM7 3;  2AQ2 B;  4ZUJ A;  3KF8 A;  4B3T L;  3GTO B;  1XNR L;  3FRP B;  3K5L A;  1EIY B;  1BF4 A;  3JAM i;  1VQM A;  3URY A;  4P71 A;  2CW0 C;  2DNE A;  2B2W C;  4AYB E;  4DNI A;  1YEZ A;  2A1A A;  2AUJ D;  2F0M A;  3NWS A;  1HZ9 A;  4A3B H;  1EY5 A;  3L7Z C;  1ZP7 A;  2JA7 H;  3D0F A;  1KAW A;  1Y1V B;  2RCF A;  1YI2 A;  1PH7 A;  4CKC A;  5C3X A;  4L5R C;  4JBW A;  4M8A A;  2JN4 A;  2JA5 H;  5M3M B;  4A3K G;  2RA4 A;  3PO2 G;  1DCZ A;  1JWU D;  5CV9 A;  1PFM A;  4CDC C;  1SNM A;  2F4V L;  4KKU A;  1F9Q A;  2JXM B;  4U67 3;  3S2H B;  4K0K Q;  5IGF A;  2NVT B;  1NR2 A;  5C0X I;  1SSO A;  1ROD A;  5KRU A;  1FNU A;  1GHJ A;  1ZXT A;  5CMD A;  4LF9 L;  4A3E H;  3ND9 A;  3LX0 A;  1NJI C;  3D6W A;  1TS3 A;  3S1Q H;  4GOP A;  3VYT A;  1WI5 A;  3C46 A;  1J6Q A;  2HD3 A;  4JV5 Q;  1A8V A;  4JI7 L;  4DA2 A;  1YNX A;  4UHV A;  1PRT B;  3J80 L;  4IUV A;  1XX8 A;  4XDX A;  1SLJ A;  5E7N A;  2SDF A;  2EYL A;  1JIC A;  5FLX E;  1QZG A;  1IYV A;  2F3I A;  2UUC L;  2UUA Q;  3M4P A;  1U5K A;  1K9M C;  1TY2 A;  4EQO A;  1DM0 B;  5AJ3 L;  1NR4 A;  5C4Z A;  3PCO B;  1I5F A;  1SE3 A;  3E9H A;  3NTK A;  1BDO A;  4FNF A;  5IYC H;  2HIV A;  3H09 A;  1J5E Q;  1BCP D;  4OXP A;  4HJ5 A;  2XRQ D;  2EY2 A;  1W6J A;  3FPU B;  3C2P A;  2PCF B;  4V0B A;  1Q46 A;  4BY7 G;  3A8I E;  2EYF A;  4LUV A;  1PXU A;  2CCZ A;  3PUV A;  3NBH B;  4R8I A;  4DR5 L;  3AEV A;  4N8X 1;  1X3G A;  1PRT C;  3DLL A;  1BNZ A;  4IPC A;  3T1Y Q;  3N6R A;  3JAM E;  5ELB A;  2FKH B;  1TWH B;  4A3F B;  3HKZ E;  1SDF A;  3W1G A;  4AQY Q;  4P73 A;  4XIG S;  4OX9 L;  4H7B A;  1BO0 A;  3QOJ A;  4KN4 C;  1IBL L;  1V8Q A;  2RF4 A;  1WTQ A;  2UUA L;  5IP7 G;  3HP3 A;  5JJZ A;  2ZXP A;  3HEJ A;  3S1N B;  1PH9 A;  2VUM H;  1UEB A;  2N88 A;  2P5Z X;  1Z7T A;  4G6V A;  3FEW X;  1ZKO A;  3MTS A;  4N9P A;  3FKI B;  2F3W A;  1VQK A;  5ELF A;  1SNC A;  1YJW A;  2YTV A;  1KDA A;  3QR8 A;  4FF2 A;  2NZO A;  2B2U A;  3RN5 A;  3S17 B;  3MXN A;  3Q24 A;  5GAG C;  1HZB A;  2WKD A;  3NTI A;  2R7Z H;  2EXZ A;  1GOZ A;  4L5Q A;  2DJG C;  3FKI G;  4JBM A;  2NN6 I;  4XYO A;  4Y7N H;  3S2D H;  2B2T C;  3CCL A;  3QO2 A;  2UXB Q;  1FJG Q;  3F2B A;  2R7F A;  1IBL Q;  2PMZ B;  2OTJ A;  1PMR A;  1VQ4 A;  5A2Q E;  5C3E B;  3NP8 A;  4A3C H;  2WJ0 A;  2HDM A;  4IZ8 A;  2D2C C;  2NVT H;  1ESF A;  4EVO A;  1TQO A;  3P20 A;  4JC0 A;  2I5L X;  3S1M B;  3SDZ A;  4HID A;  1BBU A;  3IEY B;  1RJT A;  5GAD C;  1KTK A;  4GLX A;  1AZQ A;  1EL0 A;  2F0N A;  2ES2 A;  4LF6 L;  4JPB W;  2K14 A;  4DUZ Q;  2LMC B;  5JEA J;  1YIJ A;  3PQI A;  5JOB A;  4JI5 Q;  2IWH A;  1DON A;  1HHV A;  4A3M G;  4DU9 A;  2K5H A;  5IYD H;  3QB3 