1F1ZA

Tnsa, a catalytic component of the tn7 transposition system
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
260
structure length
260
Chain Sequence
FSEVQIARRIKEGRGQGHGKDYIPWLTVQEVPSSGRSHRIYSHKTGRVHHLLSDLELAVFLSLEWESSVLDIREQFPLLPSDTRQIAIDSGIKHPVIRGVDQVMSTDFLVDCKDGPFEQFAIQVKPAAALQDERTLEKLELERRYWQQKQIPWFIFTDKEINPVVKENIEWLYSVKTEEVSAELLAQLSPLAHILQEKGDENIINVCKQVDIAYDLELGKTLSEIRALTANGFIKFNIYKSFRANKCADLCISQVVNMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords TNSA ENDONUCLEASE
publication title Unexpected structural diversity in DNA recombination: the restriction endonuclease connection.
pubmed doi rcsb
total genus 91
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08721 Tn7_Tnp_TnsA_C TnsA endonuclease C terminal
A PF08722 Tn7_Tnp_TnsA_N TnsA endonuclease N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1f1zA02
3.40.1350.10 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 1f1zA01
3F6VA 5D4SA 1O3QA 4KMUX 2BEOA 2ZFWA 3I53A 5L3DA 3SZTA 2IRFG 1SMYF 1OKRA 1TW2A 4GCVA 4DNCA 4UHTA 4LGWA 4IHSA 1GXQA 4PCQA 2R3SA 4KDPA 1TBXA 2RC4A 1LVAA 3TKYA 4EVIA 3QU3A 1R22A 4HQEA 1OB9A 2XHKA 2K27A 5IT9Z 4WCGA 5KK1A 1FX7A 2PMUA 1MZBA 2XROA 3KP7A 2QM3A 2XAFA 4O5VA 1ZN2A 2HFHA 5D5XB 2XAQA 3KZZA 5D6FA 2Q0OA 3AAFA 1V4RA 4OIOF 1B59A 4CHUA 2FBIA 2ESNA 4IHTA 1K78B 3F8CA 1YW7A 5DEQA 5KVRA 3MFKA 5D8LB 2ACJA 1Y88A 1YLFA 1ZG3A 2FXAA 4G94A 5K5QA 3I64A 3FWEA 4ESFA 2X0LA 1XDSA 4GO1A 4K2EA 2M1BA 2ZXJA 1ZRDA 1HW2A 1G3TA 1IW7F 4MHGA 4UV8A 4OIRF 3R0AA 3I4PA 3JAMZ 2BBYA 1WRJA 2PFBA 3T8RA 3WTZA 2VXZA 4MNUA 2PN6A 3EUHA 4A0YA 2FCOA 1FBSA 1IN8A 1ZARA 1LB2A 4ETSA 1MJ9A 3FF5A 3CUOA 3KP6A 2V79A 4RB1A 3E6BA 2JSCA 3DF8A 3ZN0A 2M45A 2EO0A 4RAZA 4XBFA 5BS6A 2CYYA 1S6LA 2K02A 1T0FA 2KIMA 3HSFA 3C7JA 3N97A 2QQBA 1YYVA 4B09A 4RAYA 2OAZA 4I98B 4ZYEA 2DFIA 1E17A 2JT1A 1FP1D 3L7WA 4AIHA 3ZMVA 3GFLA 3GEZA 3GWZA 4U7DA 1WQ2A 4N0BA 1SFXA 2MD5A 2M30A 1E2XA 3FZVA 3GUDA 4BHCA 1MJBA 1FBUA 1BN5A 2ISZA 3P9IA 3RKXA 2XIGA 5LGUA 3I59A 2O3FA 2VC0A 1P4WA 3LA2A 3V8JA 3D0SA 1UHWA 5LHGA 3WU1B 1J7KA 4EMSA 1P4XA 4I0BA 5DCMA 2OBPA 5E8GA 1I1SA 1SD4A 1ON1A 1ZHFA 1LQ1A 4LG0A 4U0VA 1QBJA 2C6YA 3OOPA 4KA4A 3KZYA 2WIWA 3F8FA 1OB8A 5JR3A 1S7AA 3H3ZA 1FSEA 2GXGA 2FBKA 5HDGA 5J6XA 3MQ0A 3WTXC 2ZMEB 1XDUA 3K1NA 2XAHA 3Q5FA 1ZG1A 5LGTA 4S04A 3ECHA 2WV0A 3V4GA 3I71A 3OV8A 2AS5F 3V7SA 3CLOA 3K69A 2PJPA 1IN6A 2HYGD 4RS8A 5K1YA 3E3VA 2XV4S 3B73A 2F5DA 2VE8A 4HQMA 4HF1A 3C1DA 2IVMA 2A3SA 4AD9A 3QPHA 4YFXF 3HSRA 4A6EA 1ULYA 1G3YA 1KQ0A 3ISPA 4R79A 3WTSC 1TNTA 3RPUA 1BI3A 1USSA 3FHZA 3DEUA 2F5EA 5J8FA 1IRFA 2IW5A 2PQ8A 3T1BA 2YU3A 4DQ2A 4YG2F 3I5UA 2STTA 4EJWA 2JZYA 3P1YA 1GVJA 3U2RA 2WTEA 5AIQA 2FNAA 1R1TA 1J5YA 1QGPA 4BYYA 4QWQA 2COMA 3BOQA 3F72A 1MDMB 2O61A 3E6CC 4OOIA 2FE3A 1ZP7A 1OMIA 2D1HA 1C0WA 1F9NA 2VC1A 3QRFF 1BI2A 4HX7A 4FX0A 2DO7A 3F6OA 2W85A 3LWFA 2FA5A 1OR7A 4L5IA 2DK5A 4HX8A 1KU2A 1J75A 3JSPA 2P5VA 3FM3A 1J59A 4GYIA 5K5OA 2GWRA 1K78A 3AJVB 4XSXF 2XUBA 3HOTA 4PDKA 1EV7A 1Z1DA 2GA1A 4YIIA 3P9CA 5FD5A 1ZRFA 4KN4X 1WWXA 3WE2A 1DPRA 3HOSA 4UV9A 4IRIA 2M5WA 2OA4A 1P6RA 2L4MA 1IN5A 3MZYA 4O3MA 2KKOA 3J80K 4QBLA 1R1UA 1A79A 2CGPA 2NRAC 1ZG5A 3IHUA 2MBFA 5FGMA 4AIKA 3HHHA 2MC3A 4P96A 3HHGA 5E1ZB 4G8XA 3LAPA 3GZ6A 2Z99A 3V8KA 2CO5A 4AWXB 3HTUA 5H20A 3L00A 1XMKA 3ZP5A 2EFPA 2EB7A 5H6QA 1DP7P 2XRNA 1SFUA 2FOKA 1ONVA 1YS7A 4JQFA 4CGZA 2ZJ2A 2EJRA 1RUOA 3KP5A 4EJTA 1BC8C 2P6TA 3KP3A 4HV6A 1SMTA 3D5LA 5ICEA 5E1WA 4I2OA 1HW1A 4ON0A 4ESJA 3WU0A 3G3ZA 2Z9OA 5EEHA 3HTSB 1ZH5A 2ETHA 3TQNA 2OSTA 4UVCA 1S3JA 3CJNA 4HF0A 5CVIA 4Q4ZF 2A61A 2A69F 2X4HA 3E5XA 3HRSA 2A68F 4KIGA 1T2KA 2D45A 2J5PA 3P7NA 2O03A 4A0ZA 4OINF 4HF2A 1IXCA 3TOAA 1RNLA 4E70A 4LMYA 5DD8A 1IXRC 1R5HA 2HTJA 1ODDA 5HLGA 2OZ6A 1RIOH 3CO6C 4KICA 3FMSA 3FXQA 1T39A 2J5OA 2EFWA 4A2UA 3M9AA 2W24A 1U5TC 2XGXA 2VODA 1U5TB 3RYRA 2UWMA 1YG2A 1XGMA 1I6XA 4FX4A 3BZ6A 1J9IA 5BOXA 1FT9A 1W4MA 1GXPA 2ZNYA 5ED4A 2FQ3A 2HR3A 3RPQA 1FBQA 2ZMEA 4RB0A 1O7LA 4MTDA 4IF4A 1ZLKA 1CGPA 2V1DA 5HS9A 2H94A 3Q9VA 1BIBA 2KJBA 4M6XA 3DXJF 3GFJA 2ZBKA 3O3KA 4Q5SF 4I09A 2HOEA 2MA3A 1O57A 2IP2A 3LSTA 3SFZA 1V3FA 3GXOA 3U9GA 2TDXA 2VBYA 1U78A 3EYYA 4ZYGA 3NEUA 2PI0A 4BHPA 1GEFA 5A2QK 4WF2A 2ISYA 4XLPF 2VT3A 2KIFA 2P7CB 2K4JA 5L3CA 4Y13A 3LA7A 4LK1F 3VB2A 2YR2A 2Y75A 2HQRA 4HYEA 1I27A 4UVBA 5D6EA 3QU6A 2BGCA 4G7OF 1PP8F 4WXCA 2IT0A 3KE2A 2B0LA 1OYIA 2WCZA 3TDZC 1Q1HA 2IA2A 4GXOA 4EJVA 4G7ZF 3T5XA 3E5QA 2VLDA 2VOPA 1IXSB 2Z3YA 3JSOA 4PGHA 4Y15A 4ENKA 1O3SA 1Z91A 4L9NA 4CZZA 2LSOA 3AJVA 1R5GA 3WGGA 1ZREA 2HZTA 3S2WA 3ZQ7A 3IRQA 1R7JA 4M9SA 1EH8A 1IN7A 2INBA 1BBYA 3B02A 2IJLA 5EEGA 1F1ZA 1KU3A 4GGGA 1ZGAA 2G7UA 3WE3A 4I7HA 5L3EA 2M87A 3BROA 5JVTA 2EWNA 1J0RA 3L2CA 2DK8A 3KCCA 3J81K 5DD4A 3ML6A 5JFRA 5CVUA 2UXNA 3J80Z 2EK5A 3K0LA 1Y0UA 4ZYDA 4A6DA 4KT5C 2G9WA 1G3SA 1EH7A 1ZLJA 2H6CA 3IWFA 5FDKA 3TO7A 2JTVA 5E17F 3ULQB 4HV5A 3N4MA 1F4KA 4YFKF 3REOA 1OYYA 3ERED 2MH2A 4LB5A 4HLXA 5LHIA 1JHHA 3DP7A 2DTRA 1BIAA 4LLLA 3BWGA 4WX9A 2M8EA 4LFUA 2AXLA 2MH9A 2HKOA 1G4DA 2GW6A 4G6QA 3W6KB 4CDGA 1LDDA 1Z9CA 1MKMA 5L3BA 3P1ZB 4EM0B 1W7PB 1IN4A 3WODF 1IAWA 3KETA 2DW4A 1CF7B 2CQKA 2CG4A 3JTHA 1XSDA 4P9FA 4RB2C 3KEOA 4ZZDA 5D5VB 3JTGA 1OPCA 3E97A 3ELKA 1L3LA 2ESHA 4MGRA 4P9UA 3DQVC 1HW5A 4L0YB 2PEXA 4UXNA 3ZMUA 1BOAA 1U5TA 4KN7X 4CXFA 2JPCA 3BP8A 1XCVA 1FPQA 1RZ4A 3L09A 4U0YA 2NS0A 2QQ9A 3F8MA 1IF1A 2CFXA 5E8IA 2EA4A 1YW9A 3BPVA 4QBNA 1XD7A 2E7XA 2JRTA 1D3YA 2JPBA 3P9KA 1JGSA 2QYOA 4L0ZB 2D2WA 3K1PA 4LB6B 1TTYA 2Y0MA 5HDNA 2OU2A 4BXUA 2V6CA 1LNWA 4RGXA 2FMLA 2W57A 1XMXA 5F64A 3BJOA 2LKPA 4EM2A 4G6DA 2P5KA 4AIJA 3C3WA 2K7LA 4G7HF 4YIFA 2HYFA 3EETA 3V7RA 1FY7A 4JK1X 2FBHA 1LDKB 2L02A 1HSTA 3DPLC 4WXHA 2A6EF 2EFNA 1KQ9A 5ILSA 5HVQC 3BY6A 1FP2A 5ILVA 3GO5A 3CUQC 2V9VA 3CUQB 1STZA 1XGSA 1HKTA 1XB4A 1T6SA 2WC2A 3EQLF 3MAJA 5A2QZ 2XKOA 3T0YA 1TQIA 2BE5F 1Y1OA 2K86A 4IRGA 1FYMA 4LJZF 1HH1A 1SD6A 2BYVE 2OZUA 1TW3A 3GF2A 2OQGA 2E1CA 2LF7A 3PQKA 4HAMA 2PLYA 1XCBA 1W5TA 3WTUC 2FF4A 4A12A 4BNCA 3O6BB 4EM1A 4ZZLA 3HRUA 4F7ZA 3TO9A 2ADUA 2F2EA 3KP4A 4TKKA 1DUXC 1YFHA 3F3XA 3MWMA 2STWA 1KGSA 1Z7UA 5CVVA 4MQ9F 4N9IA 3HYIA 3L9FA 2NAZA 2RVCA 3NQOA 5ILUA 3MZHA 2HWVA 2DPUA 2PBIA 3QAHA 5TJJA 3SZPA 3R0JA 2QENA 1WKMA 1AWCA 2OKFA 1QZYA 1REPC 1ZRCA 3J81Z 4RGRA 2L54A 2V1XA 2O6GE 4S05A 1HQCA 3ZMDA 2E7WA 5D4RA 1RLVA 4M72A 2GJWA 4M71A 2EV6A 2W25A 4G9YA 2HDCA 5H6RA 3HRMA 4CO8A 5E18F 3SHFA 1WSUA 3RKYA 1B4AA 2LF8A 1FLIA 3I54A 4HDVA 3IWZA 3R4KA 4EV0A 5DDGA 1USTA 2XVCA 1AOYA 4NQWA 3VODA 2P7VB 2FRHA 2DBBA 2CSOA 2DT5A 5FLXK 3M7GA 3Q9SA 1GHCA 3MCZA 4A0XA 1W7PA 3V8LA 1KU9A 1UHMA 4ZH4F 1YQAA 2GXBA 1CF7A 3BJAA 3H92A 5HOOA 2WCWA 5HDKA 4D0PA 4L18B 2DQRA 1H9TA 2IPQX 3U1DA 3G73A 3M1EA 4HDUA 2DI3A 3WGIA 1U3EM 2XAGA 2MLGA 3GZ5A 3VEPA 5DCMB 2GQQA 2EFQA 2H09A 4N9HA 1SD7A 1HKSA 2FNPA 3ROUA 4RGUA 5BQTA 4UVAA 4ENMA 3IRRA 2OQRA 3RTRA 1KYZA 2QBYB 1XGOA 5LBQA 3RI4A 3DPTA 2WJ0A 1LEAA 5AONA 3M8FA 1XGNA 4KNYA 5D8KB 4ESBA 5HLIA 2HQNA 1O7FA 3ECOA 3ZPLA 1XN7A 4IRHA 3K1MA 5LRRA 2HTSA 4PZJA 3F21A 4TV7A 1WI9A 3GVAA 4Y17A 3BDDA 5ICCA 2CV8A 1KA8A 1PUEE 4I0AA 5F1RA 5IT3A 2E1NA 2MLKA 3FXRA 2CW0F 2Y48A 1IZ1A 5CVJA 1YO5C 2YSRA 4L5JA 3BJ6A 4TKDA 2YX4A 3NRVA 2YPRA 1G6NA 2ZYZB 3CUQA 1H9GA 1OYWA 1U8RA 1MDMA 2XKPA 4IXAA 3TDUC 3LQRA 1R0VA 1YW8A 1JHFA 4WK8F 1TQMA 3KLOA 4KIFA 3ZN1A 3ZMSA 2V1UA 3H3UA 6PAXA 2CWEA 4I01A 4EJUA 1IUYA 3EDPA 3M8EA 4M9ZA 5L3GA 4Z2YA 3LQQA 3QPTA 5CLSA 1D8KA 3TGNA 1UFMA 1U2WA 3GX4X 1W5SA 4M6YA 2WWYA 1F5TA 4RGSA 1XSVA 4EJOA 2DLLA 1YS6A 5LGNA 4L9VA 2VOOA 5D5WB 1J2XA 3E5UA 4NB5A 5JI6A 4M73A 3DV8A 3RKWA 4KIBA 3F22A 2HGCA 4IPAA 5ICGA 4LLNA 2RGVA 4BAYA 1FSHA 1B1BA 3IEYA 1ZAOA 3QP5A 2XAJA 1LDJA 3COAC 2Z5UA 2OD5A 1HXDA 2KJCA 2IA1A 5LRSA 2RKHA 2QLZA 4QBOA 2VBZA 1FYKA 3IKVA 3F8BA 4A5NA 3GYHX 4L9JA 1QQIA 5F6FA 1BC7C 1S8NA 1XSXA 2QVOA 4MTEA 1BI0A 2UXXA 3RIRA 5E20A 4UUVA 1P2FA 4OU0A 2O0YA 5CYVA 3GFIA 4OIQF 2HS5A 1RUNA 1W7PD 4FHTA 2PMHA 4Q47A 2DAOA 3E6MA 4LK0F 5TRDA 4BHBA 2QUFA 1K6OA 1JXSA 1T98A 3FXUA 1Z6RA 4B8XA 2ZO4A 3IKTA 2GA2A 4R1HA 4L9TA 1A04A 1UB9A 3ZMZA 1BI1A 4IJAA 2VT2A 1R1VA 3WTWC 5D5UB 1I5ZA 1XMAA 5FFXA 3LFKA 2ZNZA 3ZMTA 1UCRA 3HUGA 4EQQA 3BPXA 5FO5A 1FYLA 5LLQA 3HRTA 4CICA 5FLXZ 5LEJA 3HSEA 1QZZA 4CYDA 1LJ9A 1ZGJA 2YX7A 3DKWA 2RDPA 2A6HF 5AIPA 1FC3A 2W84A 4GYGA 4EGYA 4R8HA 2NNYA 1P4AA 1KQ8A 4A5MA 1B6AA 4XRFA 1IRGA 2LDUA 3DFGA 2P5LC 3PFIA 4AVPA 3DNXA 4IVNA 1MD0A 4HA8A 3IL2A 4PGGA 2L4AA 4FT8A 3GFMA 2FEZA 2FU4A 2QBYA 2H6BA 1G3WA 3GLXA 3O2PE 3GW2A 3KP2A 2WIZA 2F5FA 1R11A 2GAUA 1X3UA 2A5YB 1VTNC 4NHJA 3SXYA 2KRFA 4LLGF 2LNBA 2HKXA 2H27A 3F23A 2Q8KA 5ERIA 3EYIA 2UZKA 3FX3A 2FSWA 3RJPA 3F8NA 1O3RA 3KEQA 3WTYC 4WWCA 3LA3A 4XLNF 2R7DA 4QLCU 5IT9K 1S7OA 4I02A 1B9NA 1EH6A 4H0EA 4HW0A 1HSJA 5BMZA 1DDNA 2P4WA 1FOKA 3RDIA 2GZWA 3I0TA 1PDNC 1TNSA 2DU9A 2L01A 1MGTA 1PP7U 1U6GA 2ZYZA 1SD5A 4JBAA 1R36A 1K79A 5DCFA 2VONA 1ON2A 3CTAA 3MEXA 2PG4A 2EV5A 1JE8A 5E1XA 2ZKZA 3R60A 3SQNA 1D8JA 4HX4A 3V7CA 1HBXG 1I1GA 2KIUA 2VBXA 5CJ9A 4ZYHA 5HS7A 3T8TA 1FNNA 2QQAA 5DYMA 1QNTA 3WTVC 3WGHA 2VN2A 4XSZF 1MJAA 1SFEA 1K7AA 4P5OA 2VE9A 1YIOA 4HLYA 3JAMK 4YFNF 3WTTC 2L3DA 4U0WA 4U88A 1NHAA 2P8TA 2FMYA 5FD6A 1LEBA 2F5CA 5K5RA 2QZ8A 1R58A 1Z05A 2ELHA 1R00A 5LEKA 4OMZA 2DPDA 1KU7A 1TQPA 2R7FA 3TO6A 3FOVA 1ZYRF 2VBWA 2Q2EA 2K4BA 4OMYA 1BJAA 5FB2A 2QWWA 3VOEA 5L3FA 5HLHA 1D5VA 1YTYA 4M9XA 1RI7A 5DV5A 4KFCA 4HOBA 4MQVA 1SAXA 4O6JA 4EGZA 5BPDA 3FM5A 1L0OC 3K9TA 3RYPA 2RNJA 2DQLA 3FMRA 4MEYF 3ABTA 2P6SA 2BV6A 3JW4A 4KMFA 2EV0A 2Z33A 3FMQA 1QPMA 2HEOA 4OIPF 4MEXF 2NNNA 3IC7A 5DUKA 3P1ZA 2RQPA 2EA2A 1S29A 1TLHB 1Z6TA 2G7HA 3ABUA 4KUMA 3J7AO 4UNOA 3KFWX 2NYXA 3TOBA 3I58A 5ICFA 1O3TA 3E6DA 2ZCWA 4Q48A 5CVRA 4WXDA 3HIFA 3I59B 3PQJA 4ASNA 1BM9A 5FFZA 3K2ZA 2O8XA 4KYWA 4P55A 2D1VA 3W6JB 3LAJA 1FWZA 3VFZA 2EFOA 1FZPB 4M74A 4U7BA 4ENJA 1RZNA 1KYWA 5HS8A 2RV8A 1H0MA 3WG9A 1HKQA 1B9MA 4LG0B 4BH9A 3CDHA 2RN7A 3QP6A 2XASA 4LD5A 3R6SA 1IPIA 1DPUA 2IA0A 4HBLA 1R23A 5J8CA 4ENNA 3CO7C 1T38A 2GIVA 5JHUA 3R61A 3C18A 2A07F 4HZFA 5DUIA 5LHHA 4BQAA 3KLNA 5BPIA 3QOPA 1P92A 1QO0D 4RB3C
chains in the Genus database with same CATH superfamily
