1F1ZA

Tnsa, a catalytic component of the tn7 transposition system
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
260
structure length
260
Chain Sequence
FSEVQIARRIKEGRGQGHGKDYIPWLTVQEVPSSGRSHRIYSHKTGRVHHLLSDLELAVFLSLEWESSVLDIREQFPLLPSDTRQIAIDSGIKHPVIRGVDQVMSTDFLVDCKDGPFEQFAIQVKPAAALQDERTLEKLELERRYWQQKQIPWFIFTDKEINPVVKENIEWLYSVKTEEVSAELLAQLSPLAHILQEKGDENIINVCKQVDIAYDLELGKTLSEIRALTANGFIKFNIYKSFRANKCADLCISQVVNMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TNSA ENDONUCLEASE
publication title Unexpected structural diversity in DNA recombination: the restriction endonuclease connection.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 91
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08721 Tn7_Tnp_TnsA_C TnsA endonuclease C terminal
A PF08722 Tn7_Tnp_TnsA_N TnsA endonuclease N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1f1zA02
3.40.1350.10 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 1f1zA01
4MHGA 4BXUA 2FCOA 2K7LA 1K6OA 2GQQA 1RLVA 1L3LA 2NAZA 4RB3C 1XSDA 1U78A 4YFNF 1B6AA 2IRFG 1U5TC 3IWZA 5LLQA 2ZYZB 1XGNA 2ACJA 2CV8A 1IRGA 3F8CA 5F1RA 1FC3A 4CDGA 2MH2A 3E6DA 2FA5A 3HRMA 1S6LA 2WIZA 5FFXA 4KIGA 1TW3A 1WKMA 5LHIA 1P6RA 3REOA 3IRQA 1OR7A 2UXNA 2K4BA 5HDNA 4NQWA 1GEFA 1CF7A 2G9WA 3GFLA 4BHBA 2OQGA 4PGGA 2D1HA 4DNCA 3CO7C 2WWYA 3D0SA 2QQAA 3V7CA 1U5TB 1Z9CA 3ZPLA 4HF1A 3HOSA 2YX7A 3E97A 1XN7A 4L9VA 4I7HA 2HOEA 2XGXA 5LHGA 4HZFA 2ZKZA 2BYVE 1O7LA 3F6VA 3WE3A 1OYWA 3F23A 3TOBA 3HTUA 3WTTC 4OIPF 4M73A 1G3WA 1ZRFA 3GF2A 4HX8A 4IVNA 2V79A 3DP7A 3JTHA 1MJ9A 2GJWA 3HRTA 2VBYA 4WXHA 5H6RA 5DD8A 1ZREA 2XKOA 3C1DA 1BI1A 1K78A 1Z6RA 1KU7A 2JT1A 2M87A 3R6SA 4WK8F 2V1UA 5DEQA 3DFGA 1O3SA 2ZJ2A 4UXNA 4OIQF 2J5PA 3AAFA 2QQBA 1ZN2A 1XGMA 1DPUA 1ZH5A 3MZHA 3LFKA 3JSPA 1YIOA 1J9IA 3HSFA 1USSA 3LAJA 1KGSA 2ZO4A 3BJAA 4IRGA 3GW2A 5E17F 4A6DA 2DQRA 2ESNA 4EM0B 2F5DA 2WC2A 3RTRA 1AWCA 4N0BA 1FSHA 2JTVA 1DPRA 1D5VA 3OV8A 5EEGA 1P92A 1D3YA 4YFKF 1R1UA 1S7OA 1FP1D 2H09A 4MGRA 1SD7A 2XAQA 1Y88A 4U7BA 1IXSB 1S29A 4O3MA 3BDDA 3FF5A 1ZRDA 4MNUA 2OU2A 1IAWA 3M8EA 1SD4A 4H0EA 2UXXA 1HW1A 1YFHA 3VB2A 3IWFA 4UV8A 4U0VA 3ZMZA 3MQ0A 1D8KA 2P6SA 3DNXA 5K5QA 1BIBA 1USTA 4IF4A 2IP2A 2M5WA 4LLGF 3ECHA 5E1XA 3FWEA 3ABUA 1IN5A 2NRAC 2F5EA 5LGTA 2V1DA 5E20A 3GZ6A 2UWMA 3DEUA 1RUNA 1YW7A 1UHWA 1MD0A 2IJLA 3KEOA 2FE3A 3V8JA 3SHFA 1HW5A 1JXSA 4N9IA 4CZZA 1OYIA 4DQ2A 4ENMA 1U6GA 4TKKA 2Y0MA 2LF8A 2RNJA 1DUXC 3QU6A 4KICA 5HS8A 3TKYA 2HWVA 3GUDA 4PZJA 1ZGAA 4RB2C 2HQRA 3MAJA 1IRFA 2YX4A 2G7UA 5HLIA 5EEHA 3V7SA 3I59B 1Y0UA 2O8XA 3F8BA 2GIVA 2QQ9A 3RJPA 1F5TA 2EFWA 3ZMDA 2HTJA 1JGSA 2VE8A 2EFOA 1XDSA 4A0ZA 2K86A 2ZFWA 4CXFA 3R0JA 2DPDA 1BIAA 5FLXK 1T98A 2FBIA 1ZG1A 3S2WA 1EH8A 1FPQA 1FP2A 2FSWA 2LNBA 3K1PA 3ELKA 4ESJA 5AIPA 4HOBA 4CYDA 4XRFA 2P6TA 2D1VA 2R7DA 4XBFA 5L3BA 2FMLA 5D6EA 5J8FA 3HRSA 1P4XA 4LK1F 3RDIA 4I0BA 1XCBA 4IPAA 3HTSB 2VOPA 2D45A 3EETA 3F6OA 4LMYA 3EYYA 1FBSA 2JRTA 3WGGA 4QBNA 4LG0A 2A07F 2E1NA 3LA7A 4GYGA 4OINF 2DAOA 2QWWA 1HQCA 3O3KA 2LDUA 3P9KA 4G6QA 2VC0A 5CVVA 1YYVA 5CVUA 3SZPA 4OIRF 2O61A 3C18A 2EK5A 4EJOA 2OQRA 3ECOA 5L3CA 4OMYA 1W7PD 2P7CB 2EB7A 1I27A 5D8KB 4YIIA 2GWRA 1FZPB 4U88A 3FXUA 4EJUA 2BBYA 2K02A 1G3TA 3L09A 2E7WA 3KETA 4TV7A 1CF7B 2UZKA 5L3GA 3Q5FA 1T39A 2ZCWA 5E1ZB 3KZYA 4HV6A 1BC8C 2FNAA 4G6DA 4YFXF 5HLHA 4A5MA 3V8LA 1Z1DA 2HYFA 1I6XA 3FHZA 4EJTA 3K1MA 3MWMA 1QZYA 1G6NA 3HUGA 2XKPA 5DUKA 1ZP7A 4LFUA 1UFMA 2XASA 2HFHA 3L9FA 4NB5A 3BPXA 2DTRA 3ROUA 3F3XA 2CWEA 4MEXF 3FM5A 1YS6A 3HSEA 5K1YA 1K78B 3WTVC 5BPDA 2JSCA 4D0PA 2A61A 1FNNA 1FBQA 4A6EA 3KLOA 4L5JA 3V7RA 3BWGA 4I01A 3FZVA 2QZ8A 4XSZF 4Q47A 4KN7X 3GYHX 2FEZA 1OMIA 2CW0F 4E70A 3TQNA 2XUBA 2STWA 3TO9A 2OKFA 4RGSA 5LRRA 3E6MA 3I0TA 2J5OA 1YW9A 3WTYC 3E5XA 4G7HF 4LJZF 4M9SA 5E18F 1T6SA 2BGCA 3DQVC 3PQJA 1RUOA 3KP5A 1H9TA 1OYYA 4M9ZA 5D5XB 4B8XA 5LHHA 1XMKA 5TRDA 5DCMA 2LKPA 3IL2A 2STTA 5CVIA 2HR3A 3RYPA 4FX0A 4G7OF 5DCFA 1PDNC 3FM3A 1E2XA 3WG9A 1KQ0A 3HRUA 5K5RA 1ONVA 4MTDA 3RPUA 3I58A 2L3DA 3MZYA 2L4MA 3WE2A 4KMUX 3T8RA 4A12A 3QP6A 1REPC 1KU2A 2OZUA 1W7PA 4KA4A 5ED4A 2Z3YA 2EA4A 2QYOA 4RB1A 2FMYA 5AONA 3D5LA 3P9IA 3FMQA 5L3FA 3ZMSA 4P5OA 1KU3A 1LDJA 1U3EM 2O03A 2RN7A 1TLHB 1BBYA 3I4PA 3WTXC 2H94A 4LK0F 1XGSA 2XV4S 3KCCA 3DF8A 5ICEA 4KUMA 2A6HF 2Z5UA 3L7WA 2OZ6A 4XLNF 5HS7A 1DDNA 3JW4A 2ZXJA 3GX4X 4G8XA 2EFPA 3CDHA 1YW8A 4IHSA 1BI3A 2PLYA 2QLZA 1XDUA 3RYRA 2EA2A 2HYGD 4ENJA 4WF2A 1IN4A 3TDUC 1Z05A 4EM1A 1UCRA 4EMSA 2KJBA 1BN5A 4S04A 6PAXA 1SD5A 2W85A 4HAMA 5JFRA 4HQEA 1O57A 1G4DA 4R79A 2XAGA 1TTYA 4P9UA 4LG0B 1RI7A 4MQVA 3BP8A 1IXCA 5JHUA 3EDPA 2FOKA 4TKDA 3GFIA 3HHGA 2HGCA 2PBIA 2Z33A 1R7JA 3U2RA 1LJ9A 1SFUA 1LQ1A 3E5QA 3SQNA 2PEXA 4WXDA 4HW0A 4KT5C 1JE8A 4B09A 3ZN0A 3E6CC 2ISYA 3B73A 2JZYA 4A0YA 2IW5A 3P9CA 4HYEA 4HDVA 2CYYA 3M1EA 1UHMA 2HKXA 5D5UB 2IT0A 4HX7A 4BNCA 1YLFA 1XMXA 1Z6TA 4WCGA 4IRHA 3KLNA 3ULQB 1L0OC 3WGHA 4ZYEA 1W4MA 4IRIA 1U8RA 2QENA 5FFZA 5HDKA 2COMA 4I02A 2D2WA 4I2OA 4KIBA 5CJ9A 3RKWA 4AD9A 2EWNA 4KDPA 2M30A 2V1XA 1KQ8A 1TQPA 4MEYF 1P4WA 3KP2A 3ZMUA 4L9JA 1WI9A 4PDKA 4ETSA 3WTZA 4HLYA 3JSOA 3ML6A 4WWCA 2DW4A 2R7FA 2RVCA 1MDMA 1A04A 1U2WA 3KFWX 3VOEA 5ICGA 4UUVA 3MCZA 2QVOA 1ZG3A 4ZYDA 3F72A 3GLXA 1G3SA 1ZYRF 2P5KA 4G94A 5H6QA 3IKTA 2BE5F 3M9AA 1ZLJA 1HBXG 5LRSA 3G3ZA 4FHTA 1HH1A 2EV6A 2VONA 4FT8A 2H6CA 1R23A 1XB4A 5FO5A 3R4KA 2WIWA 1B4AA 4Z2YA 4A5NA 4EGYA 2A3SA 5L3DA 5DCMB 4IXAA 2FF4A 4FX4A 4L0YB 3I71A 3QPHA 4EVIA 4UVCA 2KKOA 4JBAA 2QBYA 3TO7A 3ZMVA 1EH7A 2KRFA 2QM3A 2PFBA 1FYLA 4ASNA 4OOIA 1BOAA 2M45A 1IZ1A 1OPCA 1R5GA 2O6GE 1ON1A 5DDGA 1FYMA 2ZMEA 4KIFA 1FOKA 3AJVA 1W7PB 3T5XA 2HEOA 1WWXA 3ZP5A 4WX9A 1ZHFA 4U7DA 4L5IA 4NHJA 2XAFA 1T0FA 3EYIA 1FBUA 4ENKA 3VEPA 1R00A 1MJAA 3CUQA 1HKQA 5LEKA 1PP7U 2FU4A 2MLKA 1MZBA 2EO0A 4QBOA 2JPCA 2EV0A 4EV0A 2RDPA 3BJ6A 2EFNA 4UV9A 2F5FA 2E7XA 4BYYA 5H20A 3GZ5A 4CO8A 2CGPA 3GFJA 4Q4ZF 4LLLA 3U9GA 5CVRA 2Q0OA 4MTEA 4LGWA 3CLOA 4UHTA 2VC1A 4ENNA 1SFEA 3JAMK 4HA8A 5HS9A 3T0YA 1RIOH 1BM9A 3Q9VA 4HV5A 1J59A 3LWFA 4GXOA 4I98B 5E1WA 2PJPA 1OB9A 1IPIA 4S05A 4JQFA 3C3WA 2VBWA 2MC3A 2XIGA 2VLDA 1P2FA 3L00A 2RGVA 1O7FA 1H0MA 4Q5SF 1R1TA 4KNYA 5CYVA 3EQLF 2W57A 3DKWA 3KP7A 3K9TA 2FRHA 2P7VB 3FXQA 1LDKB 3I53A 2XAHA 3ERED 1O3RA 1TNSA 2G7HA 4AIKA 2Q2EA 1T2KA 3CUOA 3O2PE 2L54A 2CG4A 4UVBA 2OAZA 1WQ2A 3HYIA 3M7GA 3KEQA 1JHHA 1SMYF 2HTSA 4EJWA 3K69A 3R61A 2GW6A 3BOQA 3VFZA 4QLCU 2QUFA 3RKYA 2GA1A 5JVTA 1FWZA 3BJOA 3ABTA 4CICA 3V8KA 2NYXA 3J7AO 2HZTA 2IPQX 4YG2F 4O6JA 2EFQA 2L01A 5FD5A 3I54A 2ZNZA 1TQIA 1F9NA 2A68F 1XSXA 3F8FA 3IEYA 3ZQ7A 4KFCA 1X3UA 2MD5A 4OMZA 2V9VA 2ZBKA 3IHUA 1ULYA 2WCWA 3ISPA 2VXZA 4XLPF 2F5CA 5LEJA 1XSVA 1SFXA 1HSJA 4GO1A 4HLXA 4BAYA 1HXDA 5K5OA 1S8NA 1BI2A 3OOPA 2ZNYA 1GHCA 1J75A 1ODDA 1MDMB 1QBJA 1R36A 4U0YA 2WV0A 5ICFA 1Z7UA 2VT2A 3T1BA 5LGUA 4XSXF 3WTSC 3QRFF 1A79A 1XCVA 3JAMZ 4L0ZB 5CVJA 3W6KB 1E17A 3KZZA 2WCZA 5CLSA 1B9MA 1ZRCA 4A2UA 4LLNA 2ISZA 1I5ZA 2KJCA 2GA2A 1D8JA 4WXCA 4BHCA 2O0YA 1HKTA 3P1ZA 3FMSA 4M9XA 2VODA 2HKOA 2OBPA 3CUQC 3J80K 2OD5A 5JI6A 2QBYB 5ILSA 2GXGA 2C6YA 4F7ZA 1T38A 1LVAA 4U0WA 4LB6B 4EQQA 1MJBA 2PQ8A 3HOTA 2DO7A 5A2QZ 1QO0D 4KYWA 3TGNA 1YG2A 2ZMEB 2W84A 3AJVB 2DT5A 2W25A 3GVAA 4AIJA 4CHUA 1B9NA 2TDXA 2EJRA 4Y17A 3BPVA 5IT3A 2HQNA 2DFIA 1NHAA 4P9FA 3N4MA 3BY6A 3KP6A 3ZN1A 3CUQB 1B1BA 1YS7A 4ZYGA 5ICCA 1XMAA 2INBA 1F4KA 1GVJA 3KP3A 3KP4A 4RAZA 3GFMA 3DXJF 3WODF 1I1GA 1EH6A 3WGIA 4L9TA 2DLLA 1BC7C 3KE2A 4LB5A 4ESFA 2PN6A 2FNPA 4LD5A 3U1DA 4GYIA 5BOXA 2M8EA 2CFXA 3QP5A 2JPBA 4M71A 1R1VA 3R0AA 1IUYA 5F6FA 4Y15A 2XVCA 2MLGA 4M6XA 1KU9A 3DV8A 4AWXB 5LBQA 2W24A 4IJAA 3P7NA 1YQAA 2M1BA 2XAJA 4ON0A 3I64A 3LAPA 2AS5F 2P5VA 2XROA 4AVPA 5F64A 2FXAA 2YPRA 3FOVA 2IA0A 3ZMTA 4BH9A 3TDZC 1BJAA 1RNLA 4ZH4F 2WTEA 5KK1A 3COAC 2X0LA 4OIOF 1DP7P 1SD6A 1LDDA 2RQPA 1PUEE 2Q8KA 2IVMA 4RAYA 1WRJA 3T8TA 1ON2A 2A69F 3G73A 3CTAA 4P55A 3RIRA 5FGMA 2VOOA 4ESBA 2NNNA 3PQKA 1V3FA 2DBBA 2DQLA 3QOPA 1MGTA 3K1NA 1YTYA 3FMRA 5HOOA 2HDCA 1JHFA 4G7ZF 4N9HA 1IXRC 1ZARA 2KIMA 3K0LA 1J7KA 4ZZLA 5FDKA 1MKMA 1CGPA 1QQIA 1QZZA 1RZNA 2PMHA 5J6XA 3BZ6A 1XGOA 1P4AA 2DK8A 2B0LA 4ZZDA 5LGNA 5E8IA 1S7AA 4Y13A 1K79A 3BROA 5D4SA 4PGHA 2DK5A 1UB9A 1K7AA 2E1CA 2XHKA 2V6CA 3TOAA 4HX4A 3LA2A 3J80Z 2KIUA 3DPTA 2MA3A 4JK1X 1I1SA 2H27A 5BQTA 1OB8A 4QWQA 1YO5C 5J8CA 4OU0A 3JTGA 2X4HA 2P5LC 4YIFA 1G3YA 4M74A 2Z9OA 2ETHA 2FQ3A 1Z91A 1O3QA 2YU3A 2PMUA 2OA4A 2AXLA 2L02A 1J0RA 1FX7A 4O5VA 5D5WB 1ZG5A 4GCVA 1S3JA 4G9YA 5DV5A 1R0VA 5BS6A 1FYKA 3LA3A 2WJ0A 3Q9SA 3VODA 3WTWC 3QU3A 5D4RA 2XRNA 2EV5A 4EM2A 4L9NA 5D6FA 5DUIA 2ZYZA 3CJNA 1TQMA 1R11A 4MQ9F 5AIQA 5D5VB 5FD6A 1R5HA 1HKSA 3J81K 2P4WA 1OKRA 3QAHA 5DYMA 1PP8F 1TBXA 3LQQA 4BHPA 2O3FA 3QPTA 3MFKA 3H3UA 1HSTA 3EUHA 4QBLA 4BQAA 4HDUA 3P1ZB 2YSRA 1U5TA 5FB2A 2LSOA 1AOYA 1ZAOA 3TO6A 1GXQA 4HQMA 1R58A 4I0AA 3NRVA 2PG4A 3HIFA 1RZ4A 2DU9A 5L3EA 5ILUA 2F2EA 3RI4A 3FXRA 3P1YA 4M6YA 3F8MA 4A0XA 2H6BA 2IA1A 3SFZA 3E3VA 1LNWA 2VBZA 1H9GA 5IT9K 1W5SA 4CGZA 3B02A 1FT9A 4RGRA 3GEZA 4UVAA 2GXBA 4RS8A 2MH9A 1R22A 2KIFA 3V4GA 3IKVA 4R8HA 2CQKA 2BEOA 1IN6A 1J2XA 3FX3A 2NS0A 2FBHA 2OSTA 1TNTA 4IHTA 3E5UA 4HF0A 5ERIA 2ESHA 2Y75A 3N97A 2YR2A 2GZWA 3GXOA 2NNYA 5A2QK 1XD7A 3I5UA 3MEXA 2MBFA 2PI0A 1STZA 5JR3A 3NQOA 1IN8A 2RV8A 2RC4A 1ZLKA 5HLGA 4ZYHA 2BV6A 1FY7A 1QPMA 1O3TA 1ZGJA 3F8NA 2ADUA 4KMFA 3GWZA 1V4RA 4M72A 3SZTA 5E8GA 3DPLC 4R1HA 2ELHA 2VE9A 1W5TA 3WTUC 2A5YB 1IF1A 3PFIA 1KYWA 2HS5A 2R3SA 1F1ZA 2L4AA 2FBKA 1IW7F 2GAUA 1SAXA 2DPUA 3WU0A 2VT3A 3O6BB 3LQRA 1BI0A 1FLIA 4RGXA 1KYZA 1LB2A 3L2CA 1FSEA 1LEAA 3HHHA 5DD4A 2Z99A 5TJJA 1HW2A 3H92A 4PCQA 3HSRA 4RB0A 5HDGA 1VTNC 5KVRA 5D8LB 1TW2A 2DI3A 1KQ9A 4RGUA 3M8FA 4HF2A 2RKHA 5FLXZ 1EV7A 3K2ZA 2A6EF 3J81Z 3RPQA 4P96A 2VN2A 4K2EA 5ILVA 3RKXA 3GO5A 4GGGA 4Q48A 3F22A 1Y1OA 3IRRA 4L18B 3E6BA 2K27A 3F21A 3SXYA 3WU1B 4EGZA 2P8TA 4EJVA 5BPIA 3I59A 1QGPA 2VBXA 1J5YA 1QNTA 2IA2A 4AIHA 3NEUA 3CO6C 3IC7A 1KA8A 1IN7A 3R60A 4KN4X 4HBLA 5HVQC 3H3ZA 1SMTA 1Q1HA 3LSTA 1GXPA 1LEBA 2K4JA 2Y48A 4I09A 2CSOA 3C7JA 1B59A 2LF7A 3W6JB 1WSUA 1C0WA 5IT9Z 4UNOA 2CO5A 5BMZA
chains in the Genus database with same CATH superfamily