A;  4LFA Q;  4APV A;  1AW7 A;  2CQA A;  5EKI A;  3SK6 A;  4IUQ A;  3H3V C;  3T56 B;  3OYY A;  1I4G A;  1Y14 B;  4LMQ D;  3KF6 A;  5GRO A;  4GKJ Q;  3DWP A;  4JI7 Q;  1NMG A;  2JA7 G;  2QDL A;  2A74 C;  1W6K A;  2H1E A;  2KHI A;  3IRB A;  2LS0 1;  4OL7 A;  1KAA A;  3UE1 A;  4LUO A;  2J0T D;  4HR7 B;  1SRU A;  4KY6 A;  3W2D A;  4YWM A;  1HNX L;  1VQ5 A;  1MJC A;  2AWN A;  2AHO B;  1EOT A;  2XTI A;  3KK7 A;  2OXP A;  2KUM A;  4A93 B;  1XNQ Q;  3CPF A;  2ALY B;  2A73 B;  3PV0 A;  4F8M A;  1RD9 D;  2I07 B;  2AMC B;  4IN3 A;  1EYD A;  1WJJ A;  2ZTE A;  4A3F H;  1TY0 A;  1KLG D;  1RDP D;  3MAQ A;  1X3Q A;  3OPO A;  1U4R A;  5I9P A;  1STY A;  1HFG A;  1FNV A;  2MGS A;  1B7Y B;  1S5C D;  3VYS A;  1OXT A;  4B3M L;  1YNN D;  1EQR A;  1SBB B;  1FYC A;  1WTH A;  3ULL A;  3WOF A;  1JQY D;  1BBX C;  1WOC A;  4JK1 C;  1HQM C;  3NBI A;  2L9H A;  3HZX A;  4HCS A;  1S5D D;  1BR9 A;  3I91 A;  1HNW L;  5JVH 3;  4JI8 L;  1X9N A;  2R7Z B;  2HDL A;  2N49 A;  5EQ0 A;  3F2D A;  1XNR Q;  4IPH A;  2KHS A;  2OWO A;  1I6H B;  5C4J B;  3HOY G;  1HZC A;  1N33 Q;  4LFB Q;  4PMC A;  1JOK A;  4NMZ A;  4UDU C;  1C9O A;  3MC0 B;  2EYJ A;  2RDF A;  1M4V A;  3TRZ A;  3J7Y W;  4XT1 B;  2EE1 A;  4OO1 G;  4YCV A;  1FGB D;  1HXY D;  1N36 Q;  1GUO A;  3ERS X;  3MFY A;  2VW9 A;  1PH8 A;  1NBW A;  4WRD A;  3BDC A;  5GAE C;  4BY1 B;  1YIT A;  1HH1 A;  2PW7 A;  2B2Y A;  4CHT B;  4DPG A;  4GNX A;  4ILW A;  1KDB A;  1E24 A;  1PTO D;  2A6E D;  1IW7 D;  1HNW Q;  2QA4 A;  3OHX C;  2RKS A;  2EOT A;  1Y1O A;  4N8F A;  3GP7 A;  2WB1 B;  4RG1 A;  3CCU A;  4GKK L;  1HRJ A;  1I4X A;  2CFM A;  2F0V A;  5HGQ A;  1LTL A;  2L11 A;  5IYB H;  2JA5 B;  4F88 A;  1EUJ A;  2KA7 A;  1SFO B;  5BR8 L;  1UWV A;  5IGC A;  1LM0 A;  2Z6K C;  1U0L A;  2NVX H;  2E75 C;  3AJV B;  2CWP A;  2XNA C;  3U9S A;  3F2U A;  1HTP A;  2JEA I;  3G7L A;  3OTO L;  1JOR A;  3SK8 A;  1SMY C;  1OXS C;  1SRO A;  3H3V I;  4LW1 A;  1SYB A;  2MP1 A;  1X32 A;  1PLF A;  4KKT A;  5D14 A;  4POG A;  4I7A A;  1DXM A;  4OEM B;  4BBR H;  1JOO A;  1SNQ A;  1SJH D;  4GN4 B;  5JPM C;  1I50 H;  3OMC A;  2K03 A;  1YHB A;  4LF4 Q;  2D9U A;  3I4M B;  2JA8 G;  4Q0F A;  4RGT A;  1EOV A;  2OQ0 A;  1EY6 A;  4GKK Q;  2W8M A;  4C1N I;  2NVY H;  1WCM B;  3HOV G;  4KY7 A;  1NSN S;  2BDO A;  1WTW A;  5EKL A;  1HR0 L;  4E6Z A;  1B8A A;  2OEO A;  3CME A;  1IL2 A;  4L5S A;  4JOI A;  1XMX A;  3AQQ A;  2K04 A;  1F77 A;  4K2K A;  3MHB A;  4A3I B;  4DV4 Q;  3ERQ A;  1OXX K;  1WFQ A;  1EQQ A;  3M4Q A;  1A6X A;  4ZYS A;  2HQL A;  5C0X J;  1RZN A;  1L0Y B;  2D5D A;  1LV9 A;  3CCE A;  1E2Z A;  4Z9C B;  1II3 A;  2O5I C;  4B3R Q;  1Y1W G;  5C4X G;  