3F6VA 2E2HJ 1O4XA 5D4SA 3P5JA 3Q0WA 4KMUX 1O3QA 2BEOA 2FD5A 2ZFWA 3I53A 5L3DA 2CV0A 2LRDA 3SZTA 3S3NA 2IRFG 2PJRA 1SMYF 1LFBA 3AG1H 3HOZJ 1OKRA 1RR7A 2ZXHA 1QHGA 1F36A 1TW2A 4GCVA 3VPRA 4DNCA 2L5QA 4UHTA 2VL8A 4LGWA 4IHSA 3L2UA 3OYJA 1GXQA 3A01B 1H88C 1W1WE 2JUCA 4PCQA 2R3SA 4KDPA 1TBXA 1Y6IA 2RC4A 3HC7A 3W6VA 1X1CA 3W2VA 4HNTA 3GTJJ 2ZSHB 1LVAA 2LOOA 4ITVA 3TKYA 4YRVA 4CYCB 2B9SA 2GOXB 3MVPA 1H89C 1E3HA 3A03A 4EVIA 4JX4A 3QU3A 1R22A 4HQEA 1OB9A 2XHKA 2K27A 2Y9YA 4PUSA 1VQLI 5IT9Z 4WCGA 2JA8J 5KK1A 1FX7A 3CCJI 3OMYA 4DAPA 3ASOH 2PMUA 2K9SA 1MZBA 1HCRA 1YX5A 2ECCA 2XROA 1E0EA 3KP7A 2QM3A 1V54H 2XAFA 2KLOA 3BZKA 1JUMA 3PNTA 5C44J 1UJ8A 4O5VA 3TL4X 3HGGA 1ZN2A 2HFHA 5D5XB 4FQGA 2XAQA 1T08B 2DMTA 3KZZA 5D6FA 1OR7C 2KRHA 2Q0OA 3AAFA 4DJAA 1V4RA 5M5WJ 3G2BA 4OIOF 4LIUA 4XONA 3LL7A 4MIMA 1B59A 4BUPA 4CCJA 4CHUA 1ZGWA 2W7NA 2FBIA 1HA8A 2ESNA 4IHTA 1K78B 1X1PA 1X1AA 1G2HA 5FKKA 3F8CA 1YW7A 5DEQA 5KVRA 2ME6A 4IO9F 4C3IJ 3MFKA 5D8LB 2LREA 2ACJA 3FBNB 2R7VA 1Y88A 1YLFA 1A35A 1ZG3A 2FXAA 1OCRH 4G94A 4Y4RA 2I5UA 5F0CA 2Y31A 3RQIA 5K5QA 1IG7A 3I64A 3FWEA 4RA2A 4ESFA 2X0LA 4UB8C 2CQ7A 1XDSA 4GO1A 4K2EA 2MD0A 2M1BA 2ZXJA 1ZRDA 2JWTA 2CU7A 2K9QA 1HW2A 1G3TA 1IW7F 1UMQA 4MHGA 4UV8A 4C2MJ 3DU6A 4OIRF 3R0AA 2MGQA 3GTMJ 3I4PA 5IYBJ 2KT0A 3I9V2 1TL8A 2M4GA 3JAMZ 5B3SH 4UY8I 2BBYA 1WRJA 1W0UA 4BQOA 3CCQI 1R5ID 2PFBA 1UHSA 3T8RA 3WTZA 2VXZA 4MNUA 2OTLI 2PN6A 3EUHA 1N75A 4A0YA 2FCOA 1FBSA 1IN8A 1RKWA 1ZARA 5H2FC 5DM6F 1IGNA 1LB2A 4ETSA 1MJ9A 1LPQA 4XQFA 1BOBA 3FF5A 3CUOA 3KP6A 2V79A 4RB1A 3E6BA 4FE4A 2JSCA 3DF8A 2XGEA 2O9LA 3BR2A 3ZN0A 3S1QJ 3ONQA 1IV8A 4JYKA 2M45A 4IL6C 3G6EI 3OYBA 2EO0A 5M5YJ 4RAZA 4XBFA 1ZTRA 1RR8C 5BS6A 2H1LA 5F27A 2CYYA 1S6LA 2K02A 3OIPA 3K4JA 3S1MJ 2CW8A 2E36A 2JRMA 1T0FA 2KIMA 3CMEI 3HSFA 4BXFA 3C7JA 3N97A 2QQBA 4A3KJ 1YYVA 1X2NA 1FTZA 4B09A 4RAYA 2OAZA 1DU0A 4I98B 4ZYEA 2M3AA 2DFIA 1OCTC 1PYVA 1E17A 2JT1A 1FP1D 3L7WA 3VSKA 4AIHA 3ZMVA 3GFLA 1JKOC 4YEJA 3BR0A 3GEZA 2NS8A 1JTXA 3GWZA 4B3XA 4U7DA 3HM5A 4BY1J 2R5YB 1WQ2A 2IEKA 4N0BA 4JP0A 2OTJI 1SFXA 2MD5A 2M30A 1FOYA 1E2XA 3FZVA 3GUDA 2M8GX 4BHCA 1MJBA 4ZDOA 2KPMA 1FBUA 1BN5A 4D7NA 1U8BA 3CMMA 4IHYA 1WPKA 4D9JA 2ISZA 3P9IA 4XOTA 1TWAJ 3M8JA 4PFPA 2JSPA 3LSMA 2BVLA 3RKXA 4B4CA 2XIGA 3OIOA 3K4BA 5LGUA 1VQ9I 1WFXA 3I59A 2EIKH 2O3FA 4I99C 4C2TA 2VC0A 1P4WA 3B6CA 3EUKL 3LA2A 3V8JA 3D0SA 3DCFA 2B7EA 1UHWA 3L2VA 2R7RA 2OPTA 5LHGA 3WU1B 4IX7A 2BZTA 2WBMA 3CDLA 4D5FA 4X0GA 2M7BA 1Y39A 1J7KA 2K40A 3NARA 4EMSA 1UWVA 1P4XA 3Q0UA 4I0BA 1MBJA 4LIVA 3OS0A 2GM4A 5DCMA 3O8GA 3WHBA 2OBPA 1RRJA 5E8GA 1XG1A 1I1SA 1SD4A 1ON1A 1ZHFA 1LQ1A 4LG0A 2DT7B 4U0VA 4E6ZA 1QBJA 2C6YA 2LYCA 4W97A 3OOPA 3CCRI 1MBEA 3DKYA 3AG2H 1FMWA 4KA4A 1YIJI 2IS6A 3KZYA 1ACIA 2WIWA 1SVLA 3F8FA 1OB8A 3J7AY 2ELKA 2GXAA 1YJNI 5JR3A 1S7AA 2W4SA 2ELJA 3H3ZA 2VKHA 3MN2A 1FSEA 3DBHB 3CJRB 3IH4A 2ZJQF 2GXGA 2FBKA 5HDGA 5EGOB 3TMOA 5J6XA 2YU9J 3MQ0A 1QA6A 3WTXC 1VQNI 4E4HA 2ZMEC 2DMQA 1XDUA 2ZMEB 3K1NA 3PUBA 2VJ4A 1D5YA 2XAHA 3HBLA 3BT7A 3Q5FA 4D5CA 1ZG1A 3AG3H 5LGTA 1MBGA 1QVUA 4XLAA 2N8GA 4S04A 3ECHA 2WV0A 1BR2A 3V4GA 2X9DA 3MKWB 3I71A 3H5NA 4OAYA 3H1CA 4XMYA 3OV8A 1A31A 3ZQFA 2AS5F 3V7SA 2ECBA 2ICWG 3CLOA 3K69A 3S8PA 3BCAA 3BTCA 2PJPA 1IN6A 2HYGD 4RS8A 5K1YA 5EZGA 3E3VA 5F1JA 2XV4S 2V4JC 3ZRGA 1GVDA 2CUEA 2A6TA 3B73A 4F92B 2F5DA 2VE8A 2LTPA 5B1BH 3BG6A 2XSJC 5CKTA 4HQMA 4ZTFA 3CP8A 5JLWA 4HF1A 2DBSA 3C1DA 3CJQB 2IVMA 2A3SA 4AD9A 1TWCJ 4Y3OA 3QPHA 4YFXF 4AIDA 3HSRA 4A6EA 1ULYA 4YELA 1G3YA 1KQ0A 2O5RA 3ISPA 4QPQA 4R79A 3WTSC 1TNTA 3RPUA 2VXDA 2HVRA 3A01A 2QCOA 3MKZA 3HOWJ 1BI3A 1USSA 1JUSA 4XKCA 3H0DA 3DEUA 3FHZA 2LK2A 2F5EA 4BACA 5J8FA 2DA6A 1IRFA 2IW5A 1X19A 2PQ8A 3T1BA 2YU3A 2E5ZA 4DQ2A 4YG2F 3I5UA 2STTA 4EJWA 3I4NJ 1MMDA 2JZYA 2X1DA 2VJJA 3P1YA 2V1NA 4CYCA 1GVJA 3U2RA 3G1MA 3CQZJ 2WTEA 5AIQA 2LP0A 2FNAA 3CCYA 2LKXA 1R1TA 2K9MA 1J5YA 1QGPA 4BYYA 4CCMA 3O8HA 4QWQA 3A0BC 4L5EA 2FUG2 2COMA 3BOQA 3F72A 1MDMB 2O61A 3BT9A 3DBRB 2BHZA 4OOIA 3E6CC 4E7KA 2FE3A 3OOUA 1ZP7A 3FXJA 4F93B 1OMIA 2D1HA 3HZJA 1ZKGA 3ZQQA 1C0WA 1F9NA 2VC1A 3QRFF 3A02A 1BI2A 4HX7A 2M34A 4M3GA 4FX0A 3GTOJ 4XRSA 4ZDLA 3WU2C 2BY0A 2DO7A 3S14J 3F6OA 5KNLA 4F3QA 2W85A 1TWGJ 2LKSA 3LWFA 2FA5A 3I3LA 1OR7A 4IQJA 4L5IA 2DK5A 4HX8A 1KU2A 1J75A 3JSPA 2P5VA 2IXSA 3FM3A 1J59A 1LE8B 4GYIA 5K5OA 2GWRA 3L2QA 1K78A 1ERDA 3AJVB 1QU3A 1KZHA 4XSXF 2WAQA 2XUBA 3HOTA 3Q3SA 4PDKA 1EV7A 1Z1DA 2GA1A 4YIIA 3P9CA 4AM3A 5FD5A 1ZRFA 3DLLF 4KN4X 3SEZA 2M9HA 1AA7A 4M3DA 1SC7A 1WWXA 3WE2A 1X2MA 1DPRA 4JOMA 3HOSA 4UV9A 3FIWA 2KZGA 4IRIA 2M5WA 2OA4A 1P6RA 2L4MA 2VQHA 3E1SA 3HOXJ 1IN5A 3MZYA 4O3MA 9ANTA 2KKOA 5GPAA 3J80K 4AC0A 1APLC 4QBLA 3TW7A 1X1BA 1R1UA 1A79A 2XGCA 2CGPA 1B72B 2NRAC 3OYDA 1ZG5A 1K6YA 3FXOA 3IHUA 4KT6A 1MMNA 2MBFA 4C30A 3CC4I 5FGMA 4DBQA 4AIKA 3HHHA 2JN6A 4KISA 2FX0A 1JJ8C 2MC3A 4P96A 4C3HJ 3HHGA 1ENHA 3LSGA 2GBYA 4G8XA 5E1ZB 3LAPA 3GZ6A 5HLTA 4FISA 4NUBA 1I3QJ 3OL3A 3A0HC 2Z99A 3A4CA 2QF7A 3V8KA 2CO5A 1NTCA 4AWXB 1JKRC 5FLVA 3HTUA 5H20A 3L00A 3OY9A 1XMKA 3OR1C 3ZP5A 2EFPA 2EB7A 2VQCA 5H6QA 1DP7P 1ETQA 2XRNA 1SFUA 2VB6A 2FOKA 4G6VA 1ONVA 1YS7A 4JQFA 4CGZA 3ABLH 2ZJ2A 2DA3A 2EJRA 1RUOA 2VPRA 3BQZA 1WJ5A 3KP5A 4G6UA 1X1DA 4EJTA 1BC8C 1VQMI 3IUOA 5GP9A 5LFAA 2P6TA 3KP3A 4HV6A 1SMTA 3D5LA 3DKXA 5ICEA 5E1WA 2E2IJ 4IHVA 4I2OA 3M07A 1HW1A 5IOYA 4ON0A 2JA6J 3PM1A 4ESJA 3IF0X 3WU0A 3G3ZA 5J47A 3BCBA 1HF0A 3VYUB 2Z9OA 1SFKA 5EEHA 3HTSB 1ZH5A 2DA1A 2ETHA 1MNDA 2R5YA 2HVSA 3TQNA 2OSTA 4UVCA 3CC7I 3GTKJ 1S3JA 3CJNA 4HF0A 1PUFB 5CVIA 4Q4ZF 3ZQIA 4AUXA 2LD5A 2A61A 5FKLA 1Y0NA 3QOEA 1XS9A 1F43A 2A69F 2X4HA 3BR1A 5J3LA 3E5XA 3HRSA 4IOCF 1Z3YA 2A68F 4KIGA 2XF6A 1T2KA 2NOJB 2D45A 2J5PA 3P7NA 2O03A 4A0ZA 3VYSB 3GTLJ 3ERMA 4RLFA 4OINF 1NK3P 2LFBA 4HF2A 3CCMI 1HLVA 1IXCA 3TOAA 2XC7A 1RNLA 4E70A 4LMYA 5DD8A 4MFDA 1IXRC 3S93A 1R5HA 4QSHA 2HTJA 1ODDA 4XK4A 5HLGA 2X6OA 3FK7A 1PVEA 2XB5A 2R0QC 2OZ6A 1RIOH 5C4XJ 3CO6C 2DDAA 3OS1A 4KICA 3FMSA 3FXQA 1T39A 3E0JB 4ZQUA 2J5OA 2EFWA 3D5RC 4A2UA 3KYDB 3M9AA 2W24A 1JKQC 1U5TC 3GZNB 2XGXA 2VODA 2E34A 1U5TB 5IYDJ 5TISC 3RYRA 4N4OB 1Y8QB 2UWMA 1YG2A 1XGMA 1JTYA 1I6XA 5C3EJ 4FX4A 3BZ6A 2P81A 1J9IA 5BOXA 1FT9A 4BDYA 1VQ6I 3CF2A 1W4MA 3BC8A 2BOLA 1GXPA 2ZNYA 2V7FA 5ED4A 2FQ3A 2HR3A 1X4OA 3BR6A 4XLFA 3OIQA 3RPQA 5JVGF 1FBQA 2ZMEA 4RB0A 1O7LA 4MTDA 4IF4A 1ZLKA 3RPUD 2R4GA 1CGPA 4A3EJ 2V1DA 5HS9A 1RPWA 4NC6A 2H94A 5GAHJ 3Q9VA 1OQYA 4X6AJ 2DFEA 1BIBA 2MW8A 3OR2C 5IP7J 1R6RA 2KJBA 4M6XA 2WAFA 3DXJF 2JJ7A 2ZBKA 3GFJA 3O3KA 4Q5SF 3OSFA 3IAM2 4I09A 3I56I 2HOEA 2MA3A 1O57A 2IP2A 3LSTA 1NG6A 3SFZA 1V3FA 5E3NA 2DTZA 2R92J 2RAEA 3K4KA 3GXOA 3U9GA 2VJ5A 2TDXA 4XNFA 2VBYA 3U1KA 1U78A 3EYYA 4GRIA 1OCZH 4DGWB 4NDLA 2CMPA 4M3FA 4ZYGA 3CZ6A 2R5ZB 3S1RJ 3NEUA 2PI0A 2LVSA 4BHPA 1ZR4A 1GEFA 5A2QK 1T56A 4DOZA 2HPMA 4WF2A 2CW7A 2ISYA 4Y7NJ 4XLPF 2DMNA 4A3JJ 2VT3A 2KIFA 2P7CB 2K4JA 5F04A 2HDDA 5L3CA 4Y13A 3MKLA 2XSDC 3PIPF 2R7ZJ 3LA7A 4LK1F 2XF5A 3OYEA 3VB2A 2M4KA 3ZQLA 2YR2A 4II2A 2Y75A 2HQRA 4BQQA 4BQNA 4HYEA 2FOWA 1I27A 4UVBA 1RETA 2NS7A 4LOCA 3FKJA 5D6EA 3QU6A 2BGCA 4YIRX 4KJZA 4G7OF 1PP8F 1U9NA 3DU5A 4WXCA 5FLMJ 2IT0A 3KE2A 2B0LA 4EATA 2LY1A 1OYIA 2WCZA 5GAEJ 2IS4A 4IOAF 3TDZC 1Q1HA 2IA2A 4GXOA 1K4TA 2Y69H 5CPRB 4EJVA 2RREA 4BE0A 2GLOA 4IKFA 4FE7A 4G7ZF 2VI6A 3T5XA 2ZC2A 3E5QA 4NC7A 3BTIA 5F0FA 3RCOA 2VOPA 1IXSB 2VLDA 3AFHA 4EEFG 2Z3YA 3JSOA 1LE8A 4PGHA 4Y15A 4ENKA 1O3SA 3OYFA 1Z91A 4L9NA 1NK2P 3DTKA 1MW7A 3IH3A 4RAGA 4CZZA 2LSOA 3AJVA 3H35A 1R5GA 2L9SA 3WGGA 4MO7A 1ZREA 1FJLA 2HZTA 3S2WA 3ZQ7A 4XIDA 3IRQA 1R7JA 4RDUA 4UB6C 2X6WA 4M9SA 2RNGA 1EH8A 3K4NA 1IN7A 2INBA 4BBRJ 1BBYA 3B02A 2IJLA 5EEGA 1OFCX 1F1ZA 2Y9ZA 3H9QA 1P7JA 1KU3A 4GGGA 1ZGAA 2G7UA 1IUFA 1DU6A 3WE3A 4I7HA 2NVUB 1VQPI 2K9NA 5L3EA 5F0HA 3MMYB 3RZOJ 2M87A 4Z6YA 4IQ4A 3HDDA 1B72A 3BROA 3C2BA 5JVTA 2EWNA 1J0RA 2BH2A 3L2CA 2DK8A 3KCCA 1GLNA 3J81K 5DD4A 4CUGA 3ML6A 5BNGA 2UUZA 2EZHA 5JFRA 2KIQA 3ESWB 5CVUA 3LSKA 3TP3A 2UXNA 4XKBA 3J80Z 2EK5A 3S3OA 3K0LA 1I50J 1Y0UA 4ZYDA 3SJMA 3ABKH 1VQOI 1FTTA 4A6DA 4J19A 1VNDA 3NAUA 4KT5C 2G9WA 3RKQA 1G3SA 1EH7A 1ZLJA 2H6CA 4X1EA 2EH3A 2X6YA 5KCMA 3IWFA 5FDKA 5F08A 3TO7A 2JTVA 1WCMJ 5E17F 3ULQB 4HV5A 4BEHB 3N4MA 1EKEA 1F4KA 4YFKF 3REOA 1OYYA 4RM2A 3ERED 1IDYA 3H3VK 2X1EA 2MH2A 2QA4I 4LB5A 4HLXA 5LHIA 1IV6A 1JHHA 3DP7A 1A5JA 2DTRA 3LSPA 1LKXA 1BIAA 2ZXIA 2CV1A 4LLLA 3H9GA 4HSRA 3BWGA 4WX9A 4MLOA 2XB0X 1IRZA 2M8EA 4LFUA 2AXLA 2DT6A 2MH9A 2HKOA 4NQWB 3CCEI 4FASD 1G4DA 2BVMA 4MFEA 2FL3A 2GW6A 3W2WA 1XTAA 4G6QA 1QZEA 4A3GJ 3W6KB 1SFOJ 4CDGA 1LDDA 1Z9CA 1YX3A 4C3JJ 1MKMA 5K7HA 5L3BA 3JCUC 3P1ZB 3AKZA 5IP6A 4EM0B 1W7PB 1PUFA 1IN4A 3WODF 5HNHA 2LY9A 1CQTA 1IAWA 2EZLA 3KETA 3BR3A 2DW4A 3CD6I 1CF7B 1D1AA 2CQKA 5B5EC 1ZK8A 2CG4A 3JTHA 4NBQA 1XSDA 2XPUA 4P9FA 2DMPA 1HOMA 3GLLA 4RB2C 2WAEA 3KEOA 4ZZDA 1Q1VA 1AU7A 2HOTA 2HZDA 5D5VB 3CLQA 3JTGA 1OPCA 2MABA 3E97A 3ELKA 1L3LA 2ESHA 4MGRA 4P9UA 3HOUJ 3DQVC 1HW5A 1TP4A 2JK3A 3KEYA 3TW6A 4L0YB 3BQYA 2BY2A 2W1OA 3GTQJ 2PEXA 4UXNA 5E79C 3ZMUA 1MH3A 3DLAA 1BOAA 1U5TA 4G6TB 4KN7X 4C2UA 1JI8A 4B48A 1ITYA 4CXFA 2JPCA 3DPUA 3BP8A 2EPFA 1XCVA 2HVQA 3LSRA 1FPQA 1RZ4A 3L09A 3ZGKA 1R9TJ 4U0YA 2NS0A 3BTJA 2QSHX 1P7IA 1U0JA 4D7MA 1V5FA 2MSYA 2QQ9A 3F8MA 5GAGJ 3BR5A 3QYBA 2CFXA 3WG7H 5E8IA 1IF1A 2KL4A 2EA4A 1YW9A 4E6KG 1OLTA 2DOAA 1TT5B 3BPVA 4QBNA 1XD7A 2E7XA 2Y0SN 2CH0A 2JRTA 3SDGA 1D3YA 2BY3A 2KFDA 3LFUA 2JPBA 3P9KA 5J1RA 1VZ0A 2QSGX 1DGWY 1JGSA 4H4KC 2OCEA 2QYOA 4L0ZB 2ID3A 1LFPA 2F5VA 2D2WA 1I3AA 3D1NI 1W5CC 3K1PA 4LB6B 2EZKA 1TTYA 2Y0MA 4CZCA 5HDNA 1HDPA 4LQEA 2IGNA 2IGMA 2OU2A 3VSLA 1TZLA 1MMGA 4BXUA 2V6CA 1LNWA 4RGXA 2FMLA 1XMXA 2W57A 5F64A 3BJOA 3LSHA 2LKPA 2VQLA 4EM2A 4G6DA 1JKPC 2DYSH 2P5KA 4BBSJ 4AIJA 2CFOA 3C3WA 2ZB9A 5B1AH 2DA7A 2K7LA 4G7HF 1QVTA 1FOWA 2HYFA 1LVKA 4YIFA 4XORA 3L2RA 3EETA 4N4NB 2X1CA 3V7RA 4DYQA 1RESA 2R5ZA 3PO2J 1FY7A 2E5NA 4JK1X 2FBHA 4A69C 1LDKB 4ZC3A 1HC8A 3PNYA 1MSEC 2L02A 1HSTA 3DPLC 3NWTA 4WXHA 1UELB 2A6EF 2IGOA 2EFNA 1K4SA 1KQ9A 2MFZA 5ILSA 4M3EA 5J1UA 5HVQC 3BY6A 4BY7J 1FP2A 4E7ZA 3GO5A 1WJAA 1Z0XA 4HG2A 3SEQA 5ILVA 1IJWC 4BJ6C 2O8KA 3CUQC 2LH9A 2V9VA 3CUQB 1STZA 3B6AA 2O7OA 1XGSA 1HKTA 1XB4A 1T6SA 2WC2A 1ETKA 2KHMA 2W48A 3EQLF 3MAJA 4XLHA 1PJRA 5A2QZ 1OCPA 2JJQA 2XKOA 2KMUA 4UUTA 5EEAA 3T0YA 3S16J 2VPLA 1QPIA 4E7JA 3CMAI 1TQIA 2BE5F 1Y1OA 2K86A 5LD2C 3PO3J 4IRGA 2CQNA 4OAZA 4XICA 1FYMA 4LJZF 1HH1A 4S0HB 3VYRB 1SD6A 2BYVE 3LOCA 2OZUA 1TW3A 3GF2A 4ZJZA 2EBIA 2K9LA 2OQGA 2L7ZA 4XL9A 2LF7A 2E1CA 3PQKA 4HAMA 2B63J 3BTLA 2PLYA 1XCBA 1BA5A 3DEWA 1W5TA 2VKVA 2WY8Q 2ZJRF 3AL0C 2KDZA 3AL0B 2AQEA 4BDZA 3S1NJ 3WTUC 2FF4A 4A12A 4BNCA 5HNFA 3O6BB 4EM1A 1NH3A 1A6IA 3ZR8X 2FJ1A 1Y8RB 4ZDPA 4E7IA 1YHQI 4ZZLA 3DTEA 3HRUA 2NOGA 4CCLA 4F7ZA 1X58A 3IH2A 2TRTA 3TO9A 3H5AA 2VLAA 2ADUA 2F2EA 5EYRA 3KP4A 2DFFA 1VQ4I 3K4MA 2NVYJ 2XGDA 4TKKA 1DUXC 1YFHA 3F3XA 3MWMA 2STWA 3OS2A 3HPHA 4QIWN 1KGSA 1Z7UA 5CVVA 2ZFUA 1D0XA 2K5CA 4MQ9F 4N9IA 3IEYB 3IV5A 3HYIA 1Z21A 4F55A 1MIJA 2CJJA 1S7EA 2DMUA 3L9FA 2VJIA 4P1WA 1W36D 5CQEA 4V19K 2QSFX 2NAZA 2RVCA 1YI2I 4BL0B 1X4PA 3NQOA 2NVQJ 5ILUA 3MZHA 1ETVA 3FK6A 3VWBA 2HWVA 2DPUA 2PBIA 3QAHA 5TJJA 3WHCA 3FISA 2LY2A 3SZPA 4XKVA 2EIMH 3R0JA 2QENA 4DA2A 1WKMA 2ZXWH 1AWCA 2OKFA 1QZYA 1REPC 2BW3B 1ZRCA 5IY5H 3J81Z 1W36C 4BE2A 5EJCA 3OYKA 1UG2A 1N25A 2EINH 4RGRA 3KZIC 3H9JA 2L54A 2V1XA 5FKNA 4BEHA 2O6GE 4S05A 1HQCA 3ZMDA 1E3PA 2E7WA 1GV2A 