2H1LA 2COBA 3OL4A 4MHGA 1YJNI 5F04A 4BXUA 2FCOA 2K7LA 1K6OA 2GQQA 2X51A 1JUMA 4NNJA 3DBRB 1RLVA 1L3LA 2VJIA 2NAZA 1YJWI 4RB3C 4XR6A 1XSDA 1U78A 2LH9A 1FEXA 2V9PA 4YFNF 3PNTA 5GAHJ 1B6AA 5J1UA 1W5CC 1EJ9A 2E2IJ 2IRFG 2B9SA 1U5TC 3IWZA 5LLQA 4A3KJ 2ZYZB 1BA5A 1XGNA 3CCVI 4IO9F 2IEKA 4IHYA 3DU6A 2ACJA 2JN6A 1AKHB 4DYCA 2CV8A 2MD0A 1IRGA 3F8CA 1VQ9I 3QWLA 5F1RA 4XRMA 1WPKA 1FC3A 4OAYA 3JRBA 4A3DJ 3GCMA 4CDGA 2MH2A 3E6DA 2FOWA 3OYLA 2FA5A 3BTCA 2L5QA 3HRMA 1S6LA 2WIZA 5FFXA 3A01A 4KIGA 4AYBA 3NARA 3JRGA 2CJJA 5F27A 4CCJA 1TW3A 3VPRA 3B6AA 3L1PA 1WKMA 5LHIA 2RQQA 3RZDJ 1FOXA 2OC6A 2W1OA 3HBLA 1P6RA 3D1NI 3REOA 3IRQA 4DZJA 1OR7A 2UXNA 3OYAA 3A1YA 4ZTJA 2HPMA 2K4BA 5HDNA 3HOWJ 1EF4A 4NQWA 1GEFA 1MMAA 1CF7A 2G9WA 3GFLA 4D7NA 4BHBA 2OQGA 4PGGA 2D1HA 5IP7J 4DNCA 5EF6A 2WWYA 3CO7C 3D0SA 3ONQA 3LSMA 1FTTA 2QQAA 3V7CA 4A3LJ 3H35A 1U5TB 4BJTA 3RSNA 3DU5A 1Z9CA 3ZPLA 3FKJA 1WVRA 3HOSA 2OV7A 4HF1A 3HZJA 3ZR8X 2YX7A 1WI3A 2QF7A 1K4TA 2LFBA 3E97A 4G12A 1XN7A 4XKCA 3LSHA 3PNVA 4L9VA 2R5YB 4I7HA 2HOEA 2XGXA 5LHGA 4RAGA 2OUMA 3K4NA 3OYFA 3TW7A 4HZFA 2ZKZA 2BYVE 4BEHA 5HODA 5KHDA 4F93B 2IS6A 1O7LA 3F6VA 3WE3A 1OYWA 3F23A 2MC4A 3TOBA 4D5FA 4QTRA 3HTUA 3WTTC 4OIPF 4M73A 4A93J 1MNDA 2V1NA 1G3WA 4W97A 1ZRFA 5J4YA 2KL4A 3GF2A 4HX8A 4IVNA 2V79A 2K5CA 4DOZA 3DP7A 2VS1A 3JTHA 1MJ9A 1OCTC 2GJWA 3HRTA 2VBYA 4CUGA 4WXHA 2VL8A 3K4LA 5H6RA 2RAEA 4JX5A 1BW6A 5DD8A 2IGOA 3LSRA 2VKVA 2G0EA 4XLCA 1ZREA 3E1SA 2XKOA 3C1DA 5KAIC 4RDUA 1BI1A 1K78A 1OFCX 4EATA 1Z6RA 1KU7A 4AM3A 2JT1A 2M87A 3R6SA 4WK8F 2V1UA 2PJRB 2CW7A 4IHWA 3GTLJ 3SEZA 5HLTA 5DEQA 3DFGA 3CCSI 3CJTB 1O3SA 2ZJ2A 3OIQA 4UXNA 3S3MA 4OIQF 2J5PA 2PX9A 3SDGA 3OS1A 3AAFA 2QQBA 3U21A 1ZN2A 2WAQA 1XGMA 1DPUA 1ZH5A 1D0XA 1JT0A 3MZHA 3LFKA 3ZGKA 3JSPA 1OCZH 4BGDA 1YIOA 3BTIA 1TWAJ 1J9IA 5C44J 1T8IA 2VKEA 1R4MB 3HSFA 3CCMI 2V6EA 1QHHD 1USSA 4AVZA 3LAJA 1KGSA 4IQ4A 2ZO4A 3BJAA 4IRGA 4XMYA 3GW2A 3S2HJ 5E17F 4A6DA 2DQRA 3HGYA 2ESNA 4EM0B 2F5DA 2WC2A 2KRHA 1R71A 3HKZN 3RTRA 4BUPA 1N25A 2ZXIA 4BY7J 1AWCA 1MSEC 4N0BA 4X0GA 1FSHA 2JTVA 1DPRA 3FK7A 1D5VA 3OOUA 3OV8A 3W2AA 3OWTA 5EEGA 1P92A 4I6ZA 1D3YA 3ZQGA 4YFKF 1R1UA 1S7OA 1FP1D 2H09A 2EQRA 4IL6C 2XF6A 3OYGA 4BE2A 1FJLA 2WAEA 4MGRA 5J47A 1SD7A 2XAQA 3JRIA 1Y88A 4U7BA 4HEA2 1IXSB 2L9RA 4DYRA 1S29A 4O3MA 5J3LA 3BDDA 3FF5A 1ZRDA 3LL7A 4MNUA 2OU2A 1WJ5A 1WJCA 4E7ZA 1IAWA 3M8EA 1SD4A 4RLFA 4H0EA 2UXXA 5E3NA 4EV1A 1HC8A 4Z6YA 1HW1A 1YFHA 4UB6C 3VB2A 3IWFA 4UV8A 5FROA 4U0VA 3ZMZA 5GPAA 3MQ0A 1D8KA 2P6SA 5EYRA 3DNXA 2FUG2 2OF7A 2DFHA 1NK3P 5K5QA 1LFBA 2M0CA 1BIBA 1USTA 4IF4A 2IP2A 2M5WA 2HOTA 2HZDA 4LLGF 3ECHA 5E1XA 5F0HA 3DBHB 3FWEA 4CYCB 4FTHA 2I5UA 1IN5A 3ABUA 2NRAC 2F5EA 5LGTA 2V1DA 5E20A 3GZ6A 2UWMA 3DEUA 4YIRX 1RUNA 1YW7A 2LBFB 1UHWA 1MD0A 2IJLA 3KEOA 3OS0A 2FE3A 3V8JA 3SHFA 4BXFA 1HW5A 2GXAA 1TC3C 3NAUA 1HLVA 2K9MA 1JXSA 4N9IA 1V5EA 3BR3A 4CZZA 1OYIA 5DM6F 4DQ2A 3S1QJ 4ENMA 1U6GA 1Y1WJ 2I10A 4ZDLA 4TKKA 4ANJA 5M5WJ 2Y0MA 2LF8A 2RNJA 1DUXC 3E0JB 2E2HJ 5FJ8J 3QU6A 4KICA 5HS8A 3L2RA 1U8BA 1FTZA 3TKYA 2HWVA 4GRIA 3GUDA 4PZJA 3QQAA 3TP3A 1ZGAA 2LLKA 2DDAA 4RB2C 2HQRA 2LMDA 3MAJA 3I4MJ 2XGEA 3LMMA 1IC8A 2VKHA 1IRFA 2YX4A 3M07A 2G7UA 1R6RA 1BW5A 5HLIA 2BHYA 5EEHA 3V7SA 3I59B 2QEXI 1Y0UA 2O8XA 3F8BA 1T33A 2GIVA 2QQ9A 3RJPA 1F5TA 2EFWA 2CV1A 2JA7J 3DCFA 3ZMDA 4B47A 2HTJA 5KNLA 1JGSA 2VE8A 2EFOA 1XDSA 4XM3A 5GADJ 4A0ZA 2K86A 2ZFWA 4CXFA 1X1PA 3R0JA 2DPDA 1BIAA 5FKKA 5FLXK 2CUJA 1T98A 1SVMA 4YEJA 1VQNI 2AO9A 2FBIA 1ZG1A 3S2WA 1TWGJ 2Z16A 4AYBN 1EH8A 2KP6A 1I3QJ 3LSGA 2BY2A 1FPQA 2K40A 4E7IA 1FP2A 2FSWA 2LNBA 3K1PA 3OYDA 3ELKA 4NC6A 5EZHA 4ESJA 5AIPA 4HOBA 4F3QA 4CYDA 4XRFA 1I50J 2P6TA 2D1VA 2BOLA 2HQAA 2R7DA 4IOAF 4XBFA 3I9V2 2E5ZA 3G1MA 5L3BA 2FMLA 3OYBA 4IX7A 3OIPA 1D1BA 5D6EA 2Y2ZA 1XS9A 5J8FA 1OR7C 3HRSA 1P4XA 4BKXA 1DU0A 4LK1F 3RDIA 4X1EA 4I0BA 1XCBA 3J7YJ 2W48A 4IPAA 3BCAA 4RMNA 3W6VA 3G71I 3HTSB 2VOPA 1SFKA 2HNHA 4NBQA 2D45A 3EETA 3F6OA 4LMYA 4PSXA 1MBKA 3EYYA 1FBSA 3A02A 2JRTA 3G2BA 3WGGA 3ZQFA 1LFUP 3HOZJ 4QBNA 4LG0A 2DN0A 2A07F 3CJQB 2EZIA 2VQHA 2ELKA 1S5LC 2E1NA 3LA7A 4GYGA 4OINF 2DAOA 2QWWA 2FQ4A 5J40A 1HQCA 2DA7A 2LDUA 3O3KA 4E6ZA 3RPUD 2WA0A 3P9KA 3K2AA 1IG7A 4G6QA 2VC0A 1X1BA 5CVVA 1YYVA 5CKTA 5CVUA 3SZPA 4OAZA 4OIRF 2O61A 3C18A 2EK5A 4EJOA 1Y56A 4HPQA 3TW6A 2OQRA 3ECOA 5L3CA 3A01B 3ASNH 2H8RA 4OMYA 1W7PD 2LKSA 2P7CB 2EB7A 2ELJA 1GVDA 4LITA 1I27A 5D8KB 3Q3SA 4YIIA 1BR2A 2GWRA 4U88A 3OYKA 1FZPB 2E35A 3FXUA 4EJUA 5FKNA 1X1AA 2AHQA 3A0BC 4HRIA 2BBYA 2K02A 3HPHA 1G3TA 3L09A 3AG3H 3W2WA 2E7WA 4BQQA 3VSKA 2N8GA 3KETA 4TV7A 2FD5A 4NQWB 5GAEJ 1CF7B 2UZKA 5L3GA 1R9TJ 2UUZA 1WCMJ 2L7FP 3Q5FA 2DA1A 2V4JC 2KQRA 3FHNA 2ZCWA 1T39A 5E1ZB 1SVOA 3PIOF 3KZYA 2JA2A 2DOAA 1B72A 1EKEA 2WAQN 4HV6A 5IYBJ 1BC8C 2FNAA 4G6DA 4EEFG 4RBOA 2KDOA 4YFXF 2JA5J 5HLHA 2WBMA 4A5MA 3V8LA 3AG1H 1Z1DA 5K7HA 5HNFA 4BEHB 2HYFA 1I6XA 3FHZA 1YITI 1JUSA 3ABMH 4EJTA 3PUFA 3QYEA 3K1MA 3MWMA 1QZYA 1ZQ3P 1G59A 1G6NA 1DGWY 3A0HC 4XK4A 2HYJA 3MKWB 2YS9A 3WHCA 3HUGA 2XKPA 1M1EB 4ZJZA 3IUOA 4AUXA 1JI8A 5DUKA 2MGQA 1ZP7A 4A3BJ 4LFUA 1UFMA 2XASA 2HFHA 3L9FA 3GLLA 3BQZA 4NB5A 2OCEA 5KCMA 3BPXA 2DTRA 1D1CA 3ROUA 1XX5A 3LSJA 3F3XA 3HOVJ 2CWEA 2OCCH 4MEXF 5F0CA 1I3AA 3FM5A 1YS6A 3P5JA 2TCTA 3HSEA 5K1YA 2GOMA 1K78B 3KX2A 2JMWA 3WTVC 4YRVA 3S3OA 5BPDA 2JSCA 1Y1VJ 3S1MJ 4D0PA 2A61A 4DW6A 1XTAA 1FNNA 1FBQA 1TZLA 4A6EA 4HNVA 3KLOA 4L5JA 2QSGX 3V7RA 1MMSA 2IS2A 3CCRI 3BWGA 4I01A 3FZVA 4V2GA 2VB6A 2QZ8A 4XSZF 4HSTA 4Q47A 3ZCOA 3CCYA 1SC7A 2RREA 4KN7X 1TL8A 3GYHX 2FEZA 1OMIA 2CW0F 4E70A 3HGGA 1ERDA 3TQNA 2XUBA 3M4OJ 1FIAA 2STWA 4XN0A 2BHZA 3JRCA 3TEDA 4LIVA 4A3MJ 5IP9J 5FKMA 1N78A 2KRCA 3TO9A 2OKFA 3ZQCA 3BG5A 4RGSA 4U87A 2VASA 4QSHA 2E19A 4DAPA 5LRRA 3E6MA 3I0TA 4YELA 3IF0X 4PJLA 2NVYJ 3BQYA 2J5OA 2BXZA 5EEAA 4DA2A 1YW9A 5LD2C 3KPHA 3WTYC 3MZ8A 1GUUA 3E5XA 4G7HF 3BR5A 5E79C 2NOJB 4LJZF 3HDDA 4M9SA 5E18F 1T6SA 2BGCA 3DQVC 3PQJA 2CV0A 2VJJA 4PFOA 1RUOA 3ZXSA 3KP5A 2Y69H 3QYFA 2DBSA 3PJRA 2M4KA 1JKRC 4A3CJ 2DOEA 1H9TA 1YNMA 2O7OA 1OYYA 1WH7A 1MBHA 2DA2A 1RR8C 4B4CA 4M9ZA 5D5XB 4B8XA 1WZ2A 4C2MJ 5LHHA 1XMKA 5TRDA 4IKFA 3TP0A 5M3MJ 3WU2C 4OWRB 3K7AJ 1OCPA 1E0EA 5DCMA 4XL9A 4KISA 2LKPA 3IL2A 2STTA 3HJEA 3A4CA 5CVIA 2HR3A 3RYPA 4FX0A 4G7OF 3VSLA 5DCFA 4E7KA 1ORKA 1VQMI 3QYBA 1PDNC 3I56I 3FM3A 4Y33A 1E2XA 2X1EA 2XB0X 3WG9A 4PK4A 2WADA 3CQZJ 1KQ0A 3SFIA 4KJZA 3HRUA 4II3A 5K5RA 1ONVA 4XKBA 4MTDA 3RPUA 3I58A 2L3DA 3MZYA 2L4MA 3S16J 4XKVA 1ETXA 1VQ8I 3FXJA 3WE2A 3PNYA 2CH0A 4KMUX 3T8RA 4A12A 3QP6A 1TP4A 1REPC 1KU2A 2OZUA 1MH4A 1W7PA 4KA4A 2E71A 1XC5A 5ED4A 3N05A 3BLYA 2Z3YA 2EA4A 2QYOA 4M6VA 4N4NB 4RB1A 2FMYA 2O8KA 1GV2A 5B5EC 5AONA 3D5LA 3P9IA 2NVXJ 2ECBA 3FMQA 2X6YA 5L3FA 3ZMSA 4P5OA 5TISC 3EUHC 1Z21A 3L2UA 1KU3A 1LDJA 1U3EM 4ZC3A 3HG9A 1ZR4A 5E3MA 3J7ZI 3PUBA 1I6HJ 1FOWA 2O03A 2RN7A 3I4NJ 1TLHB 1MH3A 2JUCA 3HL2A 2DFEA 2Z2SB 3BTLA 1BBYA 3I4PA 3WTXC 2H94A 4LK0F 1XGSA 3S17J 2XV4S 3KCCA 3DF8A 3IH4A 1F36A 4HNTA 3GTKJ 5ICEA 4KUMA 2A6HF 4Y3OA 1Y0NA 5CQEA 2Z5UA 3L7WA 2OZ6A 2JQ7A 4Y52J 5JHFA 3K4KA 4XLNF 5HS7A 1XG1A 3O8GA 2EPFA 1DDNA 3JW4A 2CQNA 2ZXJA 3GX4X 4G8XA 2EFPA 3CDHA 1GT0C 5IOZA 5GPCA 2P81A 1YW8A 5IYCJ 4IHSA 3PSFA 3X2QH 1BI3A 2PLYA 2QLZA 1VI0A 3W2VA 1XDUA 3RYRA 2EA2A 2HYGD 2EZLA 4ENJA 4WF2A 3BTJA 4AU7A 1IN4A 3TDUC 1Z05A 2HXIA 4B3XA 2BY1A 1GDTA 2K85A 5BNGA 4EM1A 1UCRA 1T56A 4EMSA 2R7ZJ 2KJBA 1BN5A 1Q1VA 1ZKGA 4S04A 6PAXA 1SD5A 3H36A 3ZQIA 2W85A 4HAMA 2QSHX 5JFRA 1SVLA 4HQEA 1O57A 1G4DA 4R79A 2XAGA 3VYRB 4G6UA 1TTYA 4P9UA 4LG0B 3HC7A 2L7MP 3B6CA 1RI7A 4XOTA 4MQVA 3S8PA 1LE8A 1X4OA 3BP8A 2FJ1A 1JUPA 1IXCA 1DU6A 4CSWA 4KITB 1VNDA 5JHUA 2CV2A 3EDPA 2O9LA 3S2DJ 2FOKA 1YX5A 4TKDA 3GFIA 3HHGA 1QZEA 2HGCA 2W82A 2PBIA 2Z33A 1ACIA 1R7JA 3U2RA 1LJ9A 3FIWA 1SFUA 1LQ1A 3E5QA 3SQNA 3MN2A 1QRYA 2PEXA 4HW0A 4WXDA 9ANTA 4KT5C 4FETA 1JE8A 1E3PA 3FXOA 2QA4I 4B09A 2LG4A 4PJNA 5LFAA 3ZN0A 1YJ9I 4RM3A 4RAFA 3E6CC 2IGNA 1DQUA 2EH3A 2DT6A 2EBIA 2ISYA 3AG4H 3B73A 4JX6A 2NXNB 1H89C 1TT0A 1X1DA 2JZYA 4S0HB 4A0YA 2IW5A 2QKLB 3VDXA 3P9CA 4HYEA 4D7MA 1B72B 1IRZA 1P7IA 2FLCA 2ZJRF 4HDVA 1U9OA 2CYYA 2IBDA 1UHMA 3M1EA 3BT7A 3FISA 2IS1A 2HKXA 2VJ4A 5D5UB 2ICWG 2KDZA 1WJFA 4HX7A 3K10A 3K4CA 2IT0A 4BNCA 2JWTA 4J19A 4A3JJ 1YLFA 1XMXA 1Z6TA 1MIJA 2DFFA 3NWTA 2BZTA 4WCGA 4BJ5C 3OY9A 2KFDA 3OSFA 4IRHA 1MBJA 3KLNA 2VQLA 3ULQB 1VFCA 1L0OC 3RQIA 2VPRA 1WH5A 1X58A 2X6XA 3WGHA 4ZYEA 1W4MA 2CUFA 3SEQA 4IRIA 1U8RA 2QENA 5FFZA 2ECCA 2WAFA 4C3IJ 2COMA 3HUGB 4I02A 5HDKA 3DTKA 2R7UA 4XLFA 2D2WA 2DA4A 4I2OA 4KIBA 2ZSHB 1CQTA 5CJ9A 3RKWA 3V42A 2L0KA 4GDFA 1Z67A 4AD9A 2EWNA 2A05A 2QKMB 2IGKA 4KDPA 2M30A 4M3FA 4MLOA 3H0DA 2V1XA 1KQ8A 1W36D 1TQPA 2GBYA 4MEYF 1UJ8A 1P4WA 3KP2A 3ZMUA 4L9JA 1WI9A 4PDKA 1KONA 1HF0A 3RCOA 3GZNB 4ETSA 4C3JJ 3JRDA 3WTZA 1ENHA 4HLYA 3W3CA 2L2OA 2VQGA 4I99C 3JSOA 3ML6A 3OYNA 3GTMJ 4CCKA 4WWCA 1WJAA 2DW4A 2R7FA 2RVCA 2NVQJ 4HG2A 1D5YA 1MDMA 3BR0A 1PVEA 1TT5B 1A04A 1U2WA 1HOMA 3AG2H 2JJ7A 3KFWX 4CCLA 3VOEA 5ICGA 4UUVA 5FKOA 1YE9A 2NS7A 3MCZA 2GLOA 4Y7NJ 1ETOA 2QVOA 4MO7A 2Y9YA 3CC2I 1ZG3A 4ZYDA 3F72A 2KMUA 1E3HA 3GLXA 1X3WB 3LOCA 1G3SA 1ZYRF 2P5KA 4H4KC 3ZQQA 3DWLE 4G94A 5H6QA 3UNGC 5B66C 3IKTA 1Z0XA 2BE5F 2H8WA 3IAS2 2FX0A 2ZXHA 1WJBA 3RKQA 3M9AA 1ZLJA 4LIUA 4II2A 1APLC 1HBXG 3ZRGA 5LRSA 3G3ZA 4FHTA 1HH1A 1RPWA 2EV6A 2ME0A 2VONA 4FT8A 4CCOA 3H0GJ 2H6CA 1R23A 1XB4A 5FO5A 3KYLA 3R4KA 2XPWA 2EIKH 2M7AA 2LRDA 2WIWA 1AHDP 2VXDA 2R4GA 3S14J 1B4AA 4Z2YA 4A5NA 4EGYA 2A3SA 1ZELA 5L3DA 2DJIA 4DZPA 5DCMB 5GTHC 3SDBA 4IXAA 4V2FA 3QPLA 2FF4A 4CH7A 4FX4A 1H8AC 3VWBA 4L0YB 3I71A 3QPHA 4EVIA 4UVCA 2KKOA 3GTPJ 4JBAA 5B1AH 2JK3A 2QBYA 5HNHA 2ZSIB 3TO7A 3ZMVA 4A3FJ 2X9DA 1EH7A 1JTYA 2KRFA 2QM3A 2F5VA 2PFBA 3U1KA 1P9QC 4QPQA 2R7QA 4JP0A 4JOMA 2XGDA 1FYLA 1W0UA 4ASNA 2GOXB 4NUBA 4DBRA 3OYCA 4OOIA 1BOAA 2M45A 1IZ1A 5IPAA 1OPCA 1R5GA 1K83J 4CA0A 3DLLF 4BBSJ 2O6GE 1ON1A 5DDGA 1FYMA 2ZMEA 4KIFA 1FOKA 1WFXA 3AJVA 2IAIA 2ZB9A 1QVUA 2MYSA 1W7PB 3T5XA 2HEOA 2E34A 4BQNA 1WWXA 4B3AA 3ZP5A 3L2QA 4WX9A 4DBQA 1SFOJ 1ZHFA 1VQ5I 2X48A 4U7DA 5DS9A 4E7JA 4L5IA 4NHJA 3DKYA 2XAFA 1T0FA 1VQ7I 3EYIA 1FBUA 3MMYB 4ENKA 3VEPA 3A2KA 1R00A 1GV5A 1MJAA 3CUQA 1HKQA 2LY2A 5LEKA 1PP7U 2DMUA 2FU4A 2MLKA 1MZBA 2EO0A 4QBOA 3IH2A 1IRXA 2JPCA 3ASOH 2EV0A 4E6KG 4EV0A 2RDPA 3BJ6A 2EFNA 4UV9A 2F5FA 4M3BA 2VJ5A 2E7XA 5CPRB 4BL0B 5H20A 4BYYA 3GZ5A 4CO8A 4A3IJ 2CGPA 3GFJA 4Q4ZF 4N4OB 3GTOJ 4LLLA 3U9GA 5CVRA 2Q0OA 1BR1A 4LGWA 2EINH 3CLOA 2VC1A 4UHTA 4MTEA 4ENNA 4IHXA 2M4GA 1SFEA 3JAMK 4HA8A 5HS9A 3T0YA 4LOCA 1F43A 2PMZA 3Q0WA 1BM9A 1RIOH 1MBFA 3Q9VA 4HV5A 4E7LA 1J59A 3LWFA 4GXOA 5EJCA 4I98B 2HQ5A 5E1WA 5DM7F 1SEUA 2PJPA 1OB9A 4LQEA 4IHVA 1OJLA 1AU7A 1IPIA 4S05A 2I8DA 2W4SA 1SANA 2CQ7A 4JQFA 1VQKI 1D1AA 2OPTA 2VQCA 3C3WA 2VBWA 1VQPI 3I3LA 2MC3A 3BG3A 2XIGA 2VLDA 4ZDOA 1P2FA 3L00A 2RGVA 1O7FA 5KAFC 1H0MA 3HEFA 4Q5SF 1R1TA 2BW3A 1PYVA 4KNYA 1S7EA 5CYVA 2PJRA 3EQLF 2W57A 1UZCA 3DKWA 1Y8RB 3KP7A 3K70C 3K9TA 2LY1A 3OYMA 2FRHA 2L7KA 3S15J 3DKXA 4B43A 2AQFA 2P7VB 2KPMA 3FXQA 1LDKB 1MNEA 4M3EA 3LSIA 3HB9A 2YU9J 1OCOH 2O5RA 3I53A 1A6IA 1LE8B 2XAHA 3ERED 2M7BA 1O3RA 1TNSA 1K4SA 3BZCA 3BG9A 4BY1J 4JYKA 2G7HA 3CMYA 3RZOJ 4XRSG 4AIKA 1YI2I 2Q2EA 4PFPA 1JKPC 1ITYA 1T2KA 3CUOA 4PJJA 3O2PE 2DXIA 3H9GA 3H1CA 3GMEA 2L54A 2KZVA 2CG4A 2EZHA 2LK2A 2L9NA 5B3SH 1HA8A 3CC7I 1RRJA 2EIJH 2Y0SA 4UVBA 2HPIA 2OAZA 1V55H 1WQ2A 4E7SA 2DTZA 3HYIA 2X1DA 2HVSA 3M7GA 3KEQA 2GIZA 1JHHA 2VIXA 4G6VA 1IV8A 1SMYF 2WB1A 3CZ6A 2HTSA 2V7FA 4BU2A 4EJWA 4DAVA 1YRNA 4BDZA 4F52A 1VQ6I 3K69A 2K9LA 4ITVA 3SYTA 3R61A 2GW6A 3BOQA 4Y4RA 3FBIB 3VFZA 4QLCU 2QUFA 3CDIA 3Q0UA 4D5CA 1JGGA 3RKYA 2GA1A 1DP3A 3K4MA 4XOPA 5JVTA 3H9QA 5FRNA 3L2VA 1RETA 1FWZA 2LR8A 3BJOA 1A6QA 2DA5A 3ABTA 4CICA 2MG4A 1ZGWA 2JRMA 1HDPA 1MBEA 1ZR2A 3CMMA 1OLTA 3V8KA 3UR3C 2NYXA 3J7AO 2HZTA 2IPQX 4YG2F 1WJEA 4O6JA 3OYHA 2EFQA 2L01A 5FD5A 2Z1DA 3I54A 1LVKA 2ZNZA 3L2WA 1TQIA 1N77A 1F9NA 2A68F 2DJNA 3G1OA 1XSXA 2DYSH 3F8FA 3IEYA 1TWHJ 1T08B 1P7JA 3ZQ7A 3CESA 4KFCA 1X3UA 1PUFA 3BG7A 2MD5A 4OMZA 2V9VA 2ZBKA 4FE7A 3IHUA 3IP4B 1ULYA 1O4XA 1IDYA 2AXTC 2WCWA 3ISPA 1UG0A 2VXZA 4UUTA 2F5CA 3VYUB 5LEJA 4XLPF 1XSVA 1UAAA 1SFXA 3K6GA 1HSJA 4XQFA 4GO1A 4HLXA 4BAYA 1HXDA 2A5WA 5K5OA 3PIPF 1S8NA 3H3VK 1XPXA 1J09A 4LG3A 1BI2A 3OOPA 4E4HA 5JVGF 2ZNYA 1GHCA 1J75A 1ODDA 3H5NA 2HDDA 3CCEI 2R7XA 1MDMB 1QBJA 1R36A 3EUAA 4U0YA 2BXYA 1X2MA 2LD5A 1U0JA 1RC9A 2WV0A 5ICFA 3C2BA 2DOFA 3H5RA 1OCCH 2DA3A 3D5SC 1Z7UA 2VT2A 3T1BA 2DT7B 1UG2A 3PO2J 4F55A 4XIDA 5LGUA 4XSXF 3WTSC 2F4MB 3SJMA 3DLAA 5C4XJ 3QRFF 1A79A 1XCVA 3JAMZ 4L0ZB 5CVJA 3W6KB 2XC7A 1E17A 1VF9A 1RKWA 3MD2A 1UELB 3SZGA 4FQGA 5EZGA 3KZZA 2WCZA 3FXKA 5F1JA 5CLSA 1B9MA 1ZRCA 3M1CA 4A2UA 4LLNA 2E1MB 2ZMEC 2ISZA 4MIMA 1I5ZA 1GLNA 2CS3A 2KJCA 2GA2A 1D8JA 4WXCA 1G8XA 2CQXA 3K4JA 4BHCA 2O0YA 1HKTA 3P1ZA 1T0FC 3FMSA 4KT6A 1LKXA 4M9XA 2VODA 2HKOA 2YUSA 3CCUI 2OBPA 3CUQC 3J80K 4BACA 1MBGA 2DDBA 2OD5A 3OMYA 3EPZA 5JI6A 3ZQLA 2TRTA 2QBYB 1NTCA 3S3NA 1FMWA 5ILSA 2GXGA 2C6YA 3HOUJ 4F7ZA 1T38A 1LVAA 3EUKL 4U0WA 4LB6B 4IQJA 4EQQA 1MJBA 2E60A 2PQ8A 2PMZN 1TWFJ 3BR1A 2VLAA 4BE0A 4PJMA 1VQ4I 2L9SA 3LNQA 3HOTA 3LSPA 3HOXJ 2DO7A 5A2QZ 1QO0D 4KYWA 3TGNA 2QSFX 3ERMA 1V5FA 1YG2A 2ZMEB 2BVMA 2W84A 3AJVB 3S93A 2DT5A 1Y6IA 2LVSA 2W25A 5EDNA 3GTJJ 2DODA 3CF2A 3GVAA 1NG7A 4AIJA 4CHUA 4ZYAA 1B9NA 3WG7H 2TDXA 2EJRA 4Y17A 3BPVA 4F92B 1B8IA 4GFBA 3TL4X 5IT3A 2CZRA 1LPQA 2HQNA 2DFIA 1NHAA 4A3EJ 2CMPA 4P9FA 3N4MA 1MSFC 1JJ8C 3BY6A 3KP6A 3ZN1A 3J7AY 3CUQB 2Y30A 5FLMJ 1B1BA 1YS7A 2K9SA 5B1BH 