3OSO A;  3D31 A;  2XIW A;  4EQP A;  4PMW A;  2GJW A;  2WAQ E;  2C5C A;  1N33 L;  4JI5 L;  3TRE A;  1SE4 A;  2JE6 I;  3TN2 A;  1KQS A;  5IT9 L;  3BVZ A;  5C5L A;  5CR3 A;  5KYI A;  4JG2 A;  1L2F A;  4C2M H;  2BE5 D;  2JEB I;  5FJ8 G;  1BKB A;  4IQZ A;  1VQG A;  5M5W B;  2FJ2 A;  1R9T B;  3QG1 A;  1VQP A;  2F0I A;  3HGB A;  4QUC A;  1TU2 B;  2IHE A;  1TS4 A;  1BCP F;  1WTR A;  2L15 A;  4DV5 L;  4B3R L;  1B3Q A;  3V96 A;  3ITP A;  2ZTD A;  3BVM A;  4C3I G;  2D0P A;  1TWA H;  4A4I A;  1CHP D;  3VR4 A;  3WDN A;  4DUY L;  3CC2 A;  2E5L L;  1E1O A;  4A75 A;  4IJH A;  3CKI B;  4EX5 A;  3S2D B;  3VR5 A;  1STH A;  3PO3 H;  4IFD J;  4RHS A;  4A93 G;  1F2Y A;  4OWX B;  4YHH L;  3K6O A;  1VS0 A;  4E6I A;  2KEC A;  1ENF A;  2FFK B;  1CT1 D;  3ONA B;  1HQR D;  2KCN A;  4UP8 A;  3J80 i;  3D4W A;  3I55 A;  1DOM A;  2FIN B;  1X6O A;  1GJX A;  1HNZ L;  3KF6 B;  3K59 A;  1QJO A;  3HOZ G;  1KL9 A;  3OIP A;  3PUY A;  4J15 A;  3KDF B;  1FJG L;  3GTP H;  3HOU G;  1K8M A;  1LTB D;  1V9P A;  1Q1E A;  4BA1 I;  3TP6 A;  4K8J A;  2F03 A;  2MO1 A;  1VQL A;  1A15 A;  2IL8 A;  5T1I A;  2F0E A;  5CV8 A;  4G7H C;  5FDK A;  1I6V C;  2B2U C;  4LF7 Q;  1EIG A;  2NB0 A;  2IHF A;  3CMA A;  2LXJ A;  2B2T A;  2F0F A;  1QVF A;  4C3J B;  5LMN Q;  4A3L H;  3CPW A;  4X3U A;  3E0J A;  3TP8 A;  4K0K L;  1W2B A;  2K7V A;  2PPB C;  2PO4 A;  4AYB G;  3M7G A;  1N36 L;  3NQI A;  2E2I H;  2O4X A;  2WCZ A;  3A5Z B;  1F9S A;  3A7L A;  3OIQ A;  5LL6 S;  5M9O A;  1PYB A;  3Q0A A;  1HA6 A;  4XQQ A;  1WTO A;  4QIW E;  1YNM A;  1TWG B;  3AYH B;  4R1J A;  1DZ1 A;  4ME5 A;  2N78 A;  5K36 H;  1AN8 A;  2K5W A;  2EY5 A;  3ULP A;  3GDE A;  2L0C A;  2QF7 A; 
#chains in the Genus database with same CATH homology
 4UAI A;  2EJF C;  1U4L A;  4BY7 B;  3T4A C;  1Y88 A;  3S1R B;  3N52 A;  1GUT A;  4C3J G;  2G9H D;  4XTC S;  4DF7 A;  1V43 A;  1IL8 A;  4F7X A;  3KLS X;  4B08 A;  3A55 A;  1RTN A;  3O13 A;  4LQE A;  4DXG A;  4L63 B;  3OOC A;  1CK1 A;  1Q1B A;  4RHR A;  4O42 A;  4KHZ A;  2OKF A;  2WCW A;  4RWS C;  2BA1 A;  3RMH A;  1EEF D;  1C8C A;  1Z47 A;  1ET9 A;  2E74 C;  2DY8 A;  4DK0 A;  2CVR A;  3GV6 A;  1F2M A;  2K28 A;  5DAU A;  4HED A;  2PZU A;  5FOB B;  2QKI C;  4H44 C;  5IGB A;  1LAB A;  4A3G B;  2VS1 A;  1LO5 D;  5IGE A;  4C3I B;  1B2T A;  1EYC A;  1SMY D;  2AWO A;  3I72 A;  4IFD H;  4HMI A;  3H91 A;  3ZYY X;  4Q5V A;  5AFW A;  4V19 0;  2SOB A;  1UAP A;  4K5V A;  1PTO H;  1O7Z A;  4DN4 M;  1STN A;  1EZ8 A;  1RKN A;  1SND A;  1VMP A;  3R8B A;  1HTL D;  2NVX B;  1WTX A;  1ZYR C;  2J4X A;  5I2Y A;  3A8J E;  3C1E A;  4CKB A;  1LAC A;  2A6H C;  2SEB D;  2BCO A;  3T13 A;  3U9O A;  4IUP