5D4RA 1RLVA 4M72A 1GUUA 2GJWA 4M71A 2HXIA 4B47A 2EV6A 2W25A 4G9YA 2COBA 4CH7A 5E3OA 3HG9A 4BE1A 5H6RA 5FJ8J 2HDCA 1UAAA 4DZJA 3HRMA 4CO8A 5E18F 1EF4A 2HI3A 3SHFA 1WSUA 4QPOA 3RKYA 1B4AA 4AYBA 5FRNA 2LF8A 3FBIB 2DODA 3I4MJ 1FLIA 3I54A 4HDVA 1VF9A 3IWZA 3R4KA 4EV0A 5DDGA 1USTA 2OUMA 2XVCA 1MBHA 3BZCA 4FTHA 1AOYA 4NQWA 3M4OJ 4B43A 1T33A 3VODA 2ZJPF 2P7VB 2FRHA 1V55H 3HKZN 2DBBA 3M3YJ 2E2JJ 2CSOA 2DT5A 1SVMA 5FLXK 3M7GA 3Q9SA 1GHCA 3JRAA 3MCZA 3HUGB 4CCKA 4A0XA 1W7PA 3V8LA 3HL2A 1KU9A 2KRCA 4M6VA 1UHMA 4ZH4F 5GTHC 1YQAA 5C4JJ 3OYGA 5M5XJ 4AYBN 4DYRA 4XLCA 1CF7A 2GXBA 2R7SA 3BJAA 3JRFA 3H92A 5HOOA 2WCWA 2CUFA 3K10A 4ABZA 5HDKA 4D0PA 4L18B 2L7KA 2HU9A 2DQRA 3HOVJ 1H9TA 2IPQX 2JA7J 4AVZA 3U1DA 3G73A 3M1EA 1YE9A 4IHXA 1W0TA 4PJMA 3ABMH 2R7WA 1VQ5I 2VS1A 3A1YA 4HDUA 5KHDA 1WJFA 2DI3A 3WGIA 1SAUA 2QKLB 1VQ8I 2VQGA 4XN0A 1U3EM 2XAGA 3JREA 2DA4A 1MBKA 2MLGA 1XX5A 3A2KA 3GZ5A 2JUGA 3GTGJ 1OJLA 3VEPA 5DCMB 2GQQA 2EFQA 2EQRA 2H09A 4N9HA 1SD7A 3CMYA 1HKSA 2FNPA 4EV1A 3ROUA 4RGUA 5BQTA 2A05A 4UVAA 1A36A 4ENMA 3IRRA 3ZCOA 2DA2A 4XM3A 5EGOA 2OQRA 2ME0A 5M3MJ 1EA3A 3RTRA 1KYZA 2QBYB 1JUPA 1XGOA 1BR4A 5LBQA 4U87A 4B44A 3RI4A 2L0KA 3DPTA 4DAVA 4BGDA 2WJ0A 2XF7A 4XOPA 1GDTA 1LEAA 4BXXJ 2BXZA 3S17J 2L7MP 3CCVI 4LITA 3J7YJ 1R71A 3LSJA 1R4MB 2LC2A 4PJJA 5AONA 3M8FA 3RZDJ 4IEJA 4NC8A 1XGNA 2IBDA 3LNQA 2FQ4A 5CQGA 4ZYAA 5D8KB 3PL8A 1B8IB 2HOSA 4ESBA 5HLIA 2HQNA 1O7FA 1WVRA 3ECOA 3ZPLA 1XN7A 1ORKA 2V26A 4IRHA 2M2EA 2QQ8A 3KIOA 2PMZN 3K1MA 5LRRA 2CRGA 2HTSA 4PZJA 3F21A 4TV7A 1WI9A 2GIZA 3GVAA 4Y17A 3BDDA 2Y2ZA 5ICCA 3OL4A 4KITB 4I76A 4QTRA 2M0MA 2CV8A 3IP4B 1KA8A 1K61A 3N05A 5IOZA 1PUEE 1G59A 1ETOA 4I0AA 2KDOA 2H8WA 5F1RA 5IT3A 2E1NA 2MLKA 1K83J 3FXKA 3MD2A 3FXRA 3KYCB 2CW0F 2LBFB 2Y48A 3CP2A 1IZ1A 5CVJA 1YO5C 1E3OC 2YSRA 4L5JA 3BJ6A 4BKXA 2AO9A 4TKDA 4CSWA 2YX4A 3NRVA 2IS2A 4BU2A 3TEDA 2YPRA 1G6NA 2W82A 3KPHA 2JA5J 3DBLB 1WH7A 3L1PA 2ZYZB 1IO2A 2DA5A 1YITI 3CUQA 4RBOA 1LFUP 1H9GA 1OYWA 2OC6A 1U8RA 2XKPA 4IXAA 3TDUC 3LQRA 5GPCA 1MDMA 1R0VA 1YW8A 1JHFA 1TQMA 4WK8F 3DTIA 2CQXA 3KLOA 4KIFA 2JVGA 1S5LC 3ZN1A 3MZ8A 3ZMSA 2V1UA 3HEFA 1WHUA 1V5EA 3H3UA 6PAXA 2CWEA 4I01A 2XRLA 4EJUA 4RM3A 1IUYA 3EDPA 1QHHD 1IDZA 2BXYA 3GCMA 3M8EA 2LR8A 4M9ZA 2EILH 5L3GA 2XPVA 4Z2YA 3LQQA 3QPTA 3CCSI 5GADJ 3OSGA 3GBGA 1AKHB 5CLSA 2I8DA 2OV7A 1JT0A 1D8KA 1TC3C 3TGNA 3UNGC 1UFMA 3FHNA 1U2WA 3H36A 3K6GA 3GX4X 3UKGA 2IGKA 4CCOA 1W5SA 5IPAA 4M6YA 2NVTJ 2WWYA 2Q1ZB 5DS9A 1F5TA 4RGSA 1XSVA 4EJOA 2AXTC 5IP9J 2DLLA 1D0ZA 1YS6A 3S3MA 2L9NA 4ANJA 2I10A 2YUSA 3GMEA 5LGNA 2ID6A 4L9VA 2VOOA 3K70D 1N78A 5D5WB 1J2XA 3E5UA 4NB5A 2KISA 4M73A 5JI6A 4A3IJ 1X3WB 1U9OA 1MH4A 3DV8A 3RKWA 4KIBA 4PJLA 1DP3A 3K7AJ 3OYIA 1WJBA 2L9RA 3F22A 2HGCA 2WY7Q 2CV2A 4IPAA 2G0EA 2HXOA 5ICGA 4LLNA 2RGVA 4BAYA 1N77A 2X51A 5FKMA 1FSHA 1S9HA 3W2AA 3SFIA 1WZ2A 4A3LJ 1YRNB 3EPZA 4PSXA 1B1BA 1FEXA 2GOMA 3IEYA 1ZAOA 3K70C 3QP5A 1YOVB 4GFBA 2HPIA 2XAJA 2DJNA 1LDJA 1LUJB 2Z5UA 2HQAA 2K85A 3OYNA 4PSWA 2M0CA 3COAC 2OD5A 2E1MC 2Q2EB 1XPXA 2E1MB 2QKMB 3NWSA 3KX2A 1HXDA 2ZSIB 2KJCA 2IA1A 5LRSA 3G1OA 2EZIA 3CJTB 2R7TA 2UV1A 2RKHA 1BJZA 2QLZA 4QBOA 4JX5A 2VBZA 1WI3A 1FYKA 3IKVA 1Y1VJ 1P9QC 2HYJA 3F8BA 4A5NA 2QEXI 1IC8A 1HDDC 2AHQA 3GYHX 4L9JA 4V2FA 1QQIA 2P0WA 4XLEA 3JRGA 1Z77A 5F6FA 2BW3A 4UUSB 1BC7C 3BG7A 1S8NA 3OYHA 4J01A 1XSXA 2QVOA 4MTEA 1BI0A 2UXXA 3RIRA 1MMSA 5E20A 3JRBA 4UUVA 1P2FA 4OU0A 4C9YA 2O0YA 1Y1WJ 5CYVA 3GFIA 3LSIA 4OIQF 2HS5A 3BG9A 1RUNA 3X2QH 1W7PD 1Z3XA 4FHTA 2PMHA 4Q47A 2DAOA 3E6MA 1MSFC 3SDBA 4PFOA 4LK0F 2NVXJ 5TRDA 4BHBA 4IZZA 4A3DJ 5DTDA 2QUFA 3G1LA 1K6OA 1JXSA 1T98A 3FXUA 1Z6RA 4B8XA 1OCOH 4HRIA 1POGA 2QGUA 2ZO4A 1T95A 3IKTA 2GA2A 4LG3A 4R1HA 4L9TA 3FXLA 1A04A 2X6XA 1UB9A 1WJCA 1YJWI 3ZMZA 1BI1A 4IJAA 2VT2A 1R1VA 3WTWC 5D5UB 3U21A 1VFCA 1YNMA 1I5ZA 1XMAA 3S2DJ 5FFXA 3LFKA 4RAFA 2ZNZA 1BW6A 1UCRA 3ZMTA 3HUGA 1BL0A 4EQQA 4XKWA 3BPXA 5K7ZA 1VQKI 3LMMA 5E3MA 2EIJH 5FO5A 2V9KA 4RLQA 1FYLA 3L2WA 5B66C 5LLQA 3E7LA 1JJ6C 3HRTA 2XDVA 4CICA 1FMVA 1TWFJ 5FLXZ 5LEJA 1UG0A 3MKYB 3HSEA 1QZZA 4CYDA 1LJ9A 2E35A 1OCCH 1FOXA 1ZGJA 3AG4H 3OWTA 2YX7A 1WJDA 4OWRB 2L9VA 3F0CA 3DKWA 5EG0B 2VKEA 3OYAA 2RDPA 2Y0SA 4PJ0C 4ZTJA 4E7LA 2A6HF 5AIPA 1SANA 4PK4A 4G12A 3ZOBA 1FC3A 2W84A 4GYGA 4EGYA 4R8HA 2NNYA 1P4AA 1KQ8A 3CF5F 1S72I 1RC9A 4A5MA 1B6AA 2K3PA 4XRFA 1IRGA 1DQUA 2LDUA 3DFGA 2P5LC 3ZQCA 2Z1DA 4JX6A 3PFIA 4AVPA 1GT0C 5JHFA 4IVNA 3DNXA 1MD0A 4HA8A 3IL2A 4PGGA 2L4AA 2DFHA 3EUAA 3GFMA 4FT8A 2FEZA 3PNVA 2FU4A 3QPSA 2QBYA 2H6BA 2W8MA 2NXNB 1G3WA 2E1OA 3GLXA 3O2PE 1ZQ3P 3H5RA 3GW2A 3D5SC 1UZCA 3KP2A 3CC2I 2WIZA 5FKOA 2F5FA 3HPGA 1TWHJ 1T8IA 1R11A 2VASA 2GAUA 2HQ5A 2BHYA 1X3UA 1BW5A 1Z67A 2JA2A 2A5YB 1VTNC 4NHJA 3SXYA 2KRFA 4LLGF 2LNBA 4F52A 4A3CJ 1WH5A 1B8IA 2DCEA 2HKXA 2H27A 1MNEA 3F23A 2VUMJ 2Q8KA 5ERIA 2D5VA 3EYIA 1FIAA 2UZKA 3FX3A 2FSWA 3VYTB 2OCCH 4W1UA 3RJPA 3F8NA 1Z7LA 2PX9A 2PJRB 1D1CA 1O3RA 1DGRM 3RQ4A 3KEQA 2F4IA 3WTYC 4WWCA 2WB1A 2DOFA 3LA3A 4XLNF 2R7DA 4QLCU 4Y52J 1D0YA 4RMNA 5IT9K 1S7OA 3K2AA 4I02A 5KAIC 3DWLE 1B9NA 1XC5A 1NG7A 1EH6A 4H0EA 4HW0A 1HSJA 3G4SI 5BMZA 2R7OA 2LBFA 1DDNA 2P4WA 3BG5A 1FOKA 3RDIA 2GZWA 4NNJA 1ETYA 3I0TA 2JVHA 5J40A 1PDNC 1TNSA 2DU9A 3J7ZI 3JRHA 2L01A 1MGTA 3I55I 1PP7U 1U6GA 2CUZA 2ZYZA 4BS9A 2DDBA 1SD5A 4JBAA 2WB1N 1R36A 1R49A 1K79A 2CQQA 2XPWA 5DCFA 2VONA 2M7AA 4F91B 2E19A 3KYLA 1ON2A 2E60A 2L7FP 2E71A 1ZR2A 1M1EB 3CTAA 3MEXA 3QYEA 2PG4A 1MNMC 1KONA 2EV5A 3PJRA 1JE8A 4DBRA 5E1XA 4BJTA 2ZKZA 1GV5A 3OYLA 1AKHA 4KNYA 2DOEA 3R60A 5EDNA 3SQNA 1D8JA 3QPLA 4HX4A 2H8RA 3V7CA 2V6EA 1FIPA 1HBXG 1I1GA 3PSFA 1EJ9A 2KIUA 3ZXSA 4B3AA 2VBXA 2X48A 5CJ9A 4ZYHA 1YJ9I 3PUFA 5HS7A 3T8TA 1FNNA 2LG4A 2QQAA 3CESA 4HSTA 3QWLA 5DYMA 1QNTA 3WTVC 1D1BA 3CCUI 3WGHA 2VN2A 3S2HJ 4XSZF 4V2GA 4AU7A 1OISA 1MJAA 1SFEA 4M3BA 1K7AA 3QODA 4P5OA 5J4YA 2DN0A 2VE9A 1YIOA 4HLYA 5IYCJ 3JAMK 3CCLI 4YFNF 3WTTC 2KQRA 3JRDA 2L3DA 2KZVA 4U0WA 4U88A 1NHAA 3ZQHA 2P8TA 2FMYA 2IAIA 5FD6A 2JQ7A 1LEBA 1AHDP 2F5CA 5K5RA 2QZ8A 1YRNA 1R58A 1Z05A 2LMDA 2ELHA 1BR1A 2DXIA 1R00A 5LEKA 4OMZA 2DPDA 1JGGA 3W3CA 3PSIA 2F6CA 1KU7A 1TQPA 2R7FA 3M1CA 3TO6A 3FOVA 1ZYRF 2VBWA 2WAQN 1IRXA 5DM7F 2Z0RA 2Q2EA 2FKCA 1H8AC 3JRIA 2F4OB 4XRMA 2K4BA 4OMYA 1V5GA 4DYCA 1BJAA 5FB2A 4HEA2 2QWWA 3EUHC 3VOEA 5L3FA 3PIOF 2YS9A 5HLHA 5HODA 4I6ZA 1D5VA 1YTYA 4CA0A 1X3ZB 4M9XA 3FXMA 3ASNH 3RSNA 1RI7A 3TP0A 5DV5A 2X85A 4KFCA 2VKDA 4IHWA 3HJEA 4HOBA 4MQVA 3H0GJ 4UUSA 4CCNA 2LLKA 3HKZA 1SAXA 4HPQA 3K4CA 4O6JA 4XRSG 4EGZA 5BPDA 3FM5A 3GTPJ 3OYMA 4II3A 3JRCA 1L0OC 3K9TA 2MG4A 3RYPA 2FLCA 2AQFA 2RNJA 1T0FC 3BLYA 2DQLA 3FMRA 4MEYF 3ABTA 3PFYA 3QQAA 2IS1A 5EZHA 2P6SA 2BV6A 3JW4A 4KMFA 1SEUA 2WADA 3TBIA 2EV0A 3OYCA 5FRMA 2Z33A 5M3FJ 4E7SA 2FKHB 3FMQA 1VI0A 3SYTA 4A3MJ 1QPMA 4BJ5C 1MBFA 1ZELA 2HEOA 4OIPF 4MEXF 2NNNA 4B1RA 2F4MB 3HOYJ 2VIXA 3IC7A 5DUKA 3P1ZA 3F9KA 2RQPA 2EA2A 5FROA 1S29A 4D1QA 1Y56A 4J00A 1MMAA 1TLHB 1Z6TA 2G7HA 3ABUA 4KUMA 3J7AO 2CZRA 4UNOA 3C2GA 3KFWX 3S32A 1I39A 3HGYA 2NYXA 2H1KA 2K3FA 1RKTA 4PJNA 3TOBA 3HB9A 3I58A 5ICFA 2F48A 1O3TA 1WGXA 3E6DA 2Z2SB 2ZCWA 4FETA 4Q48A 3DEEA 5CVRA 2DJIA 1R4NB 2R7UA 2TCTA 4WXDA 3HIFA 3I59B 5JLXA 4HNUA 2BY1A 2WA0A 5EF6A 3PQJA 4ASNA 1BM9A 5FFZA 3K2ZA 4DW6A 4A3BJ 2A5WA 2O8XA 3IAS2 4KYWA 2MC4A 4P55A 4A3FJ 2D1VA 2OJED 3W6JB 3LAJA 5J4VA 4DZPA 5GTIC 1FWZA 3C2HA 1I6HJ 3VFZA 2EFOA 4HNVA 3G71I 1FZPB 2WV1A 5EG0A 5TGTA 5K7FA 2HOAA 4M74A 4FCYA 4U7BA 4ENJA 1J09A 3VDXA 1KYWA 4GDFA 4A93J 5HS8A 1RZNA 3SZGA 4Y33A 2RV8A 1H0MA 2R7QA 3WG9A 2CUJA 3FDYA 2DYRH 5J1YA 1HKQA 1B9MA 4LG0B 1WJEA 3CDHA 2RN7A 4BH9A 3QP6A 3K4LA 3Q0VA 3FKIJ 2RQQA 2XASA 4LD5A 2XAUA 2Y30A 2HDWA 2MYSA 2OF7A 3QYFA 3R6SA 3V42A 1QRYA 1VQ7I 1IPIA 1TT0A 3UR3C 1G8XA 2PMZA 2V9PA 2W00A 1DPUA 2IA0A 4HBLA 1R23A 5J8CA 2CS3A 2R93J 4ENNA 3S15J 2R7XA 1ETXA 3CDIA 3CO7C 1T38A 4XN3A 2GIVA 5JHUA 3R61A 3C18A 2A07F 1A6QA 4XR6A 5KAFC 1JT6A 4HZFA 2Z16A 1SVOA 5DUIA 3JR9A 5LHHA 4BQAA 3ZQGA 2KP6A 2HNHA 3KLNA 2JMWA 5BPIA 3HXLA 3QOPA 1ETWA 1P92A 1QO0D 5E3LA 4DIQA 4RB3C 3BG3A 4E7HA 2L2OA
chains in the Genus database with same CATH topology
3F6VA 5D4SA 1O3QA 4KMUX 2BEOA 2ZFWA 3I53A 5L3DA 3SZTA 2IRFG 1SMYF 1OKRA 1TW2A 4GCVA 4DNCA 4UHTA 4LGWA 4IHSA 1GXQA 4PCQA 2R3SA 4KDPA 1TBXA 2RC4A 1LVAA 3TKYA 4EVIA 3QU3A 1R22A 4HQEA 1OB9A 2XHKA 2K27A 5IT9Z 4WCGA 5KK1A 1FX7A 4DAPA 2PMUA 1MZBA 2XROA 3KP7A 2QM3A 2XAFA 4O5VA 1ZN2A 2HFHA 5D5XB 2XAQA 3KZZA 5D6FA 2Q0OA 3AAFA 1V4RA 4OIOF 1B59A 4CHUA 2FBIA 2ESNA 4IHTA 1K78B 3F8CA 1YW7A 5DEQA 5KVRA 3MFKA 5D8LB 2ACJA 1Y88A 1YLFA 1ZG3A 2FXAA 4G94A 5K5QA 3I64A 3FWEA 4ESFA 2X0LA 1XDSA 4GO1A 4K2EA 2M1BA 2ZXJA 1ZRDA 1HW2A 1G3TA 1IW7F 4MHGA 4UV8A 4OIRF 3R0AA 3I4PA 3JAMZ 2BBYA 1WRJA 2PFBA 3T8RA 3WTZA 2VXZA 4MNUA 2PN6A 3EUHA 4A0YA 2FCOA 1FBSA 1IN8A 1ZARA 1LB2A 4ETSA 1MJ9A 3FF5A 3CUOA 3KP6A 2V79A 4RB1A 3E6BA 2JSCA 3DF8A 3ZN0A 2M45A 2EO0A 4RAZA 4XBFA 5BS6A 2CYYA 1S6LA 2K02A 1T0FA 2KIMA 3HSFA 3C7JA 3N97A 2QQBA 1YYVA 4B09A 4RAYA 2OAZA 4I98B 4ZYEA 2DFIA 1E17A 2JT1A 1FP1D 3L7WA 4AIHA 3ZMVA 3GFLA 3GEZA 3GWZA 4U7DA 1WQ2A 4N0BA 1SFXA 2MD5A 2M30A 1E2XA 3FZVA 3GUDA 4BHCA 1MJBA 1FBUA 1BN5A 2ISZA 3P9IA 3RKXA 2XIGA 5LGUA 3I59A 2O3FA 2VC0A 1P4WA 3LA2A 3V8JA 3D0SA 1UHWA 5LHGA 3WU1B 1J7KA 1UWVA 4EMSA 1P4XA 4I0BA 5DCMA 2OBPA 5E8GA 1I1SA 1SD4A 1ON1A 1ZHFA 1LQ1A 4LG0A 4U0VA 4E6ZA 1QBJA 2C6YA 3OOPA 4KA4A 3KZYA 2WIWA 3F8FA 1OB8A 5JR3A 1S7AA 3H3ZA 1FSEA 2GXGA 2FBKA 5HDGA 5J6XA 3MQ0A 3WTXC 2ZMEB 1XDUA 3K1NA 2XAHA 3BT7A 3Q5FA 1ZG1A 5LGTA 4S04A 3ECHA 2WV0A 3V4GA 3I71A 3OV8A 2AS5F 3V7SA 3CLOA 3K69A 2PJPA 1IN6A 2HYGD 4RS8A 5K1YA 3E3VA 2XV4S 3B73A 2F5DA 2VE8A 4HQMA 4HF1A 2DBSA 3C1DA 2IVMA 2A3SA 4AD9A 3QPHA 4YFXF 3HSRA 4A6EA 1ULYA 1G3YA 1KQ0A 3ISPA 4R79A 3WTSC 1TNTA 3RPUA 1BI3A 1USSA 3FHZA 3DEUA 2F5EA 5J8FA 1IRFA 2IW5A 2PQ8A 3T1BA 2YU3A 4DQ2A 4YG2F 3I5UA 2STTA 4EJWA 2JZYA 3P1YA 1GVJA 3U2RA 2WTEA 5AIQA 2FNAA 1R1TA 1J5YA 1QGPA 4BYYA 4QWQA 2COMA 3BOQA 3F72A 1MDMB 2O61A 3E6CC 4OOIA 2FE3A 1ZP7A 1OMIA 2D1HA 1C0WA 1F9NA 2VC1A 3QRFF 1BI2A 4HX7A 4FX0A 2DO7A 3F6OA 2W85A 3LWFA 2FA5A 1OR7A 4L5IA 2DK5A 4HX8A 1KU2A 1J75A 3JSPA 2P5VA 2IXSA 3FM3A 1J59A 4GYIA 5K5OA 2GWRA 1K78A 3AJVB 4XSXF 2XUBA 3HOTA 4PDKA 1EV7A 1Z1DA 2GA1A 4YIIA 3P9CA 5FD5A 1ZRFA 4KN4X 1WWXA 3WE2A 1DPRA 3HOSA 4UV9A 4IRIA 2M5WA 2OA4A 1P6RA 2L4MA 1IN5A 3MZYA 4O3MA 2KKOA 3J80K 4QBLA 1R1UA 1A79A 2CGPA 2NRAC 1ZG5A 3IHUA 2MBFA 5FGMA 4AIKA 3HHHA 2MC3A 4P96A 3HHGA 5E1ZB 4G8XA 3LAPA 3GZ6A 2Z99A 3V8KA 2CO5A 4AWXB 3HTUA 5H20A 3L00A 1XMKA 3ZP5A 2EFPA 2EB7A 5H6QA 1DP7P 2XRNA 1SFUA 2FOKA 4G6VA 1ONVA 1YS7A 4JQFA 4CGZA 2ZJ2A 2EJRA 1RUOA 3KP5A 4G6UA 4EJTA 1BC8C 2P6TA 3KP3A 4HV6A 1SMTA 3D5LA 5ICEA 5E1WA 4I2OA 1HW1A 4ON0A 4ESJA 3IF0X 3WU0A 3G3ZA 2Z9OA 5EEHA 3HTSB 1ZH5A 2ETHA 3TQNA 2OSTA 4UVCA 1S3JA 3CJNA 4HF0A 5CVIA 4Q4ZF 