4V19K 4ZYGA 5ICCA 1XMAA 2W8MA 1A31A 1JKOC 2INBA 1F4KA 1GVJA 3KP3A 3DTIA 1S9HA 3KP4A 4RAZA 1W36C 2HVRA 3GFMA 3DXJF 3WODF 1I1GA 2RNGA 1EH6A 4XNFA 4CCNA 2MSYA 3WGIA 3KIOA 4L9TA 2DLLA 4D9JA 1BC7C 3KE2A 3KYCB 4ESFA 4LB5A 2HOSA 2PN6A 2FNPA 2R93J 4LD5A 3U1DA 5J1RA 4GYIA 5J1YA 5BOXA 2M8EA 2CFXA 3QP5A 3I55I 3CF5F 2JPBA 3IH3A 4M71A 1UHSA 1R1VA 3D5RC 3R0AA 1IGNA 1IUYA 4BS9A 3HPGA 4MFDA 2CUZA 4XORA 5F6FA 4Y15A 2JSPA 5C4JJ 1ETYA 5TGTA 2XVCA 2MLGA 3KYDB 4M6XA 1U9NA 1KU9A 3G1LA 1D0YA 3DV8A 4AWXB 5H2FC 5LBQA 2W24A 3S1NJ 2XAUA 3JRHA 4IJAA 2R7WA 3P7NA 2Y0SN 4P1WA 1YQAA 3CMAI 2M1BA 2K3PA 3E7LA 3HOYJ 1QU3A 2XAJA 4ON0A 3C2HA 3I64A 2QCOA 3LAPA 3CCLI 5EGOA 1POGA 2AS5F 2P5VA 2WB1N 2CFOA 3FXMA 4XLAA 2XROA 4AVPA 5F64A 3CMEI 2FXAA 2YPRA 1A5JA 3FOVA 1V54H 2IA0A 2XB5A 3ZMTA 4XICA 4BH9A 1I39A 3TDZC 1BJAA 1RNLA 1E3OC 2BW3B 3GBGA 3PSIA 3ABKH 4UUSA 4MFEA 4ZH4F 2WTEA 2X85A 5KK1A 3COAC 2OTLI 2HOAA 2X0LA 4E7HA 1BJZA 2E1OA 4UY8I 2Q1ZB 4OIOF 1DP7P 2XPUA 2D5VA 2M34A 1SD6A 2GM4A 1LDDA 2HXOA 1X1CA 3TBIA 2RQPA 1PUEE 2Q8KA 1SAUA 2IVMA 2VPLA 4RAYA 1WRJA 3T8TA 1ON2A 4DIQA 4BDYA 2WY7Q 3KZIC 2K9QA 5J4VA 5EG0A 2NS8A 2A69F 2XPVA 3G73A 3CTAA 1IJWC 4P55A 3RIRA 4ZTFA 5FGMA 2DMPA 2XGCA 1MNMC 2VOOA 4ESBA 4B44A 1JKQC 2NNNA 3PQKA 1RR7A 1V3FA 2Q2EB 5F0FA 5FRMA 1LFPA 2DBBA 2DQLA 3QOPA 2DMQA 1MGTA 3K1NA 1YTYA 2ID3A 3FMRA 1KZHA 3G4SI 3JREA 5JLXA 5HOOA 2HDCA 5M3FJ 1JHFA 4G7ZF 1UMQA 2IGMA 4PUSA 5GAGJ 2JA6J 4N9HA 1IXRC 1Y8QB 1ZARA 2KIMA 4CCMA 2BY0A 2KLOA 3K0LA 2XDVA 3CLQA 1J7KA 4ZZLA 5FDKA 1MKMA 1CGPA 3PL8A 1QQIA 1QZZA 1VQLI 1AA7A 2NVTJ 1YRNB 1RZNA 2PMHA 5J6XA 2ZFUA 4FISA 3BZ6A 1XGOA 1P4AA 2DK8A 1FOYA 2LREA 2B0LA 1IDZA 4ZZDA 5LGNA 4AC0A 5E8IA 1S7AA 4Y13A 2Y31A 5K7FA 1K79A 3BROA 5D4SA 4X6AJ 4RM2A 4PGHA 2DK5A 2X1CA 1EA3A 3DTEA 1UB9A 2M3AA 1K7AA 2LC2A 2R5ZA 4A69C 2R7SA 2E1CA 4NDLA 1BR4A 2XHKA 2ZC2A 3CCJI 3UKGA 2V6CA 3TOAA 4HX4A 4L5EA 2EZKA 3GTGJ 3LA2A 2A6TA 4BJ6C 3J80Z 4NC7A 2KIUA 3DPTA 2MA3A 1WHUA 3CJRB 4ZDPA 2VKDA 4JK1X 1X2NA 1I1SA 1IUFA 2H27A 2P0WA 2V9KA 5BQTA 3BR6A 1OB8A 1X19A 4QWQA 2UV1A 3FK6A 1YO5C 2X6OA 5J8CA 2FL3A 4OU0A 3BG6A 1MMNA 3JTGA 2KHMA 2ID6A 1ETQA 2X4HA 3IEYB 2P5LC 1N75A 2W00A 2R0QC 4YIFA 4M3DA 1G3YA 3S1RJ 1PUFB 4M74A 1IV6A 2R7RA 2Z9OA 3OL3A 2ETHA 2FQ3A 1YHQI 1ZK8A 1Z91A 4C30A 1O3QA 4C2UA 2YU3A 2JJQA 2PMUA 4IEJA 2OA4A 3MKZA 4XRSA 5FLVA 2AXLA 3AKZA 2L02A 3VYTB 4BXXJ 2KT0A 3PFYA 3FKIJ 3ESWB 3OYIA 1ZTRA 1J0RA 1FX7A 4O5VA 5D5WB 1ZG5A 3AL0C 4GCVA 5K7ZA 1S3JA 4G9YA 5DV5A 1R0VA 5BS6A 2JVGA 1FYKA 2BY3A 3LA3A 3K4BA 4AIDA 3G6EI 2WJ0A 3Q9SA 3KEYA 3BR2A 2EIMH 2HU9A 3VODA 4F91B 1FMVA 3WTWC 3QU3A 5D4RA 2XRNA 2F6CA 2EV5A 1JTXA 4EM2A 4L9NA 5D6FA 5DUIA 1W0TA 2ZYZA 5CQGA 1YX3A 3ABLH 3Q0VA 3BZKA 3IV5A 1Z3YA 4XONA 2K9NA 3HXLA 3CJNA 1AKHA 1OCRH 1Z77A 3LSKA 1TQMA 2DMNA 4FE4A 4HNUA 1W1WE 4MQ9F 1R11A 2M8GX 3CCQI 2MFZA 3O8HA 5AIQA 1H88C 5D5VB 5FD6A 1R5HA 2CUEA 1HKSA 3MKLA 2NVUB 1PJRA 2XSDC 4B48A 3J81K 1NK2P 2P4WA 3PO3J 2LTPA 1OKRA 3QAHA 5DYMA 4HSRA 4J01A 1PP8F 3JR9A 2DMTA 1TBXA 3JRAA 3LQQA 3AL0B 3GTQJ 3M3YJ 4BHPA 5E3OA 2O3FA 2WV1A 2IS4A 3QPTA 3MFKA 4B1RA 3H3UA 5IP6A 1VQOI 1HSTA 3EUHA 2AQEA 3H9JA 4QBLA 4XLHA 4BQAA 4HDUA 3RQ4A 1YIJI 2OTJI 2YSRA 3P1ZB 3FXLA 1A35A 1U5TA 5FB2A 2MW8A 2E2JJ 4QIWN 2KZGA 5M5YJ 2LSOA 1AOYA 1ZAOA 2XF7A 3HM5A 1T95A 1Z3XA 1IO2A 3CP2A 3TO6A 2R5YA 1GXQA 3OS2A 4HQMA 5F08A 5IOYA 2DCEA 1R58A 2LY9A 3AFHA 4I0AA 4UB8C 3CD6I 3NRVA 3JRFA 1R5ID 2PG4A 3HIFA 1RZ4A 3NWSA 2DU9A 5E3LA 5L3EA 5ILUA 2QGUA 2F2EA 2V26A 3M8JA 4D1QA 1HDDC 3H5AA 3FXRA 3RI4A 1MW7A 3CDLA 3P1YA 2L7ZA 2MABA 3F8MA 4M6YA 4A0XA 4IZZA 3MKYB 1QHGA 2NOGA 2H6BA 2IA1A 5JLWA 3SFZA 4W1UA 3E3VA 1LNWA 2CU7A 3DBLB 1S72I 2VBZA 1H9GA 5IT9K 2M9HA 3JCUC 1W5SA 1Z7LA 3F9KA 4DYQA 4CGZA 2B63J 4BBRJ 3B02A 1FT9A 4RGRA 3GEZA 4UVAA 2HDWA 1B8IB 2GXBA 4RS8A 2MH9A 1R22A 2KIFA 3V4GA 3IKVA 2FKHB 4R8HA 2CQKA 2BEOA 2WY8Q 1IN6A 1J2XA 3FX3A 2NS0A 3BC8A 4FASD 2FBHA 2OSTA 1TNTA 1QPIA 3A03A 3OR2C 1K6YA 3QODA 4CZCA 1QA6A 4IHTA 3E5UA 4HF0A 3QPSA 5ERIA 2ESHA 2M2EA 2Y75A 2ZXWH 1X3ZB 2XRLA 2HI3A 2F4OB 3N97A 2JUGA 1JJ6C 2YR2A 2GZWA 2XF5A 3GXOA 2NNYA 1FIPA 5A2QK 1JT6A 1XD7A 2L9VA 3I5UA 4QPOA 3IAM2 2MBFA 3MEXA 1HCRA 4ABZA 2PI0A 1STZA 4XKWA 4XN3A 5JR3A 3OR1C 3NQOA 1IN8A 2RV8A 2RC4A 2DA6A 4IOCF 1A36A 1ZLKA 2H1KA 5HLGA 5FKLA 4ZYHA 2EILH 3ZOBA 2B7EA 5M5XJ 2BV6A 1FY7A 1QPMA 2R7VA 3DPUA 1O3TA 3C2GA 1ZGJA 2VI6A 3F8NA 2ADUA 4KMFA 3GWZA 1V4RA 2X6WA 3BCBA 4M72A 3SZTA 2CRGA 5EGOB 5E8GA 3DPLC 1R4NB 4M3GA 2LOOA 4R1HA 2IXSA 2JA8J 2QQ8A 2ELHA 3ZQHA 2FKCA 2HVQA 2VE9A 2KISA 1W5TA 3PM1A 4C2TA 2E36A 3WTUC 4J00A 4FCYA 4UUSB 2A5YB 1IF1A 2JVHA 3PFIA 1KYWA 2F4IA 2HS5A 1R49A 2R3SA 1F1ZA 1YOVB 2L4AA 2FBKA 1IW7F 2GAUA 4DGWB 2E5NA 2CW8A 1SAXA 1ETVA 2DPUA 2LKXA 1DGRM 3WU0A 5GP9A 2LP0A 3BT9A 2VT3A 3O6BB 3LQRA 1BI0A 1FLIA 1LUJB 2LYCA 4RGXA 1KYZA 1QVTA 1TWCJ 4DJAA 1LB2A 3L2CA 5EG0B 1FSEA 4CYCA 3OSGA 1LEAA 2K3FA 3HHHA 5DD4A 4C3HJ 5IYDJ 2BVLA 2Z99A 4I76A 4XLEA 5TJJA 1HW2A 3H92A 2LBFA 4PCQA 1WGXA 1RESA 3HSRA 4RB0A 5HDGA 1VTNC 5KVRA 1BL0A 5D8LB 2Z0RA 4RA2A 1TW2A 3QOEA 2DI3A 3HKZA 2BH2A 3F0CA 1KQ9A 4RGUA 1MMDA 3M8FA 2R92J 4HF2A 2RKHA 1VZ0A 1V5GA 2ZJPF 5FLXZ 2R7TA 4PJ0C 3CP8A 1EV7A 3K2ZA 2A6EF 3RPQA 3J81Z 3DEEA 2VUMJ 4P96A 1X4PA 2VN2A 1UWVA 4K2EA 5ILVA 2E1MC 1BOBA 3RKXA 3GO5A 4GGGA 4Q48A 3F22A 1Y1OA 4G6TB 3IRRA 4L18B 3E6BA 1ETKA 2K27A 3DEWA 2OJED 3F21A 3SXYA 3K70D 5IY5H 3WU1B 4EGZA 2P8TA 1K61A 4EJVA 5BPIA 3I59A 1QGPA 1RKTA 4PSWA 2R5ZB 5GTIC 2VBXA 3S32A 1WJDA 3LFUA 1J5YA 4ZQUA 1QNTA 3MVPA 1D0ZA 3OYJA 2IA2A 4AIHA 3NEUA 2W7NA 3CO6C 1NH3A 3IC7A 1KA8A 4RLQA 4JX4A 1NG6A 4C9YA 1IN7A 3R60A 3OYEA 1G2HA 3WHBA 4KN4X 2Y9ZA 4HBLA 5HVQC 4A3GJ 3H3ZA 5C3EJ 1SMTA 1Q1HA 3LSTA 1GXPA 1LEBA 3OIOA 1OISA 3FBNB 4BE1A 2ZJQF 2M0MA 4NC8A 2K4JA 2ME6A 3TMOA 2Y48A 3CC4I 4I09A 1OQYA 2CSOA 2XSJC 3FDYA 1Y39A 3C7JA 1B59A 3VYSB 2LF7A 5DTDA 2DYRH 2CQQA 2R7OA 1ETWA 3W6JB 2KIQA 1WSUA 2F48A 1C0WA 5IT9Z 4BQOA 4UNOA 2CO5A 1MMGA 5BMZA
chains in the Genus database with same CATH topology
4MHGA 4BXUA 2FCOA 2K7LA 1K6OA 2GQQA 1RLVA 1L3LA 2NAZA 4RB3C 1XSDA 1U78A 4YFNF 1B6AA 2IRFG 1U5TC 3IWZA 5LLQA 2ZYZB 1XGNA 2ACJA 2CV8A 1IRGA 3F8CA 5F1RA 1FC3A 4CDGA 2MH2A 3E6DA 2FA5A 3HRMA 1S6LA 2WIZA 5FFXA 4KIGA 1TW3A 1WKMA 5LHIA 1P6RA 3REOA 3IRQA 1OR7A 2UXNA 2K4BA 5HDNA 4NQWA 1GEFA 1CF7A 2G9WA 3GFLA 4BHBA 2OQGA 4PGGA 2D1HA 4DNCA 3CO7C 2WWYA 3D0SA 2QQAA 3V7CA 1U5TB 1Z9CA 3ZPLA 4HF1A 3HOSA 2YX7A 3E97A 1XN7A 4L9VA 4I7HA 2HOEA 2XGXA 5LHGA 4HZFA 2ZKZA 2BYVE 1O7LA 3F6VA 3WE3A 1OYWA 3F23A 3TOBA 3HTUA 3WTTC 4OIPF 4M73A 1G3WA 1ZRFA 3GF2A 4HX8A 4IVNA 2V79A 3DP7A 2VS1A 3JTHA 1MJ9A 2GJWA 3HRTA 2VBYA 4WXHA 5H6RA 5DD8A 1ZREA 2XKOA 3C1DA 1BI1A 1K78A 1Z6RA 1KU7A 2JT1A 2M87A 3R6SA 4WK8F 2V1UA 5DEQA 3DFGA 1O3SA 2ZJ2A 4UXNA 4OIQF 2J5PA 3AAFA 2QQBA 1ZN2A 1XGMA 1DPUA 1ZH5A 3MZHA 3LFKA 3JSPA 1YIOA 1J9IA 3HSFA 1USSA 3LAJA 1KGSA 2ZO4A 3BJAA 4IRGA 3GW2A 5E17F 4A6DA 2DQRA 2ESNA 4EM0B 2F5DA 2WC2A 3RTRA 1AWCA 4N0BA 1FSHA 2JTVA 1DPRA 1D5VA 3OV8A 5EEGA 1P92A 1D3YA 4YFKF 1R1UA 1S7OA 1FP1D 2H09A 4MGRA 1SD7A 2XAQA 1Y88A 4U7BA 1IXSB 1S29A 4O3MA 3BDDA 3FF5A 1ZRDA 4MNUA 2OU2A 1IAWA 3M8EA 1SD4A 4H0EA 4EV1A 2UXXA 1HW1A 1YFHA 3VB2A 3IWFA 4UV8A 4U0VA 3ZMZA 3MQ0A 1D8KA 2P6SA 3DNXA 5K5QA 1BIBA 1USTA 4IF4A 2IP2A 2M5WA 4LLGF 3ECHA 5E1XA 3FWEA 3ABUA 1IN5A 2NRAC 2F5EA 5LGTA 2V1DA 5E20A 3GZ6A 2UWMA 3DEUA 1RUNA 1YW7A 1UHWA 1MD0A 2IJLA 3KEOA 2FE3A 3V8JA 3SHFA 1HW5A 1JXSA 4N9IA 4CZZA 1OYIA 4DQ2A 4ENMA 1U6GA 4TKKA 2Y0MA 2LF8A 2RNJA 1DUXC 3QU6A 4KICA 5HS8A 3TKYA 2HWVA 3GUDA 4PZJA 1ZGAA 4RB2C 2HQRA 3MAJA 1IRFA 2YX4A 2G7UA 5HLIA 5EEHA 3V7SA 3I59B 1Y0UA 2O8XA 3F8BA 2GIVA 2QQ9A 3RJPA 1F5TA 2EFWA 3ZMDA 2HTJA 1JGSA 2VE8A 2EFOA 1XDSA 4A0ZA 2K86A 2ZFWA 4CXFA 3R0JA 2DPDA 1BIAA 5FLXK 1T98A 2FBIA 1ZG1A 3S2WA 1EH8A 1FPQA 1FP2A 2FSWA 2LNBA 3K1PA 3ELKA 4ESJA 5AIPA 4HOBA 4CYDA 4XRFA 2P6TA 2D1VA 2R7DA 4XBFA 5L3BA 2FMLA 5D6EA 5J8FA 3HRSA 1P4XA 4LK1F 3RDIA 4I0BA 1XCBA 4IPAA 3HTSB 2VOPA 2D45A 3EETA 3F6OA 4LMYA 3EYYA 1FBSA 2JRTA 3WGGA 4QBNA 4LG0A 2A07F 2E1NA 3LA7A 4GYGA 4OINF 2DAOA 2QWWA 1HQCA 3O3KA 2LDUA 4E6ZA 3P9KA 4G6QA 2VC0A 5CVVA 1YYVA 5CVUA 3SZPA 4OIRF 2O61A 3C18A 2EK5A 4EJOA 2OQRA 3ECOA 5L3CA 4OMYA 1W7PD 2P7CB 2EB7A 1I27A 5D8KB 4YIIA 2GWRA 1FZPB 4U88A 3FXUA 4EJUA 2BBYA 2K02A 1G3TA 3L09A 2E7WA 3KETA 4TV7A 1CF7B 2UZKA 5L3GA 3Q5FA 1T39A 2ZCWA 5E1ZB 3KZYA 4HV6A 1BC8C 2FNAA 4G6DA 4YFXF 5HLHA 4A5MA 3V8LA 1Z1DA 2HYFA 1I6XA 3FHZA 4EJTA 3K1MA 3MWMA 1QZYA 1G6NA 3HUGA 2XKPA 5DUKA 1ZP7A 4LFUA 1UFMA 2XASA 2HFHA 3L9FA 4NB5A 3BPXA 2DTRA 3ROUA 3F3XA 2CWEA 4MEXF 3FM5A 1YS6A 3HSEA 5K1YA 1K78B 3WTVC 5BPDA 2JSCA 4D0PA 2A61A 1FNNA 1FBQA 4A6EA 3KLOA 4L5JA 3V7RA 3BWGA 4I01A 3FZVA 2QZ8A 4XSZF 4Q47A 4KN7X 3GYHX 2FEZA 1OMIA 2CW0F 4E70A 3TQNA 2XUBA 2STWA 3TO9A 2OKFA 4RGSA 4DAPA 5LRRA 3E6MA 3I0TA 3IF0X 2J5OA 4DA2A 1YW9A 3WTYC 3E5XA 4G7HF 4LJZF 4M9SA 5E18F 1T6SA 2BGCA 3DQVC 3PQJA 1RUOA 3KP5A 2DBSA 1H9TA 1YNMA 1OYYA 4M9ZA 5D5XB 4B8XA 5LHHA 1XMKA 5TRDA 5DCMA 2LKPA 3IL2A 2STTA 5CVIA 2HR3A 3RYPA 4FX0A 4G7OF 5DCFA 1PDNC 3FM3A 1E2XA 3WG9A 1KQ0A 3HRUA 5K5RA 1ONVA 4MTDA 3RPUA 3I58A 2L3DA 3MZYA 2L4MA 3WE2A 4KMUX 3T8RA 4A12A 3QP6A 1REPC 1KU2A 2OZUA 1W7PA 4KA4A 5ED4A 2Z3YA 2EA4A 2QYOA 4RB1A 2FMYA 5AONA 3D5LA 3P9IA 3FMQA 5L3FA 3ZMSA 4P5OA 1KU3A 1LDJA 1U3EM 2O03A 2RN7A 1TLHB 1BBYA 3I4PA 3WTXC 2H94A 4LK0F 1XGSA 2XV4S 3KCCA 3DF8A 5ICEA 4KUMA 2A6HF 2Z5UA 3L7WA 2OZ6A 4XLNF 5HS7A 1DDNA 3JW4A 2ZXJA 3GX4X 4G8XA 2EFPA 3CDHA 1YW8A 4IHSA 1BI3A 2PLYA 2QLZA 1XDUA 3RYRA 2EA2A 2HYGD 4ENJA 4WF2A 1IN4A 3TDUC 1Z05A 4EM1A 1UCRA 4EMSA 2KJBA 1BN5A 4S04A 6PAXA 1SD5A 2W85A 4HAMA 5JFRA 4HQEA 1O57A 1G4DA 4R79A 2XAGA 4G6UA 1TTYA 4P9UA 4LG0B 1RI7A 4MQVA 3BP8A 1IXCA 5JHUA 3EDPA 2FOKA 4TKDA 3GFIA 3HHGA 2HGCA 2PBIA 2Z33A 1R7JA 3U2RA 1LJ9A 1SFUA 1LQ1A 3E5QA 3SQNA 2PEXA 4WXDA 4HW0A 4KT5C 1JE8A 4B09A 3ZN0A 3E6CC 2ISYA 3B73A 2JZYA 4A0YA 2IW5A 3P9CA 4HYEA 2FLCA 4HDVA 2CYYA 3M1EA 1UHMA 3BT7A 2HKXA 5D5UB 2IT0A 4HX7A 4BNCA 1YLFA 1XMXA 1Z6TA 4WCGA 4IRHA 3KLNA 3ULQB 1L0OC 3WGHA 4ZYEA 1W4MA 4IRIA 1U8RA 2QENA 5FFZA 5HDKA 2COMA 4I02A 2D2WA 4I2OA 4KIBA 5CJ9A 3RKWA 4AD9A 2EWNA 4KDPA 2M30A 2V1XA 1KQ8A 1TQPA 4MEYF 1P4WA 3KP2A 3ZMUA 4L9JA 1WI9A 4PDKA 4ETSA 3WTZA 4HLYA 3JSOA 3ML6A 4WWCA 2DW4A 2R7FA 2RVCA 1MDMA 1A04A 1U2WA 3KFWX 3VOEA 5ICGA 4UUVA 3MCZA 2QVOA 1ZG3A 4ZYDA 3F72A 3GLXA 1G3SA 1ZYRF 2P5KA 4G94A 5H6QA 3IKTA 2BE5F 3M9AA 1ZLJA 1HBXG 5LRSA 3G3ZA 4FHTA 1HH1A 2EV6A 2VONA 4FT8A 2H6CA 1R23A 1XB4A 5FO5A 3R4KA 2WIWA 1B4AA 4Z2YA 4A5NA 4EGYA 2A3SA 5L3DA 5DCMB 4IXAA 2FF4A 4FX4A 4L0YB 3I71A 3QPHA 4EVIA 4UVCA 2KKOA 4JBAA 2QBYA 3TO7A 3ZMVA 1EH7A 2KRFA 2QM3A 2PFBA 1FYLA 4ASNA 4OOIA 1BOAA 2M45A 1IZ1A 1OPCA 1R5GA 2O6GE 1ON1A 5DDGA 1FYMA 2ZMEA 4KIFA 1FOKA 3AJVA 1W7PB 3T5XA 2HEOA 1WWXA 3ZP5A 4WX9A 1ZHFA 4U7DA 4L5IA 4NHJA 2XAFA 1T0FA 3EYIA 1FBUA 4ENKA 3VEPA 1R00A 1MJAA 3CUQA 1HKQA 5LEKA 1PP7U 2FU4A 2MLKA 1MZBA 2EO0A 4QBOA 2JPCA 2EV0A 4EV0A 2RDPA 3BJ6A 2EFNA 4UV9A 2F5FA 2E7XA 4BYYA 5H20A 3GZ5A 4CO8A 2CGPA 3GFJA 4Q4ZF 4LLLA 3U9GA 5CVRA 2Q0OA 4MTEA 4LGWA 3CLOA 4UHTA 2VC1A 4ENNA 1SFEA 3JAMK 4HA8A 5HS9A 3T0YA 1RIOH 1BM9A 3Q9VA 4HV5A 1J59A 3LWFA 4GXOA 4I98B 5E1WA 2PJPA 1OB9A 4LQEA 1IPIA 4S05A 4JQFA 3C3WA 2VBWA 2MC3A 2XIGA 2VLDA 1P2FA 3L00A 2RGVA 1O7FA 1H0MA 4Q5SF 1R1TA 4KNYA 5CYVA 3EQLF 2W57A 3DKWA 3KP7A 3K9TA 2FRHA 2P7VB 3FXQA 1LDKB 3I53A 2XAHA 3ERED 1O3RA 1TNSA 2G7HA 4AIKA 2Q2EA 1T2KA 3CUOA 3O2PE 2L54A 2CG4A 4UVBA 2OAZA 1WQ2A 3HYIA 3M7GA 3KEQA 1JHHA 4G6VA 1SMYF 2HTSA 4DAVA 4EJWA 3K69A 3R61A 2GW6A 3BOQA 3VFZA 4QLCU 2QUFA 3RKYA 2GA1A 5JVTA 1FWZA 3BJOA 3ABTA 4CICA 3V8KA 2NYXA 3J7AO 2HZTA 2IPQX 4YG2F 4O6JA 2EFQA 2L01A 5FD5A 3I54A 2ZNZA 1TQIA 1F9NA 2A68F 1XSXA 3F8FA 3IEYA 3ZQ7A 4KFCA 1X3UA 2MD5A 4OMZA 2V9VA 2ZBKA 3IHUA 1ULYA 2WCWA 3ISPA 2VXZA 4XLPF 2F5CA 5LEJA 1XSVA 1SFXA 1HSJA 4GO1A 4HLXA 4BAYA 1HXDA 5K5OA 1S8NA 1BI2A 3OOPA 2ZNYA 1GHCA 