A;  3J80 E;  1XYI A;  5COY A;  4DFA A;  3K58 A;  4XQJ A;  3EJI A;  1JE4 A;  4CJ2 C;  4A3J B;  1WVL A;  4IFD I;  3PO2 B;  2O2L D;  4K8I A;  2DNC A;  5E3F A;  2R93 B;  3HOV B;  5ELE A;  2GA4 B;  1ZYR D;  2F0K A;  1JCK B;  3H94 A;  2V4D A;  2FCO A;  3T53 B;  2INB A;  1LTT D;  3SVM A;  2EYO A;  2ZYZ A;  5I6Y A;  4TRD A;  3SK4 A;  2WIW A;  2JA6 B;  1R4P B;  3C3L A;  1EY0 A;  1SYG A;  1B1Z A;  1CM9 A;  4KJN A;  4GZY C;  3QOL A;  3FDT A;  4IAL A;  2OST A;  2M9V A;  2F4I A;  4BS9 A;  1MSG A;  2WAC A;  1B9M A;  2F0D A;  4YIJ A;  2EVB A;  3MXP A;  1JC7 A;  2WIZ A;  1S4Z A;  1SYF A;  3S14 B;  5CBA E;  4WFN 3;  2IW3 A;  1HA5 A;  2HUG A;  1EFI D;  2Q8I B;  3GV3 A;  1PTO B;  1I4H A;  5FO8 B;  1H9S B;  4I65 A;  2BA0 A;  5JEA H;  2A68 D;  3PUX A;  4NKL A;  5CC4 A;  4R8N A;  4LAA A;  1H9K A;  4MN3 A;  3DM1 A;  2IT1 A;  3SXH A;  2VB3 X;  2IX1 A;  2NWG A;  2XWB B;  3GTL B;  2B2V C;  4BA2 I;  3J7A F;  3TSS A;  2L55 A;  2EYH A;  1PZI D;  1U9R A;  4HTH A;  2E2I B;  5J22 A;  1BCP C;  2RSO A;  1EWH A;  1O80 A;  2R61 A;  2ENB A;  4J8Q A;  1ONL A;  4CJ0 B;  1YNJ C;  1CQF A;  3E5S A;  1B9N A;  1TS2 A;  1IPI A;  2JA7 B;  3DHQ A;  2A68 C;  5IGG A;  3X3M A;  2KJX A;  1ILQ A;  3OWE B;  1VCI A;  1H9R A;  1H9J A;  5HUR A;  4QIW B;  3GO5 A;  3AJV A;  1T5E A;  4HMJ A;  1C48 A;  4FXG C;  1Q3L A;  1D6E C;  4A3B B;  3S16 B;  2IXS A;  5I2X A;  2F0L A;  1CA5 A;  1SNP A;  1A3T A;  5G3L F;  1WD1 A;  2RVL A;  5IT9 E;  3S1Q B;  2ZXR A;  2EZV A;  5C6A A;  5D65 A;  2X6L A;  4FF3 A;  1Y8P B;  2KOL A;  4C3H B;  2ID0 A;  2HCC A;  1ZEQ X;  2M2L A;  3P1Y A;  3PIP 3;  4HSP A;  3V2T A;  3G6J B;  2F3V A;  1M8A A;  3VR6 A;  1BOS A;  4QF4 A;  2KQ3 A;  3QJY A;  4KD4 A;  3NTH A;  4KMU C;  3OWF A;  1EZ6 A;  5EBD A;  4ZLT F;  1ESR A;  3J7A V;  2NBF A;  4BWG B;  1SXT A;  4J6H A;  5J39 A;  1WTV A;  4ZAI A;  5D3D A;  1LTS D;  2TSS A;  4OIK A;  2R6G A;  1A79 A;  1OB8 A;  3L9A X;  1MGS A;  1NUC A;  1QG7 A;  5C0X G;  4IUR A;  1CFM A;  5FO7 B;  5EKK A;  3GTQ B;  1UEA B;  3S15 B;  4PV1 C;  3OW7 A;  3R3O A;  1LT3 D;  1PRT F;  1U4M A;  3MXU A;  5M5X B;  2J7Z A;  3NSW A;  1YNJ D;  2NTT A;  4MIU A;  4K14 A;  3S9W A;  3M85 A;  4AYB B;  2F0O A;  4G7O C;  3HRZ C;  3TME A;  1BCP B;  1VF7 A;  1JOQ A;  4OIJ A;  3M7N A;  1EQV A;  1F9P A;  5E4W C;  5FKA C;  1TWF B;  2A69 C;  2B8G A;  2K1B A;  3NXW A;  3DMU A;  2BH2 A;  3R2I A;  3JAM L;  2MJ8 A;  2E2H B;  4K2L A;  1PYW D;  3QWN A;  1RHP A;  4N9T A;  1F2L A;  4ABN A;  2CV8 A;  1LT6 D;  1IHZ A;  4ODG A;  1J8I A;  2A69 D;  1IKL A;  5HGT A;  4WOR A;  1C4Q A;  2NTS A;  5KNB A;  3P1Z A;  4ZQU A;  2OT2 A;  3KUP A;  4RCO A;  1LTG D;  3I90 A;  2NN6 H;  