2A61A 2A69F 2X4HA 3E5XA 3HRSA 2A68F 4KIGA 1T2KA 2D45A 2J5PA 3P7NA 2O03A 4A0ZA 4OINF 4HF2A 1IXCA 3TOAA 1RNLA 4E70A 4LMYA 5DD8A 1IXRC 1R5HA 2HTJA 1ODDA 5HLGA 2OZ6A 1RIOH 3CO6C 4KICA 3FMSA 3FXQA 1T39A 4ZQUA 2J5OA 2EFWA 4A2UA 3M9AA 2W24A 1U5TC 2XGXA 2VODA 1U5TB 3RYRA 2UWMA 1YG2A 1XGMA 1I6XA 4FX4A 3BZ6A 1J9IA 5BOXA 1FT9A 1W4MA 1GXPA 2ZNYA 5ED4A 2FQ3A 2HR3A 3RPQA 1FBQA 2ZMEA 4RB0A 1O7LA 4MTDA 4IF4A 1ZLKA 1CGPA 2V1DA 5HS9A 2H94A 3Q9VA 1BIBA 2KJBA 4M6XA 3DXJF 3GFJA 2ZBKA 3O3KA 4Q5SF 4I09A 2HOEA 2MA3A 1O57A 2IP2A 3LSTA 3SFZA 1V3FA 3GXOA 3U9GA 2TDXA 2VBYA 1U78A 3EYYA 4ZYGA 3NEUA 2PI0A 4BHPA 1GEFA 5A2QK 4WF2A 2ISYA 4XLPF 2VT3A 2KIFA 2P7CB 2K4JA 5L3CA 4Y13A 3LA7A 4LK1F 3VB2A 2YR2A 2Y75A 2HQRA 4HYEA 1I27A 4UVBA 5D6EA 3QU6A 2BGCA 4G7OF 1PP8F 4WXCA 2IT0A 3KE2A 2B0LA 1OYIA 2WCZA 3TDZC 1Q1HA 2IA2A 4GXOA 4EJVA 4G7ZF 3T5XA 3E5QA 2VLDA 2VOPA 1IXSB 2Z3YA 3JSOA 4PGHA 4Y15A 4ENKA 1O3SA 1Z91A 4L9NA 4CZZA 2LSOA 3AJVA 1R5GA 3WGGA 1ZREA 2HZTA 3S2WA 3ZQ7A 3IRQA 1R7JA 4M9SA 1EH8A 1IN7A 2INBA 1BBYA 3B02A 2IJLA 5EEGA 1F1ZA 1KU3A 4GGGA 1ZGAA 2G7UA 3WE3A 4I7HA 5L3EA 2M87A 3BROA 5JVTA 2EWNA 1J0RA 2BH2A 3L2CA 2DK8A 3KCCA 3J81K 5DD4A 3ML6A 5JFRA 5CVUA 2UXNA 3J80Z 2EK5A 3K0LA 1Y0UA 4ZYDA 4A6DA 4KT5C 2G9WA 1G3SA 1EH7A 1ZLJA 2H6CA 3IWFA 5FDKA 3TO7A 2JTVA 5E17F 3ULQB 4HV5A 3N4MA 1F4KA 4YFKF 3REOA 1OYYA 3ERED 2MH2A 4LB5A 4HLXA 5LHIA 1JHHA 3DP7A 2DTRA 1BIAA 4LLLA 3BWGA 4WX9A 2M8EA 4LFUA 2AXLA 2MH9A 2HKOA 1G4DA 2FL3A 2GW6A 4G6QA 3W6KB 4CDGA 1LDDA 1Z9CA 1MKMA 5L3BA 3P1ZB 4EM0B 1W7PB 1IN4A 3WODF 1IAWA 3KETA 2DW4A 1CF7B 2CQKA 2CG4A 3JTHA 1XSDA 4P9FA 4RB2C 3KEOA 4ZZDA 5D5VB 3JTGA 1OPCA 3E97A 3ELKA 1L3LA 2ESHA 4MGRA 4P9UA 3DQVC 1HW5A 4L0YB 2PEXA 4UXNA 3ZMUA 1BOAA 1U5TA 4KN7X 4CXFA 2JPCA 3BP8A 1XCVA 1FPQA 1RZ4A 3L09A 4U0YA 2NS0A 2QQ9A 3F8MA 1IF1A 2CFXA 5E8IA 2EA4A 1YW9A 3BPVA 4QBNA 1XD7A 2E7XA 2JRTA 1D3YA 2JPBA 3P9KA 1JGSA 2QYOA 4L0ZB 2D2WA 3K1PA 4LB6B 1TTYA 2Y0MA 5HDNA 4LQEA 2OU2A 4BXUA 2V6CA 1LNWA 4RGXA 2FMLA 2W57A 1XMXA 5F64A 3BJOA 2LKPA 4EM2A 4G6DA 2P5KA 4AIJA 3C3WA 2K7LA 4G7HF 4YIFA 2HYFA 3EETA 3V7RA 1FY7A 4JK1X 2FBHA 1LDKB 2L02A 1HSTA 3DPLC 4WXHA 2A6EF 2EFNA 1KQ9A 5ILSA 5HVQC 3BY6A 1FP2A 5ILVA 3GO5A 3CUQC 2V9VA 3CUQB 1STZA 1XGSA 1HKTA 1XB4A 1T6SA 2WC2A 3EQLF 3MAJA 5A2QZ 2JJQA 2XKOA 3T0YA 1TQIA 2BE5F 1Y1OA 2K86A 4IRGA 1FYMA 4LJZF 1HH1A 1SD6A 2BYVE 2OZUA 1TW3A 3GF2A 2OQGA 2E1CA 2LF7A 3PQKA 4HAMA 2PLYA 1XCBA 1W5TA 3WTUC 2FF4A 4A12A 4BNCA 3O6BB 4EM1A 4ZZLA 3HRUA 4F7ZA 3TO9A 2ADUA 2F2EA 3KP4A 4TKKA 1DUXC 1YFHA 3F3XA 3MWMA 2STWA 1KGSA 1Z7UA 5CVVA 4MQ9F 4N9IA 3IEYB 3HYIA 3L9FA 2NAZA 2RVCA 3NQOA 5ILUA 3MZHA 2HWVA 2DPUA 2PBIA 3QAHA 5TJJA 3SZPA 3R0JA 2QENA 4DA2A 1WKMA 1AWCA 2OKFA 1QZYA 1REPC 1ZRCA 3J81Z 4RGRA 2L54A 2V1XA 2O6GE 4S05A 1HQCA 3ZMDA 2E7WA 5D4RA 1RLVA 4M72A 2GJWA 4M71A 2EV6A 2W25A 4G9YA 2HDCA 5H6RA 3HRMA 4CO8A 5E18F 3SHFA 1WSUA 3RKYA 1B4AA 2LF8A 1FLIA 3I54A 4HDVA 3IWZA 3R4KA 4EV0A 5DDGA 1USTA 2XVCA 1AOYA 4NQWA 3VODA 2P7VB 2FRHA 2DBBA 2CSOA 2DT5A 5FLXK 3M7GA 3Q9SA 1GHCA 3MCZA 4A0XA 1W7PA 3V8LA 1KU9A 1UHMA 4ZH4F 1YQAA 2GXBA 1CF7A 3BJAA 3H92A 5HOOA 2WCWA 5HDKA 4D0PA 4L18B 2DQRA 1H9TA 2IPQX 3U1DA 3G73A 3M1EA 2VS1A 4HDUA 2DI3A 3WGIA 1U3EM 2XAGA 2MLGA 3GZ5A 3VEPA 5DCMB 2GQQA 2EFQA 2H09A 4N9HA 1SD7A 1HKSA 2FNPA 4EV1A 3ROUA 4RGUA 5BQTA 4UVAA 4ENMA 3IRRA 2OQRA 3RTRA 1KYZA 2QBYB 1XGOA 5LBQA 3RI4A 3DPTA 4DAVA 2WJ0A 1LEAA 5AONA 3M8FA 1XGNA 4KNYA 5D8KB 4ESBA 5HLIA 2HQNA 1O7FA 3ECOA 3ZPLA 1XN7A 4IRHA 3K1MA 5LRRA 2HTSA 4PZJA 3F21A 4TV7A 1WI9A 3GVAA 4Y17A 3BDDA 5ICCA 2CV8A 1KA8A 1PUEE 4I0AA 5F1RA 5IT3A 2E1NA 2MLKA 3FXRA 2CW0F 2Y48A 1IZ1A 5CVJA 1YO5C 2YSRA 4L5JA 3BJ6A 4TKDA 2YX4A 3NRVA 2YPRA 1G6NA 2ZYZB 3CUQA 1H9GA 1OYWA 1U8RA 1MDMA 2XKPA 4IXAA 3TDUC 3LQRA 1R0VA 1YW8A 1JHFA 4WK8F 1TQMA 3KLOA 4KIFA 3ZN1A 3ZMSA 2V1UA 3H3UA 6PAXA 2CWEA 4I01A 4EJUA 1IUYA 3EDPA 3M8EA 4M9ZA 5L3GA 4Z2YA 3LQQA 3QPTA 5CLSA 1D8KA 3TGNA 1UFMA 1U2WA 3GX4X 1W5SA 4M6YA 2WWYA 1F5TA 4RGSA 1XSVA 4EJOA 2DLLA 1YS6A 5LGNA 4L9VA 2VOOA 5D5WB 1J2XA 3E5UA 4NB5A 5JI6A 4M73A 3DV8A 3RKWA 4KIBA 3F22A 2HGCA 4IPAA 5ICGA 4LLNA 2RGVA 4BAYA 1FSHA 1B1BA 3IEYA 1ZAOA 3QP5A 2XAJA 1LDJA 3COAC 2Z5UA 2OD5A 1HXDA 2KJCA 2IA1A 5LRSA 2RKHA 2QLZA 4QBOA 2VBZA 1FYKA 3IKVA 3F8BA 4A5NA 3GYHX 4L9JA 1QQIA 5F6FA 1BC7C 1S8NA 1XSXA 2QVOA 4MTEA 1BI0A 2UXXA 3RIRA 5E20A 4UUVA 1P2FA 4OU0A 2O0YA 5CYVA 3GFIA 4OIQF 2HS5A 1RUNA 1W7PD 4FHTA 2PMHA 4Q47A 2DAOA 3E6MA 4LK0F 5TRDA 4BHBA 2QUFA 1K6OA 1JXSA 1T98A 3FXUA 1Z6RA 4B8XA 2ZO4A 3IKTA 2GA2A 4R1HA 4L9TA 1A04A 1UB9A 3ZMZA 1BI1A 4IJAA 2VT2A 1R1VA 3WTWC 5D5UB 1YNMA 1I5ZA 1XMAA 5FFXA 3LFKA 2ZNZA 3ZMTA 1UCRA 3HUGA 4EQQA 3BPXA 5FO5A 1FYLA 5LLQA 3HRTA 4CICA 5FLXZ 5LEJA 3HSEA 1QZZA 4CYDA 1LJ9A 1ZGJA 2YX7A 3DKWA 2RDPA 2A6HF 5AIPA 1FC3A 2W84A 4GYGA 4EGYA 4R8HA 2NNYA 1P4AA 1KQ8A 4A5MA 1B6AA 4XRFA 1IRGA 2LDUA 3DFGA 2P5LC 3PFIA 4AVPA 3DNXA 4IVNA 1MD0A 4HA8A 3IL2A 4PGGA 2L4AA 4FT8A 3GFMA 2FEZA 2FU4A 2QBYA 2H6BA 2W8MA 1G3WA 3GLXA 3O2PE 3GW2A 3KP2A 2WIZA 2F5FA 1R11A 2GAUA 1X3UA 2A5YB 1VTNC 4NHJA 3SXYA 2KRFA 4LLGF 2LNBA 2HKXA 2H27A 3F23A 2Q8KA 5ERIA 3EYIA 2UZKA 3FX3A 2FSWA 3RJPA 3F8NA 1O3RA 3KEQA 3WTYC 4WWCA 3LA3A 4XLNF 2R7DA 4QLCU 5IT9K 1S7OA 4I02A 1B9NA 1EH6A 4H0EA 4HW0A 1HSJA 5BMZA 1DDNA 2P4WA 1FOKA 3RDIA 2GZWA 3I0TA 1PDNC 1TNSA 2DU9A 2L01A 1MGTA 1PP7U 1U6GA 2ZYZA 1SD5A 4JBAA 1R36A 1K79A 5DCFA 2VONA 1ON2A 3CTAA 3MEXA 2PG4A 2EV5A 1JE8A 5E1XA 2ZKZA 3R60A 3SQNA 1D8JA 4HX4A 3V7CA 1HBXG 1I1GA 2KIUA 2VBXA 5CJ9A 4ZYHA 5HS7A 3T8TA 1FNNA 2QQAA 5DYMA 1QNTA 3WTVC 3WGHA 2VN2A 4XSZF 1MJAA 1SFEA 1K7AA 4P5OA 2VE9A 1YIOA 4HLYA 3JAMK 4YFNF 3WTTC 2L3DA 4U0WA 4U88A 1NHAA 2P8TA 2FMYA 5FD6A 1LEBA 2F5CA 5K5RA 2QZ8A 1R58A 1Z05A 2ELHA 1R00A 5LEKA 4OMZA 2DPDA 1KU7A 1TQPA 2R7FA 3TO6A 3FOVA 1ZYRF 2VBWA 2Z0RA 2Q2EA 2FKCA 2K4BA 4OMYA 1BJAA 5FB2A 2QWWA 3VOEA 5L3FA 5HLHA 1D5VA 1YTYA 4M9XA 1RI7A 5DV5A 4KFCA 4HOBA 4MQVA 1SAXA 4O6JA 4EGZA 5BPDA 3FM5A 1L0OC 3K9TA 3RYPA 2FLCA 2RNJA 2DQLA 3FMRA 4MEYF 3ABTA 2P6SA 2BV6A 3JW4A 4KMFA 2EV0A 2Z33A 2FKHB 3FMQA 1QPMA 2HEOA 4OIPF 4MEXF 2NNNA 3IC7A 5DUKA 3P1ZA 2RQPA 2EA2A 1S29A 1TLHB 1Z6TA 2G7HA 3ABUA 4KUMA 3J7AO 2CZRA 4UNOA 3KFWX 2NYXA 3TOBA 3I58A 5ICFA 1O3TA 3E6DA 2ZCWA 4Q48A 5CVRA 4WXDA 3HIFA 3I59B 3PQJA 4ASNA 1BM9A 5FFZA 3K2ZA 2O8XA 4KYWA 4P55A 2D1VA 3W6JB 3LAJA 1FWZA 3VFZA 2EFOA 1FZPB 4M74A 4U7BA 4ENJA 1RZNA 1KYWA 5HS8A 2RV8A 1H0MA 3WG9A 1HKQA 1B9MA 4LG0B 4BH9A 3CDHA 2RN7A 3QP6A 2XASA 4LD5A 3R6SA 1IPIA 1DPUA 2IA0A 4HBLA 1R23A 5J8CA 4ENNA 3CO7C 1T38A 2GIVA 5JHUA 3R61A 3C18A 2A07F 4HZFA 5DUIA 5LHHA 4BQAA 3KLNA 5BPIA 3QOPA 1P92A 1QO0D 4RB3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F6V A;  5D4S A;  1O3Q A;  4KMU X;  2BEO A;  2ZFW A;  3I53 A;  5L3D A;  3SZT A;  2IRF G;  1SMY F;  1OKR A;  1TW2 A;  4GCV A;  4DNC A;  4UHT A;  4LGW A;  4IHS A;  1GXQ A;  4PCQ A;  2R3S A;  4KDP A;  1TBX A;  2RC4 A;  1LVA A;  3TKY A;  4EVI A;  3QU3 A;  1R22 A;  4HQE A;  1OB9 A;  2XHK A;  2K27 A;  5IT9 Z;  4WCG A;  5KK1 A;  1FX7 A;  2PMU A;  1MZB A;  2XRO A;  3KP7 A;  2QM3 A;  2XAF A;  4O5V A;  1ZN2 A;  2HFH A;  5D5X B;  2XAQ A;  3KZZ A;  5D6F A;  2Q0O A;  3AAF A;  1V4R A;  4OIO F;  1B59 A;  4CHU A;  2FBI A;  2ESN A;  4IHT A;  1K78 B;  3F8C A;  1YW7 A;  5DEQ A;  5KVR A;  3MFK A;  5D8L B;  2ACJ A;  1Y88 A;  1YLF A;  1ZG3 A;  2FXA A;  4G94 A;  5K5Q A;  3I64 A;  3FWE A;  4ESF A;  2X0L A;  1XDS A;  4GO1 A;  4K2E A;  2M1B A;  2ZXJ A;  1ZRD A;  1HW2 A;  1G3T A;  1IW7 F;  4MHG A;  4UV8 A;  4OIR F;  3R0A A;  3I4P A;  3JAM Z;  2BBY A;  1WRJ A;  2PFB A;  3T8R A;  3WTZ A;  2VXZ A;  4MNU A;  2PN6 A;  3EUH A;  4A0Y A;  2FCO A;  1FBS A;  1IN8 A;  1ZAR A;  1LB2 A;  4ETS A;  1MJ9 A;  3FF5 A;  3CUO A;  3KP6 A;  2V79 A;  4RB1 A;  3E6B A;  2JSC A;  3DF8 A;  3ZN0 A;  2M45 A;  2EO0 A;  4RAZ A;  4XBF A;  5BS6 A;  2CYY A;  1S6L A;  2K02 A;  1T0F A;  2KIM A;  3HSF A;  3C7J A;  3N97 A;  2QQB A;  1YYV A;  4B09 A;  4RAY A;  2OAZ A;  4I98 B;  4ZYE A;  2DFI A;  1E17 A;  2JT1 A;  1FP1 D;  3L7W A;  4AIH A;  3ZMV A;  3GFL A;  3GEZ A;  3GWZ A;  4U7D A;  1WQ2 A;  4N0B A;  1SFX A;  2MD5 A;  2M30 A;  1E2X A;  3FZV A;  3GUD A;  4BHC A;  1MJB A;  1FBU A;  1BN5 A;  2ISZ A;  3P9I A;  3RKX A;  2XIG A;  5LGU A;  3I59 A;  2O3F A;  2VC0 A;  1P4W A;  3LA2 A;  3V8J A;  3D0S A;  1UHW A;  5LHG A;  3WU1 B;  1J7K A;  4EMS A;  1P4X A;  4I0B A;  5DCM A;  2OBP A;  5E8G A;  1I1S A;  1SD4 A;  1ON1 A;  1ZHF A;  1LQ1 A;  4LG0 A;  4U0V A;  1QBJ A;  2C6Y A;  3OOP A;  4KA4 A;  3KZY A;  2WIW A;  3F8F A;  1OB8 A;  5JR3 A;  1S7A A;  3H3Z A;  1FSE A;  2GXG A;  2FBK A;  5HDG A;  5J6X A;  3MQ0 A;  3WTX C;  2ZME B;  1XDU A;  3K1N A;  2XAH A;  3Q5F A;  1ZG1 A;  5LGT A;  4S04 A;  3ECH A;  2WV0 A;  3V4G A;  3I71 A;  3OV8 A;  2AS5 F;  3V7S A;  3CLO A;  3K69 A;  2PJP A;  1IN6 A;  2HYG D;  4RS8 A;  5K1Y A;  3E3V A;  2XV4 S;  3B73 A;  2F5D A;  2VE8 A;  4HQM A;  4HF1 A;  3C1D A;  2IVM A;  2A3S A;  4AD9 A;  3QPH A;  4YFX F;  3HSR A;  4A6E A;  1ULY A;  1G3Y A;  1KQ0 A;  3ISP A;  4R79 A;  3WTS C;  1TNT A;  3RPU A;  1BI3 A;  1USS A;  3FHZ A;  3DEU A;  2F5E A;  5J8F A;  1IRF A;  2IW5 A;  2PQ8 A;  3T1B A;  2YU3 A;  4DQ2 A;  4YG2 F;  3I5U A;  2STT A;  4EJW A;  2JZY A;  3P1Y A;  1GVJ A;  3U2R A;  2WTE A;  5AIQ A;  2FNA A;  1R1T A;  1J5Y A;  1QGP A;  4BYY A;  4QWQ A;  2COM A;  3BOQ A;  3F72 A;  1MDM B;  2O61 A;  3E6C C;  4OOI A;  2FE3 A;  1ZP7 A;  1OMI A;  2D1H A;  1C0W A;  1F9N A;  2VC1 A;  3QRF F;  1BI2 A;  4HX7 A;  4FX0 A;  2DO7 A;  3F6O A;  2W85 A;  3LWF A;  2FA5 A;  1OR7 A;  4L5I A;  2DK5 A;  4HX8 A;  1KU2 A;  1J75 A;  3JSP A;  2P5V A;  3FM3 A;  1J59 A;  4GYI A;  5K5O A;  2GWR A;  1K78 A;  3AJV B;  4XSX F;  2XUB A;  3HOT A;  4PDK A;  1EV7 A;  1Z1D A;  2GA1 A;  4YII A;  3P9C A;  5FD5 A;  1ZRF A;  4KN4 X;  1WWX A;  3WE2 A;  1DPR A;  3HOS A;  4UV9 A;  4IRI A;  2M5W A;  2OA4 A;  1P6R A;  2L4M A;  1IN5 A;  3MZY A;  4O3M A;  2KKO A;  3J80 K;  4QBL A;  1R1U A;  1A79 A;  2CGP A;  2NRA C;  1ZG5 A;  3IHU A;  2MBF A;  5FGM A;  4AIK A;  3HHH A;  2MC3 A;  4P96 A;  3HHG A;  5E1Z B;  4G8X A;  3LAP A;  3GZ6 A;  2Z99 A;  3V8K A;  2CO5 A;  4AWX B;  3HTU A;  5H20 A;  3L00 A;  1XMK A;  3ZP5 A;  2EFP A;  2EB7 A;  5H6Q A;  1DP7 P;  2XRN A;  1SFU A;  2FOK A;  1ONV A;  1YS7 A;  4JQF A;  4CGZ A;  2ZJ2 A;  2EJR A;  1RUO A;  3KP5 A;  4EJT A;  1BC8 C;  2P6T A;  3KP3 A;  4HV6 A;  1SMT A;  3D5L A;  5ICE A;  5E1W A;  4I2O A;  1HW1 A;  4ON0 A;  4ESJ A;  3WU0 A;  3G3Z A;  2Z9O A;  5EEH A;  3HTS B;  1ZH5 A;  2ETH A;  3TQN A;  2OST A;  4UVC A;  1S3J A;  3CJN A;  4HF0 A;  5CVI A;  4Q4Z F;  2A61 A;  2A69 F;  2X4H A;  3E5X A;  3HRS A;  2A68 F;  4KIG A;  1T2K A;  2D45 A;  2J5P A;  3P7N A;  2O03 A;  4A0Z A;  4OIN F;  4HF2 A;  1IXC A;  3TOA A;  1RNL A;  4E70 A;  4LMY A;  