1J75A 1ODDA 1MDMB 1QBJA 1R36A 4U0YA 2WV0A 5ICFA 1Z7UA 2VT2A 3T1BA 5LGUA 4XSXF 3WTSC 3QRFF 1A79A 1XCVA 3JAMZ 4L0ZB 5CVJA 3W6KB 1E17A 3KZZA 2WCZA 5CLSA 1B9MA 1ZRCA 4A2UA 4LLNA 2ISZA 1I5ZA 2KJCA 2GA2A 1D8JA 4WXCA 4BHCA 2O0YA 1HKTA 3P1ZA 3FMSA 4M9XA 2VODA 2HKOA 2OBPA 3CUQC 3J80K 2OD5A 5JI6A 2QBYB 5ILSA 2GXGA 2C6YA 4F7ZA 1T38A 1LVAA 4U0WA 4LB6B 4EQQA 1MJBA 2PQ8A 3HOTA 2DO7A 5A2QZ 1QO0D 4KYWA 3TGNA 1YG2A 2ZMEB 2W84A 3AJVB 2DT5A 2W25A 3GVAA 4AIJA 4CHUA 1B9NA 2TDXA 2EJRA 4Y17A 3BPVA 5IT3A 2CZRA 2HQNA 2DFIA 1NHAA 4P9FA 3N4MA 3BY6A 3KP6A 3ZN1A 3CUQB 1B1BA 1YS7A 4ZYGA 5ICCA 1XMAA 2W8MA 2INBA 1F4KA 1GVJA 3KP3A 3KP4A 4RAZA 3GFMA 3DXJF 3WODF 1I1GA 1EH6A 3WGIA 4L9TA 2DLLA 1BC7C 3KE2A 4LB5A 4ESFA 2PN6A 2FNPA 4LD5A 3U1DA 4GYIA 5BOXA 2M8EA 2CFXA 3QP5A 2JPBA 4M71A 1R1VA 3R0AA 1IUYA 5F6FA 4Y15A 2XVCA 2MLGA 4M6XA 1KU9A 3DV8A 4AWXB 5LBQA 2W24A 4IJAA 3P7NA 1YQAA 2M1BA 2XAJA 4ON0A 3I64A 3LAPA 2AS5F 2P5VA 2XROA 4AVPA 5F64A 2FXAA 2YPRA 3FOVA 2IA0A 3ZMTA 4BH9A 3TDZC 1BJAA 1RNLA 4ZH4F 2WTEA 5KK1A 3COAC 2X0LA 4OIOF 1DP7P 1SD6A 1LDDA 2RQPA 1PUEE 2Q8KA 2IVMA 4RAYA 1WRJA 3T8TA 1ON2A 2A69F 3G73A 3CTAA 4P55A 3RIRA 5FGMA 2VOOA 4ESBA 2NNNA 3PQKA 1V3FA 2DBBA 2DQLA 3QOPA 1MGTA 3K1NA 1YTYA 3FMRA 5HOOA 2HDCA 1JHFA 4G7ZF 4N9HA 1IXRC 1ZARA 2KIMA 3K0LA 1J7KA 4ZZLA 5FDKA 1MKMA 1CGPA 1QQIA 1QZZA 1RZNA 2PMHA 5J6XA 3BZ6A 1XGOA 1P4AA 2DK8A 2B0LA 4ZZDA 5LGNA 5E8IA 1S7AA 4Y13A 1K79A 3BROA 5D4SA 4PGHA 2DK5A 1UB9A 1K7AA 2E1CA 2XHKA 2V6CA 3TOAA 4HX4A 3LA2A 3J80Z 2KIUA 3DPTA 2MA3A 4JK1X 1I1SA 2H27A 5BQTA 1OB8A 4QWQA 1YO5C 5J8CA 2FL3A 4OU0A 3JTGA 2X4HA 3IEYB 2P5LC 4YIFA 1G3YA 4M74A 2Z9OA 2ETHA 2FQ3A 2JJQA 1Z91A 1O3QA 2YU3A 2PMUA 2OA4A 2AXLA 2L02A 1J0RA 1FX7A 4O5VA 5D5WB 1ZG5A 4GCVA 1S3JA 4G9YA 5DV5A 1R0VA 5BS6A 1FYKA 3LA3A 2WJ0A 3Q9SA 3VODA 3WTWC 3QU3A 5D4RA 2XRNA 2EV5A 4EM2A 4L9NA 5D6FA 5DUIA 2ZYZA 3CJNA 1TQMA 1R11A 4MQ9F 5AIQA 5D5VB 5FD6A 1R5HA 1HKSA 3J81K 2P4WA 1OKRA 3QAHA 5DYMA 1PP8F 1TBXA 3LQQA 4BHPA 2O3FA 3QPTA 3MFKA 3H3UA 1HSTA 3EUHA 4QBLA 4BQAA 4HDUA 3P1ZB 2YSRA 1U5TA 5FB2A 2LSOA 1AOYA 1ZAOA 3TO6A 1GXQA 4HQMA 1R58A 4I0AA 3NRVA 2PG4A 3HIFA 1RZ4A 2DU9A 5L3EA 5ILUA 2F2EA 3RI4A 3FXRA 3P1YA 4M6YA 3F8MA 4A0XA 2H6BA 2IA1A 3SFZA 3E3VA 1LNWA 2VBZA 1H9GA 5IT9K 1W5SA 4CGZA 3B02A 1FT9A 4RGRA 3GEZA 4UVAA 2GXBA 4RS8A 2MH9A 1R22A 2KIFA 3V4GA 3IKVA 2FKHB 4R8HA 2CQKA 2BEOA 1IN6A 1J2XA 3FX3A 2NS0A 2FBHA 2OSTA 1TNTA 4IHTA 3E5UA 4HF0A 5ERIA 2ESHA 2Y75A 3N97A 2YR2A 2GZWA 3GXOA 2NNYA 5A2QK 1XD7A 3I5UA 3MEXA 2MBFA 2PI0A 1STZA 5JR3A 3NQOA 1IN8A 2RV8A 2RC4A 1ZLKA 5HLGA 4ZYHA 2BV6A 1FY7A 1QPMA 1O3TA 1ZGJA 3F8NA 2ADUA 4KMFA 3GWZA 1V4RA 4M72A 3SZTA 5E8GA 3DPLC 4R1HA 2IXSA 2ELHA 2FKCA 2VE9A 1W5TA 3WTUC 2A5YB 1IF1A 3PFIA 1KYWA 2HS5A 2R3SA 1F1ZA 2L4AA 2FBKA 1IW7F 2GAUA 1SAXA 2DPUA 3WU0A 2VT3A 3O6BB 3LQRA 1BI0A 1FLIA 4RGXA 1KYZA 1LB2A 3L2CA 1FSEA 1LEAA 3HHHA 5DD4A 2Z99A 5TJJA 1HW2A 3H92A 4PCQA 3HSRA 4RB0A 5HDGA 1VTNC 5KVRA 5D8LB 2Z0RA 1TW2A 2DI3A 2BH2A 1KQ9A 4RGUA 3M8FA 4HF2A 2RKHA 5FLXZ 1EV7A 3K2ZA 2A6EF 3J81Z 3RPQA 4P96A 2VN2A 1UWVA 4K2EA 5ILVA 3RKXA 3GO5A 4GGGA 4Q48A 3F22A 1Y1OA 3IRRA 4L18B 3E6BA 2K27A 3F21A 3SXYA 3WU1B 4EGZA 2P8TA 4EJVA 5BPIA 3I59A 1QGPA 2VBXA 1J5YA 4ZQUA 1QNTA 2IA2A 4AIHA 3NEUA 3CO6C 3IC7A 1KA8A 1IN7A 3R60A 4KN4X 4HBLA 5HVQC 3H3ZA 1SMTA 1Q1HA 3LSTA 1GXPA 1LEBA 2K4JA 2Y48A 4I09A 2CSOA 3C7JA 1B59A 2LF7A 3W6JB 1WSUA 1C0WA 5IT9Z 4UNOA 2CO5A 5BMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHG A;  4BXU A;  2FCO A;  2K7L A;  1K6O A;  2GQQ A;  1RLV A;  1L3L A;  2NAZ A;  4RB3 C;  1XSD A;  1U78 A;  4YFN F;  1B6A A;  2IRF G;  1U5T C;  3IWZ A;  5LLQ A;  2ZYZ B;  1XGN A;  2ACJ A;  2CV8 A;  1IRG A;  3F8C A;  5F1R A;  1FC3 A;  4CDG A;  2MH2 A;  3E6D A;  2FA5 A;  3HRM A;  1S6L A;  2WIZ A;  5FFX A;  4KIG A;  1TW3 A;  1WKM A;  5LHI A;  1P6R A;  3REO A;  3IRQ A;  1OR7 A;  2UXN A;  2K4B A;  5HDN A;  4NQW A;  1GEF A;  1CF7 A;  2G9W A;  3GFL A;  4BHB A;  2OQG A;  4PGG A;  2D1H A;  4DNC A;  3CO7 C;  2WWY A;  3D0S A;  2QQA A;  3V7C A;  1U5T B;  1Z9C A;  3ZPL A;  4HF1 A;  3HOS A;  2YX7 A;  3E97 A;  1XN7 A;  4L9V A;  4I7H A;  2HOE A;  2XGX A;  5LHG A;  4HZF A;  2ZKZ A;  2BYV E;  1O7L A;  3F6V A;  3WE3 A;  1OYW A;  3F23 A;  3TOB A;  3HTU A;  3WTT C;  4OIP F;  4M73 A;  1G3W A;  1ZRF A;  3GF2 A;  4HX8 A;  4IVN A;  2V79 A;  3DP7 A;  3JTH A;  1MJ9 A;  2GJW A;  3HRT A;  2VBY A;  4WXH A;  5H6R A;  5DD8 A;  1ZRE A;  2XKO A;  3C1D A;  1BI1 A;  1K78 A;  1Z6R A;  1KU7 A;  2JT1 A;  2M87 A;  3R6S A;  4WK8 F;  2V1U A;  5DEQ A;  3DFG A;  1O3S A;  2ZJ2 A;  4UXN A;  4OIQ F;  2J5P A;  3AAF A;  2QQB A;  1ZN2 A;  1XGM A;  1DPU A;  1ZH5 A;  3MZH A;  3LFK A;  3JSP A;  1YIO A;  1J9I A;  3HSF A;  1USS A;  3LAJ A;  1KGS A;  2ZO4 A;  3BJA A;  4IRG A;  3GW2 A;  5E17 F;  4A6D A;  2DQR A;  2ESN A;  4EM0 B;  2F5D A;  2WC2 A;  3RTR A;  1AWC A;  4N0B A;  1FSH A;  2JTV A;  1DPR A;  1D5V A;  3OV8 A;  5EEG A;  1P92 A;  1D3Y A;  4YFK F;  1R1U A;  1S7O A;  1FP1 D;  2H09 A;  4MGR A;  1SD7 A;  2XAQ A;  1Y88 A;  4U7B A;  1IXS B;  1S29 A;  4O3M A;  3BDD A;  3FF5 A;  1ZRD A;  4MNU A;  2OU2 A;  1IAW A;  3M8E A;  1SD4 A;  4H0E A;  2UXX A;  1HW1 A;  1YFH A;  3VB2 A;  3IWF A;  4UV8 A;  4U0V A;  3ZMZ A;  3MQ0 A;  1D8K A;  2P6S A;  3DNX A;  5K5Q A;  1BIB A;  1UST A;  4IF4 A;  2IP2 A;  2M5W A;  4LLG F;  3ECH A;  5E1X A;  3FWE A;  3ABU A;  1IN5 A;  2NRA C;  2F5E A;  5LGT A;  2V1D A;  5E20 A;  3GZ6 A;  2UWM A;  3DEU A;  1RUN A;  1YW7 A;  1UHW A;  1MD0 A;  2IJL A;  3KEO A;  2FE3 A;  3V8J A;  3SHF A;  1HW5 A;  1JXS A;  4N9I A;  4CZZ A;  1OYI A;  4DQ2 A;  4ENM A;  1U6G A;  4TKK A;  2Y0M A;  2LF8 A;  2RNJ A;  1DUX C;  3QU6 A;  4KIC A;  5HS8 A;  3TKY A;  2HWV A;  3GUD A;  4PZJ A;  1ZGA A;  4RB2 C;  2HQR A;  3MAJ A;  1IRF A;  2YX4 A;  2G7U A;  5HLI A;  5EEH A;  3V7S A;  3I59 B;  1Y0U A;  2O8X A;  3F8B A;  2GIV A;  2QQ9 A;  3RJP A;  1F5T A;  2EFW A;  3ZMD A;  2HTJ A;  1JGS A;  2VE8 A;  2EFO A;  1XDS A;  4A0Z A;  2K86 A;  2ZFW A;  4CXF A;  3R0J A;  2DPD A;  1BIA A;  5FLX K;  1T98 A;  2FBI A;  1ZG1 A;  3S2W A;  1EH8 A;  1FPQ A;  1FP2 A;  2FSW A;  2LNB A;  3K1P A;  3ELK A;  4ESJ A;  5AIP A;  4HOB A;  4CYD A;  4XRF A;  2P6T A;  2D1V A;  2R7D A;  4XBF A;  5L3B A;  2FML A;  5D6E A;  5J8F A;  3HRS A;  1P4X A;  4LK1 F;  3RDI A;  4I0B A;  1XCB A;  4IPA A;  3HTS B;  2VOP A;  2D45 A;  3EET A;  3F6O A;  4LMY A;  3EYY A;  1FBS A;  2JRT A;  3WGG A;  4QBN A;  4LG0 A;  2A07 F;  2E1N A;  3LA7 A;  4GYG A;  4OIN F;  2DAO A;  2QWW A;  1HQC A;  3O3K A;  2LDU A;  3P9K A;  4G6Q A;  2VC0 A;  5CVV A;  1YYV A;  5CVU A;  3SZP A;  4OIR F;  2O61 A;  3C18 A;  2EK5 A;  4EJO A;  2OQR A;  3ECO A;  5L3C A;  4OMY A;  1W7P D;  2P7C B;  2EB7 A;  1I27 A;  5D8K B;  4YII A;  2GWR A;  1FZP B;  4U88 A;  3FXU A;  4EJU A;  2BBY A;  2K02 A;  1G3T A;  3L09 A;  2E7W A;  3KET A;  4TV7 A;  1CF7 B;  2UZK A;  5L3G A;  3Q5F A;  1T39 A;  2ZCW A;  5E1Z B;  3KZY A;  4HV6 A;  1BC8 C;  2FNA A;  4G6D A;  4YFX F;  5HLH A;  4A5M A;  3V8L A;  1Z1D A;  2HYF A;  1I6X A;  3FHZ A;  4EJT A;  3K1M A;  3MWM A;  1QZY A;  1G6N A;  3HUG A;  2XKP A;  5DUK A;  1ZP7 A;  4LFU A;  1UFM A;  2XAS A;  2HFH A;  3L9F A;  4NB5 A;  3BPX A;  2DTR A;  3ROU A;  3F3X A;  2CWE A;  4MEX F;  3FM5 A;  1YS6 A;  3HSE A;  5K1Y A;  1K78 B;  3WTV C;  5BPD A;  2JSC A;  4D0P A;  2A61 A;  1FNN A;  1FBQ A;  4A6E A;  3KLO A;  4L5J A;  3V7R A;  3BWG A;  4I01 A;  3FZV A;  2QZ8 A;  4XSZ F;  4Q47 A;  4KN7 X;  3GYH X;  2FEZ A;  1OMI A;  2CW0 F;  4E70 A;  3TQN A;  2XUB A;  2STW A;  3TO9 A;  2OKF A;  4RGS A;  5LRR A;  3E6M A;  3I0T A;  2J5O A;  1YW9 A;  3WTY C;  3E5X A;  4G7H F;  4LJZ F;  4M9S A;  5E18 F;  1T6S A;  2BGC A;  3DQV C;  3PQJ A;  1RUO A;  3KP5 A;  1H9T A;  1OYY A;  4M9Z A;  5D5X B;  4B8X A;  5LHH A;  1XMK A;  5TRD A;  5DCM A;  2LKP A;  3IL2 A;  2STT A;  5CVI A;  2HR3 A;  3RYP A;  4FX0 A;  4G7O F;  5DCF A;  1PDN C;  3FM3 A;  1E2X A;  3WG9 A;  1KQ0 A;  3HRU A;  5K5R A;  1ONV A;  4MTD A;  3RPU A;  3I58 A;  2L3D A;  3MZY A;  2L4M A;  3WE2 A;  4KMU X;  3T8R A;  4A12 A;  3QP6 A;  1REP C;  1KU2 A;  2OZU A;  1W7P A;  4KA4 A;  5ED4 A;  2Z3Y A;  2EA4 A;  2QYO A;  4RB1 A;  2FMY A;  5AON A;  3D5L A;  3P9I A;  3FMQ A;  5L3F A;  3ZMS A;  4P5O A;  1KU3 A;  1LDJ A;  1U3E M;  2O03 A;  2RN7 A;  1TLH B;  1BBY A;  3I4P A;  3WTX C;  2H94 A;  4LK0 F;  1XGS A;  2XV4 S;  3KCC A;  3DF8 A;  5ICE A;  4KUM A;  2A6H F;  2Z5U A;  3L7W A;  2OZ6 A;  4XLN F;  5HS7 A;  1DDN A;  3JW4 A;  2ZXJ A;  3GX4 X;  4G8X A;  2EFP A;  3CDH A;  1YW8 A;  4IHS A;  1BI3 A;  2PLY A;  2QLZ A;  1XDU A;  3RYR A;  2EA2 A;  2HYG D;  4ENJ A;  4WF2 A;  1IN4 A;  3TDU C;  1Z05 A;  4EM1 A;  1UCR A;  4EMS A;  2KJB A;  1BN5 A;  4S04 A;  6PAX A;  1SD5 A;  2W85 A;  4HAM A;  5JFR A;  4HQE A;  1O57 A;  1G4D A;  4R79 A;  2XAG A;  1TTY A;  4P9U A;  4LG0 B;  1RI7 A;  4MQV A;  3BP8 A;  1IXC A;  5JHU A;  3EDP A;  2FOK A;  4TKD A;  3GFI A;  3HHG A;  2HGC A;  2PBI A;  2Z33 A;  1R7J A;  3U2R A;  1LJ9 A;  1SFU A;  1LQ1 A;  3E5Q A;  3SQN A;  2PEX A;  4WXD A;  4HW0 A;  4KT5 C;  1JE8 A;  4B09 A;  3ZN0 A;  3E6C C;  2ISY A;  3B73 A;  2JZY A;  4A0Y A;  2IW5 A;  3P9C A;  4HYE A;  4HDV A;  2CYY A;  3M1E A;  1UHM A;  2HKX A;  5D5U B;  2IT0 A;  4HX7 A;  4BNC A;  1YLF A;  1XMX A;  1Z6T A;  4WCG A;  4IRH A;  3KLN A;  3ULQ B;  1L0O C;  3WGH A;  4ZYE A;  1W4M A;  4IRI A;  1U8R A;  2QEN A;  5FFZ A;  5HDK A;  2COM A;  4I02 A;  2D2W A;  4I2O A;  4KIB A;  5CJ9 A;  3RKW A;  4AD9 A;  2EWN A;  4KDP A;  2M30 A;  2V1X A;  1KQ8 A;  1TQP A;  4MEY F;  1P4W A;  3KP2 A;  3ZMU A;  4L9J A;  1WI9 A;  4PDK A;  4ETS A;  3WTZ A;  4HLY A;  3JSO A;  3ML6 A;  4WWC A;  2DW4 A;  2R7F A;  2RVC A;  1MDM A;  1A04 A;  1U2W A;  3KFW X;  3VOE A;  5ICG A;  4UUV A;  3MCZ A;  2QVO A;  1ZG3 A;  4ZYD A;  3F72 A;  3GLX A;  1G3S A;  1ZYR F;  2P5K A;  4G94 A;  5H6Q A;  3IKT A;  2BE5 F;  3M9A A;  1ZLJ A;  1HBX G;  5LRS A;  3G3Z A;  4FHT A;  1HH1 A;  2EV6 A;  2VON A;  4FT8 A;  2H6C A;  1R23 A;  1XB4 A;  5FO5 A;  3R4K A;  2WIW A;  1B4A A;  4Z2Y A;  4A5N A;  4EGY A;  2A3S A;  5L3D A;  5DCM B;  4IXA A;  2FF4 A;  4FX4 A;  4L0Y B;  3I71 A;  3QPH A;  4EVI A;  4UVC A;  2KKO A;  4JBA A;  2QBY A;  3TO7 A;  3ZMV A;  1EH7 A;  2KRF A;  2QM3 A;  2PFB A;  1FYL A;  4ASN A;  4OOI A;  1BOA A;  2M45 A;  1IZ1 A;  1OPC A;  1R5G A;  2O6G E;  1ON1 A;  5DDG A;  1FYM A;  2ZME A;  4KIF A;  1FOK A;  3AJV A;  1W7P B;  3T5X A;  2HEO A;  1WWX A;  3ZP5 A;  4WX9 A;  1ZHF A;  4U7D A;  4L5I A;  4NHJ A;  2XAF A;  1T0F A;  3EYI A;  1FBU A;  4ENK A;  3VEP A;  1R00 A;  1MJA A;  3CUQ A;  1HKQ A;  5LEK A;  1PP7 U;  2FU4 A;  2MLK A;  1MZB A;  2EO0 A;  4QBO A;  2JPC A;  2EV0 A;  4EV0 A;  2RDP A;  3BJ6 A;  2EFN A;  4UV9 A;  2F5F A;  2E7X A;  4BYY A;  5H20 A;  3GZ5 A;  4CO8 A;  2CGP A;  3GFJ A;  4Q4Z F;  4LLL A;  3U9G A;  5CVR A;  2Q0O A;  4MTE A;  4LGW A;  3CLO A;  4UHT A;  2VC1 A;  4ENN A;  1SFE A;  3JAM K;  4HA8 A;  5HS9 A;  3T0Y A;  1RIO H;  1BM9 A;  3Q9V A;  4HV5 A;  1J59 A;  3LWF A;  4GXO A;  4I98 B;  5E1W A;  2PJP A;  1OB9 A;  1IPI A;  4S05 A;  4JQF A;  3C3W A;  2VBW A;  2MC3 A;  2XIG A;  2VLD A;  1P2F A;  3L00 A;  2RGV A;  1O7F A;  1H0M A;  4Q5S F;  1R1T A;  4KNY A;  5CYV A;  3EQL F;  2W57 A;  3DKW A;  3KP7 A;  3K9T A;  2FRH A;  2P7V B;  3FXQ A;  1LDK B;  3I53 A;  2XAH A;  3ERE D;  1O3R A;  1TNS A;  2G7H A;  4AIK A;  2Q2E A;  1T2K A;  3CUO A;  3O2P E;  2L54 A;  2CG4 A;  4UVB A;  2OAZ A;  1WQ2 A;  3HYI A;  3M7G A;  3KEQ A;  1JHH A;  1SMY F;  2HTS A;  4EJW A;  3K69 A;  3R61 A;  2GW6 A;  3BOQ A;  3VFZ A;  4QLC U;  2QUF A;  3RKY A;  2GA1 A;  5JVT A;  1FWZ A;  3BJO A;  3ABT A;  4CIC A;  3V8K A;  2NYX A;  3J7A O;  2HZT A;  2IPQ X;  4YG2 F;  4O6J A;  2EFQ A;  2L01 A;  5FD5 A;  3I54 A;  2ZNZ A;  1TQI A;  1F9N A;  2A68 F;  1XSX A;  