3K5N A;  4K5W A;  3WOE A;  5TSS A;  1B44 D;  2RQX A;  5BN5 A;  2X69 A;  3T16 A;  3VA7 A;  3A8K E;  2EYM A;  3HOX B;  3BS1 A;  3HS0 C;  4PNY A;  2AQ1 B;  1OO9 B;  4HAE A;  5CV6 A;  3KLS A;  4KTA A;  3LWU A;  1BQQ T;  2K6A A;  1S5B D;  2K33 A;  1B50 A;  4ZKC B;  3NQT A;  2EYP A;  3PUZ A;  1EYA A;  4RFB A;  4G4K A;  5IGD A;  1CTM A;  3DEO A;  3QIA A;  1RCV D;  4KK7 A;  1ILP A;  4EV1 A;  3IF0 X;  1CZW A;  4M1U B;  1KLU D;  2F0J A;  3MXG A;  3D4R A;  2FMC A;  3CU7 A;  1EU3 A;  2B2W A;  2C9O A;  1G29 1;  4A3M B;  1GUS A;  3MEH A;  1SNO A;  4J1M A;  1DYQ A;  4CGY B;  4IUU A;  1STB A;  5DNF A;  1B53 A;  4KD3 A;  4NW2 A;  2XRS D;  2F0G A;  4MHE A;  1QNU A;  2NN6 G;  1GUN A;  3H6M A;  4OHJ A;  5IOC A;  1D5M C;  1R4Q B;  2SNM A;  1PFB A;  3DUZ A;  3FMC A;  4P2C B;  5J1Z A;  1B3A A;  1GUW A;  4HSV A;  1MSH A;  3CHB D;  4B9W A;  3MZ5 A;  3I3C A;  2H4O A;  2CW0 D;  5C5M A;  5EPK A;  3P7J A;  4DAY A;  2D62 A;  1STA A;  2YYZ A;  2PNR C;  3SE0 A;  4TQU S;  2KEE A;  2Z4I A;  2G9D A;  2IX3 A;  1SYD A;  1A3U A;  5CV5 A;  1KNE A;  3TBI B;  2Z4H A;  4Y7N B;  2N55 A;  2WIN B;  2JJQ A;  5E4X A;  1LTI D;  3K7A B;  2R3Z A;  1JR0 D;  4X3T A;  1F1Z A;  5A35 A;  2VNU D;  3SK5 A;  4H13 C;  5LL6 X;  1GHK A;  4EQN A;  2F0S A;  2CHB D;  3BYT B;  3MFG A;  2KVM A;  3D3R A;  3I73 A;  1EY8 A;  2XVS A;  4C1N K;  1DD2 A;  1AFP A;  1G2T A;  4QUF A;  1UNS A;  1NCV A;  3AB9 A;  4ZRZ A;  2IX0 A;  1I50 B;  4CBV A;  4F87 A;  2K5Q A;  1G8Z D;  5ELC A;  4DAP A;  5M5Y B;  1AP0 A;  2QIL A;  3SHL A;  3BT7 A;  2JSO A;  1LTR D;  3ND8 A;  2VB2 X;  4DNT B;  2FKC A;  1PRT D;  1ENA A;  1F2Z A;  3FOV A;  3I4L A;  3LNN A;  1ML0 D;  3LWE A;  4QBL A;  3R2T A;  2ICI A;  1JB3 A;  2TMP A;  4CJ1 B;  4U68 A;  4RGM A;  5K36 G;  4ZUI A;  1G2S A;  1QIL A;  1HPC A;  2B8F A;  4B9X A;  1TS5 A;  5FO9 B;  5FK9 C;  1HFN A;  1EIH A;  4KHV A;  5C3W A;  1O7Y A;  2B2V A;  1A2T A;  4L6T B;  3R93 A;  3Q22 A;  3GTK B;  1SYC A;  3DEP A;  1GEF A;  1RLV A;  2HCI A;  3C1F A;  1TWA B;  3W3A A;  2GW6 A;  2DY7 A;  1G91 A;  2WAQ B;  2ZXO A;  3RUZ A;  2F0W A;  4KV6 A;  1V1P A;  1IW7 C;  1QB5 D;  1RF2 D;  1DJR D;  3K5O A;  5IIF A;  4FXK C;  1TKW B;  1TR5 A;  1KAB A;  2WKC A;  1D5Z C;  1D5X C;  4DGZ A;  5KND A;  2B39 A;  1QWY A;  1QNK A;  3NHH A;  5EBC A;  5EJW A;  5K5P A;  4QCL A;  1SE2 A;  2Z0R A;  4O1N A;  1PZK D;  1SYE A;  4BBR B;  4LK1 C;  3EFX D;  2E2D C;  3TZD A;  2VLD A;  1XWE A;  3A56 A;  3NK9 A;  4S3S A;  3IL8 A;  5G3L D;  2NVY B;  2IPK D;  3AU7 A;  2DN8 A;  4XQN A;  1KDC A;  2JYO A;  3OMG A;  1PZJ D;  4QB4 A;  4X3S A;  1AZP A;  1EY9 A;  2L12 A;  4FF1 A;  1E2W A;  1J9O A;  1TII D;  2M00 A;  