5DD8 A;  1IXR C;  1R5H A;  2HTJ A;  1ODD A;  5HLG A;  2OZ6 A;  1RIO H;  3CO6 C;  4KIC A;  3FMS A;  3FXQ A;  1T39 A;  2J5O A;  2EFW A;  4A2U A;  3M9A A;  2W24 A;  1U5T C;  2XGX A;  2VOD A;  1U5T B;  3RYR A;  2UWM A;  1YG2 A;  1XGM A;  1I6X A;  4FX4 A;  3BZ6 A;  1J9I A;  5BOX A;  1FT9 A;  1W4M A;  1GXP A;  2ZNY A;  5ED4 A;  2FQ3 A;  2HR3 A;  3RPQ A;  1FBQ A;  2ZME A;  4RB0 A;  1O7L A;  4MTD A;  4IF4 A;  1ZLK A;  1CGP A;  2V1D A;  5HS9 A;  2H94 A;  3Q9V A;  1BIB A;  2KJB A;  4M6X A;  3DXJ F;  3GFJ A;  2ZBK A;  3O3K A;  4Q5S F;  4I09 A;  2HOE A;  2MA3 A;  1O57 A;  2IP2 A;  3LST A;  3SFZ A;  1V3F A;  3GXO A;  3U9G A;  2TDX A;  2VBY A;  1U78 A;  3EYY A;  4ZYG A;  3NEU A;  2PI0 A;  4BHP A;  1GEF A;  5A2Q K;  4WF2 A;  2ISY A;  4XLP F;  2VT3 A;  2KIF A;  2P7C B;  2K4J A;  5L3C A;  4Y13 A;  3LA7 A;  4LK1 F;  3VB2 A;  2YR2 A;  2Y75 A;  2HQR A;  4HYE A;  1I27 A;  4UVB A;  5D6E A;  3QU6 A;  2BGC A;  4G7O F;  1PP8 F;  4WXC A;  2IT0 A;  3KE2 A;  2B0L A;  1OYI A;  2WCZ A;  3TDZ C;  1Q1H A;  2IA2 A;  4GXO A;  4EJV A;  4G7Z F;  3T5X A;  3E5Q A;  2VLD A;  2VOP A;  1IXS B;  2Z3Y A;  3JSO A;  4PGH A;  4Y15 A;  4ENK A;  1O3S A;  1Z91 A;  4L9N A;  4CZZ A;  2LSO A;  3AJV A;  1R5G A;  3WGG A;  1ZRE A;  2HZT A;  3S2W A;  3ZQ7 A;  3IRQ A;  1R7J A;  4M9S A;  1EH8 A;  1IN7 A;  2INB A;  1BBY A;  3B02 A;  2IJL A;  5EEG A;  1F1Z A;  1KU3 A;  4GGG A;  1ZGA A;  2G7U A;  3WE3 A;  4I7H A;  5L3E A;  2M87 A;  3BRO A;  5JVT A;  2EWN A;  1J0R A;  3L2C A;  2DK8 A;  3KCC A;  3J81 K;  5DD4 A;  3ML6 A;  5JFR A;  5CVU A;  2UXN A;  3J80 Z;  2EK5 A;  3K0L A;  1Y0U A;  4ZYD A;  4A6D A;  4KT5 C;  2G9W A;  1G3S A;  1EH7 A;  1ZLJ A;  2H6C A;  3IWF A;  5FDK A;  3TO7 A;  2JTV A;  5E17 F;  3ULQ B;  4HV5 A;  3N4M A;  1F4K A;  4YFK F;  3REO A;  1OYY A;  3ERE D;  2MH2 A;  4LB5 A;  4HLX A;  5LHI A;  1JHH A;  3DP7 A;  2DTR A;  1BIA A;  4LLL A;  3BWG A;  4WX9 A;  2M8E A;  4LFU A;  2AXL A;  2MH9 A;  2HKO A;  1G4D A;  2GW6 A;  4G6Q A;  3W6K B;  4CDG A;  1LDD A;  1Z9C A;  1MKM A;  5L3B A;  3P1Z B;  4EM0 B;  1W7P B;  1IN4 A;  3WOD F;  1IAW A;  3KET A;  2DW4 A;  1CF7 B;  2CQK A;  2CG4 A;  3JTH A;  1XSD A;  4P9F A;  4RB2 C;  3KEO A;  4ZZD A;  5D5V B;  3JTG A;  1OPC A;  3E97 A;  3ELK A;  1L3L A;  2ESH A;  4MGR A;  4P9U A;  3DQV C;  1HW5 A;  4L0Y B;  2PEX A;  4UXN A;  3ZMU A;  1BOA A;  1U5T A;  4KN7 X;  4CXF A;  2JPC A;  3BP8 A;  1XCV A;  1FPQ A;  1RZ4 A;  3L09 A;  4U0Y A;  2NS0 A;  2QQ9 A;  3F8M A;  1IF1 A;  2CFX A;  5E8I A;  2EA4 A;  1YW9 A;  3BPV A;  4QBN A;  1XD7 A;  2E7X A;  2JRT A;  1D3Y A;  2JPB A;  3P9K A;  1JGS A;  2QYO A;  4L0Z B;  2D2W A;  3K1P A;  4LB6 B;  1TTY A;  2Y0M A;  5HDN A;  2OU2 A;  4BXU A;  2V6C A;  1LNW A;  4RGX A;  2FML A;  2W57 A;  1XMX A;  5F64 A;  3BJO A;  2LKP A;  4EM2 A;  4G6D A;  2P5K A;  4AIJ A;  3C3W A;  2K7L A;  4G7H F;  4YIF A;  2HYF A;  3EET A;  3V7R A;  1FY7 A;  4JK1 X;  2FBH A;  1LDK B;  2L02 A;  1HST A;  3DPL C;  4WXH A;  2A6E F;  2EFN A;  1KQ9 A;  5ILS A;  5HVQ C;  3BY6 A;  1FP2 A;  5ILV A;  3GO5 A;  3CUQ C;  2V9V A;  3CUQ B;  1STZ A;  1XGS A;  1HKT A;  1XB4 A;  1T6S A;  2WC2 A;  3EQL F;  3MAJ A;  5A2Q Z;  2XKO A;  3T0Y A;  1TQI A;  2BE5 F;  1Y1O A;  2K86 A;  4IRG A;  1FYM A;  4LJZ F;  1HH1 A;  1SD6 A;  2BYV E;  2OZU A;  1TW3 A;  3GF2 A;  2OQG A;  2E1C A;  2LF7 A;  3PQK A;  4HAM A;  2PLY A;  1XCB A;  1W5T A;  3WTU C;  2FF4 A;  4A12 A;  4BNC A;  3O6B B;  4EM1 A;  4ZZL A;  3HRU A;  4F7Z A;  3TO9 A;  2ADU A;  2F2E A;  3KP4 A;  4TKK A;  1DUX C;  1YFH A;  3F3X A;  3MWM A;  2STW A;  1KGS A;  1Z7U A;  5CVV A;  4MQ9 F;  4N9I A;  3HYI A;  3L9F A;  2NAZ A;  2RVC A;  3NQO A;  5ILU A;  3MZH A;  2HWV A;  2DPU A;  2PBI A;  3QAH A;  5TJJ A;  3SZP A;  3R0J A;  2QEN A;  1WKM A;  1AWC A;  2OKF A;  1QZY A;  1REP C;  1ZRC A;  3J81 Z;  4RGR A;  2L54 A;  2V1X A;  2O6G E;  4S05 A;  1HQC A;  3ZMD A;  2E7W A;  5D4R A;  1RLV A;  4M72 A;  2GJW A;  4M71 A;  2EV6 A;  2W25 A;  4G9Y A;  2HDC A;  5H6R A;  3HRM A;  4CO8 A;  5E18 F;  3SHF A;  1WSU A;  3RKY A;  1B4A A;  2LF8 A;  1FLI A;  3I54 A;  4HDV A;  3IWZ A;  3R4K A;  4EV0 A;  5DDG A;  1UST A;  2XVC A;  1AOY A;  4NQW A;  3VOD A;  2P7V B;  2FRH A;  2DBB A;  2CSO A;  2DT5 A;  5FLX K;  3M7G A;  3Q9S A;  1GHC A;  3MCZ A;  4A0X A;  1W7P A;  3V8L A;  1KU9 A;  1UHM A;  4ZH4 F;  1YQA A;  2GXB A;  1CF7 A;  3BJA A;  3H92 A;  5HOO A;  2WCW A;  5HDK A;  4D0P A;  4L18 B;  2DQR A;  1H9T A;  2IPQ X;  3U1D A;  3G73 A;  3M1E A;  4HDU A;  2DI3 A;  3WGI A;  1U3E M;  2XAG A;  2MLG A;  3GZ5 A;  3VEP A;  5DCM B;  2GQQ A;  2EFQ A;  2H09 A;  4N9H A;  1SD7 A;  1HKS A;  2FNP A;  3ROU A;  4RGU A;  5BQT A;  4UVA A;  4ENM A;  3IRR A;  2OQR A;  3RTR A;  1KYZ A;  2QBY B;  1XGO A;  5LBQ A;  3RI4 A;  3DPT A;  2WJ0 A;  1LEA A;  5AON A;  3M8F A;  1XGN A;  4KNY A;  5D8K B;  4ESB A;  5HLI A;  2HQN A;  1O7F A;  3ECO A;  3ZPL A;  1XN7 A;  4IRH A;  3K1M A;  5LRR A;  2HTS A;  4PZJ A;  3F21 A;  4TV7 A;  1WI9 A;  3GVA A;  4Y17 A;  3BDD A;  5ICC A;  2CV8 A;  1KA8 A;  1PUE E;  4I0A A;  5F1R A;  5IT3 A;  2E1N A;  2MLK A;  3FXR A;  2CW0 F;  2Y48 A;  1IZ1 A;  5CVJ A;  1YO5 C;  2YSR A;  4L5J A;  3BJ6 A;  4TKD A;  2YX4 A;  3NRV A;  2YPR A;  1G6N A;  2ZYZ B;  3CUQ A;  1H9G A;  1OYW A;  1U8R A;  1MDM A;  2XKP A;  4IXA A;  3TDU C;  3LQR A;  1R0V A;  1YW8 A;  1JHF A;  4WK8 F;  1TQM A;  3KLO A;  4KIF A;  3ZN1 A;  3ZMS A;  2V1U A;  3H3U A;  6PAX A;  2CWE A;  4I01 A;  4EJU A;  1IUY A;  3EDP A;  3M8E A;  4M9Z A;  5L3G A;  4Z2Y A;  3LQQ A;  3QPT A;  5CLS A;  1D8K A;  3TGN A;  1UFM A;  1U2W A;  3GX4 X;  1W5S A;  4M6Y A;  2WWY A;  1F5T A;  4RGS A;  1XSV A;  4EJO A;  2DLL A;  1YS6 A;  5LGN A;  4L9V A;  2VOO A;  5D5W B;  1J2X A;  3E5U A;  4NB5 A;  5JI6 A;  4M73 A;  3DV8 A;  3RKW A;  4KIB A;  3F22 A;  2HGC A;  4IPA A;  5ICG A;  4LLN A;  2RGV A;  4BAY A;  1FSH A;  1B1B A;  3IEY A;  1ZAO A;  3QP5 A;  2XAJ A;  1LDJ A;  3COA C;  2Z5U A;  2OD5 A;  1HXD A;  2KJC A;  2IA1 A;  5LRS A;  2RKH A;  2QLZ A;  4QBO A;  2VBZ A;  1FYK A;  3IKV A;  3F8B A;  4A5N A;  3GYH X;  4L9J A;  1QQI A;  5F6F A;  1BC7 C;  1S8N A;  1XSX A;  2QVO A;  4MTE A;  1BI0 A;  2UXX A;  3RIR A;  5E20 A;  4UUV A;  1P2F A;  4OU0 A;  2O0Y A;  5CYV A;  3GFI A;  4OIQ F;  2HS5 A;  1RUN A;  1W7P D;  4FHT A;  2PMH A;  4Q47 A;  2DAO A;  3E6M A;  4LK0 F;  5TRD A;  4BHB A;  2QUF A;  1K6O A;  1JXS A;  1T98 A;  3FXU A;  1Z6R A;  4B8X A;  2ZO4 A;  3IKT A;  2GA2 A;  4R1H A;  4L9T A;  1A04 A;  1UB9 A;  3ZMZ A;  1BI1 A;  4IJA A;  2VT2 A;  1R1V A;  3WTW C;  5D5U B;  1I5Z A;  1XMA A;  5FFX A;  3LFK A;  2ZNZ A;  3ZMT A;  1UCR A;  3HUG A;  4EQQ A;  3BPX A;  5FO5 A;  1FYL A;  5LLQ A;  3HRT A;  4CIC A;  5FLX Z;  5LEJ A;  3HSE A;  1QZZ A;  4CYD A;  1LJ9 A;  1ZGJ A;  2YX7 A;  3DKW A;  2RDP A;  2A6H F;  5AIP A;  1FC3 A;  2W84 A;  4GYG A;  4EGY A;  4R8H A;  2NNY A;  1P4A A;  1KQ8 A;  4A5M A;  1B6A A;  4XRF A;  1IRG A;  2LDU A;  3DFG A;  2P5L C;  3PFI A;  4AVP A;  3DNX A;  4IVN A;  1MD0 A;  4HA8 A;  3IL2 A;  4PGG A;  2L4A A;  4FT8 A;  3GFM A;  2FEZ A;  2FU4 A;  2QBY A;  2H6B A;  1G3W A;  3GLX A;  3O2P E;  3GW2 A;  3KP2 A;  2WIZ A;  2F5F A;  1R11 A;  2GAU A;  1X3U A;  2A5Y B;  1VTN C;  4NHJ A;  3SXY A;  2KRF A;  4LLG F;  2LNB A;  2HKX A;  2H27 A;  3F23 A;  2Q8K A;  5ERI A;  3EYI A;  2UZK A;  3FX3 A;  2FSW A;  3RJP A;  3F8N A;  1O3R A;  3KEQ A;  3WTY C;  4WWC A;  3LA3 A;  4XLN F;  2R7D A;  4QLC U;  5IT9 K;  1S7O A;  4I02 A;  1B9N A;  1EH6 A;  4H0E A;  4HW0 A;  1HSJ A;  5BMZ A;  1DDN A;  2P4W A;  1FOK A;  3RDI A;  2GZW A;  3I0T A;  1PDN C;  1TNS A;  2DU9 A;  2L01 A;  1MGT A;  1PP7 U;  1U6G A;  2ZYZ A;  1SD5 A;  4JBA A;  1R36 A;  1K79 A;  5DCF A;  2VON A;  1ON2 A;  3CTA A;  3MEX A;  2PG4 A;  2EV5 A;  1JE8 A;  5E1X A;  2ZKZ A;  3R60 A;  3SQN A;  1D8J A;  4HX4 A;  3V7C A;  1HBX G;  1I1G A;  2KIU A;  2VBX A;  5CJ9 A;  4ZYH A;  5HS7 A;  3T8T A;  1FNN A;  2QQA A;  5DYM A;  1QNT A;  3WTV C;  3WGH A;  2VN2 A;  4XSZ F;  1MJA A;  1SFE A;  1K7A A;  4P5O A;  2VE9 A;  1YIO A;  4HLY A;  3JAM K;  4YFN F;  3WTT C;  2L3D A;  4U0W A;  4U88 A;  1NHA A;  2P8T A;  2FMY A;  5FD6 A;  1LEB A;  2F5C A;  5K5R A;  2QZ8 A;  1R58 A;  1Z05 A;  2ELH A;  1R00 A;  5LEK A;  4OMZ A;  2DPD A;  1KU7 A;  1TQP A;  2R7F A;  3TO6 A;  3FOV A;  1ZYR F;  2VBW A;  2Q2E A;  2K4B A;  4OMY A;  1BJA A;  5FB2 A;  2QWW A;  3VOE A;  5L3F A;  5HLH A;  1D5V A;  1YTY A;  4M9X A;  1RI7 A;  5DV5 A;  4KFC A;  4HOB A;  4MQV A;  1SAX A;  4O6J A;  4EGZ A;  5BPD A;  3FM5 A;  1L0O C;  3K9T A;  3RYP A;  2RNJ A;  2DQL A;  3FMR A;  4MEY F;  3ABT A;  2P6S A;  2BV6 A;  3JW4 A;  4KMF A;  2EV0 A;  2Z33 A;  3FMQ A;  1QPM A;  2HEO A;  4OIP F;  4MEX F;  2NNN A;  3IC7 A;  5DUK A;  3P1Z A;  2RQP A;  2EA2 A;  1S29 A;  1TLH B;  1Z6T A;  2G7H A;  3ABU A;  4KUM A;  3J7A O;  4UNO A;  3KFW X;  2NYX A;  3TOB A;  3I58 A;  5ICF A;  1O3T A;  3E6D A;  2ZCW A;  4Q48 A;  5CVR A;  4WXD A;  3HIF A;  3I59 B;  3PQJ A;  4ASN A;  1BM9 A;  5FFZ A;  3K2Z A;  2O8X A;  4KYW A;  4P55 A;  2D1V A;  3W6J B;  3LAJ A;  1FWZ A;  3VFZ A;  2EFO A;  1FZP B;  4M74 A;  4U7B A;  4ENJ A;  1RZN A;  1KYW A;  5HS8 A;  2RV8 A;  1H0M A;  3WG9 A;  1HKQ A;  1B9M A;  4LG0 B;  4BH9 A;  3CDH A;  2RN7 A;  3QP6 A;  2XAS A;  4LD5 A;  3R6S A;  1IPI A;  1DPU A;  2IA0 A;  4HBL A;  1R23 A;  5J8C A;  4ENN A;  3CO7 C;  1T38 A;  2GIV A;  5JHU A;  3R61 A;  3C18 A;  2A07 F;  4HZF A;  5DUI A;  5LHH A;  4BQA A;  3KLN A;  5BPI A;  3QOP A;  1P92 A;  1QO0 D;  4RB3 C; 
#chains in the Genus database with same CATH topology