3F8F A;  3IEY A;  3ZQ7 A;  4KFC A;  1X3U A;  2MD5 A;  4OMZ A;  2V9V A;  2ZBK A;  3IHU A;  1ULY A;  2WCW A;  3ISP A;  2VXZ A;  4XLP F;  2F5C A;  5LEJ A;  1XSV A;  1SFX A;  1HSJ A;  4GO1 A;  4HLX A;  4BAY A;  1HXD A;  5K5O A;  1S8N A;  1BI2 A;  3OOP A;  2ZNY A;  1GHC A;  1J75 A;  1ODD A;  1MDM B;  1QBJ A;  1R36 A;  4U0Y A;  2WV0 A;  5ICF A;  1Z7U A;  2VT2 A;  3T1B A;  5LGU A;  4XSX F;  3WTS C;  3QRF F;  1A79 A;  1XCV A;  3JAM Z;  4L0Z B;  5CVJ A;  3W6K B;  1E17 A;  3KZZ A;  2WCZ A;  5CLS A;  1B9M A;  1ZRC A;  4A2U A;  4LLN A;  2ISZ A;  1I5Z A;  2KJC A;  2GA2 A;  1D8J A;  4WXC A;  4BHC A;  2O0Y A;  1HKT A;  3P1Z A;  3FMS A;  4M9X A;  2VOD A;  2HKO A;  2OBP A;  3CUQ C;  3J80 K;  2OD5 A;  5JI6 A;  2QBY B;  5ILS A;  2GXG A;  2C6Y A;  4F7Z A;  1T38 A;  1LVA A;  4U0W A;  4LB6 B;  4EQQ A;  1MJB A;  2PQ8 A;  3HOT A;  2DO7 A;  5A2Q Z;  1QO0 D;  4KYW A;  3TGN A;  1YG2 A;  2ZME B;  2W84 A;  3AJV B;  2DT5 A;  2W25 A;  3GVA A;  4AIJ A;  4CHU A;  1B9N A;  2TDX A;  2EJR A;  4Y17 A;  3BPV A;  5IT3 A;  2HQN A;  2DFI A;  1NHA A;  4P9F A;  3N4M A;  3BY6 A;  3KP6 A;  3ZN1 A;  3CUQ B;  1B1B A;  1YS7 A;  4ZYG A;  5ICC A;  1XMA A;  2INB A;  1F4K A;  1GVJ A;  3KP3 A;  3KP4 A;  4RAZ A;  3GFM A;  3DXJ F;  3WOD F;  1I1G A;  1EH6 A;  3WGI A;  4L9T A;  2DLL A;  1BC7 C;  3KE2 A;  4LB5 A;  4ESF A;  2PN6 A;  2FNP A;  4LD5 A;  3U1D A;  4GYI A;  5BOX A;  2M8E A;  2CFX A;  3QP5 A;  2JPB A;  4M71 A;  1R1V A;  3R0A A;  1IUY A;  5F6F A;  4Y15 A;  2XVC A;  2MLG A;  4M6X A;  1KU9 A;  3DV8 A;  4AWX B;  5LBQ A;  2W24 A;  4IJA A;  3P7N A;  1YQA A;  2M1B A;  2XAJ A;  4ON0 A;  3I64 A;  3LAP A;  2AS5 F;  2P5V A;  2XRO A;  4AVP A;  5F64 A;  2FXA A;  2YPR A;  3FOV A;  2IA0 A;  3ZMT A;  4BH9 A;  3TDZ C;  1BJA A;  1RNL A;  4ZH4 F;  2WTE A;  5KK1 A;  3COA C;  2X0L A;  4OIO F;  1DP7 P;  1SD6 A;  1LDD A;  2RQP A;  1PUE E;  2Q8K A;  2IVM A;  4RAY A;  1WRJ A;  3T8T A;  1ON2 A;  2A69 F;  3G73 A;  3CTA A;  4P55 A;  3RIR A;  5FGM A;  2VOO A;  4ESB A;  2NNN A;  3PQK A;  1V3F A;  2DBB A;  2DQL A;  3QOP A;  1MGT A;  3K1N A;  1YTY A;  3FMR A;  5HOO A;  2HDC A;  1JHF A;  4G7Z F;  4N9H A;  1IXR C;  1ZAR A;  2KIM A;  3K0L A;  1J7K A;  4ZZL A;  5FDK A;  1MKM A;  1CGP A;  1QQI A;  1QZZ A;  1RZN A;  2PMH A;  5J6X A;  3BZ6 A;  1XGO A;  1P4A A;  2DK8 A;  2B0L A;  4ZZD A;  5LGN A;  5E8I A;  1S7A A;  4Y13 A;  1K79 A;  3BRO A;  5D4S A;  4PGH A;  2DK5 A;  1UB9 A;  1K7A A;  2E1C A;  2XHK A;  2V6C A;  3TOA A;  4HX4 A;  3LA2 A;  3J80 Z;  2KIU A;  3DPT A;  2MA3 A;  4JK1 X;  1I1S A;  2H27 A;  5BQT A;  1OB8 A;  4QWQ A;  1YO5 C;  5J8C A;  4OU0 A;  3JTG A;  2X4H A;  2P5L C;  4YIF A;  1G3Y A;  4M74 A;  2Z9O A;  2ETH A;  2FQ3 A;  1Z91 A;  1O3Q A;  2YU3 A;  2PMU A;  2OA4 A;  2AXL A;  2L02 A;  1J0R A;  1FX7 A;  4O5V A;  5D5W B;  1ZG5 A;  4GCV A;  1S3J A;  4G9Y A;  5DV5 A;  1R0V A;  5BS6 A;  1FYK A;  3LA3 A;  2WJ0 A;  3Q9S A;  3VOD A;  3WTW C;  3QU3 A;  5D4R A;  2XRN A;  2EV5 A;  4EM2 A;  4L9N A;  5D6F A;  5DUI A;  2ZYZ A;  3CJN A;  1TQM A;  1R11 A;  4MQ9 F;  5AIQ A;  5D5V B;  5FD6 A;  1R5H A;  1HKS A;  3J81 K;  2P4W A;  1OKR A;  3QAH A;  5DYM A;  1PP8 F;  1TBX A;  3LQQ A;  4BHP A;  2O3F A;  3QPT A;  3MFK A;  3H3U A;  1HST A;  3EUH A;  4QBL A;  4BQA A;  4HDU A;  3P1Z B;  2YSR A;  1U5T A;  5FB2 A;  2LSO A;  1AOY A;  1ZAO A;  3TO6 A;  1GXQ A;  4HQM A;  1R58 A;  4I0A A;  3NRV A;  2PG4 A;  3HIF A;  1RZ4 A;  2DU9 A;  5L3E A;  5ILU A;  2F2E A;  3RI4 A;  3FXR A;  3P1Y A;  4M6Y A;  3F8M A;  4A0X A;  2H6B A;  2IA1 A;  3SFZ A;  3E3V A;  1LNW A;  2VBZ A;  1H9G A;  5IT9 K;  1W5S A;  4CGZ A;  3B02 A;  1FT9 A;  4RGR A;  3GEZ A;  4UVA A;  2GXB A;  4RS8 A;  2MH9 A;  1R22 A;  2KIF A;  3V4G A;  3IKV A;  4R8H A;  2CQK A;  2BEO A;  1IN6 A;  1J2X A;  3FX3 A;  2NS0 A;  2FBH A;  2OST A;  1TNT A;  4IHT A;  3E5U A;  4HF0 A;  5ERI A;  2ESH A;  2Y75 A;  3N97 A;  2YR2 A;  2GZW A;  3GXO A;  2NNY A;  5A2Q K;  1XD7 A;  3I5U A;  3MEX A;  2MBF A;  2PI0 A;  1STZ A;  5JR3 A;  3NQO A;  1IN8 A;  2RV8 A;  2RC4 A;  1ZLK A;  5HLG A;  4ZYH A;  2BV6 A;  1FY7 A;  1QPM A;  1O3T A;  1ZGJ A;  3F8N A;  2ADU A;  4KMF A;  3GWZ A;  1V4R A;  4M72 A;  3SZT A;  5E8G A;  3DPL C;  4R1H A;  2ELH A;  2VE9 A;  1W5T A;  3WTU C;  2A5Y B;  1IF1 A;  3PFI A;  1KYW A;  2HS5 A;  2R3S A;  1F1Z A;  2L4A A;  2FBK A;  1IW7 F;  2GAU A;  1SAX A;  2DPU A;  3WU0 A;  2VT3 A;  3O6B B;  3LQR A;  1BI0 A;  1FLI A;  4RGX A;  1KYZ A;  1LB2 A;  3L2C A;  1FSE A;  1LEA A;  3HHH A;  5DD4 A;  2Z99 A;  5TJJ A;  1HW2 A;  3H92 A;  4PCQ A;  3HSR A;  4RB0 A;  5HDG A;  1VTN C;  5KVR A;  5D8L B;  1TW2 A;  2DI3 A;  1KQ9 A;  4RGU A;  3M8F A;  4HF2 A;  2RKH A;  5FLX Z;  1EV7 A;  3K2Z A;  2A6E F;  3J81 Z;  3RPQ A;  4P96 A;  2VN2 A;  4K2E A;  5ILV A;  3RKX A;  3GO5 A;  4GGG A;  4Q48 A;  3F22 A;  1Y1O A;  3IRR A;  4L18 B;  3E6B A;  2K27 A;  3F21 A;  3SXY A;  3WU1 B;  4EGZ A;  2P8T A;  4EJV A;  5BPI A;  3I59 A;  1QGP A;  2VBX A;  1J5Y A;  1QNT A;  2IA2 A;  4AIH A;  3NEU A;  3CO6 C;  3IC7 A;  1KA8 A;  1IN7 A;  3R60 A;  4KN4 X;  4HBL A;  5HVQ C;  3H3Z A;  1SMT A;  1Q1H A;  3LST A;  1GXP A;  1LEB A;  2K4J A;  2Y48 A;  4I09 A;  2CSO A;  3C7J A;  1B59 A;  2LF7 A;  3W6J B;  1WSU A;  1C0W A;  5IT9 Z;  4UNO A;  2CO5 A;  5BMZ A; 
#chains in the Genus database with same CATH topology
 2H1L A;  2COB A;  3OL4 A;  4MHG A;  1YJN I;  5F04 A;  4BXU A;  2FCO A;  2K7L A;  1K6O A;  2GQQ A;  2X51 A;  1JUM A;  4NNJ A;  3DBR B;  1RLV A;  1L3L A;  2VJI A;  2NAZ A;  1YJW I;  4RB3 C;  4XR6 A;  1XSD A;  1U78 A;  2LH9 A;  1FEX A;  2V9P A;  4YFN F;  3PNT A;  5GAH J;  1B6A A;  5J1U A;  1W5C C;  1EJ9 A;  2E2I J;  2IRF G;  2B9S A;  1U5T C;  3IWZ A;  5LLQ A;  4A3K J;  2ZYZ B;  1BA5 A;  1XGN A;  3CCV I;  4IO9 F;  2IEK A;  4IHY A;  3DU6 A;  2ACJ A;  2JN6 A;  1AKH B;  4DYC A;  2CV8 A;  2MD0 A;  1IRG A;  3F8C A;  1VQ9 I;  3QWL A;  5F1R A;  4XRM A;  1WPK A;  1FC3 A;  4OAY A;  3JRB A;  4A3D J;  3GCM A;  4CDG A;  2MH2 A;  3E6D A;  2FOW A;  3OYL A;  2FA5 A;  3BTC A;  2L5Q A;  3HRM A;  1S6L A;  2WIZ A;  5FFX A;  3A01 A;  4KIG A;  4AYB A;  3NAR A;  3JRG A;  2CJJ A;  5F27 A;  4CCJ A;  1TW3 A;  3VPR A;  3B6A A;  3L1P A;  1WKM A;  5LHI A;  2RQQ A;  3RZD J;  1FOX A;  2OC6 A;  2W1O A;  3HBL A;  1P6R A;  3D1N I;  3REO A;  3IRQ A;  4DZJ A;  1OR7 A;  2UXN A;  3OYA A;  3A1Y A;  4ZTJ A;  2HPM A;  2K4B A;  5HDN A;  3HOW J;  1EF4 A;  4NQW A;  1GEF A;  1MMA A;  1CF7 A;  2G9W A;  3GFL A;  4D7N A;  4BHB A;  2OQG A;  4PGG A;  2D1H A;  5IP7 J;  4DNC A;  5EF6 A;  2WWY A;  3CO7 C;  3D0S A;  3ONQ A;  3LSM A;  1FTT A;  2QQA A;  3V7C A;  4A3L J;  3H35 A;  1U5T B;  4BJT A;  3RSN A;  3DU5 A;  1Z9C A;  3ZPL A;  3FKJ A;  1WVR A;  3HOS A;  2OV7 A;  4HF1 A;  3HZJ A;  3ZR8 X;  2YX7 A;  1WI3 A;  2QF7 A;  1K4T A;  2LFB A;  3E97 A;  4G12 A;  1XN7 A;  4XKC A;  3LSH A;  3PNV A;  4L9V A;  2R5Y B;  4I7H A;  2HOE A;  2XGX A;  5LHG A;  4RAG A;  2OUM A;  3K4N A;  3OYF A;  3TW7 A;  4HZF A;  2ZKZ A;  2BYV E;  4BEH A;  5HOD A;  5KHD A;  4F93 B;  2IS6 A;  1O7L A;  3F6V A;  3WE3 A;  1OYW A;  3F23 A;  2MC4 A;  3TOB A;  4D5F A;  4QTR A;  3HTU A;  3WTT C;  4OIP F;  4M73 A;  4A93 J;  1MND A;  2V1N A;  1G3W A;  4W97 A;  1ZRF A;  5J4Y A;  2KL4 A;  3GF2 A;  4HX8 A;  4IVN A;  2V79 A;  2K5C A;  4DOZ A;  3DP7 A;  2VS1 A;  3JTH A;  1MJ9 A;  1OCT C;  2GJW A;  3HRT A;  2VBY A;  4CUG A;  4WXH A;  2VL8 A;  3K4L A;  5H6R A;  2RAE A;  4JX5 A;  1BW6 A;  5DD8 A;  2IGO A;  3LSR A;  2VKV A;  2G0E A;  4XLC A;  1ZRE A;  3E1S A;  2XKO A;  3C1D A;  5KAI C;  4RDU A;  1BI1 A;  1K78 A;  1OFC X;  4EAT A;  1Z6R A;  1KU7 A;  4AM3 A;  2JT1 A;  2M87 A;  3R6S A;  4WK8 F;  2V1U A;  2PJR B;  2CW7 A;  4IHW A;  3GTL J;  3SEZ A;  5HLT A;  5DEQ A;  3DFG A;  3CCS I;  3CJT B;  1O3S A;  2ZJ2 A;  3OIQ A;  4UXN A;  3S3M A;  4OIQ F;  2J5P A;  2PX9 A;  3SDG A;  3OS1 A;  3AAF A;  2QQB A;  3U21 A;  1ZN2 A;  2WAQ A;  1XGM A;  1DPU A;  1ZH5 A;  1D0X A;  1JT0 A;  3MZH A;  3LFK A;  3ZGK A;  3JSP A;  1OCZ H;  4BGD A;  1YIO A;  3BTI A;  1TWA J;  1J9I A;  5C44 J;  1T8I A;  2VKE A;  1R4M B;  3HSF A;  3CCM I;  2V6E A;  1QHH D;  1USS A;  4AVZ A;  3LAJ A;  1KGS A;  4IQ4 A;  2ZO4 A;  3BJA A;  4IRG A;  4XMY A;  3GW2 A;  3S2H J;  5E17 F;  4A6D A;  2DQR A;  3HGY A;  2ESN A;  4EM0 B;  2F5D A;  2WC2 A;  2KRH A;  1R71 A;  3HKZ N;  3RTR A;  4BUP A;  1N25 A;  2ZXI A;  4BY7 J;  1AWC A;  1MSE C;  4N0B A;  4X0G A;  1FSH A;  2JTV A;  1DPR A;  3FK7 A;  1D5V A;  3OOU A;  3OV8 A;  3W2A A;  3OWT A;  5EEG A;  1P92 A;  4I6Z A;  1D3Y A;  3ZQG A;  4YFK F;  1R1U A;  1S7O A;  1FP1 D;  2H09 A;  2EQR A;  4IL6 C;  2XF6 A;  3OYG A;  4BE2 A;  1FJL A;  2WAE A;  4MGR A;  5J47 A;  1SD7 A;  2XAQ A;  3JRI A;  1Y88 A;  4U7B A;  4HEA 2;  1IXS B;  2L9R A;  4DYR A;  1S29 A;  4O3M A;  5J3L A;  3BDD A;  3FF5 A;  1ZRD A;  3LL7 A;  4MNU A;  2OU2 A;  1WJ5 A;  1WJC A;  4E7Z A;  1IAW A;  3M8E A;  1SD4 A;  4RLF A;  4H0E A;  2UXX A;  5E3N A;  4EV1 A;  1HC8 A;  4Z6Y A;  1HW1 A;  1YFH A;  4UB6 C;  3VB2 A;  3IWF A;  4UV8 A;  5FRO A;  4U0V A;  3ZMZ A;  5GPA A;  3MQ0 A;  1D8K A;  2P6S A;  5EYR A;  3DNX A;  2FUG 2;  2OF7 A;  2DFH A;  1NK3 P;  5K5Q A;  1LFB A;  2M0C A;  1BIB A;  1UST A;  4IF4 A;  2IP2 A;  2M5W A;  2HOT A;  2HZD A;  4LLG F;  3ECH A;  5E1X A;  5F0H A;  3DBH B;  3FWE A;  4CYC B;  4FTH A;  2I5U A;  1IN5 A;  3ABU A;  2NRA C;  2F5E A;  5LGT A;  2V1D A;  5E20 A;  3GZ6 A;  2UWM A;  3DEU A;  4YIR X;  1RUN A;  1YW7 A;  2LBF B;  1UHW A;  1MD0 A;  2IJL A;  3KEO A;  3OS0 A;  2FE3 A;  3V8J A;  3SHF A;  4BXF A;  1HW5 A;  2GXA A;  1TC3 C;  3NAU A;  1HLV A;  2K9M A;  1JXS A;  4N9I A;  1V5E A;  3BR3 A;  4CZZ A;  1OYI A;  5DM6 F;  4DQ2 A;  3S1Q J;  4ENM A;  1U6G A;  1Y1W J;  2I10 A;  4ZDL A;  4TKK A;  4ANJ A;  5M5W J;  2Y0M A;  2LF8 A;  2RNJ A;  1DUX C;  3E0J B;  2E2H J;  5FJ8 J;  3QU6 A;  4KIC A;  5HS8 A;  3L2R A;  1U8B A;  1FTZ A;  3TKY A;  2HWV A;  4GRI A;  3GUD A;  4PZJ A;  3QQA A;  3TP3 A;  1ZGA A;  2LLK A;  2DDA A;  4RB2 C;  2HQR A;  2LMD A;  3MAJ A;  3I4M J;  2XGE A;  3LMM A;  1IC8 A;  2VKH A;  1IRF A;  2YX4 A;  3M07 A;  2G7U A;  1R6R A;  1BW5 A;  5HLI A;  2BHY A;  5EEH A;  3V7S A;  3I59 B;  2QEX I;  1Y0U A;  2O8X A;  3F8B A;  1T33 A;  2GIV A;  2QQ9 A;  3RJP A;  1F5T A;  2EFW A;  2CV1 A;  2JA7 J;  3DCF A;  3ZMD A;  4B47 A;  2HTJ A;  5KNL A;  1JGS A;  2VE8 A;  2EFO A;  1XDS A;  4XM3 A;  5GAD J;  4A0Z A;  2K86 A;  2ZFW A;  4CXF A;  1X1P A;  3R0J A;  2DPD A;  1BIA A;  5FKK A;  5FLX K;  2CUJ A;  1T98 A;  1SVM A;  4YEJ A;  1VQN I;  2AO9 A;  2FBI A;  1ZG1 A;  3S2W A;  1TWG J;  2Z16 A;  4AYB N;  1EH8 A;  2KP6 A;  1I3Q J;  3LSG A;  2BY2 A;  1FPQ A;  2K40 A;  4E7I A;  1FP2 A;  2FSW A;  2LNB A;  3K1P A;  3OYD A;  3ELK A;  4NC6 A;  5EZH A;  4ESJ A;  5AIP A;  4HOB A;  4F3Q A;  4CYD A;  4XRF A;  1I50 J;  2P6T A;  2D1V A;  2BOL A;  2HQA A;  2R7D A;  4IOA F;  4XBF A;  3I9V 2;  2E5Z A;  3G1M A;  5L3B A;  2FML A;  3OYB A;  4IX7 A;  3OIP A;  1D1B A;  5D6E A;  2Y2Z A;  1XS9 A;  5J8F A;  1OR7 C;  3HRS A;  1P4X A;  4BKX A;  1DU0 A;  4LK1 F;  3RDI A;  4X1E A;  4I0B A;  1XCB A;  3J7Y J;  2W48 A;  4IPA A;  3BCA A;  4RMN A;  3W6V A;  3G71 I;  3HTS B;  2VOP A;  1SFK A;  2HNH A;  4NBQ A;  2D45 A;  3EET A;  3F6O A;  4LMY A;  4PSX A;  1MBK A;  3EYY A;  1FBS A;  3A02 A;  2JRT A;  3G2B A;  3WGG A;  3ZQF A;  1LFU P;  3HOZ J;  4QBN A;  4LG0 A;  2DN0 A;  2A07 F;  3CJQ B;  2EZI A;  2VQH A;  2ELK A;  1S5L C;  2E1N A;  3LA7 A;  4GYG A;  4OIN F;  2DAO A;  2QWW A;  2FQ4 A;  5J40 A;  1HQC A;  2DA7 A;  2LDU A;  3O3K A;  4E6Z A;  3RPU D;  2WA0 A;  3P9K A;  3K2A A;  1IG7 A;  4G6Q A;  2VC0 A;  1X1B A;  5CVV A;  1YYV A;  5CKT A;  5CVU A;  3SZP A;  4OAZ A;  4OIR F;  2O61 A;  3C18 A;  2EK5 A;  4EJO A;  1Y56 A;  4HPQ A;  3TW6 A;  2OQR A;  3ECO A;  5L3C