1MBY A;  2QCP X;  3RLF A;  3IAY A;  3IFD A;  4FYD A;  3L3O C;  5BN3 A;  2ZYZ B;  2F0P A;  5ELD A;  3MWY W;  4DNR B;  2X6G A;  4C3H G;  3KBG A;  4WJW A;  4X3K A;  1EQT A;  3D8G A;  3RD4 A;  4ZKB B;  2L1B A;  4C2M B;  3HOY B;  4K6L A;  3H0G B;  2LFN A;  2XWJ B;  1HUN A;  1VMC A;  2Q8R E;  1D2B A;  3M4O B;  1E0B A;  4DXF A;  1DOL A;  2KCC A;  1A2U A;  1T0F A;  1NAP A;  2NVQ B;  3DNX A;  1UUP A;  4PMB A;  3GTJ B;  2F0U A;  3CQZ B;  3VYR A;  2K01 A;  4ULL A;  2FL3 A;  4IFD G;  4G6U A;  3PO3 B;  1CA6 A;  1V1P B;  2EO0 A;  4LJZ C;  3Q6S A;  1TVX A;  3EQL C;  4RKB A;  5CV4 A;  2EJM A;  2LY7 A;  3FPP A;  3SR1 A;  3BDL A;  2E76 C;  1CQV A;  2Y0S B;  4OO1 H;  5C4H A;  4XYQ A;  2WV6 D;  3BG3 A;  1DOK A;  2EY1 A;  4CKE A;  1RTO A;  2BDN A;  5C4X B;  4TSS A;  4A3D B;  2EY6 A;  4L8J A;  5E1F A;  2MPM A;  2F0H A;  3KLR A;  3EVQ A;  2CZR A;  2F1M A;  1STG A;  2F0T A;  3GTP B;  4A3K B;  1Z6H A;  5T1G A;  2FHT A;  3I8Z A;  4K5X A;  3GQB A;  1PTO F;  1R0V A;  2NYZ D;  1JWS D;  1HCZ A;  4QBN A;  1GXD C;  5DEH A;  2PZW A;  4KKS A;  3P75 A;  1D1K A;  4FF4 A;  1I4R A;  5BN4 A;  3MA2 B;  3J81 L;  1YNN C;  1Q90 A;  1R11 A;  2BOS A;  1FD7 D;  1QCB D;  1G6Z A;  2BE5 C;  4IUN A;  2FMM A;  1PTO C;  1BUV T;  3RZD B;  3KBX A;  4DK1 A;  1TWC B;  2LKV A;  3SEB A;  4RGN A;  2PQE A;  1IYU A;  5EGT A;  5JPN C;  5KYL A;  3PUW A;  1K8O A;  2K32 A;  2JP1 A;  1S5E D;  3DXJ C;  1KNA A;  3IFT A;  1IKM A;  3AMU A;  2RDH A;  3VA5 A;  3GD7 A;  1TT2 A;  5CGK A;  1FNW A;  2R92 B;  2ZT9 C;  2XSC A;  3M4Y A;  1Y69 U;  2EJG C;  3HOU B;  1CZG A;  1L0X B;  3K5M A;  1LT4 D;  1GUG A;  2Q8T A;  3HOZ B;  4DAV A;  3PMF A;  3A7A B;  3VYU A;  2VXW A;  2I46 A;  1EEI D;  4FXD A;  4G57 A;  5CBE E;  1SJE D;  5F2D A;  1STE A;  1CI3 M;  1OB9 A;  3GTM B;  1LT5 D;  4RA8 A;  2SNS A;  5JAV A;  3BYY B;  3VR2 A;  4PQX A;  3CRK C;  5D3I B;  1MD2 D;  4RCN A;  3FVQ A;  3M3Y B;  1BXT A;  3NBH A;  1SAP A;  4BBS B;  5IOD A;  1T5X D;  1U4P A;  3V05 A;  1WD0 A;  1Q12 A;  5M3F B;  5DM6 3;  4XXE A;  3K57 A;  3UI2 A;  1OXU A;  4KI0 A;  4HCE A;  1EY7 A;  3J81 E;  1XTC D;  1QOH A;  1AEX A;  3K0Y A;  1QE6 A;  4FP5 D;  2A6E C;  3D6C A;  3BVG A;  5NUC A;  1I4P A;  2RBM A;  5CYU A;  3X3N A;  2VUM B;  4KJO A;  4G7Z C;  1Q8I A;  1K83 B;  2F0Q A;  5KEE A;  1Y1W B;  1ENC A;  4FO2 A;  3TP7 A;  5A2Q L;  5KGU A;  1PFN A;  2YU9 B;  5CV7 A;  2FLC A;  2O5J C;  4QMG A;  3TP5 A;  4XT3 B;  3GTG B;  1ET6 A;  1ICW A;  4ID6 A;  4NP5 A;  4KY5 A;  3NWT A;  1S5F D;  3NPP A;  1O7L A;  5C44 B;  2EPB A;  4RH6 A;  3NUC A;  3IKJ A;  3I4N B;  3BDO A;  3DWQ A;  1H9S A;  2PZT A;  4K6D A;  4KN7 C;  4I7Z C;  3ERO A;  1JWM D;  2AQ3 