 3F6V A;  2E2H J;  1O4X A;  5D4S A;  3P5J A;  3Q0W A;  4KMU X;  1O3Q A;  2BEO A;  2FD5 A;  2ZFW A;  3I53 A;  5L3D A;  2CV0 A;  2LRD A;  3SZT A;  3S3N A;  2IRF G;  2PJR A;  1SMY F;  1LFB A;  3AG1 H;  3HOZ J;  1OKR A;  1RR7 A;  2ZXH A;  1QHG A;  1F36 A;  1TW2 A;  4GCV A;  3VPR A;  4DNC A;  2L5Q A;  4UHT A;  2VL8 A;  4LGW A;  4IHS A;  3L2U A;  3OYJ A;  1GXQ A;  3A01 B;  1H88 C;  1W1W E;  2JUC A;  4PCQ A;  2R3S A;  4KDP A;  1TBX A;  1Y6I A;  2RC4 A;  3HC7 A;  3W6V A;  1X1C A;  3W2V A;  4HNT A;  3GTJ J;  2ZSH B;  1LVA A;  2LOO A;  4ITV A;  3TKY A;  4YRV A;  4CYC B;  2B9S A;  2GOX B;  3MVP A;  1H89 C;  1E3H A;  3A03 A;  4EVI A;  4JX4 A;  3QU3 A;  1R22 A;  4HQE A;  1OB9 A;  2XHK A;  2K27 A;  2Y9Y A;  4PUS A;  1VQL I;  5IT9 Z;  4WCG A;  2JA8 J;  5KK1 A;  1FX7 A;  3CCJ I;  3OMY A;  4DAP A;  3ASO H;  2PMU A;  2K9S A;  1MZB A;  1HCR A;  1YX5 A;  2ECC A;  2XRO A;  1E0E A;  3KP7 A;  2QM3 A;  1V54 H;  2XAF A;  2KLO A;  3BZK A;  1JUM A;  3PNT A;  5C44 J;  1UJ8 A;  4O5V A;  3TL4 X;  3HGG A;  1ZN2 A;  2HFH A;  5D5X B;  4FQG A;  2XAQ A;  1T08 B;  2DMT A;  3KZZ A;  5D6F A;  1OR7 C;  2KRH A;  2Q0O A;  3AAF A;  4DJA A;  1V4R A;  5M5W J;  3G2B A;  4OIO F;  4LIU A;  4XON A;  3LL7 A;  4MIM A;  1B59 A;  4BUP A;  4CCJ A;  4CHU A;  1ZGW A;  2W7N A;  2FBI A;  1HA8 A;  2ESN A;  4IHT A;  1K78 B;  1X1P A;  1X1A A;  1G2H A;  5FKK A;  3F8C A;  1YW7 A;  5DEQ A;  5KVR A;  2ME6 A;  4IO9 F;  4C3I J;  3MFK A;  5D8L B;  2LRE A;  2ACJ A;  3FBN B;  2R7V A;  1Y88 A;  1YLF A;  1A35 A;  1ZG3 A;  2FXA A;  1OCR H;  4G94 A;  4Y4R A;  2I5U A;  5F0C A;  2Y31 A;  3RQI A;  5K5Q A;  1IG7 A;  3I64 A;  3FWE A;  4RA2 A;  4ESF A;  2X0L A;  4UB8 C;  2CQ7 A;  1XDS A;  4GO1 A;  4K2E A;  2MD0 A;  2M1B A;  2ZXJ A;  1ZRD A;  2JWT A;  2CU7 A;  2K9Q A;  1HW2 A;  1G3T A;  1IW7 F;  1UMQ A;  4MHG A;  4UV8 A;  4C2M J;  3DU6 A;  4OIR F;  3R0A A;  2MGQ A;  3GTM J;  3I4P A;  5IYB J;  2KT0 A;  3I9V 2;  1TL8 A;  2M4G A;  3JAM Z;  5B3S H;  4UY8 I;  2BBY A;  1WRJ A;  1W0U A;  4BQO A;  3CCQ I;  1R5I D;  2PFB A;  1UHS A;  3T8R A;  3WTZ A;  2VXZ A;  4MNU A;  2OTL I;  2PN6 A;  3EUH A;  1N75 A;  4A0Y A;  2FCO A;  1FBS A;  1IN8 A;  1RKW A;  1ZAR A;  5H2F C;  5DM6 F;  1IGN A;  1LB2 A;  4ETS A;  1MJ9 A;  1LPQ A;  4XQF A;  1BOB A;  3FF5 A;  3CUO A;  3KP6 A;  2V79 A;  4RB1 A;  3E6B A;  4FE4 A;  2JSC A;  3DF8 A;  2XGE A;  2O9L A;  3BR2 A;  3ZN0 A;  3S1Q J;  3ONQ A;  1IV8 A;  4JYK A;  2M45 A;  4IL6 C;  3G6E I;  3OYB A;  2EO0 A;  5M5Y J;  4RAZ A;  4XBF A;  1ZTR A;  1RR8 C;  5BS6 A;  2H1L A;  5F27 A;  2CYY A;  1S6L A;  2K02 A;  3OIP A;  3K4J A;  3S1M J;  2CW8 A;  2E36 A;  2JRM A;  1T0F A;  2KIM A;  3CME I;  3HSF A;  4BXF A;  3C7J A;  3N97 A;  2QQB A;  4A3K J;  1YYV A;  1X2N A;  1FTZ A;  4B09 A;  4RAY A;  2OAZ A;  1DU0 A;  4I98 B;  4ZYE A;  2M3A A;  2DFI A;  1OCT C;  1PYV A;  1E17 A;  2JT1 A;  1FP1 D;  3L7W A;  3VSK A;  4AIH A;  3ZMV A;  3GFL A;  1JKO C;  4YEJ A;  3BR0 A;  3GEZ A;  2NS8 A;  1JTX A;  3GWZ A;  4B3X A;  4U7D A;  3HM5 A;  4BY1 J;  2R5Y B;  1WQ2 A;  2IEK A;  4N0B A;  4JP0 A;  2OTJ I;  1SFX A;  2MD5 A;  2M30 A;  1FOY A;  1E2X A;  3FZV A;  3GUD A;  2M8G X;  4BHC A;  1MJB A;  4ZDO A;  2KPM A;  1FBU A;  1BN5 A;  4D7N A;  1U8B A;  3CMM A;  4IHY A;  1WPK A;  4D9J A;  2ISZ A;  3P9I A;  4XOT A;  1TWA J;  3M8J A;  4PFP A;  2JSP A;  3LSM A;  2BVL A;  3RKX A;  4B4C A;  2XIG A;  3OIO A;  3K4B A;  5LGU A;  1VQ9 I;  1WFX A;  3I59 A;  2EIK H;  2O3F A;  4I99 C;  4C2T A;  2VC0 A;  1P4W A;  3B6C A;  3EUK L;  3LA2 A;  3V8J A;  3D0S A;  3DCF A;  2B7E A;  1UHW A;  3L2V A;  2R7R A;  2OPT A;  5LHG A;  3WU1 B;  4IX7 A;  2BZT A;  2WBM A;  3CDL A;  4D5F A;  4X0G A;  2M7B A;  1Y39 A;  1J7K A;  2K40 A;  3NAR A;  4EMS A;  1UWV A;  1P4X A;  3Q0U A;  4I0B A;  1MBJ A;  4LIV A;  3OS0 A;  2GM4 A;  5DCM A;  3O8G A;  3WHB A;  2OBP A;  1RRJ A;  5E8G A;  1XG1 A;  1I1S A;  1SD4 A;  1ON1 A;  1ZHF A;  1LQ1 A;  4LG0 A;  2DT7 B;  4U0V A;  4E6Z A;  1QBJ A;  2C6Y A;  2LYC A;  4W97 A;  3OOP A;  3CCR I;  1MBE A;  3DKY A;  3AG2 H;  1FMW A;  4KA4 A;  1YIJ I;  2IS6 A;  3KZY A;  1ACI A;  2WIW A;  1SVL A;  3F8F A;  1OB8 A;  3J7A Y;  2ELK A;  2GXA A;  1YJN I;  5JR3 A;  1S7A A;  2W4S A;  2ELJ A;  3H3Z A;  2VKH A;  3MN2 A;  1FSE A;  3DBH B;  3CJR B;  3IH4 A;  2ZJQ F;  2GXG A;  2FBK A;  5HDG A;  5EGO B;  3TMO A;  5J6X A;  2YU9 J;  3MQ0 A;  1QA6 A;  3WTX C;  1VQN I;  4E4H A;  2ZME C;  2DMQ A;  1XDU A;  2ZME B;  3K1N A;  3PUB A;  2VJ4 A;  1D5Y A;  2XAH A;  3HBL A;  3BT7 A;  3Q5F A;  4D5C A;  1ZG1 A;  3AG3 H;  5LGT A;  1MBG A;  1QVU A;  4XLA A;  2N8G A;  4S04 A;  3ECH A;  2WV0 A;  1BR2 A;  3V4G A;  2X9D A;  3MKW B;  3I71 A;  3H5N A;  4OAY A;  3H1C A;  4XMY A;  3OV8 A;  1A31 A;  3ZQF A;  2AS5 F;  3V7S A;  2ECB A;  2ICW G;  3CLO A;  3K69 A;  3S8P A;  3BCA A;  3BTC A;  2PJP A;  1IN6 A;  2HYG D;  4RS8 A;  5K1Y A;  5EZG A;  3E3V A;  5F1J A;  2XV4 S;  2V4J C;  3ZRG A;  1GVD A;  2CUE A;  2A6T A;  3B73 A;  4F92 B;  2F5D A;  2VE8 A;  2LTP A;  5B1B H;  3BG6 A;  2XSJ C;  5CKT A;  4HQM A;  4ZTF A;  3CP8 A;  5JLW A;  4HF1 A;  2DBS A;  3C1D A;  3CJQ B;  2IVM A;  2A3S A;  4AD9 A;  1TWC J;  4Y3O A;  3QPH A;  4YFX F;  4AID A;  3HSR A;  4A6E A;  1ULY A;  4YEL A;  1G3Y A;  1KQ0 A;  2O5R A;  3ISP A;  4QPQ A;  4R79 A;  3WTS C;  1TNT A;  3RPU A;  2VXD A;  2HVR A;  3A01 A;  2QCO A;  3MKZ A;  3HOW J;  1BI3 A;  1USS A;  1JUS A;  4XKC A;  3H0D A;  3DEU A;  3FHZ A;  2LK2 A;  2F5E A;  4BAC A;  5J8F A;  2DA6 A;  1IRF A;  2IW5 A;  1X19 A;  2PQ8 A;  3T1B A;  2YU3 A;  2E5Z A;  4DQ2 A;  4YG2 F;  3I5U A;  2STT A;  4EJW A;  3I4N J;  1MMD A;  2JZY A;  2X1D A;  2VJJ A;  3P1Y A;  2V1N A;  4CYC A;  1GVJ A;  3U2R A;  3G1M A;  3CQZ J;  2WTE A;  5AIQ A;  2LP0 A;  2FNA A;  3CCY A;  2LKX A;  1R1T A;  2K9M A;  1J5Y A;  1QGP A;  4BYY A;  4CCM A;  3O8H A;  4QWQ A;  3A0B C;  4L5E A;  2FUG 2;  2COM A;  3BOQ A;  3F72 A;  1MDM B;  2O61 A;  3BT9 A;  3DBR B;  2BHZ A;  4OOI A;  3E6C C;  4E7K A;  2FE3 A;  3OOU A;  1ZP7 A;  3FXJ A;  4F93 B;  1OMI A;  2D1H A;  3HZJ A;  1ZKG A;  3ZQQ A;  1C0W A;  1F9N A;  2VC1 A;  3QRF F;  3A02 A;  1BI2 A;  4HX7 A;  2M34 A;  4M3G A;  4FX0 A;  3GTO J;  4XRS A;  4ZDL A;  3WU2 C;  2BY0 A;  2DO7 A;  3S14 J;  3F6O A;  5KNL A;  4F3Q A;  2W85 A;  1TWG J;  2LKS A;  3LWF A;  2FA5 A;  3I3L A;  1OR7 A;  4IQJ A;  4L5I A;  2DK5 A;  4HX8 A;  1KU2 A;  1J75 A;  3JSP A;  2P5V A;  2IXS A;  3FM3 A;  1J59 A;  1LE8 B;  4GYI A;  5K5O A;  2GWR A;  3L2Q A;  1K78 A;  1ERD A;  3AJV B;  1QU3 A;  1KZH A;  4XSX F;  2WAQ A;  2XUB A;  3HOT A;  3Q3S A;  4PDK A;  1EV7 A;  1Z1D A;  2GA1 A;  4YII A;  3P9C A;  4AM3 A;  5FD5 A;  1ZRF A;  3DLL F;  4KN4 X;  3SEZ A;  2M9H A;  1AA7 A;  4M3D A;  1SC7 A;  1WWX A;  3WE2 A;  1X2M A;  1DPR A;  4JOM A;  3HOS A;  4UV9 A;  3FIW A;  2KZG A;  4IRI A;  2M5W A;  2OA4 A;  1P6R A;  2L4M A;  2VQH A;  3E1S A;  3HOX J;  1IN5 A;  3MZY A;  4O3M A;  9ANT A;  2KKO A;  5GPA A;  3J80 K;  4AC0 A;  1APL C;  4QBL A;  3TW7 A;  1X1B A;  1R1U A;  1A79 A;  2XGC A;  2CGP A;  1B72 B;  2NRA C;  3OYD A;  1ZG5 A;  1K6Y A;  3FXO A;  3IHU A;  4KT6 A;  1MMN A;  2MBF A;  4C30 A;  3CC4 I;  5FGM A;  4DBQ A;  4AIK A;  3HHH A;  2JN6 A;  4KIS A;  2FX0 A;  1JJ8 C;  2MC3 A;  4P96 A;  4C3H J;  3HHG A;  1ENH A;  3LSG A;  2GBY A;  4G8X A;  5E1Z B;  3LAP A;  3GZ6 A;  5HLT A;  4FIS A;  4NUB A;  1I3Q J;  3OL3 A;  3A0H C;  2Z99 A;  3A4C A;  2QF7 A;  3V8K A;  2CO5 A;  1NTC A;  4AWX B;  1JKR C;  5FLV A;  3HTU A;  5H20 A;  3L00 A;  3OY9 A;  1XMK A;  3OR1 C;  3ZP5 A;  2EFP A;  2EB7 A;  2VQC A;  5H6Q A;  1DP7 P;  1ETQ A;  2XRN A;  1SFU A;  2VB6 A;  2FOK A;  4G6V A;  1ONV A;  1YS7 A;  4JQF A;  4CGZ A;  3ABL H;  2ZJ2 A;  2DA3 A;  2EJR A;  1RUO A;  2VPR A;  3BQZ A;  1WJ5 A;  3KP5 A;  4G6U A;  1X1D A;  4EJT A;  1BC8 C;  1VQM I;  3IUO A;  5GP9 A;  5LFA A;  2P6T A;  3KP3 A;  4HV6 A;  1SMT A;  3D5L A;  3DKX A;  5ICE A;  5E1W A;  2E2I J;  4IHV A;  4I2O A;  3M07 A;  1HW1 A;  5IOY A;  4ON0 A;  2JA6 J;  3PM1 A;  4ESJ A;  3IF0 X;  3WU0 A;  3G3Z A;  5J47 A;  3BCB A;  1HF0 A;  3VYU B;  2Z9O A;  1SFK A;  5EEH A;  3HTS B;  1ZH5 A;  2DA1 A;  2ETH A;  1MND A;  2R5Y A;  2HVS A;  3TQN A;  2OST A;  4UVC A;  3CC7 I;  3GTK J;  1S3J A;  3CJN A;  4HF0 A;  1PUF B;  5CVI A;  4Q4Z F;  3ZQI A;  4AUX A;  2LD5 A;  2A61 A;  5FKL A;  1Y0N A;  3QOE A;  1XS9 A;  1F43 A;  2A69 F;  2X4H A;  3BR1 A;  5J3L A;  3E5X A;  3HRS A;  4IOC F;  1Z3Y A;  2A68 F;  4KIG A;  2XF6 A;  1T2K A;  2NOJ B;  2D45 A;  2J5P A;  3P7N A;  2O03 A;  4A0Z A;  3VYS B;  3GTL J;  3ERM A;  4RLF A;  4OIN F;  1NK3 P;  2LFB A;  4HF2 A;  3CCM I;  1HLV A;  1IXC A;  3TOA A;  2XC7 A;  1RNL A;  4E70 A;  4LMY A;  5DD8 A;  4MFD A;  1IXR C;  3S93 A;  1R5H A;  4QSH A;  2HTJ A;  1ODD A;  4XK4 A;  5HLG A;  2X6O A;  3FK7 A;  1PVE A;  2XB5 A;  2R0Q C;  2OZ6 A;  1RIO H;  5C4X J;  3CO6 C;  2DDA A;  3OS1 A;  4KIC A;  3FMS A;  3FXQ A;  1T39 A;  3E0J B;  4ZQU A;  2J5O A;  2EFW A;  3D5R C;  4A2U A;  3KYD B;  3M9A A;  2W24 A;  1JKQ C;  1U5T C;  3GZN B;  2XGX A;  2VOD A;  2E34 A;  1U5T B;  5IYD J;  5TIS C;  3RYR A;  4N4O B;  1Y8Q B;  2UWM A;  1YG2 A;  1XGM A;  1JTY A;  1I6X A;  5C3E J;  4FX4 A;  3BZ6 A;  2P81 A;  1J9I A;  5BOX A;  1FT9 A;  4BDY A;  1VQ6 I;  3CF2 A;  1W4M A;  3BC8 A;  2BOL A;  1GXP A;  2ZNY A;  2V7F A;  5ED4 A;  2FQ3 A;  2HR3 A;  1X4O A;  3BR6 A;  4XLF A;  3OIQ A;  3RPQ A;  5JVG F;  1FBQ A;  2ZME A;  4RB0 A;  1O7L A;  4MTD A;  4IF4 A;  1ZLK A;  3RPU D;  2R4G A;  1CGP A;  4A3E J;  2V1D A;  5HS9 A;  1RPW A;  4NC6 A;  2H94 A;  5GAH J;  3Q9V A;  1OQY A;  4X6A J;  2DFE A;  1BIB A;  2MW8 A;  3OR2 C;  5IP7 J;  1R6R A;  2KJB A;  4M6X A;  2WAF A;  3DXJ F;  2JJ7 A;  2ZBK A;  3GFJ A;  3O3K A;  4Q5S F;  3OSF A;  3IAM 2;  4I09 A;  3I56 I;  2HOE A;  2MA3 A;  1O57 A;  2IP2 A;  3LST A;  1NG6 A;  3SFZ A;  1V3F A;  5E3N A;  2DTZ A;  2R92 J;  2RAE A;  3K4K A;  3GXO A;  3U9G A;  2VJ5 A;  2TDX A;  4XNF A;  2VBY A;  3U1K A;  1U78 A;  3EYY A;  4GRI A;  1OCZ H;  4DGW B;  4NDL A;  2CMP A;  4M3F A;  4ZYG A;  3CZ6 A;  2R5Z B;  3S1R J;  3NEU A;  2PI0 A;  2LVS A;  4BHP A;  1ZR4 A;  1GEF A;  5A2Q K;  1T56 A;  4DOZ A;  2HPM A;  4WF2 A;  2CW7 A;  2ISY A;  4Y7N J;  4XLP F;  2DMN A;  4A3J J;  2VT3 A;  2KIF A;  2P7C B;  2K4J A;  5F04 A;  2HDD A;  5L3C A;  4Y13 A;  3MKL A;  2XSD C;  3PIP F;  2R7Z J;  3LA7 A;  4LK1 F;  2XF5 A;  3OYE A;  3VB2 A;  2M4K A;  3ZQL A;  2YR2 A;  4II2 A;  2Y75 A;  2HQR A;  4BQQ A;  4BQN A;  4HYE A;  2FOW A;  1I27 A;  4UVB A;  1RET A;  2NS7 A;  4LOC A;  3FKJ A;  5D6E A;  3QU6 A;  2BGC A;  4YIR X;  4KJZ A;  4G7O F;  1PP8 F;  1U9N A;  3DU5 A;  4WXC A;  5FLM J;  2IT0 A;  3KE2 A;  2B0L A;  4EAT A;  2LY1 A;  1OYI A;  2WCZ A;  5GAE J;  2IS4 A;  4IOA F;  3TDZ C;  1Q1H A;  2IA2 A;  4GXO A;  1K4T A;  2Y69 H;  5CPR B;  4EJV A;  2RRE A;  4BE0 A;  2GLO A;  4IKF A;  4FE7 A;  4G7Z F;  2VI6 A;  3T5X A;  2ZC2 A;  3E5Q A;  4NC7 A;  3BTI A;  5F0F A;  3RCO A;  2VOP A;  1IXS B;  2VLD A;  3AFH A;  4EEF G;  2Z3Y A;  3JSO A;  1LE8 A;  4PGH A;  4Y15 A;  4ENK A;  1O3S A;  3OYF A;  1Z91 A;  4L9N A;  1NK2 P;  3DTK A;  1MW7 A;  3IH3 A;  4RAG A;  4CZZ A;  2LSO A;  3AJV A;  3H35 A;  1R5G A;  2L9S A;  3WGG A;  4MO7 A;  1ZRE A;  1FJL A;  2HZT A;  3S2W A;  3ZQ7 A;  4XID A;  3IRQ A;  1R7J A;  4RDU A;  4UB6 C;  2X6W A;  4M9S A;  2RNG A;  1EH8 A;  3K4N A;  1IN7 A;  2INB A;  4BBR J;  1BBY A;  3B02 A;  2IJL A;  5EEG A;  1OFC X;  1F1Z A;  2Y9Z A;  3H9Q A;  1P7J A;  1KU3 A;  4GGG A;  1ZGA A;  2G7U A;  1IUF A;  1DU6 A;  3WE3 A;  4I7H A;  2NVU B;  1VQP I;  2K9N A;  5L3E A;  5F0H A;  3MMY B;  3RZO J;  2M87 A;  4Z6Y A;  4IQ4 A;  3HDD A;  1B72 A;  3BRO A;  3C2B A;  5JVT A;  2EWN A;  1J0R A;  2BH2 A;  3L2C A;  2DK8 A;  3KCC A;  1GLN A;  3J81 K;  5DD4 A;  4CUG A;  3ML6 A;  5BNG A;  2UUZ A;  2EZH A;  5JFR A;  2KIQ A;  3ESW B;  5CVU A;  3LSK A;  3TP3 A;  2UXN A;  4XKB A;  