A;  3A01 B;  3ASN H;  2H8R A;  4OMY A;  1W7P D;  2LKS A;  2P7C B;  2EB7 A;  2ELJ A;  1GVD A;  4LIT A;  1I27 A;  5D8K B;  3Q3S A;  4YII A;  1BR2 A;  2GWR A;  4U88 A;  3OYK A;  1FZP B;  2E35 A;  3FXU A;  4EJU A;  5FKN A;  1X1A A;  2AHQ A;  3A0B C;  4HRI A;  2BBY A;  2K02 A;  3HPH A;  1G3T A;  3L09 A;  3AG3 H;  3W2W A;  2E7W A;  4BQQ A;  3VSK A;  2N8G A;  3KET A;  4TV7 A;  2FD5 A;  4NQW B;  5GAE J;  1CF7 B;  2UZK A;  5L3G A;  1R9T J;  2UUZ A;  1WCM J;  2L7F P;  3Q5F A;  2DA1 A;  2V4J C;  2KQR A;  3FHN A;  2ZCW A;  1T39 A;  5E1Z B;  1SVO A;  3PIO F;  3KZY A;  2JA2 A;  2DOA A;  1B72 A;  1EKE A;  2WAQ N;  4HV6 A;  5IYB J;  1BC8 C;  2FNA A;  4G6D A;  4EEF G;  4RBO A;  2KDO A;  4YFX F;  2JA5 J;  5HLH A;  2WBM A;  4A5M A;  3V8L A;  3AG1 H;  1Z1D A;  5K7H A;  5HNF A;  4BEH B;  2HYF A;  1I6X A;  3FHZ A;  1YIT I;  1JUS A;  3ABM H;  4EJT A;  3PUF A;  3QYE A;  3K1M A;  3MWM A;  1QZY A;  1ZQ3 P;  1G59 A;  1G6N A;  1DGW Y;  3A0H C;  4XK4 A;  2HYJ A;  3MKW B;  2YS9 A;  3WHC A;  3HUG A;  2XKP A;  1M1E B;  4ZJZ A;  3IUO A;  4AUX A;  1JI8 A;  5DUK A;  2MGQ A;  1ZP7 A;  4A3B J;  4LFU A;  1UFM A;  2XAS A;  2HFH A;  3L9F A;  3GLL A;  3BQZ A;  4NB5 A;  2OCE A;  5KCM A;  3BPX A;  2DTR A;  1D1C A;  3ROU A;  1XX5 A;  3LSJ A;  3F3X A;  3HOV J;  2CWE A;  2OCC H;  4MEX F;  5F0C A;  1I3A A;  3FM5 A;  1YS6 A;  3P5J A;  2TCT A;  3HSE A;  5K1Y A;  2GOM A;  1K78 B;  3KX2 A;  2JMW A;  3WTV C;  4YRV A;  3S3O A;  5BPD A;  2JSC A;  1Y1V J;  3S1M J;  4D0P A;  2A61 A;  4DW6 A;  1XTA A;  1FNN A;  1FBQ A;  1TZL A;  4A6E A;  4HNV A;  3KLO A;  4L5J A;  2QSG X;  3V7R A;  1MMS A;  2IS2 A;  3CCR I;  3BWG A;  4I01 A;  3FZV A;  4V2G A;  2VB6 A;  2QZ8 A;  4XSZ F;  4HST A;  4Q47 A;  3ZCO A;  3CCY A;  1SC7 A;  2RRE A;  4KN7 X;  1TL8 A;  3GYH X;  2FEZ A;  1OMI A;  2CW0 F;  4E70 A;  3HGG A;  1ERD A;  3TQN A;  2XUB A;  3M4O J;  1FIA A;  2STW A;  4XN0 A;  2BHZ A;  3JRC A;  3TED A;  4LIV A;  4A3M J;  5IP9 J;  5FKM A;  1N78 A;  2KRC A;  3TO9 A;  2OKF A;  3ZQC A;  3BG5 A;  4RGS A;  4U87 A;  2VAS A;  4QSH A;  2E19 A;  4DAP A;  5LRR A;  3E6M A;  3I0T A;  4YEL A;  3IF0 X;  4PJL A;  2NVY J;  3BQY A;  2J5O A;  2BXZ A;  5EEA A;  4DA2 A;  1YW9 A;  5LD2 C;  3KPH A;  3WTY C;  3MZ8 A;  1GUU A;  3E5X A;  4G7H F;  3BR5 A;  5E79 C;  2NOJ B;  4LJZ F;  3HDD A;  4M9S A;  5E18 F;  1T6S A;  2BGC A;  3DQV C;  3PQJ A;  2CV0 A;  2VJJ A;  4PFO A;  1RUO A;  3ZXS A;  3KP5 A;  2Y69 H;  3QYF A;  2DBS A;  3PJR A;  2M4K A;  1JKR C;  4A3C J;  2DOE A;  1H9T A;  1YNM A;  2O7O A;  1OYY A;  1WH7 A;  1MBH A;  2DA2 A;  1RR8 C;  4B4C A;  4M9Z A;  5D5X B;  4B8X A;  1WZ2 A;  4C2M J;  5LHH A;  1XMK A;  5TRD A;  4IKF A;  3TP0 A;  5M3M J;  3WU2 C;  4OWR B;  3K7A J;  1OCP A;  1E0E A;  5DCM A;  4XL9 A;  4KIS A;  2LKP A;  3IL2 A;  2STT A;  3HJE A;  3A4C A;  5CVI A;  2HR3 A;  3RYP A;  4FX0 A;  4G7O F;  3VSL A;  5DCF A;  4E7K A;  1ORK A;  1VQM I;  3QYB A;  1PDN C;  3I56 I;  3FM3 A;  4Y33 A;  1E2X A;  2X1E A;  2XB0 X;  3WG9 A;  4PK4 A;  2WAD A;  3CQZ J;  1KQ0 A;  3SFI A;  4KJZ A;  3HRU A;  4II3 A;  5K5R A;  1ONV A;  4XKB A;  4MTD A;  3RPU A;  3I58 A;  2L3D A;  3MZY A;  2L4M A;  3S16 J;  4XKV A;  1ETX A;  1VQ8 I;  3FXJ A;  3WE2 A;  3PNY A;  2CH0 A;  4KMU X;  3T8R A;  4A12 A;  3QP6 A;  1TP4 A;  1REP C;  1KU2 A;  2OZU A;  1MH4 A;  1W7P A;  4KA4 A;  2E71 A;  1XC5 A;  5ED4 A;  3N05 A;  3BLY A;  2Z3Y A;  2EA4 A;  2QYO A;  4M6V A;  4N4N B;  4RB1 A;  2FMY A;  2O8K A;  1GV2 A;  5B5E C;  5AON A;  3D5L A;  3P9I A;  2NVX J;  2ECB A;  3FMQ A;  2X6Y A;  5L3F A;  3ZMS A;  4P5O A;  5TIS C;  3EUH C;  1Z21 A;  3L2U A;  1KU3 A;  1LDJ A;  1U3E M;  4ZC3 A;  3HG9 A;  1ZR4 A;  5E3M A;  3J7Z I;  3PUB A;  1I6H J;  1FOW A;  2O03 A;  2RN7 A;  3I4N J;  1TLH B;  1MH3 A;  2JUC A;  3HL2 A;  2DFE A;  2Z2S B;  3BTL A;  1BBY A;  3I4P A;  3WTX C;  2H94 A;  4LK0 F;  1XGS A;  3S17 J;  2XV4 S;  3KCC A;  3DF8 A;  3IH4 A;  1F36 A;  4HNT A;  3GTK J;  5ICE A;  4KUM A;  2A6H F;  4Y3O A;  1Y0N A;  5CQE A;  2Z5U A;  3L7W A;  2OZ6 A;  2JQ7 A;  4Y52 J;  5JHF A;  3K4K A;  4XLN F;  5HS7 A;  1XG1 A;  3O8G A;  2EPF A;  1DDN A;  3JW4 A;  2CQN A;  2ZXJ A;  3GX4 X;  4G8X A;  2EFP A;  3CDH A;  1GT0 C;  5IOZ A;  5GPC A;  2P81 A;  1YW8 A;  5IYC J;  4IHS A;  3PSF A;  3X2Q H;  1BI3 A;  2PLY A;  2QLZ A;  1VI0 A;  3W2V A;  1XDU A;  3RYR A;  2EA2 A;  2HYG D;  2EZL A;  4ENJ A;  4WF2 A;  3BTJ A;  4AU7 A;  1IN4 A;  3TDU C;  1Z05 A;  2HXI A;  4B3X A;  2BY1 A;  1GDT A;  2K85 A;  5BNG A;  4EM1 A;  1UCR A;  1T56 A;  4EMS A;  2R7Z J;  2KJB A;  1BN5 A;  1Q1V A;  1ZKG A;  4S04 A;  6PAX A;  1SD5 A;  3H36 A;  3ZQI A;  2W85 A;  4HAM A;  2QSH X;  5JFR A;  1SVL A;  4HQE A;  1O57 A;  1G4D A;  4R79 A;  2XAG A;  3VYR B;  4G6U A;  1TTY A;  4P9U A;  4LG0 B;  3HC7 A;  2L7M P;  3B6C A;  1RI7 A;  4XOT A;  4MQV A;  3S8P A;  1LE8 A;  1X4O A;  3BP8 A;  2FJ1 A;  1JUP A;  1IXC A;  1DU6 A;  4CSW A;  4KIT B;  1VND A;  5JHU A;  2CV2 A;  3EDP A;  2O9L A;  3S2D J;  2FOK A;  1YX5 A;  4TKD A;  3GFI A;  3HHG A;  1QZE A;  2HGC A;  2W82 A;  2PBI A;  2Z33 A;  1ACI A;  1R7J A;  3U2R A;  1LJ9 A;  3FIW A;  1SFU A;  1LQ1 A;  3E5Q A;  3SQN A;  3MN2 A;  1QRY A;  2PEX A;  4HW0 A;  4WXD A;  9ANT A;  4KT5 C;  4FET A;  1JE8 A;  1E3P A;  3FXO A;  2QA4 I;  4B09 A;  2LG4 A;  4PJN A;  5LFA A;  3ZN0 A;  1YJ9 I;  4RM3 A;  4RAF A;  3E6C C;  2IGN A;  1DQU A;  2EH3 A;  2DT6 A;  2EBI A;  2ISY A;  3AG4 H;  3B73 A;  4JX6 A;  2NXN B;  1H89 C;  1TT0 A;  1X1D A;  2JZY A;  4S0H B;  4A0Y A;  2IW5 A;  2QKL B;  3VDX A;  3P9C A;  4HYE A;  4D7M A;  1B72 B;  1IRZ A;  1P7I A;  2FLC A;  2ZJR F;  4HDV A;  1U9O A;  2CYY A;  2IBD A;  1UHM A;  3M1E A;  3BT7 A;  3FIS A;  2IS1 A;  2HKX A;  2VJ4 A;  5D5U B;  2ICW G;  2KDZ A;  1WJF A;  4HX7 A;  3K10 A;  3K4C A;  2IT0 A;  4BNC A;  2JWT A;  4J19 A;  4A3J J;  1YLF A;  1XMX A;  1Z6T A;  1MIJ A;  2DFF A;  3NWT A;  2BZT A;  4WCG A;  4BJ5 C;  3OY9 A;  2KFD A;  3OSF A;  4IRH A;  1MBJ A;  3KLN A;  2VQL A;  3ULQ B;  1VFC A;  1L0O C;  3RQI A;  2VPR A;  1WH5 A;  1X58 A;  2X6X A;  3WGH A;  4ZYE A;  1W4M A;  2CUF A;  3SEQ A;  4IRI A;  1U8R A;  2QEN A;  5FFZ A;  2ECC A;  2WAF A;  4C3I J;  2COM A;  3HUG B;  4I02 A;  5HDK A;  3DTK A;  2R7U A;  4XLF A;  2D2W A;  2DA4 A;  4I2O A;  4KIB A;  2ZSH B;  1CQT A;  5CJ9 A;  3RKW A;  3V42 A;  2L0K A;  4GDF A;  1Z67 A;  4AD9 A;  2EWN A;  2A05 A;  2QKM B;  2IGK A;  4KDP A;  2M30 A;  4M3F A;  4MLO A;  3H0D A;  2V1X A;  1KQ8 A;  1W36 D;  1TQP A;  2GBY A;  4MEY F;  1UJ8 A;  1P4W A;  3KP2 A;  3ZMU A;  4L9J A;  1WI9 A;  4PDK A;  1KON A;  1HF0 A;  3RCO A;  3GZN B;  4ETS A;  4C3J J;  3JRD A;  3WTZ A;  1ENH A;  4HLY A;  3W3C A;  2L2O A;  2VQG A;  4I99 C;  3JSO A;  3ML6 A;  3OYN A;  3GTM J;  4CCK A;  4WWC A;  1WJA A;  2DW4 A;  2R7F A;  2RVC A;  2NVQ J;  4HG2 A;  1D5Y A;  1MDM A;  3BR0 A;  1PVE A;  1TT5 B;  1A04 A;  1U2W A;  1HOM A;  3AG2 H;  2JJ7 A;  3KFW X;  4CCL A;  3VOE A;  5ICG A;  4UUV A;  5FKO A;  1YE9 A;  2NS7 A;  3MCZ A;  2GLO A;  4Y7N J;  1ETO A;  2QVO A;  4MO7 A;  2Y9Y A;  3CC2 I;  1ZG3 A;  4ZYD A;  3F72 A;  2KMU A;  1E3H A;  3GLX A;  1X3W B;  3LOC A;  1G3S A;  1ZYR F;  2P5K A;  4H4K C;  3ZQQ A;  3DWL E;  4G94 A;  5H6Q A;  3UNG C;  5B66 C;  3IKT A;  1Z0X A;  2BE5 F;  2H8W A;  3IAS 2;  2FX0 A;  2ZXH A;  1WJB A;  3RKQ A;  3M9A A;  1ZLJ A;  4LIU A;  4II2 A;  1APL C;  1HBX G;  3ZRG A;  5LRS A;  3G3Z A;  4FHT A;  1HH1 A;  1RPW A;  2EV6 A;  2ME0 A;  2VON A;  4FT8 A;  4CCO A;  3H0G J;  2H6C A;  1R23 A;  1XB4 A;  5FO5 A;  3KYL A;  3R4K A;  2XPW A;  2EIK H;  2M7A A;  2LRD A;  2WIW A;  1AHD P;  2VXD A;  2R4G A;  3S14 J;  1B4A A;  4Z2Y A;  4A5N A;  4EGY A;  2A3S A;  1ZEL A;  5L3D A;  2DJI A;  4DZP A;  5DCM B;  5GTH C;  3SDB A;  4IXA A;  4V2F A;  3QPL A;  2FF4 A;  4CH7 A;  4FX4 A;  1H8A C;  3VWB A;  4L0Y B;  3I71 A;  3QPH A;  4EVI A;  4UVC A;  2KKO A;  3GTP J;  4JBA A;  5B1A H;  2JK3 A;  2QBY A;  5HNH A;  2ZSI B;  3TO7 A;  3ZMV A;  4A3F J;  2X9D A;  1EH7 A;  1JTY A;  2KRF A;  2QM3 A;  2F5V A;  2PFB A;  3U1K A;  1P9Q C;  4QPQ A;  2R7Q A;  4JP0 A;  4JOM A;  2XGD A;  1FYL A;  1W0U A;  4ASN A;  2GOX B;  4NUB A;  4DBR A;  3OYC A;  4OOI A;  1BOA A;  2M45 A;  1IZ1 A;  5IPA A;  1OPC A;  1R5G A;  1K83 J;  4CA0 A;  3DLL F;  4BBS J;  2O6G E;  1ON1 A;  5DDG A;  1FYM A;  2ZME A;  4KIF A;  1FOK A;  1WFX A;  3AJV A;  2IAI A;  2ZB9 A;  1QVU A;  2MYS A;  1W7P B;  3T5X A;  2HEO A;  2E34 A;  4BQN A;  1WWX A;  4B3A A;  3ZP5 A;  3L2Q A;  4WX9 A;  4DBQ A;  1SFO J;  1ZHF A;  1VQ5 I;  2X48 A;  4U7D A;  5DS9 A;  4E7J A;  4L5I A;  4NHJ A;  3DKY A;  2XAF A;  1T0F A;  1VQ7 I;  3EYI A;  1FBU A;  3MMY B;  4ENK A;  3VEP A;  3A2K A;  1R00 A;  1GV5 A;  1MJA A;  3CUQ A;  1HKQ A;  2LY2 A;  5LEK A;  1PP7 U;  2DMU A;  2FU4 A;  2MLK A;  1MZB A;  2EO0 A;  4QBO A;  3IH2 A;  1IRX A;  2JPC A;  3ASO H;  2EV0 A;  4E6K G;  4EV0 A;  2RDP A;  3BJ6 A;  2EFN A;  4UV9 A;  2F5F A;  4M3B A;  2VJ5 A;  2E7X A;  5CPR B;  4BL0 B;  5H20 A;  4BYY A;  3GZ5 A;  4CO8 A;  4A3I J;  2CGP A;  3GFJ A;  4Q4Z F;  4N4O B;  3GTO J;  4LLL A;  3U9G A;  5CVR A;  2Q0O A;  1BR1 A;  4LGW A;  2EIN H;  3CLO A;  2VC1 A;  4UHT A;  4MTE A;  4ENN A;  4IHX A;  2M4G A;  1SFE A;  3JAM K;  4HA8 A;  5HS9 A;  3T0Y A;  4LOC A;  1F43 A;  2PMZ A;  3Q0W A;  1BM9 A;  1RIO H;  1MBF A;  3Q9V A;  4HV5 A;  4E7L A;  1J59 A;  3LWF A;  4GXO A;  5EJC A;  4I98 B;  2HQ5 A;  5E1W A;  5DM7 F;  1SEU A;  2PJP A;  1OB9 A;  4LQE A;  4IHV A;  1OJL A;  1AU7 A;  1IPI A;  4S05 A;  2I8D A;  2W4S A;  1SAN A;  2CQ7 A;  4JQF A;  1VQK I;  1D1A A;  2OPT A;  2VQC A;  3C3W A;  2VBW A;  1VQP I;  3I3L A;  2MC3 A;  3BG3 A;  2XIG A;  2VLD A;  4ZDO A;  1P2F A;  3L00 A;  2RGV A;  1O7F A;  5KAF C;  1H0M A;  3HEF A;  4Q5S F;  1R1T A;  2BW3 A;  1PYV A;  4KNY A;  1S7E A;  5CYV A;  2PJR A;  3EQL F;  2W57 A;  1UZC A;  3DKW A;  1Y8R B;  3KP7 A;  3K70 C;  3K9T A;  2LY1 A;  3OYM A;  2FRH A;  2L7K A;  3S15 J;  3DKX A;  4B43 A;  2AQF A;  2P7V B;  2KPM A;  3FXQ A;  1LDK B;  1MNE A;  4M3E A;  3LSI A;  3HB9 A;  2YU9 J;  1OCO H;  2O5R A;  3I53 A;  1A6I A;  1LE8 B;  2XAH A;  3ERE D;  2M7B A;  1O3R A;  1TNS A;  1K4S A;  3BZC A;  3BG9 A;  4BY1 J;  4JYK A;  2G7H A;  3CMY A;  3RZO J;  4XRS G;  4AIK A;  1YI2 I;  2Q2E A;  4PFP A;  1JKP C;  1ITY A;  1T2K A;  3CUO A;  4PJJ A;  3O2P E;  2DXI A;  3H9G A;  3H1C A;  3GME A;  2L54 A;  2KZV A;  2CG4 A;  2EZH A;  2LK2 A;  2L9N A;  5B3S H;  1HA8 A;  3CC7 I;  1RRJ A;  2EIJ H;  2Y0S A;  4UVB A;  2HPI A;  2OAZ A;  1V55 H;  1WQ2 A;  4E7S A;  2DTZ A;  3HYI A;  2X1D A;  2HVS A;  3M7G A;  3KEQ A;  2GIZ A;  1JHH A;  2VIX A;  4G6V A;  1IV8 A;  1SMY F;  2WB1 A;  3CZ6 A;  2HTS A;  2V7F A;  4BU2 A;  4EJW A;  4DAV A;  1YRN A;  4BDZ A;  4F52 A;  1VQ6 I;  3K69 A;  2K9L A;  4ITV A;  3SYT A;  3R61 A;  2GW6 A;  3BOQ A;  4Y4R A;  3FBI B;  3VFZ A;  4QLC U;  2QUF A;  3CDI A;  3Q0U A;  4D5C A;  1JGG A;  3RKY A;  2GA1 A;  1DP3 A;  3K4M A;  4XOP A;  5JVT A;  3H9Q A;  5FRN A;  3L2V A;  1RET A;  1FWZ A;  2LR8 A;  3BJO A;  1A6Q A;  2DA5 A;  3ABT A;  4CIC A;  2MG4 A;  1ZGW A;  2JRM A;  1HDP A;  1MBE A;  1ZR2 A;  3CMM A;  1OLT A;  3V8K A;  3UR3 C;  2NYX A;  3J7A O;  2HZT A;  2IPQ X;  4YG2 F;  1WJE A;  4O6J A;  3OYH A;  2EFQ A;  2L01 A;  5FD5 A;  2Z1D A;  3I54 A;  1LVK A;  2ZNZ A;  3L2W A;  1TQI A;  1N77 A;  1F9N A;  2A68 F;  2DJN A;  3G1O A;  1XSX A;  2DYS H;  3F8F A;  3IEY A;  1TWH J;  1T08 B;  1P7J A;  3ZQ7 A;  3CES A;  4KFC A;  1X3U A;  1PUF A;  3BG7 A;  2MD5 A;  4OMZ A;  2V9V A;  2ZBK A;  4FE7 A;  3IHU A;  3IP4 B;  1ULY A;  1O4X A;  1IDY A;  2AXT C;  2WCW A;  3ISP A;  1UG0 A;  2VXZ A;  4UUT A;  2F5C A;  3VYU B;  5LEJ A;  4XLP F;  1XSV A;  1UAA A;  1SFX A;  3K6G A;  1HSJ A;  4XQF A;  4GO1 A;  4HLX A;  4BAY A;  1HXD A;  2A5W A;  5K5O A;  3PIP F;  