B;  1MI2 A;  1I4Q A;  3EA6 A;  1X3P A;  1HUM A;  1EWC A;  3I70 A;  5JEA G;  3PIO 3;  2EDG A;  2QDB A;  3A54 A;  5COR A;  4ZQ3 A;  1O78 A;  2RDG A;  4FVM A;  2DBS A;  1B4O A;  1Y8O B;  3P1H A;  1H9M A;  3HOW B;  2XN9 C;  5EPJ A;  1Y8N B;  1VF5 C;  2B63 B;  2L5T A;  3P1Z B;  1LTA D;  1WTP A;  4OGQ C;  5I9O A;  2E2J B;  4TKO B;  1VDZ A;  3MVV A;  1EU4 A;  2IJ0 A;  4NDX A;  5EPL A;  2JA8 B;  4A3E B;  3E6Z X;  4TKK A;  3IEY A;  2NUC A;  4HN7 A;  4H0L C;  5KIX A;  5JVG 3;  2ICE C;  3TDQ A;  1CHQ D;  3VR3 A;  3RZO B;  5KNC A;  2KED A;  4EGV A;  1D1I A;  2WII B;  4RKL A;  3T51 B;  3TZU A;  2AUK A;  4IUT A;  3BZD B;  3HKZ B;  3NE5 B;  1A3V A;  1PDQ A;  2MUY A;  2HQE A;  4R9W A;  2MHV A;  5LHY 1;  4ZK9 B;  1F9R A;  1LLR D;  2K5D A;  2L4N A;  5ISR A;  1I3Q B;  1V1O A;  5FLX L;  1FR3 A;  2PYK A;  2Z1C A;  1SEB D;  2K05 A;  4QBO A;  3HG9 A;  2A6H D;  3D4D A;  2RSN A;  3CRL C;  1E2V A;  2NZ1 D;  2QEJ C;  1EY4 A;  4RGO S;  2A5H A;  4TKD A;  2B2Y C;  5I4D A;  4OO1 I;  1XXG A;  2WP8 J;  2Z8L A;  2OF1 A;  4C56 C;  3Q23 A;  4RAU C;  5I6W A;  3DWA A;  2PW5 A;  5C0X H;  5DM7 3;  2AQ2 B;  4ZUJ A;  3KF8 A;  3GTO B;  3FRP B;  3K5L A;  1BF4 A;  3URY A;  2CW0 C;  2DNE A;  2B2W C;  2AUJ D;  2F0M A;  3NWS A;  1EY5 A;  3L7Z C;  1ZP7 A;  1Y1V B;  4CKC A;  5C3X A;  4JBW A;  4M8A A;  5M3M B;  2RA4 A;  1DCZ A;  1JWU D;  5CV9 A;  1PFM A;  1SNM A;  4KKU A;  1F9Q A;  2JXM B;  4U67 3;  3S2H B;  5IGF A;  2NVT B;  1NR2 A;  5C0X I;  1SSO A;  1ROD A;  5KRU A;  1FNU A;  1GHJ A;  1ZXT A;  5CMD A;  3ND9 A;  3LX0 A;  3D6W A;  1TS3 A;  3VYT A;  3C46 A;  4DA2 A;  1PRT B;  3J80 L;  4IUV A;  1XX8 A;  4XDX A;  2SDF A;  2EYL A;  1JIC A;  5FLX E;  1IYV A;  1TY2 A;  4EQO A;  1DM0 B;  1NR4 A;  5C4Z A;  1SE3 A;  3NTK A;  1BDO A;  4FNF A;  3H09 A;  1BCP D;  2XRQ D;  2EY2 A;  1W6J A;  3FPU B;  3C2P A;  2PCF B;  4V0B A;  3A8I E;  2EYF A;  1PXU A;  3PUV A;  4R8I A;  1PRT C;  1BNZ A;  3N6R A;  3JAM E;  5ELB A;  2FKH B;  1TWH B;  4A3F B;  1SDF A;  4XIG S;  4H7B A;  1BO0 A;  3QOJ A;  4KN4 C;  1V8Q A;  1WTQ A;  3HP3 A;  5JJZ A;  2ZXP A;  3HEJ A;  3S1N B;  2N88 A;  1Z7T A;  4G6V A;  3FEW X;  1ZKO A;  3MTS A;  4N9P A;  3FKI B;  2F3W A;  5ELF A;  1SNC A;  4FF2 A;  1KDA A;  3S17 B;  2B2U A;  3MXN A;  3Q24 A;  2WKD A;  3NTI A;  2EXZ A;  1GOZ A;  2NN6 I;  4XYO A;  2B2T C;  3QO2 A;  2PMZ B;  1PMR A;  5A2Q E;  5C3E B;  3NP8 A;  2WJ0 A;  2HDM A;  4IZ8 A;  2D2C C;  1ESF A;  4EVO A;  1TQO A;  3P20 A;  3S1M B;  3SDZ A;  3IEY B;  1RJT A;  1KTK A;  1AZQ A;  1EL0 A;  2F0N A;  2LMC B;  5JEA J;  5JOB A;  2IWH A;  1DON A;  1HHV A;  4DU9 A;  3QB3 A;  1AW7 A;  2CQA A;  5EKI A;  3SK6 A;  4IUQ A;  