3J80 Z;  2EK5 A;  3S3O A;  3K0L A;  1I50 J;  1Y0U A;  4ZYD A;  3SJM A;  3ABK H;  1VQO I;  1FTT A;  4A6D A;  4J19 A;  1VND A;  3NAU A;  4KT5 C;  2G9W A;  3RKQ A;  1G3S A;  1EH7 A;  1ZLJ A;  2H6C A;  4X1E A;  2EH3 A;  2X6Y A;  5KCM A;  3IWF A;  5FDK A;  5F08 A;  3TO7 A;  2JTV A;  1WCM J;  5E17 F;  3ULQ B;  4HV5 A;  4BEH B;  3N4M A;  1EKE A;  1F4K A;  4YFK F;  3REO A;  1OYY A;  4RM2 A;  3ERE D;  1IDY A;  3H3V K;  2X1E A;  2MH2 A;  2QA4 I;  4LB5 A;  4HLX A;  5LHI A;  1IV6 A;  1JHH A;  3DP7 A;  1A5J A;  2DTR A;  3LSP A;  1LKX A;  1BIA A;  2ZXI A;  2CV1 A;  4LLL A;  3H9G A;  4HSR A;  3BWG A;  4WX9 A;  4MLO A;  2XB0 X;  1IRZ A;  2M8E A;  4LFU A;  2AXL A;  2DT6 A;  2MH9 A;  2HKO A;  4NQW B;  3CCE I;  4FAS D;  1G4D A;  2BVM A;  4MFE A;  2FL3 A;  2GW6 A;  3W2W A;  1XTA A;  4G6Q A;  1QZE A;  4A3G J;  3W6K B;  1SFO J;  4CDG A;  1LDD A;  1Z9C A;  1YX3 A;  4C3J J;  1MKM A;  5K7H A;  5L3B A;  3JCU C;  3P1Z B;  3AKZ A;  5IP6 A;  4EM0 B;  1W7P B;  1PUF A;  1IN4 A;  3WOD F;  5HNH A;  2LY9 A;  1CQT A;  1IAW A;  2EZL A;  3KET A;  3BR3 A;  2DW4 A;  3CD6 I;  1CF7 B;  1D1A A;  2CQK A;  5B5E C;  1ZK8 A;  2CG4 A;  3JTH A;  4NBQ A;  1XSD A;  2XPU A;  4P9F A;  2DMP A;  1HOM A;  3GLL A;  4RB2 C;  2WAE A;  3KEO A;  4ZZD A;  1Q1V A;  1AU7 A;  2HOT A;  2HZD A;  5D5V B;  3CLQ A;  3JTG A;  1OPC A;  2MAB A;  3E97 A;  3ELK A;  1L3L A;  2ESH A;  4MGR A;  4P9U A;  3HOU J;  3DQV C;  1HW5 A;  1TP4 A;  2JK3 A;  3KEY A;  3TW6 A;  4L0Y B;  3BQY A;  2BY2 A;  2W1O A;  3GTQ J;  2PEX A;  4UXN A;  5E79 C;  3ZMU A;  1MH3 A;  3DLA A;  1BOA A;  1U5T A;  4G6T B;  4KN7 X;  4C2U A;  1JI8 A;  4B48 A;  1ITY A;  4CXF A;  2JPC A;  3DPU A;  3BP8 A;  2EPF A;  1XCV A;  2HVQ A;  3LSR A;  1FPQ A;  1RZ4 A;  3L09 A;  3ZGK A;  1R9T J;  4U0Y A;  2NS0 A;  3BTJ A;  2QSH X;  1P7I A;  1U0J A;  4D7M A;  1V5F A;  2MSY A;  2QQ9 A;  3F8M A;  5GAG J;  3BR5 A;  3QYB A;  2CFX A;  3WG7 H;  5E8I A;  1IF1 A;  2KL4 A;  2EA4 A;  1YW9 A;  4E6K G;  1OLT A;  2DOA A;  1TT5 B;  3BPV A;  4QBN A;  1XD7 A;  2E7X A;  2Y0S N;  2CH0 A;  2JRT A;  3SDG A;  1D3Y A;  2BY3 A;  2KFD A;  3LFU A;  2JPB A;  3P9K A;  5J1R A;  1VZ0 A;  2QSG X;  1DGW Y;  1JGS A;  4H4K C;  2OCE A;  2QYO A;  4L0Z B;  2ID3 A;  1LFP A;  2F5V A;  2D2W A;  1I3A A;  3D1N I;  1W5C C;  3K1P A;  4LB6 B;  2EZK A;  1TTY A;  2Y0M A;  4CZC A;  5HDN A;  1HDP A;  4LQE A;  2IGN A;  2IGM A;  2OU2 A;  3VSL A;  1TZL A;  1MMG A;  4BXU A;  2V6C A;  1LNW A;  4RGX A;  2FML A;  1XMX A;  2W57 A;  5F64 A;  3BJO A;  3LSH A;  2LKP A;  2VQL A;  4EM2 A;  4G6D A;  1JKP C;  2DYS H;  2P5K A;  4BBS J;  4AIJ A;  2CFO A;  3C3W A;  2ZB9 A;  5B1A H;  2DA7 A;  2K7L A;  4G7H F;  1QVT A;  1FOW A;  2HYF A;  1LVK A;  4YIF A;  4XOR A;  3L2R A;  3EET A;  4N4N B;  2X1C A;  3V7R A;  4DYQ A;  1RES A;  2R5Z A;  3PO2 J;  1FY7 A;  2E5N A;  4JK1 X;  2FBH A;  4A69 C;  1LDK B;  4ZC3 A;  1HC8 A;  3PNY A;  1MSE C;  2L02 A;  1HST A;  3DPL C;  3NWT A;  4WXH A;  1UEL B;  2A6E F;  2IGO A;  2EFN A;  1K4S A;  1KQ9 A;  2MFZ A;  5ILS A;  4M3E A;  5J1U A;  5HVQ C;  3BY6 A;  4BY7 J;  1FP2 A;  4E7Z A;  3GO5 A;  1WJA A;  1Z0X A;  4HG2 A;  3SEQ A;  5ILV A;  1IJW C;  4BJ6 C;  2O8K A;  3CUQ C;  2LH9 A;  2V9V A;  3CUQ B;  1STZ A;  3B6A A;  2O7O A;  1XGS A;  1HKT A;  1XB4 A;  1T6S A;  2WC2 A;  1ETK A;  2KHM A;  2W48 A;  3EQL F;  3MAJ A;  4XLH A;  1PJR A;  5A2Q Z;  1OCP A;  2JJQ A;  2XKO A;  2KMU A;  4UUT A;  5EEA A;  3T0Y A;  3S16 J;  2VPL A;  1QPI A;  4E7J A;  3CMA I;  1TQI A;  2BE5 F;  1Y1O A;  2K86 A;  5LD2 C;  3PO3 J;  4IRG A;  2CQN A;  4OAZ A;  4XIC A;  1FYM A;  4LJZ F;  1HH1 A;  4S0H B;  3VYR B;  1SD6 A;  2BYV E;  3LOC A;  2OZU A;  1TW3 A;  3GF2 A;  4ZJZ A;  2EBI A;  2K9L A;  2OQG A;  2L7Z A;  4XL9 A;  2LF7 A;  2E1C A;  3PQK A;  4HAM A;  2B63 J;  3BTL A;  2PLY A;  1XCB A;  1BA5 A;  3DEW A;  1W5T A;  2VKV A;  2WY8 Q;  2ZJR F;  3AL0 C;  2KDZ A;  3AL0 B;  2AQE A;  4BDZ A;  3S1N J;  3WTU C;  2FF4 A;  4A12 A;  4BNC A;  5HNF A;  3O6B B;  4EM1 A;  1NH3 A;  1A6I A;  3ZR8 X;  2FJ1 A;  1Y8R B;  4ZDP A;  4E7I A;  1YHQ I;  4ZZL A;  3DTE A;  3HRU A;  2NOG A;  4CCL A;  4F7Z A;  1X58 A;  3IH2 A;  2TRT A;  3TO9 A;  3H5A A;  2VLA A;  2ADU A;  2F2E A;  5EYR A;  3KP4 A;  2DFF A;  1VQ4 I;  3K4M A;  2NVY J;  2XGD A;  4TKK A;  1DUX C;  1YFH A;  3F3X A;  3MWM A;  2STW A;  3OS2 A;  3HPH A;  4QIW N;  1KGS A;  1Z7U A;  5CVV A;  2ZFU A;  1D0X A;  2K5C A;  4MQ9 F;  4N9I A;  3IEY B;  3IV5 A;  3HYI A;  1Z21 A;  4F55 A;  1MIJ A;  2CJJ A;  1S7E A;  2DMU A;  3L9F A;  2VJI A;  4P1W A;  1W36 D;  5CQE A;  4V19 K;  2QSF X;  2NAZ A;  2RVC A;  1YI2 I;  4BL0 B;  1X4P A;  3NQO A;  2NVQ J;  5ILU A;  3MZH A;  1ETV A;  3FK6 A;  3VWB A;  2HWV A;  2DPU A;  2PBI A;  3QAH A;  5TJJ A;  3WHC A;  3FIS A;  2LY2 A;  3SZP A;  4XKV A;  2EIM H;  3R0J A;  2QEN A;  4DA2 A;  1WKM A;  2ZXW H;  1AWC A;  2OKF A;  1QZY A;  1REP C;  2BW3 B;  1ZRC A;  5IY5 H;  3J81 Z;  1W36 C;  4BE2 A;  5EJC A;  3OYK A;  1UG2 A;  1N25 A;  2EIN H;  4RGR A;  3KZI C;  3H9J A;  2L54 A;  2V1X A;  5FKN A;  4BEH A;  2O6G E;  4S05 A;  1HQC A;  3ZMD A;  1E3P A;  2E7W A;  1GV2 A;  5D4R A;  1RLV A;  4M72 A;  1GUU A;  2GJW A;  4M71 A;  2HXI A;  4B47 A;  2EV6 A;  2W25 A;  4G9Y A;  2COB A;  4CH7 A;  5E3O A;  3HG9 A;  4BE1 A;  5H6R A;  5FJ8 J;  2HDC A;  1UAA A;  4DZJ A;  3HRM A;  4CO8 A;  5E18 F;  1EF4 A;  2HI3 A;  3SHF A;  1WSU A;  4QPO A;  3RKY A;  1B4A A;  4AYB A;  5FRN A;  2LF8 A;  3FBI B;  2DOD A;  3I4M J;  1FLI A;  3I54 A;  4HDV A;  1VF9 A;  3IWZ A;  3R4K A;  4EV0 A;  5DDG A;  1UST A;  2OUM A;  2XVC A;  1MBH A;  3BZC A;  4FTH A;  1AOY A;  4NQW A;  3M4O J;  4B43 A;  1T33 A;  3VOD A;  2ZJP F;  2P7V B;  2FRH A;  1V55 H;  3HKZ N;  2DBB A;  3M3Y J;  2E2J J;  2CSO A;  2DT5 A;  1SVM A;  5FLX K;  3M7G A;  3Q9S A;  1GHC A;  3JRA A;  3MCZ A;  3HUG B;  4CCK A;  4A0X A;  1W7P A;  3V8L A;  3HL2 A;  1KU9 A;  2KRC A;  4M6V A;  1UHM A;  4ZH4 F;  5GTH C;  1YQA A;  5C4J J;  3OYG A;  5M5X J;  4AYB N;  4DYR A;  4XLC A;  1CF7 A;  2GXB A;  2R7S A;  3BJA A;  3JRF A;  3H92 A;  5HOO A;  2WCW A;  2CUF A;  3K10 A;  4ABZ A;  5HDK A;  4D0P A;  4L18 B;  2L7K A;  2HU9 A;  2DQR A;  3HOV J;  1H9T A;  2IPQ X;  2JA7 J;  4AVZ A;  3U1D A;  3G73 A;  3M1E A;  1YE9 A;  4IHX A;  1W0T A;  4PJM A;  3ABM H;  2R7W A;  1VQ5 I;  2VS1 A;  3A1Y A;  4HDU A;  5KHD A;  1WJF A;  2DI3 A;  3WGI A;  1SAU A;  2QKL B;  1VQ8 I;  2VQG A;  4XN0 A;  1U3E M;  2XAG A;  3JRE A;  2DA4 A;  1MBK A;  2MLG A;  1XX5 A;  3A2K A;  3GZ5 A;  2JUG A;  3GTG J;  1OJL A;  3VEP A;  5DCM B;  2GQQ A;  2EFQ A;  2EQR A;  2H09 A;  4N9H A;  1SD7 A;  3CMY A;  1HKS A;  2FNP A;  4EV1 A;  3ROU A;  4RGU A;  5BQT A;  2A05 A;  4UVA A;  1A36 A;  4ENM A;  3IRR A;  3ZCO A;  2DA2 A;  4XM3 A;  5EGO A;  2OQR A;  2ME0 A;  5M3M J;  1EA3 A;  3RTR A;  1KYZ A;  2QBY B;  1JUP A;  1XGO A;  1BR4 A;  5LBQ A;  4U87 A;  4B44 A;  3RI4 A;  2L0K A;  3DPT A;  4DAV A;  4BGD A;  2WJ0 A;  2XF7 A;  4XOP A;  1GDT A;  1LEA A;  4BXX J;  2BXZ A;  3S17 J;  2L7M P;  3CCV I;  4LIT A;  3J7Y J;  1R71 A;  3LSJ A;  1R4M B;  2LC2 A;  4PJJ A;  5AON A;  3M8F A;  3RZD J;  4IEJ A;  4NC8 A;  1XGN A;  2IBD A;  3LNQ A;  2FQ4 A;  5CQG A;  4ZYA A;  5D8K B;  3PL8 A;  1B8I B;  2HOS A;  4ESB A;  5HLI A;  2HQN A;  1O7F A;  1WVR A;  3ECO A;  3ZPL A;  1XN7 A;  1ORK A;  2V26 A;  4IRH A;  2M2E A;  2QQ8 A;  3KIO A;  2PMZ N;  3K1M A;  5LRR A;  2CRG A;  2HTS A;  4PZJ A;  3F21 A;  4TV7 A;  1WI9 A;  2GIZ A;  3GVA A;  4Y17 A;  3BDD A;  2Y2Z A;  5ICC A;  3OL4 A;  4KIT B;  4I76 A;  4QTR A;  2M0M A;  2CV8 A;  3IP4 B;  1KA8 A;  1K61 A;  3N05 A;  5IOZ A;  1PUE E;  1G59 A;  1ETO A;  4I0A A;  2KDO A;  2H8W A;  5F1R A;  5IT3 A;  2E1N A;  2MLK A;  1K83 J;  3FXK A;  3MD2 A;  3FXR A;  3KYC B;  2CW0 F;  2LBF B;  2Y48 A;  3CP2 A;  1IZ1 A;  5CVJ A;  1YO5 C;  1E3O C;  2YSR A;  4L5J A;  3BJ6 A;  4BKX A;  2AO9 A;  4TKD A;  4CSW A;  2YX4 A;  3NRV A;  2IS2 A;  4BU2 A;  3TED A;  2YPR A;  1G6N A;  2W82 A;  3KPH A;  2JA5 J;  3DBL B;  1WH7 A;  3L1P A;  2ZYZ B;  1IO2 A;  2DA5 A;  1YIT I;  3CUQ A;  4RBO A;  1LFU P;  1H9G A;  1OYW A;  2OC6 A;  1U8R A;  2XKP A;  4IXA A;  3TDU C;  3LQR A;  5GPC A;  1MDM A;  1R0V A;  1YW8 A;  1JHF A;  1TQM A;  4WK8 F;  3DTI A;  2CQX A;  3KLO A;  4KIF A;  2JVG A;  1S5L C;  3ZN1 A;  3MZ8 A;  3ZMS A;  2V1U A;  3HEF A;  1WHU A;  1V5E A;  3H3U A;  6PAX A;  2CWE A;  4I01 A;  2XRL A;  4EJU A;  4RM3 A;  1IUY A;  3EDP A;  1QHH D;  1IDZ A;  2BXY A;  3GCM A;  3M8E A;  2LR8 A;  4M9Z A;  2EIL H;  5L3G A;  2XPV A;  4Z2Y A;  3LQQ A;  3QPT A;  3CCS I;  5GAD J;  3OSG A;  3GBG A;  1AKH B;  5CLS A;  2I8D A;  2OV7 A;  1JT0 A;  1D8K A;  1TC3 C;  3TGN A;  3UNG C;  1UFM A;  3FHN A;  1U2W A;  3H36 A;  3K6G A;  3GX4 X;  3UKG A;  2IGK A;  4CCO A;  1W5S A;  5IPA A;  4M6Y A;  2NVT J;  2WWY A;  2Q1Z B;  5DS9 A;  1F5T A;  4RGS A;  1XSV A;  4EJO A;  2AXT C;  5IP9 J;  2DLL A;  1D0Z A;  1YS6 A;  3S3M A;  2L9N A;  4ANJ A;  2I10 A;  2YUS A;  3GME A;  5LGN A;  2ID6 A;  4L9V A;  2VOO A;  3K70 D;  1N78 A;  5D5W B;  1J2X A;  3E5U A;  4NB5 A;  2KIS A;  4M73 A;  5JI6 A;  4A3I J;  1X3W B;  1U9O A;  1MH4 A;  3DV8 A;  3RKW A;  4KIB A;  4PJL A;  1DP3 A;  3K7A J;  3OYI A;  1WJB A;  2L9R A;  3F22 A;  2HGC A;  2WY7 Q;  2CV2 A;  4IPA A;  2G0E A;  2HXO A;  5ICG A;  4LLN A;  2RGV A;  4BAY A;  1N77 A;  2X51 A;  5FKM A;  1FSH A;  1S9H A;  3W2A A;  3SFI A;  1WZ2 A;  4A3L J;  1YRN B;  3EPZ A;  4PSX A;  1B1B A;  1FEX A;  2GOM A;  3IEY A;  1ZAO A;  3K70 C;  3QP5 A;  1YOV B;  4GFB A;  2HPI A;  2XAJ A;  2DJN A;  1LDJ A;  1LUJ B;  2Z5U A;  2HQA A;  2K85 A;  3OYN A;  4PSW A;  2M0C A;  3COA C;  2OD5 A;  2E1M C;  2Q2E B;  1XPX A;  2E1M B;  2QKM B;  3NWS A;  3KX2 A;  1HXD A;  2ZSI B;  2KJC A;  2IA1 A;  5LRS A;  3G1O A;  2EZI A;  3CJT B;  2R7T A;  2UV1 A;  2RKH A;  1BJZ A;  2QLZ A;  4QBO A;  4JX5 A;  2VBZ A;  1WI3 A;  1FYK A;  3IKV A;  1Y1V J;  1P9Q C;  2HYJ A;  3F8B A;  4A5N A;  2QEX I;  1IC8 A;  1HDD C;  2AHQ A;  3GYH X;  4L9J A;  4V2F A;  1QQI A;  2P0W A;  4XLE A;  3JRG A;  1Z77 A;  5F6F A;  2BW3 A;  4UUS B;  1BC7 C;  3BG7 A;  1S8N A;  3OYH A;  4J01 A;  1XSX A;  2QVO A;  4MTE A;  1BI0 A;  2UXX A;  3RIR A;  1MMS A;  5E20 A;  3JRB A;  4UUV A;  1P2F A;  4OU0 A;  4C9Y A;  2O0Y A;  1Y1W J;  5CYV A;  3GFI A;  3LSI A;  4OIQ F;  2HS5 A;  3BG9 A;  1RUN A;  3X2Q H;  1W7P D;  1Z3X A;  4FHT A;  2PMH A;  4Q47 A;  2DAO A;  3E6M A;  1MSF C;  3SDB A;  4PFO A;  4LK0 F;  2NVX J;  5TRD A;  4BHB A;  4IZZ A;  4A3D J;  5DTD A;  2QUF A;  3G1L A;  1K6O A;  1JXS A;  1T98 A;  3FXU A;  1Z6R A;  4B8X A;  1OCO H;  4HRI A;  1POG A;  2QGU A;  2ZO4 A;  1T95 A;  3IKT A;  2GA2 A;  4LG3 A;  4R1H A;  4L9T A;  3FXL A;  1A04 A;  2X6X A;  1UB9 A;  1WJC A;  