1S8N A;  3H3V K;  1XPX A;  1J09 A;  4LG3 A;  1BI2 A;  3OOP A;  4E4H A;  5JVG F;  2ZNY A;  1GHC A;  1J75 A;  1ODD A;  3H5N A;  2HDD A;  3CCE I;  2R7X A;  1MDM B;  1QBJ A;  1R36 A;  3EUA A;  4U0Y A;  2BXY A;  1X2M A;  2LD5 A;  1U0J A;  1RC9 A;  2WV0 A;  5ICF A;  3C2B A;  2DOF A;  3H5R A;  1OCC H;  2DA3 A;  3D5S C;  1Z7U A;  2VT2 A;  3T1B A;  2DT7 B;  1UG2 A;  3PO2 J;  4F55 A;  4XID A;  5LGU A;  4XSX F;  3WTS C;  2F4M B;  3SJM A;  3DLA A;  5C4X J;  3QRF F;  1A79 A;  1XCV A;  3JAM Z;  4L0Z B;  5CVJ A;  3W6K B;  2XC7 A;  1E17 A;  1VF9 A;  1RKW A;  3MD2 A;  1UEL B;  3SZG A;  4FQG A;  5EZG A;  3KZZ A;  2WCZ A;  3FXK A;  5F1J A;  5CLS A;  1B9M A;  1ZRC A;  3M1C A;  4A2U A;  4LLN A;  2E1M B;  2ZME C;  2ISZ A;  4MIM A;  1I5Z A;  1GLN A;  2CS3 A;  2KJC A;  2GA2 A;  1D8J A;  4WXC A;  1G8X A;  2CQX A;  3K4J A;  4BHC A;  2O0Y A;  1HKT A;  3P1Z A;  1T0F C;  3FMS A;  4KT6 A;  1LKX A;  4M9X A;  2VOD A;  2HKO A;  2YUS A;  3CCU I;  2OBP A;  3CUQ C;  3J80 K;  4BAC A;  1MBG A;  2DDB A;  2OD5 A;  3OMY A;  3EPZ A;  5JI6 A;  3ZQL A;  2TRT A;  2QBY B;  1NTC A;  3S3N A;  1FMW A;  5ILS A;  2GXG A;  2C6Y A;  3HOU J;  4F7Z A;  1T38 A;  1LVA A;  3EUK L;  4U0W A;  4LB6 B;  4IQJ A;  4EQQ A;  1MJB A;  2E60 A;  2PQ8 A;  2PMZ N;  1TWF J;  3BR1 A;  2VLA A;  4BE0 A;  4PJM A;  1VQ4 I;  2L9S A;  3LNQ A;  3HOT A;  3LSP A;  3HOX J;  2DO7 A;  5A2Q Z;  1QO0 D;  4KYW A;  3TGN A;  2QSF X;  3ERM A;  1V5F A;  1YG2 A;  2ZME B;  2BVM A;  2W84 A;  3AJV B;  3S93 A;  2DT5 A;  1Y6I A;  2LVS A;  2W25 A;  5EDN A;  3GTJ J;  2DOD A;  3CF2 A;  3GVA A;  1NG7 A;  4AIJ A;  4CHU A;  4ZYA A;  1B9N A;  3WG7 H;  2TDX A;  2EJR A;  4Y17 A;  3BPV A;  4F92 B;  1B8I A;  4GFB A;  3TL4 X;  5IT3 A;  2CZR A;  1LPQ A;  2HQN A;  2DFI A;  1NHA A;  4A3E J;  2CMP A;  4P9F A;  3N4M A;  1MSF C;  1JJ8 C;  3BY6 A;  3KP6 A;  3ZN1 A;  3J7A Y;  3CUQ B;  2Y30 A;  5FLM J;  1B1B A;  1YS7 A;  2K9S A;  5B1B H;  4V19 K;  4ZYG A;  5ICC A;  1XMA A;  2W8M A;  1A31 A;  1JKO C;  2INB A;  1F4K A;  1GVJ A;  3KP3 A;  3DTI A;  1S9H A;  3KP4 A;  4RAZ A;  1W36 C;  2HVR A;  3GFM A;  3DXJ F;  3WOD F;  1I1G A;  2RNG A;  1EH6 A;  4XNF A;  4CCN A;  2MSY A;  3WGI A;  3KIO A;  4L9T A;  2DLL A;  4D9J A;  1BC7 C;  3KE2 A;  3KYC B;  4ESF A;  4LB5 A;  2HOS A;  2PN6 A;  2FNP A;  2R93 J;  4LD5 A;  3U1D A;  5J1R A;  4GYI A;  5J1Y A;  5BOX A;  2M8E A;  2CFX A;  3QP5 A;  3I55 I;  3CF5 F;  2JPB A;  3IH3 A;  4M71 A;  1UHS A;  1R1V A;  3D5R C;  3R0A A;  1IGN A;  1IUY A;  4BS9 A;  3HPG A;  4MFD A;  2CUZ A;  4XOR A;  5F6F A;  4Y15 A;  2JSP A;  5C4J J;  1ETY A;  5TGT A;  2XVC A;  2MLG A;  3KYD B;  4M6X A;  1U9N A;  1KU9 A;  3G1L A;  1D0Y A;  3DV8 A;  4AWX B;  5H2F C;  5LBQ A;  2W24 A;  3S1N J;  2XAU A;  3JRH A;  4IJA A;  2R7W A;  3P7N A;  2Y0S N;  4P1W A;  1YQA A;  3CMA I;  2M1B A;  2K3P A;  3E7L A;  3HOY J;  1QU3 A;  2XAJ A;  4ON0 A;  3C2H A;  3I64 A;  2QCO A;  3LAP A;  3CCL I;  5EGO A;  1POG A;  2AS5 F;  2P5V A;  2WB1 N;  2CFO A;  3FXM A;  4XLA A;  2XRO A;  4AVP A;  5F64 A;  3CME I;  2FXA A;  2YPR A;  1A5J A;  3FOV A;  1V54 H;  2IA0 A;  2XB5 A;  3ZMT A;  4XIC A;  4BH9 A;  1I39 A;  3TDZ C;  1BJA A;  1RNL A;  1E3O C;  2BW3 B;  3GBG A;  3PSI A;  3ABK H;  4UUS A;  4MFE A;  4ZH4 F;  2WTE A;  2X85 A;  5KK1 A;  3COA C;  2OTL I;  2HOA A;  2X0L A;  4E7H A;  1BJZ A;  2E1O A;  4UY8 I;  2Q1Z B;  4OIO F;  1DP7 P;  2XPU A;  2D5V A;  2M34 A;  1SD6 A;  2GM4 A;  1LDD A;  2HXO A;  1X1C A;  3TBI A;  2RQP A;  1PUE E;  2Q8K A;  1SAU A;  2IVM A;  2VPL A;  4RAY A;  1WRJ A;  3T8T A;  1ON2 A;  4DIQ A;  4BDY A;  2WY7 Q;  3KZI C;  2K9Q A;  5J4V A;  5EG0 A;  2NS8 A;  2A69 F;  2XPV A;  3G73 A;  3CTA A;  1IJW C;  4P55 A;  3RIR A;  4ZTF A;  5FGM A;  2DMP A;  2XGC A;  1MNM C;  2VOO A;  4ESB A;  4B44 A;  1JKQ C;  2NNN A;  3PQK A;  1RR7 A;  1V3F A;  2Q2E B;  5F0F A;  5FRM A;  1LFP A;  2DBB A;  2DQL A;  3QOP A;  2DMQ A;  1MGT A;  3K1N A;  1YTY A;  2ID3 A;  3FMR A;  1KZH A;  3G4S I;  3JRE A;  5JLX A;  5HOO A;  2HDC A;  5M3F J;  1JHF A;  4G7Z F;  1UMQ A;  2IGM A;  4PUS A;  5GAG J;  2JA6 J;  4N9H A;  1IXR C;  1Y8Q B;  1ZAR A;  2KIM A;  4CCM A;  2BY0 A;  2KLO A;  3K0L A;  2XDV A;  3CLQ A;  1J7K A;  4ZZL A;  5FDK A;  1MKM A;  1CGP A;  3PL8 A;  1QQI A;  1QZZ A;  1VQL I;  1AA7 A;  2NVT J;  1YRN B;  1RZN A;  2PMH A;  5J6X A;  2ZFU A;  4FIS A;  3BZ6 A;  1XGO A;  1P4A A;  2DK8 A;  1FOY A;  2LRE A;  2B0L A;  1IDZ A;  4ZZD A;  5LGN A;  4AC0 A;  5E8I A;  1S7A A;  4Y13 A;  2Y31 A;  5K7F A;  1K79 A;  3BRO A;  5D4S A;  4X6A J;  4RM2 A;  4PGH A;  2DK5 A;  2X1C A;  1EA3 A;  3DTE A;  1UB9 A;  2M3A A;  1K7A A;  2LC2 A;  2R5Z A;  4A69 C;  2R7S A;  2E1C A;  4NDL A;  1BR4 A;  2XHK A;  2ZC2 A;  3CCJ I;  3UKG A;  2V6C A;  3TOA A;  4HX4 A;  4L5E A;  2EZK A;  3GTG J;  3LA2 A;  2A6T A;  4BJ6 C;  3J80 Z;  4NC7 A;  2KIU A;  3DPT A;  2MA3 A;  1WHU A;  3CJR B;  4ZDP A;  2VKD A;  4JK1 X;  1X2N A;  1I1S A;  1IUF A;  2H27 A;  2P0W A;  2V9K A;  5BQT A;  3BR6 A;  1OB8 A;  1X19 A;  4QWQ A;  2UV1 A;  3FK6 A;  1YO5 C;  2X6O A;  5J8C A;  2FL3 A;  4OU0 A;  3BG6 A;  1MMN A;  3JTG A;  2KHM A;  2ID6 A;  1ETQ A;  2X4H A;  3IEY B;  2P5L C;  1N75 A;  2W00 A;  2R0Q C;  4YIF A;  4M3D A;  1G3Y A;  3S1R J;  1PUF B;  4M74 A;  1IV6 A;  2R7R A;  2Z9O A;  3OL3 A;  2ETH A;  2FQ3 A;  1YHQ I;  1ZK8 A;  1Z91 A;  4C30 A;  1O3Q A;  4C2U A;  2YU3 A;  2JJQ A;  2PMU A;  4IEJ A;  2OA4 A;  3MKZ A;  4XRS A;  5FLV A;  2AXL A;  3AKZ A;  2L02 A;  3VYT B;  4BXX J;  2KT0 A;  3PFY A;  3FKI J;  3ESW B;  3OYI A;  1ZTR A;  1J0R A;  1FX7 A;  4O5V A;  5D5W B;  1ZG5 A;  3AL0 C;  4GCV A;  5K7Z A;  1S3J A;  4G9Y A;  5DV5 A;  1R0V A;  5BS6 A;  2JVG A;  1FYK A;  2BY3 A;  3LA3 A;  3K4B A;  4AID A;  3G6E I;  2WJ0 A;  3Q9S A;  3KEY A;  3BR2 A;  2EIM H;  2HU9 A;  3VOD A;  4F91 B;  1FMV A;  3WTW C;  3QU3 A;  5D4R A;  2XRN A;  2F6C A;  2EV5 A;  1JTX A;  4EM2 A;  4L9N A;  5D6F A;  5DUI A;  1W0T A;  2ZYZ A;  5CQG A;  1YX3 A;  3ABL H;  3Q0V A;  3BZK A;  3IV5 A;  1Z3Y A;  4XON A;  2K9N A;  3HXL A;  3CJN A;  1AKH A;  1OCR H;  1Z77 A;  3LSK A;  1TQM A;  2DMN A;  4FE4 A;  4HNU A;  1W1W E;  4MQ9 F;  1R11 A;  2M8G X;  3CCQ I;  2MFZ A;  3O8H A;  5AIQ A;  1H88 C;  5D5V B;  5FD6 A;  1R5H A;  2CUE A;  1HKS A;  3MKL A;  2NVU B;  1PJR A;  2XSD C;  4B48 A;  3J81 K;  1NK2 P;  2P4W A;  3PO3 J;  2LTP A;  1OKR A;  3QAH A;  5DYM A;  4HSR A;  4J01 A;  1PP8 F;  3JR9 A;  2DMT A;  1TBX A;  3JRA A;  3LQQ A;  3AL0 B;  3GTQ J;  3M3Y J;  4BHP A;  5E3O A;  2O3F A;  2WV1 A;  2IS4 A;  3QPT A;  3MFK A;  4B1R A;  3H3U A;  5IP6 A;  1VQO I;  1HST A;  3EUH A;  2AQE A;  3H9J A;  4QBL A;  4XLH A;  4BQA A;  4HDU A;  3RQ4 A;  1YIJ I;  2OTJ I;  2YSR A;  3P1Z B;  3FXL A;  1A35 A;  1U5T A;  5FB2 A;  2MW8 A;  2E2J J;  4QIW N;  2KZG A;  5M5Y J;  2LSO A;  1AOY A;  1ZAO A;  2XF7 A;  3HM5 A;  1T95 A;  1Z3X A;  1IO2 A;  3CP2 A;  3TO6 A;  2R5Y A;  1GXQ A;  3OS2 A;  4HQM A;  5F08 A;  5IOY A;  2DCE A;  1R58 A;  2LY9 A;  3AFH A;  4I0A A;  4UB8 C;  3CD6 I;  3NRV A;  3JRF A;  1R5I D;  2PG4 A;  3HIF A;  1RZ4 A;  3NWS A;  2DU9 A;  5E3L A;  5L3E A;  5ILU A;  2QGU A;  2F2E A;  2V26 A;  3M8J A;  4D1Q A;  1HDD C;  3H5A A;  3FXR A;  3RI4 A;  1MW7 A;  3CDL A;  3P1Y A;  2L7Z A;  2MAB A;  3F8M A;  4M6Y A;  4A0X A;  4IZZ A;  3MKY B;  1QHG A;  2NOG A;  2H6B A;  2IA1 A;  5JLW A;  3SFZ A;  4W1U A;  3E3V A;  1LNW A;  2CU7 A;  3DBL B;  1S72 I;  2VBZ A;  1H9G A;  5IT9 K;  2M9H A;  3JCU C;  1W5S A;  1Z7L A;  3F9K A;  4DYQ A;  4CGZ A;  2B63 J;  4BBR J;  3B02 A;  1FT9 A;  4RGR A;  3GEZ A;  4UVA A;  2HDW A;  1B8I B;  2GXB A;  4RS8 A;  2MH9 A;  1R22 A;  2KIF A;  3V4G A;  3IKV A;  2FKH B;  4R8H A;  2CQK A;  2BEO A;  2WY8 Q;  1IN6 A;  1J2X A;  3FX3 A;  2NS0 A;  3BC8 A;  4FAS D;  2FBH A;  2OST A;  1TNT A;  1QPI A;  3A03 A;  3OR2 C;  1K6Y A;  3QOD A;  4CZC A;  1QA6 A;  4IHT A;  3E5U A;  4HF0 A;  3QPS A;  5ERI A;  2ESH A;  2M2E A;  2Y75 A;  2ZXW H;  1X3Z B;  2XRL A;  2HI3 A;  2F4O B;  3N97 A;  2JUG A;  1JJ6 C;  2YR2 A;  2GZW A;  2XF5 A;  3GXO A;  2NNY A;  1FIP A;  5A2Q K;  1JT6 A;  1XD7 A;  2L9V A;  3I5U A;  4QPO A;  3IAM 2;  2MBF A;  3MEX A;  1HCR A;  4ABZ A;  2PI0 A;  1STZ A;  4XKW A;  4XN3 A;  5JR3 A;  3OR1 C;  3NQO A;  1IN8 A;  2RV8 A;  2RC4 A;  2DA6 A;  4IOC F;  1A36 A;  1ZLK A;  2H1K A;  5HLG A;  5FKL A;  4ZYH A;  2EIL H;  3ZOB A;  2B7E A;  5M5X J;  2BV6 A;  1FY7 A;  1QPM A;  2R7V A;  3DPU A;  1O3T A;  3C2G A;  1ZGJ A;  2VI6 A;  3F8N A;  2ADU A;  4KMF A;  3GWZ A;  1V4R A;  2X6W A;  3BCB A;  4M72 A;  3SZT A;  2CRG A;  5EGO B;  5E8G A;  3DPL C;  1R4N B;  4M3G A;  2LOO A;  4R1H A;  2IXS A;  2JA8 J;  2QQ8 A;  2ELH A;  3ZQH A;  2FKC A;  2HVQ A;  2VE9 A;  2KIS A;  1W5T A;  3PM1 A;  4C2T A;  2E36 A;  3WTU C;  4J00 A;  4FCY A;  4UUS B;  2A5Y B;  1IF1 A;  2JVH A;  3PFI A;  1KYW A;  2F4I A;  2HS5 A;  1R49 A;  2R3S A;  1F1Z A;  1YOV B;  2L4A A;  2FBK A;  1IW7 F;  2GAU A;  4DGW B;  2E5N A;  2CW8 A;  1SAX A;  1ETV A;  2DPU A;  2LKX A;  1DGR M;  3WU0 A;  5GP9 A;  2LP0 A;  3BT9 A;  2VT3 A;  3O6B B;  3LQR A;  1BI0 A;  1FLI A;  1LUJ B;  2LYC A;  4RGX A;  1KYZ A;  1QVT A;  1TWC J;  4DJA A;  1LB2 A;  3L2C A;  5EG0 B;  1FSE A;  4CYC A;  3OSG A;  1LEA A;  2K3F A;  3HHH A;  5DD4 A;  4C3H J;  5IYD J;  2BVL A;  2Z99 A;  4I76 A;  4XLE A;  5TJJ A;  1HW2 A;  3H92 A;  2LBF A;  4PCQ A;  1WGX A;  1RES A;  3HSR A;  4RB0 A;  5HDG A;  1VTN C;  5KVR A;  1BL0 A;  5D8L B;  2Z0R A;  4RA2 A;  1TW2 A;  3QOE A;  2DI3 A;  3HKZ A;  2BH2 A;  3F0C A;  1KQ9 A;  4RGU A;  1MMD A;  3M8F A;  2R92 J;  4HF2 A;  2RKH A;  1VZ0 A;  1V5G A;  2ZJP F;  5FLX Z;  2R7T A;  4PJ0 C;  3CP8 A;  1EV7 A;  3K2Z A;  2A6E F;  3RPQ A;  3J81 Z;  3DEE A;  2VUM J;  4P96 A;  1X4P A;  2VN2 A;  1UWV A;  4K2E A;  5ILV A;  2E1M C;  1BOB A;  3RKX A;  3GO5 A;  4GGG A;  4Q48 A;  3F22 A;  1Y1O A;  4G6T B;  3IRR A;  4L18 B;  3E6B A;  1ETK A;  2K27 A;  3DEW A;  2OJE D;  3F21 A;  3SXY A;  3K70 D;  5IY5 H;  3WU1 B;  4EGZ A;  2P8T A;  1K61 A;  4EJV A;  5BPI A;  3I59 A;  1QGP A;  1RKT A;  4PSW A;  2R5Z B;  5GTI C;  2VBX A;  3S32 A;  1WJD A;  3LFU A;  1J5Y A;  4ZQU A;  1QNT A;  3MVP A;  1D0Z A;  3OYJ A;  2IA2 A;  4AIH A;  3NEU A;  2W7N A;  3CO6 C;  1NH3 A;  3IC7 A;  1KA8 A;  4RLQ A;  4JX4 A;  1NG6 A;  4C9Y A;  1IN7 A;  3R60 A;  3OYE A;  1G2H A;  3WHB A;  4KN4 X;  2Y9Z A;  4HBL A;  5HVQ C;  4A3G J;  3H3Z A;  5C3E J;  1SMT A;  1Q1H A;  3LST A;  1GXP A;  1LEB A;  3OIO A;  1OIS A;  3FBN B;  4BE1 A;  2ZJQ F;  2M0M A;  4NC8 A;  2K4J A;  2ME6 A;  3TMO A;  2Y48 A;  3CC4 I;  4I09 A;  1OQY A;  2CSO A;  2XSJ C;  3FDY A;  1Y39 A;  3C7J A;  1B59 A;  3VYS B;  2LF7 A;  5DTD A;  2DYR H;  2CQQ A;  2R7O A;  1ETW A;  3W6J B;  2KIQ A;  1WSU A;  2F48 A;  1C0W A;  5IT9 Z;  4BQO A;  4UNO A;  2CO5 A;  1MMG A;  5BMZ A; 
#chains in the Genus database with same CATH homology