3H3V C;  3T56 B;  1I4G A;  4LMQ D;  3DWP A;  2A74 C;  1W6K A;  2H1E A;  2LS0 1;  4OL7 A;  1KAA A;  2J0T D;  4HR7 B;  4KY6 A;  3W2D A;  2AWN A;  1EOT A;  3KK7 A;  2OXP A;  2KUM A;  4A93 B;  2A73 B;  3PV0 A;  4F8M A;  1RD9 D;  2I07 B;  4IN3 A;  1EYD A;  1TY0 A;  1KLG D;  1RDP D;  3MAQ A;  1X3Q A;  3OPO A;  1U4R A;  5I9P A;  1STY A;  1HFG A;  1FNV A;  2MGS A;  1S5C D;  3VYS A;  1OXT A;  1YNN D;  1SBB B;  1FYC A;  3WOF A;  1JQY D;  1BBX C;  4JK1 C;  1HQM C;  3NBI A;  2L9H A;  3HZX A;  4HCS A;  1S5D D;  1BR9 A;  3I91 A;  5JVH 3;  2R7Z B;  2HDL A;  5EQ0 A;  2KHS A;  1I6H B;  5C4J B;  4PMC A;  1JOK A;  4NMZ A;  4UDU C;  3MC0 B;  2EYJ A;  2RDF A;  1M4V A;  3J7Y W;  4XT1 B;  2EE1 A;  4OO1 G;  1FGB D;  1HXY D;  1GUO A;  3MFY A;  4WRD A;  3BDC A;  4BY1 B;  1HH1 A;  2PW7 A;  2B2Y A;  4CHT B;  4ILW A;  1KDB A;  2A6E D;  1PTO D;  1IW7 D;  3OHX C;  2RKS A;  2EOT A;  1Y1O A;  3GP7 A;  2WB1 B;  1HRJ A;  1I4X A;  2F0V A;  2L11 A;  2JA5 B;  4F88 A;  2KA7 A;  1SFO B;  1UWV A;  5IGC A;  2E75 C;  3AJV B;  2XNA C;  3U9S A;  3F2U A;  1HTP A;  2JEA I;  3G7L A;  1JOR A;  3SK8 A;  1SMY C;  1OXS C;  1SYB A;  2MP1 A;  1X32 A;  1PLF A;  4KKT A;  5D14 A;  1DXM A;  1JOO A;  1SNQ A;  1SJH D;  5JPM C;  3OMC A;  2K03 A;  2D9U A;  3I4M B;  4Q0F A;  4RGT A;  1EY6 A;  2W8M A;  4C1N I;  1WCM B;  4KY7 A;  1NSN S;  2BDO A;  1WTW A;  5EKL A;  4E6Z A;  2OEO A;  1XMX A;  2K04 A;  1F77 A;  4A3I B;  3MHB A;  4K2K A;  3ERQ A;  1OXX K;  1A6X A;  4ZYS A;  5C0X J;  1RZN A;  1L0Y B;  2D5D A;  1LV9 A;  1E2Z A;  4Z9C B;  1II3 A;  2O5I C;  3OSO A;  3D31 A;  2XIW A;  4EQP A;  4PMW A;  2GJW A;  2C5C A;  1SE4 A;  2JE6 I;  3TN2 A;  5IT9 L;  3BVZ A;  5C5L A;  5CR3 A;  5KYI A;  2BE5 D;  2JEB I;  4IQZ A;  5M5W B;  2FJ2 A;  1R9T B;  3QG1 A;  2F0I A;  3HGB A;  4QUC A;  1TU2 B;  1TS4 A;  1BCP F;  1WTR A;  3V96 A;  3ITP A;  3BVM A;  4C3I G;  1CHP D;  3VR4 A;  3WDN A;  3CKI B;  3S2D B;  3VR5 A;  1STH A;  4IFD J;  4RHS A;  1F2Y A;  3K6O A;  4E6I A;  2KEC A;  1ENF A;  2FFK B;  1CT1 D;  3ONA B;  1HQR D;  2KCN A;  3D4W A;  1DOM A;  2FIN B;  1GJX A;  3K59 A;  1QJO A;  3OIP A;  3PUY A;  1K8M A;  1LTB D;  1Q1E A;  4BA1 I;  3TP6 A;  4K8J A;  2F03 A;  1A15 A;  2IL8 A;  5T1I A;  2F0E A;  5CV8 A;  4G7H C;  5FDK A;  1I6V C;  2B2U C;  1EIG A;  2NB0 A;  2B2T A;  2F0F A;  4C3J B;  4X3U A;  3E0J A;  3TP8 A;  2K7V A;  2PPB C;  2PO4 A;  3M7G A;  3NQI A;  2O4X A;  2WCZ A;  1F9S A;  3A7L A;  3OIQ A;  5LL6 S;  5M9O A;  3Q0A A;  1HA6 A;  4XQQ A;  1WTO A;  1YNM A;  1TWG B;  1DZ1 A;  4ME5 A;  5K36 H;  1AN8 A;  2K5W A;  2EY5 A;  1OXV A;  2L0C A;  2QF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...