 4MHG A;  4BXU A;  2FCO A;  2K7L A;  1K6O A;  2GQQ A;  1RLV A;  1L3L A;  2NAZ A;  4RB3 C;  1XSD A;  1U78 A;  4YFN F;  1B6A A;  2IRF G;  1U5T C;  3IWZ A;  5LLQ A;  2ZYZ B;  1XGN A;  2ACJ A;  2CV8 A;  1IRG A;  3F8C A;  5F1R A;  1FC3 A;  4CDG A;  2MH2 A;  3E6D A;  2FA5 A;  3HRM A;  1S6L A;  2WIZ A;  5FFX A;  4KIG A;  1TW3 A;  1WKM A;  5LHI A;  1P6R A;  3REO A;  3IRQ A;  1OR7 A;  2UXN A;  2K4B A;  5HDN A;  4NQW A;  1GEF A;  1CF7 A;  2G9W A;  3GFL A;  4BHB A;  2OQG A;  4PGG A;  2D1H A;  4DNC A;  3CO7 C;  2WWY A;  3D0S A;  2QQA A;  3V7C A;  1U5T B;  1Z9C A;  3ZPL A;  4HF1 A;  3HOS A;  2YX7 A;  3E97 A;  1XN7 A;  4L9V A;  4I7H A;  2HOE A;  2XGX A;  5LHG A;  4HZF A;  2ZKZ A;  2BYV E;  1O7L A;  3F6V A;  3WE3 A;  1OYW A;  3F23 A;  3TOB A;  3HTU A;  3WTT C;  4OIP F;  4M73 A;  1G3W A;  1ZRF A;  3GF2 A;  4HX8 A;  4IVN A;  2V79 A;  3DP7 A;  2VS1 A;  3JTH A;  1MJ9 A;  2GJW A;  3HRT A;  2VBY A;  4WXH A;  5H6R A;  5DD8 A;  1ZRE A;  2XKO A;  3C1D A;  1BI1 A;  1K78 A;  1Z6R A;  1KU7 A;  2JT1 A;  2M87 A;  3R6S A;  4WK8 F;  2V1U A;  5DEQ A;  3DFG A;  1O3S A;  2ZJ2 A;  4UXN A;  4OIQ F;  2J5P A;  3AAF A;  2QQB A;  1ZN2 A;  1XGM A;  1DPU A;  1ZH5 A;  3MZH A;  3LFK A;  3JSP A;  1YIO A;  1J9I A;  3HSF A;  1USS A;  3LAJ A;  1KGS A;  2ZO4 A;  3BJA A;  4IRG A;  3GW2 A;  5E17 F;  4A6D A;  2DQR A;  2ESN A;  4EM0 B;  2F5D A;  2WC2 A;  3RTR A;  1AWC A;  4N0B A;  1FSH A;  2JTV A;  1DPR A;  1D5V A;  3OV8 A;  5EEG A;  1P92 A;  1D3Y A;  4YFK F;  1R1U A;  1S7O A;  1FP1 D;  2H09 A;  4MGR A;  1SD7 A;  2XAQ A;  1Y88 A;  4U7B A;  1IXS B;  1S29 A;  4O3M A;  3BDD A;  3FF5 A;  1ZRD A;  4MNU A;  2OU2 A;  1IAW A;  3M8E A;  1SD4 A;  4H0E A;  4EV1 A;  2UXX A;  1HW1 A;  1YFH A;  3VB2 A;  3IWF A;  4UV8 A;  4U0V A;  3ZMZ A;  3MQ0 A;  1D8K A;  2P6S A;  3DNX A;  5K5Q A;  1BIB A;  1UST A;  4IF4 A;  2IP2 A;  2M5W A;  4LLG F;  3ECH A;  5E1X A;  3FWE A;  3ABU A;  1IN5 A;  2NRA C;  2F5E A;  5LGT A;  2V1D A;  5E20 A;  3GZ6 A;  2UWM A;  3DEU A;  1RUN A;  1YW7 A;  1UHW A;  1MD0 A;  2IJL A;  3KEO A;  2FE3 A;  3V8J A;  3SHF A;  1HW5 A;  1JXS A;  4N9I A;  4CZZ A;  1OYI A;  4DQ2 A;  4ENM A;  1U6G A;  4TKK A;  2Y0M A;  2LF8 A;  2RNJ A;  1DUX C;  3QU6 A;  4KIC A;  5HS8 A;  3TKY A;  2HWV A;  3GUD A;  4PZJ A;  1ZGA A;  4RB2 C;  2HQR A;  3MAJ A;  1IRF A;  2YX4 A;  2G7U A;  5HLI A;  5EEH A;  3V7S A;  3I59 B;  1Y0U A;  2O8X A;  3F8B A;  2GIV A;  2QQ9 A;  3RJP A;  1F5T A;  2EFW A;  3ZMD A;  2HTJ A;  1JGS A;  2VE8 A;  2EFO A;  1XDS A;  4A0Z A;  2K86 A;  2ZFW A;  4CXF A;  3R0J A;  2DPD A;  1BIA A;  5FLX K;  1T98 A;  2FBI A;  1ZG1 A;  3S2W A;  1EH8 A;  1FPQ A;  1FP2 A;  2FSW A;  2LNB A;  3K1P A;  3ELK A;  4ESJ A;  5AIP A;  4HOB A;  4CYD A;  4XRF A;  2P6T A;  2D1V A;  2R7D A;  4XBF A;  5L3B A;  2FML A;  5D6E A;  5J8F A;  3HRS A;  1P4X A;  4LK1 F;  3RDI A;  4I0B A;  1XCB A;  4IPA A;  3HTS B;  2VOP A;  2D45 A;  3EET A;  3F6O A;  4LMY A;  3EYY A;  1FBS A;  2JRT A;  3WGG A;  4QBN A;  4LG0 A;  2A07 F;  2E1N A;  3LA7 A;  4GYG A;  4OIN F;  2DAO A;  2QWW A;  1HQC A;  3O3K A;  2LDU A;  4E6Z A;  3P9K A;  4G6Q A;  2VC0 A;  5CVV A;  1YYV A;  5CVU A;  3SZP A;  4OIR F;  2O61 A;  3C18 A;  2EK5 A;  4EJO A;  2OQR A;  3ECO A;  5L3C A;  4OMY A;  1W7P D;  2P7C B;  2EB7 A;  1I27 A;  5D8K B;  4YII A;  2GWR A;  1FZP B;  4U88 A;  3FXU A;  4EJU A;  2BBY A;  2K02 A;  1G3T A;  3L09 A;  2E7W A;  3KET A;  4TV7 A;  1CF7 B;  2UZK A;  5L3G A;  3Q5F A;  1T39 A;  2ZCW A;  5E1Z B;  3KZY A;  4HV6 A;  1BC8 C;  2FNA A;  4G6D A;  4YFX F;  5HLH A;  4A5M A;  3V8L A;  1Z1D A;  2HYF A;  1I6X A;  3FHZ A;  4EJT A;  3K1M A;  3MWM A;  1QZY A;  1G6N A;  3HUG A;  2XKP A;  5DUK A;  1ZP7 A;  4LFU A;  1UFM A;  2XAS A;  2HFH A;  3L9F A;  4NB5 A;  3BPX A;  2DTR A;  3ROU A;  3F3X A;  2CWE A;  4MEX F;  3FM5 A;  1YS6 A;  3HSE A;  5K1Y A;  1K78 B;  3WTV C;  5BPD A;  2JSC A;  4D0P A;  2A61 A;  1FNN A;  1FBQ A;  4A6E A;  3KLO A;  4L5J A;  3V7R A;  3BWG A;  4I01 A;  3FZV A;  2QZ8 A;  4XSZ F;  4Q47 A;  4KN7 X;  3GYH X;  2FEZ A;  1OMI A;  2CW0 F;  4E70 A;  3TQN A;  2XUB A;  2STW A;  3TO9 A;  2OKF A;  4RGS A;  4DAP A;  5LRR A;  3E6M A;  3I0T A;  3IF0 X;  2J5O A;  4DA2 A;  1YW9 A;  3WTY C;  3E5X A;  4G7H F;  4LJZ F;  4M9S A;  5E18 F;  1T6S A;  2BGC A;  3DQV C;  3PQJ A;  1RUO A;  3KP5 A;  2DBS A;  1H9T A;  1YNM A;  1OYY A;  4M9Z A;  5D5X B;  4B8X A;  5LHH A;  1XMK A;  5TRD A;  5DCM A;  2LKP A;  3IL2 A;  2STT A;  5CVI A;  2HR3 A;  3RYP A;  4FX0 A;  4G7O F;  5DCF A;  1PDN C;  3FM3 A;  1E2X A;  3WG9 A;  1KQ0 A;  3HRU A;  5K5R A;  1ONV A;  4MTD A;  3RPU A;  3I58 A;  2L3D A;  3MZY A;  2L4M A;  3WE2 A;  4KMU X;  3T8R A;  4A12 A;  3QP6 A;  1REP C;  1KU2 A;  2OZU A;  1W7P A;  4KA4 A;  5ED4 A;  2Z3Y A;  2EA4 A;  2QYO A;  4RB1 A;  2FMY A;  5AON A;  3D5L A;  3P9I A;  3FMQ A;  5L3F A;  3ZMS A;  4P5O A;  1KU3 A;  1LDJ A;  1U3E M;  2O03 A;  2RN7 A;  1TLH B;  1BBY A;  3I4P A;  3WTX C;  2H94 A;  4LK0 F;  1XGS A;  2XV4 S;  3KCC A;  3DF8 A;  5ICE A;  4KUM A;  2A6H F;  2Z5U A;  3L7W A;  2OZ6 A;  4XLN F;  5HS7 A;  1DDN A;  3JW4 A;  2ZXJ A;  3GX4 X;  4G8X A;  2EFP A;  3CDH A;  1YW8 A;  4IHS A;  1BI3 A;  2PLY A;  2QLZ A;  1XDU A;  3RYR A;  2EA2 A;  2HYG D;  4ENJ A;  4WF2 A;  1IN4 A;  3TDU C;  1Z05 A;  4EM1 A;  1UCR A;  4EMS A;  2KJB A;  1BN5 A;  4S04 A;  6PAX A;  1SD5 A;  2W85 A;  4HAM A;  5JFR A;  4HQE A;  1O57 A;  1G4D A;  4R79 A;  2XAG A;  4G6U A;  1TTY A;  4P9U A;  4LG0 B;  1RI7 A;  4MQV A;  3BP8 A;  1IXC A;  5JHU A;  3EDP A;  2FOK A;  4TKD A;  3GFI A;  3HHG A;  2HGC A;  2PBI A;  2Z33 A;  1R7J A;  3U2R A;  1LJ9 A;  1SFU A;  1LQ1 A;  3E5Q A;  3SQN A;  2PEX A;  4WXD A;  4HW0 A;  4KT5 C;  1JE8 A;  4B09 A;  3ZN0 A;  3E6C C;  2ISY A;  3B73 A;  2JZY A;  4A0Y A;  2IW5 A;  3P9C A;  4HYE A;  2FLC A;  4HDV A;  2CYY A;  3M1E A;  1UHM A;  3BT7 A;  2HKX A;  5D5U B;  2IT0 A;  4HX7 A;  4BNC A;  1YLF A;  1XMX A;  1Z6T A;  4WCG A;  4IRH A;  3KLN A;  3ULQ B;  1L0O C;  3WGH A;  4ZYE A;  1W4M A;  4IRI A;  1U8R A;  2QEN A;  5FFZ A;  5HDK A;  2COM A;  4I02 A;  2D2W A;  4I2O A;  4KIB A;  5CJ9 A;  3RKW A;  4AD9 A;  2EWN A;  4KDP A;  2M30 A;  2V1X A;  1KQ8 A;  1TQP A;  4MEY F;  1P4W A;  3KP2 A;  3ZMU A;  4L9J A;  1WI9 A;  4PDK A;  4ETS A;  3WTZ A;  4HLY A;  3JSO A;  3ML6 A;  4WWC A;  2DW4 A;  2R7F A;  2RVC A;  1MDM A;  1A04 A;  1U2W A;  3KFW X;  3VOE A;  5ICG A;  4UUV A;  3MCZ A;  2QVO A;  1ZG3 A;  4ZYD A;  3F72 A;  3GLX A;  1G3S A;  1ZYR F;  2P5K A;  4G94 A;  5H6Q A;  3IKT A;  2BE5 F;  3M9A A;  1ZLJ A;  1HBX G;  5LRS A;  3G3Z A;  4FHT A;  1HH1 A;  2EV6 A;  2VON A;  4FT8 A;  2H6C A;  1R23 A;  1XB4 A;  5FO5 A;  3R4K A;  2WIW A;  1B4A A;  4Z2Y A;  4A5N A;  4EGY A;  2A3S A;  5L3D A;  5DCM B;  4IXA A;  2FF4 A;  4FX4 A;  4L0Y B;  3I71 A;  3QPH A;  4EVI A;  4UVC A;  2KKO A;  4JBA A;  2QBY A;  3TO7 A;  3ZMV A;  1EH7 A;  2KRF A;  2QM3 A;  2PFB A;  1FYL A;  4ASN A;  4OOI A;  1BOA A;  2M45 A;  1IZ1 A;  1OPC A;  1R5G A;  2O6G E;  1ON1 A;  5DDG A;  1FYM A;  2ZME A;  4KIF A;  1FOK A;  3AJV A;  1W7P B;  3T5X A;  2HEO A;  1WWX A;  3ZP5 A;  4WX9 A;  1ZHF A;  4U7D A;  4L5I A;  4NHJ A;  2XAF A;  1T0F A;  3EYI A;  1FBU A;  4ENK A;  3VEP A;  1R00 A;  1MJA A;  3CUQ A;  1HKQ A;  5LEK A;  1PP7 U;  2FU4 A;  2MLK A;  1MZB A;  2EO0 A;  4QBO A;  2JPC A;  2EV0 A;  4EV0 A;  2RDP A;  3BJ6 A;  2EFN A;  4UV9 A;  2F5F A;  2E7X A;  4BYY A;  5H20 A;  3GZ5 A;  4CO8 A;  2CGP A;  3GFJ A;  4Q4Z F;  4LLL A;  3U9G A;  5CVR A;  2Q0O A;  4MTE A;  4LGW A;  3CLO A;  4UHT A;  2VC1 A;  4ENN A;  1SFE A;  3JAM K;  4HA8 A;  5HS9 A;  3T0Y A;  1RIO H;  1BM9 A;  3Q9V A;  4HV5 A;  1J59 A;  3LWF A;  4GXO A;  4I98 B;  5E1W A;  2PJP A;  1OB9 A;  4LQE A;  1IPI A;  4S05 A;  4JQF A;  3C3W A;  2VBW A;  2MC3 A;  2XIG A;  2VLD A;  1P2F A;  3L00 A;  2RGV A;  1O7F A;  1H0M A;  4Q5S F;  1R1T A;  4KNY A;  5CYV A;  3EQL F;  2W57 A;  3DKW A;  3KP7 A;  3K9T A;  2FRH A;  2P7V B;  3FXQ A;  1LDK B;  3I53 A;  2XAH A;  3ERE D;  1O3R A;  1TNS A;  2G7H A;  4AIK A;  2Q2E A;  1T2K A;  3CUO A;  3O2P E;  2L54 A;  2CG4 A;  4UVB A;  2OAZ A;  1WQ2 A;  3HYI A;  3M7G A;  3KEQ A;  1JHH A;  4G6V A;  1SMY F;  2HTS A;  4DAV A;  4EJW A;  3K69 A;  3R61 A;  2GW6 A;  3BOQ A;  3VFZ A;  4QLC U;  2QUF A;  3RKY A;  2GA1 A;  5JVT A;  1FWZ A;  3BJO A;  3ABT A;  4CIC A;  3V8K A;  2NYX A;  3J7A O;  2HZT A;  2IPQ X;  4YG2 F;  4O6J A;  2EFQ A;  2L01 A;  5FD5 A;  3I54 A;  2ZNZ A;  1TQI A;  1F9N A;  2A68 F;  1XSX A;  3F8F A;  3IEY A;  3ZQ7 A;  4KFC A;  1X3U A;  2MD5 A;  4OMZ A;  2V9V A;  2ZBK A;  3IHU A;  1ULY A;  2WCW A;  3ISP A;  2VXZ A;  4XLP F;  2F5C A;  5LEJ A;  1XSV A;  1SFX A;  1HSJ A;  4GO1 A;  4HLX A;  4BAY A;  1HXD A;  5K5O A;  1S8N A;  1BI2 A;  3OOP A;  2ZNY A;  1GHC A;  1J75 A;  1ODD A;  1MDM B;  1QBJ A;  1R36 A;  4U0Y A;  2WV0 A;  5ICF A;  1Z7U A;  2VT2 A;  3T1B A;  5LGU A;  4XSX F;  3WTS C;  3QRF F;  1A79 A;  1XCV A;  3JAM Z;  4L0Z B;  5CVJ A;  3W6K B;  1E17 A;  3KZZ A;  2WCZ A;  5CLS A;  1B9M A;  1ZRC A;  4A2U A;  4LLN A;  2ISZ A;  1I5Z A;  2KJC A;  2GA2 A;  1D8J A;  4WXC A;  4BHC A;  2O0Y A;  1HKT A;  3P1Z A;  3FMS A;  4M9X A;  2VOD A;  2HKO A;  2OBP A;  3CUQ C;  3J80 K;  2OD5 A;  5JI6 A;  2QBY B;  5ILS A;  2GXG A;  2C6Y A;  4F7Z A;  1T38 A;  1LVA A;  4U0W A;  4LB6 B;  4EQQ A;  1MJB A;  2PQ8 A;  3HOT A;  2DO7 A;  5A2Q Z;  1QO0 D;  4KYW A;  3TGN A;  1YG2 A;  2ZME B;  2W84 A;  3AJV B;  2DT5 A;  2W25 A;  3GVA A;  4AIJ A;  4CHU A;  1B9N A;  2TDX A;  2EJR A;  4Y17 A;  3BPV A;  5IT3 A;  2CZR A;  2HQN A;  2DFI A;  1NHA A;  4P9F A;  3N4M A;  3BY6 A;  3KP6 A;  3ZN1 A;  3CUQ B;  1B1B A;  1YS7 A;  4ZYG A;  5ICC A;  1XMA A;  2W8M A;  2INB A;  1F4K A;  1GVJ A;  3KP3 A;  3KP4 A;  4RAZ A;  3GFM A;  3DXJ F;  3WOD F;  1I1G A;  1EH6 A;  3WGI A;  4L9T A;  2DLL A;  1BC7 C;  3KE2 A;  4LB5 A;  4ESF A;  2PN6 A;  2FNP A;  4LD5 A;  3U1D A;  4GYI A;  5BOX A;  2M8E A;  2CFX A;  3QP5 A;  2JPB A;  4M71 A;  1R1V A;  3R0A A;  1IUY A;  5F6F A;  4Y15 A;  2XVC A;  2MLG A;  4M6X A;  1KU9 A;  3DV8 A;  4AWX B;  5LBQ A;  2W24 A;  4IJA A;  3P7N A;  1YQA A;  2M1B A;  2XAJ A;  4ON0 A;  3I64 A;  3LAP A;  2AS5 F;  2P5V A;  2XRO A;  4AVP A;  5F64 A;  2FXA A;  2YPR A;  3FOV A;  2IA0 A;  3ZMT A;  4BH9 A;  3TDZ C;  1BJA A;  1RNL A;  4ZH4 F;  2WTE A;  5KK1 A;  3COA C;  2X0L A;  4OIO F;  1DP7 P;  1SD6 A;  1LDD A;  2RQP A;  1PUE E;  2Q8K A;  2IVM A;  4RAY A;  1WRJ A;  3T8T A;  1ON2 A;  2A69 F;  3G73 A;  3CTA A;  4P55 A;  3RIR A;  5FGM A;  2VOO A;  4ESB A;  2NNN A;  3PQK A;  1V3F A;  2DBB A;  2DQL A;  3QOP A;  1MGT A;  3K1N A;  1YTY A;  3FMR A;  5HOO A;  2HDC A;  1JHF A;  4G7Z F;  4N9H A;  1IXR C;  1ZAR A;  2KIM A;  3K0L A;  1J7K A;  4ZZL A;  5FDK A;  1MKM A;  1CGP A;  1QQI A;  1QZZ A;  1RZN A;  2PMH A;  5J6X A;  3BZ6 A;  1XGO A;  1P4A A;  2DK8 A;  2B0L A;  4ZZD A;  5LGN A;  5E8I A;  1S7A A;  4Y13 A;  1K79 A;  3BRO A;  5D4S A;  4PGH A;  2DK5 A;  1UB9 A;  1K7A A;  2E1C A;  2XHK A;  2V6C A;  3TOA A;  4HX4 A;  3LA2 A;  3J80 Z;  2KIU A;  3DPT A;  2MA3 A;  4JK1 X;  1I1S A;  2H27 A;  5BQT A;  1OB8 A;  4QWQ A;  1YO5 C;  5J8C A;  2FL3 A;  4OU0 A;  3JTG A;  2X4H A;  3IEY B;  2P5L C;  4YIF A;  1G3Y A;  4M74 A;  2Z9O A;  2ETH A;  2FQ3 A;  2JJQ A;  1Z91 A;  1O3Q A;  2YU3 A;  2PMU A;  2OA4 A;  2AXL A;  2L02 A;  1J0R A;  1FX7 A;  4O5V A;  5D5W B;  1ZG5 A;  4GCV A;  1S3J A;  4G9Y A;  5DV5 A;  1R0V A;  5BS6 A;  1FYK A;  3LA3 A;  2WJ0 A;  3Q9S A;  3VOD A;  3WTW C;  3QU3 A;  5D4R A;  2XRN A;  2EV5 A;  4EM2 A;  4L9N A;  5D6F A;  5DUI A;  2ZYZ A;  3CJN A;  1TQM A;  1R11 A;  4MQ9 F;  5AIQ A;  5D5V B;  5FD6 A;  1R5H A;  1HKS A;  3J81 K;  2P4W A;  1OKR A;  3QAH A;  5DYM A;  1PP8 F;  1TBX A;  3LQQ A;  4BHP A;  2O3F A;  3QPT A;  3MFK A;  3H3U A;  1HST A;  3EUH A;  4QBL A;  4BQA A;  4HDU A;  3P1Z B;  2YSR A;  1U5T A;  5FB2 A;  2LSO A;  1AOY A;  1ZAO A;  3TO6 A;  1GXQ A;  4HQM A;  1R58 A;  4I0A A;  3NRV A;  2PG4 A;  3HIF A;  1RZ4 A;  2DU9 A;  5L3E A;  5ILU A;  2F2E A;  3RI4 A;  3FXR A;  3P1Y A;  4M6Y A;  3F8M A;  4A0X A;  2H6B A;  2IA1 A;  3SFZ A;  3E3V A;  1LNW A;  2VBZ A;  1H9G A;  5IT9 K;  1W5S A;  4CGZ A;  3B02 A;  1FT9 A;  4RGR A;  3GEZ A;  4UVA A;  2GXB A;  4RS8 A;  2MH9 A;  1R22 A;  2KIF A;  3V4G A;  3IKV A;  2FKH B;  4R8H A;  2CQK A;  2BEO A;  1IN6 A;  1J2X A;  3FX3 A;  2NS0 A;  2FBH A;  2OST A;  1TNT A;  4IHT A;  3E5U A;  4HF0 A;  5ERI A;  2ESH A;  2Y75 A;  3N97 A;  2YR2 A;  2GZW A;  3GXO A;  2NNY A;  5A2Q K;  1XD7 A;  3I5U A;  3MEX A;  2MBF A;  2PI0 A;  1STZ A;  5JR3 A;  3NQO A;  1IN8 A;  2RV8 A;  2RC4 A;  1ZLK A;  5HLG A;  4ZYH A;  2BV6 A;  1FY7 A;  1QPM A;  1O3T A;  1ZGJ A;  3F8N A;  2ADU A;  4KMF A;  3GWZ A;  1V4R A;  4M72 A;  3SZT A;  5E8G A;  3DPL C;  4R1H