1YJW I;  3ZMZ A;  1BI1 A;  4IJA A;  2VT2 A;  1R1V A;  3WTW C;  5D5U B;  3U21 A;  1VFC A;  1YNM A;  1I5Z A;  1XMA A;  3S2D J;  5FFX A;  3LFK A;  4RAF A;  2ZNZ A;  1BW6 A;  1UCR A;  3ZMT A;  3HUG A;  1BL0 A;  4EQQ A;  4XKW A;  3BPX A;  5K7Z A;  1VQK I;  3LMM A;  5E3M A;  2EIJ H;  5FO5 A;  2V9K A;  4RLQ A;  1FYL A;  3L2W A;  5B66 C;  5LLQ A;  3E7L A;  1JJ6 C;  3HRT A;  2XDV A;  4CIC A;  1FMV A;  1TWF J;  5FLX Z;  5LEJ A;  1UG0 A;  3MKY B;  3HSE A;  1QZZ A;  4CYD A;  1LJ9 A;  2E35 A;  1OCC H;  1FOX A;  1ZGJ A;  3AG4 H;  3OWT A;  2YX7 A;  1WJD A;  4OWR B;  2L9V A;  3F0C A;  3DKW A;  5EG0 B;  2VKE A;  3OYA A;  2RDP A;  2Y0S A;  4PJ0 C;  4ZTJ A;  4E7L A;  2A6H F;  5AIP A;  1SAN A;  4PK4 A;  4G12 A;  3ZOB A;  1FC3 A;  2W84 A;  4GYG A;  4EGY A;  4R8H A;  2NNY A;  1P4A A;  1KQ8 A;  3CF5 F;  1S72 I;  1RC9 A;  4A5M A;  1B6A A;  2K3P A;  4XRF A;  1IRG A;  1DQU A;  2LDU A;  3DFG A;  2P5L C;  3ZQC A;  2Z1D A;  4JX6 A;  3PFI A;  4AVP A;  1GT0 C;  5JHF A;  4IVN A;  3DNX A;  1MD0 A;  4HA8 A;  3IL2 A;  4PGG A;  2L4A A;  2DFH A;  3EUA A;  3GFM A;  4FT8 A;  2FEZ A;  3PNV A;  2FU4 A;  3QPS A;  2QBY A;  2H6B A;  2W8M A;  2NXN B;  1G3W A;  2E1O A;  3GLX A;  3O2P E;  1ZQ3 P;  3H5R A;  3GW2 A;  3D5S C;  1UZC A;  3KP2 A;  3CC2 I;  2WIZ A;  5FKO A;  2F5F A;  3HPG A;  1TWH J;  1T8I A;  1R11 A;  2VAS A;  2GAU A;  2HQ5 A;  2BHY A;  1X3U A;  1BW5 A;  1Z67 A;  2JA2 A;  2A5Y B;  1VTN C;  4NHJ A;  3SXY A;  2KRF A;  4LLG F;  2LNB A;  4F52 A;  4A3C J;  1WH5 A;  1B8I A;  2DCE A;  2HKX A;  2H27 A;  1MNE A;  3F23 A;  2VUM J;  2Q8K A;  5ERI A;  2D5V A;  3EYI A;  1FIA A;  2UZK A;  3FX3 A;  2FSW A;  3VYT B;  2OCC H;  4W1U A;  3RJP A;  3F8N A;  1Z7L A;  2PX9 A;  2PJR B;  1D1C A;  1O3R A;  1DGR M;  3RQ4 A;  3KEQ A;  2F4I A;  3WTY C;  4WWC A;  2WB1 A;  2DOF A;  3LA3 A;  4XLN F;  2R7D A;  4QLC U;  4Y52 J;  1D0Y A;  4RMN A;  5IT9 K;  1S7O A;  3K2A A;  4I02 A;  5KAI C;  3DWL E;  1B9N A;  1XC5 A;  1NG7 A;  1EH6 A;  4H0E A;  4HW0 A;  1HSJ A;  3G4S I;  5BMZ A;  2R7O A;  2LBF A;  1DDN A;  2P4W A;  3BG5 A;  1FOK A;  3RDI A;  2GZW A;  4NNJ A;  1ETY A;  3I0T A;  2JVH A;  5J40 A;  1PDN C;  1TNS A;  2DU9 A;  3J7Z I;  3JRH A;  2L01 A;  1MGT A;  3I55 I;  1PP7 U;  1U6G A;  2CUZ A;  2ZYZ A;  4BS9 A;  2DDB A;  1SD5 A;  4JBA A;  2WB1 N;  1R36 A;  1R49 A;  1K79 A;  2CQQ A;  2XPW A;  5DCF A;  2VON A;  2M7A A;  4F91 B;  2E19 A;  3KYL A;  1ON2 A;  2E60 A;  2L7F P;  2E71 A;  1ZR2 A;  1M1E B;  3CTA A;  3MEX A;  3QYE A;  2PG4 A;  1MNM C;  1KON A;  2EV5 A;  3PJR A;  1JE8 A;  4DBR A;  5E1X A;  4BJT A;  2ZKZ A;  1GV5 A;  3OYL A;  1AKH A;  4KNY A;  2DOE A;  3R60 A;  5EDN A;  3SQN A;  1D8J A;  3QPL A;  4HX4 A;  2H8R A;  3V7C A;  2V6E A;  1FIP A;  1HBX G;  1I1G A;  3PSF A;  1EJ9 A;  2KIU A;  3ZXS A;  4B3A A;  2VBX A;  2X48 A;  5CJ9 A;  4ZYH A;  1YJ9 I;  3PUF A;  5HS7 A;  3T8T A;  1FNN A;  2LG4 A;  2QQA A;  3CES A;  4HST A;  3QWL A;  5DYM A;  1QNT A;  3WTV C;  1D1B A;  3CCU I;  3WGH A;  2VN2 A;  3S2H J;  4XSZ F;  4V2G A;  4AU7 A;  1OIS A;  1MJA A;  1SFE A;  4M3B A;  1K7A A;  3QOD A;  4P5O A;  5J4Y A;  2DN0 A;  2VE9 A;  1YIO A;  4HLY A;  5IYC J;  3JAM K;  3CCL I;  4YFN F;  3WTT C;  2KQR A;  3JRD A;  2L3D A;  2KZV A;  4U0W A;  4U88 A;  1NHA A;  3ZQH A;  2P8T A;  2FMY A;  2IAI A;  5FD6 A;  2JQ7 A;  1LEB A;  1AHD P;  2F5C A;  5K5R A;  2QZ8 A;  1YRN A;  1R58 A;  1Z05 A;  2LMD A;  2ELH A;  1BR1 A;  2DXI A;  1R00 A;  5LEK A;  4OMZ A;  2DPD A;  1JGG A;  3W3C A;  3PSI A;  2F6C A;  1KU7 A;  1TQP A;  2R7F A;  3M1C A;  3TO6 A;  3FOV A;  1ZYR F;  2VBW A;  2WAQ N;  1IRX A;  5DM7 F;  2Z0R A;  2Q2E A;  2FKC A;  1H8A C;  3JRI A;  2F4O B;  4XRM A;  2K4B A;  4OMY A;  1V5G A;  4DYC A;  1BJA A;  5FB2 A;  4HEA 2;  2QWW A;  3EUH C;  3VOE A;  5L3F A;  3PIO F;  2YS9 A;  5HLH A;  5HOD A;  4I6Z A;  1D5V A;  1YTY A;  4CA0 A;  1X3Z B;  4M9X A;  3FXM A;  3ASN H;  3RSN A;  1RI7 A;  3TP0 A;  5DV5 A;  2X85 A;  4KFC A;  2VKD A;  4IHW A;  3HJE A;  4HOB A;  4MQV A;  3H0G J;  4UUS A;  4CCN A;  2LLK A;  3HKZ A;  1SAX A;  4HPQ A;  3K4C A;  4O6J A;  4XRS G;  4EGZ A;  5BPD A;  3FM5 A;  3GTP J;  3OYM A;  4II3 A;  3JRC A;  1L0O C;  3K9T A;  2MG4 A;  3RYP A;  2FLC A;  2AQF A;  2RNJ A;  1T0F C;  3BLY A;  2DQL A;  3FMR A;  4MEY F;  3ABT A;  3PFY A;  3QQA A;  2IS1 A;  5EZH A;  2P6S A;  2BV6 A;  3JW4 A;  4KMF A;  1SEU A;  2WAD A;  3TBI A;  2EV0 A;  3OYC A;  5FRM A;  2Z33 A;  5M3F J;  4E7S A;  2FKH B;  3FMQ A;  1VI0 A;  3SYT A;  4A3M J;  1QPM A;  4BJ5 C;  1MBF A;  1ZEL A;  2HEO A;  4OIP F;  4MEX F;  2NNN A;  4B1R A;  2F4M B;  3HOY J;  2VIX A;  3IC7 A;  5DUK A;  3P1Z A;  3F9K A;  2RQP A;  2EA2 A;  5FRO A;  1S29 A;  4D1Q A;  1Y56 A;  4J00 A;  1MMA A;  1TLH B;  1Z6T A;  2G7H A;  3ABU A;  4KUM A;  3J7A O;  2CZR A;  4UNO A;  3C2G A;  3KFW X;  3S32 A;  1I39 A;  3HGY A;  2NYX A;  2H1K A;  2K3F A;  1RKT A;  4PJN A;  3TOB A;  3HB9 A;  3I58 A;  5ICF A;  2F48 A;  1O3T A;  1WGX A;  3E6D A;  2Z2S B;  2ZCW A;  4FET A;  4Q48 A;  3DEE A;  5CVR A;  2DJI A;  1R4N B;  2R7U A;  2TCT A;  4WXD A;  3HIF A;  3I59 B;  5JLX A;  4HNU A;  2BY1 A;  2WA0 A;  5EF6 A;  3PQJ A;  4ASN A;  1BM9 A;  5FFZ A;  3K2Z A;  4DW6 A;  4A3B J;  2A5W A;  2O8X A;  3IAS 2;  4KYW A;  2MC4 A;  4P55 A;  4A3F J;  2D1V A;  2OJE D;  3W6J B;  3LAJ A;  5J4V A;  4DZP A;  5GTI C;  1FWZ A;  3C2H A;  1I6H J;  3VFZ A;  2EFO A;  4HNV A;  3G71 I;  1FZP B;  2WV1 A;  5EG0 A;  5TGT A;  5K7F A;  2HOA A;  4M74 A;  4FCY A;  4U7B A;  4ENJ A;  1J09 A;  3VDX A;  1KYW A;  4GDF A;  4A93 J;  5HS8 A;  1RZN A;  3SZG A;  4Y33 A;  2RV8 A;  1H0M A;  2R7Q A;  3WG9 A;  2CUJ A;  3FDY A;  2DYR H;  5J1Y A;  1HKQ A;  1B9M A;  4LG0 B;  1WJE A;  3CDH A;  2RN7 A;  4BH9 A;  3QP6 A;  3K4L A;  3Q0V A;  3FKI J;  2RQQ A;  2XAS A;  4LD5 A;  2XAU A;  2Y30 A;  2HDW A;  2MYS A;  2OF7 A;  3QYF A;  3R6S A;  3V42 A;  1QRY A;  1VQ7 I;  1IPI A;  1TT0 A;  3UR3 C;  1G8X A;  2PMZ A;  2V9P A;  2W00 A;  1DPU A;  2IA0 A;  4HBL A;  1R23 A;  5J8C A;  2CS3 A;  2R93 J;  4ENN A;  3S15 J;  2R7X A;  1ETX A;  3CDI A;  3CO7 C;  1T38 A;  4XN3 A;  2GIV A;  5JHU A;  3R61 A;  3C18 A;  2A07 F;  1A6Q A;  4XR6 A;  5KAF C;  1JT6 A;  4HZF A;  2Z16 A;  1SVO A;  5DUI A;  3JR9 A;  5LHH A;  4BQA A;  3ZQG A;  2KP6 A;  2HNH A;  3KLN A;  2JMW A;  5BPI A;  3HXL A;  3QOP A;  1ETW A;  1P92 A;  1QO0 D;  5E3L A;  4DIQ A;  4RB3 C;  3BG3 A;  4E7H A;  2L2O A; 
#chains in the Genus database with same CATH homology
 3F6V A;  5D4S A;  1O3Q A;  4KMU X;  2BEO A;  2ZFW A;  3I53 A;  5L3D A;  3SZT A;  2IRF G;  1SMY F;  1OKR A;  1TW2 A;  4GCV A;  4DNC A;  4UHT A;  4LGW A;  4IHS A;  1GXQ A;  4PCQ A;  2R3S A;  4KDP A;  1TBX A;  2RC4 A;  1LVA A;  3TKY A;  4EVI A;  3QU3 A;  1R22 A;  4HQE A;  1OB9 A;  2XHK A;  2K27 A;  5IT9 Z;  4WCG A;  5KK1 A;  1FX7 A;  4DAP A;  2PMU A;  1MZB A;  2XRO A;  3KP7 A;  2QM3 A;  2XAF A;  4O5V A;  1ZN2 A;  2HFH A;  5D5X B;  2XAQ A;  3KZZ A;  5D6F A;  2Q0O A;  3AAF A;  1V4R A;  4OIO F;  1B59 A;  4CHU A;  2FBI A;  2ESN A;  4IHT A;  1K78 B;  3F8C A;  1YW7 A;  5DEQ A;  5KVR A;  3MFK A;  5D8L B;  2ACJ A;  1Y88 A;  1YLF A;  1ZG3 A;  2FXA A;  4G94 A;  5K5Q A;  3I64 A;  3FWE A;  4ESF A;  2X0L A;  1XDS A;  4GO1 A;  4K2E A;  2M1B A;  2ZXJ A;  1ZRD A;  1HW2 A;  1G3T A;  1IW7 F;  4MHG A;  4UV8 A;  4OIR F;  3R0A A;  3I4P A;  3JAM Z;  2BBY A;  1WRJ A;  2PFB A;  3T8R A;  3WTZ A;  2VXZ A;  4MNU A;  2PN6 A;  3EUH A;  4A0Y A;  2FCO A;  1FBS A;  1IN8 A;  1ZAR A;  1LB2 A;  4ETS A;  1MJ9 A;  3FF5 A;  3CUO A;  3KP6 A;  2V79 A;  4RB1 A;  3E6B A;  2JSC A;  3DF8 A;  3ZN0 A;  2M45 A;  2EO0 A;  4RAZ A;  4XBF A;  5BS6 A;  2CYY A;  1S6L A;  2K02 A;  1T0F A;  2KIM A;  3HSF A;  3C7J A;  3N97 A;  2QQB A;  1YYV A;  4B09 A;  4RAY A;  2OAZ A;  4I98 B;  4ZYE A;  2DFI A;  1E17 A;  2JT1 A;  1FP1 D;  3L7W A;  4AIH A;  3ZMV A;  3GFL A;  3GEZ A;  3GWZ A;  4U7D A;  1WQ2 A;  4N0B A;  1SFX A;  2MD5 A;  2M30 A;  1E2X A;  3FZV A;  3GUD A;  4BHC A;  1MJB A;  1FBU A;  1BN5 A;  2ISZ A;  3P9I A;  3RKX A;  2XIG A;  5LGU A;  3I59 A;  2O3F A;  2VC0 A;  1P4W A;  3LA2 A;  3V8J A;  3D0S A;  1UHW A;  5LHG A;  3WU1 B;  1J7K A;  1UWV A;  4EMS A;  1P4X A;  4I0B A;  5DCM A;  2OBP A;  5E8G A;  1I1S A;  1SD4 A;  1ON1 A;  1ZHF A;  1LQ1 A;  4LG0 A;  4U0V A;  4E6Z A;  1QBJ A;  2C6Y A;  3OOP A;  4KA4 A;  3KZY A;  2WIW A;  3F8F A;  1OB8 A;  5JR3 A;  1S7A A;  3H3Z A;  1FSE A;  2GXG A;  2FBK A;  5HDG A;  5J6X A;  3MQ0 A;  3WTX C;  2ZME B;  1XDU A;  3K1N A;  2XAH A;  3BT7 A;  3Q5F A;  1ZG1 A;  5LGT A;  4S04 A;  3ECH A;  2WV0 A;  3V4G A;  3I71 A;  3OV8 A;  2AS5 F;  3V7S A;  3CLO A;  3K69 A;  2PJP A;  1IN6 A;  2HYG D;  4RS8 A;  5K1Y A;  3E3V A;  2XV4 S;  3B73 A;  2F5D A;  2VE8 A;  4HQM A;  4HF1 A;  2DBS A;  3C1D A;  2IVM A;  2A3S A;  4AD9 A;  3QPH A;  4YFX F;  3HSR A;  4A6E A;  1ULY A;  1G3Y A;  1KQ0 A;  3ISP A;  4R79 A;  3WTS C;  1TNT A;  3RPU A;  1BI3 A;  1USS A;  3FHZ A;  3DEU A;  2F5E A;  5J8F A;  1IRF A;  2IW5 A;  2PQ8 A;  3T1B A;  2YU3 A;  4DQ2 A;  4YG2 F;  3I5U A;  2STT A;  4EJW A;  2JZY A;  3P1Y A;  1GVJ A;  3U2R A;  2WTE A;  5AIQ A;  2FNA A;  1R1T A;  1J5Y A;  1QGP A;  4BYY A;  4QWQ A;  2COM A;  3BOQ A;  3F72 A;  1MDM B;  2O61 A;  3E6C C;  4OOI A;  2FE3 A;  1ZP7 A;  1OMI A;  2D1H A;  1C0W A;  1F9N A;  2VC1 A;  3QRF F;  1BI2 A;  4HX7 A;  4FX0 A;  2DO7 A;  3F6O A;  2W85 A;  3LWF A;  2FA5 A;  1OR7 A;  4L5I A;  2DK5 A;  4HX8 A;  1KU2 A;  1J75 A;  3JSP A;  2P5V A;  2IXS A;  3FM3 A;  1J59 A;  4GYI A;  5K5O A;  2GWR A;  1K78 A;  3AJV B;  4XSX F;  2XUB A;  3HOT A;  4PDK A;  1EV7 A;  1Z1D A;  2GA1 A;  4YII A;  3P9C A;  5FD5 A;  1ZRF A;  4KN4 X;  1WWX A;  3WE2 A;  1DPR A;  3HOS A;  4UV9 A;  4IRI A;  2M5W A;  2OA4 A;  1P6R A;  2L4M A;  1IN5 A;  3MZY A;  4O3M A;  2KKO A;  3J80 K;  4QBL A;  1R1U A;  1A79 A;  2CGP A;  2NRA C;  1ZG5 A;  3IHU A;  2MBF A;  5FGM A;  4AIK A;  3HHH A;  2MC3 A;  4P96 A;  3HHG A;  5E1Z B;  4G8X A;  3LAP A;  3GZ6 A;  2Z99 A;  3V8K A;  2CO5 A;  4AWX B;  3HTU A;  5H20 A;  3L00 A;  1XMK A;  3ZP5 A;  2EFP A;  2EB7 A;  5H6Q A;  1DP7 P;  2XRN A;  1SFU A;  2FOK A;  4G6V A;  1ONV A;  1YS7 A;  4JQF A;  4CGZ A;  2ZJ2 A;  2EJR A;  1RUO A;  3KP5 A;  4G6U A;  4EJT A;  1BC8 C;  2P6T A;  3KP3 A;  4HV6 A;  1SMT A;  3D5L A;  5ICE A;  5E1W A;  4I2O A;  1HW1 A;  4ON0 A;  4ESJ A;  3IF0 X;  3WU0 A;  3G3Z A;  2Z9O A;  5EEH A;  3HTS B;  1ZH5 A;  2ETH A;  3TQN A;  2OST A;  4UVC A;  1S3J A;  3CJN A;  4HF0 A;  5CVI A;  4Q4Z F;  2A61 A;  2A69 F;  2X4H A;  3E5X A;  3HRS A;  2A68 F;  4KIG A;  1T2K A;  2D45 A;  2J5P A;  3P7N A;  2O03 A;  4A0Z A;  4OIN F;  4HF2 A;  1IXC A;  3TOA A;  1RNL A;  4E70 A;  4LMY A;  5DD8 A;  1IXR C;  1R5H A;  2HTJ A;  1ODD A;  5HLG A;  2OZ6 A;  1RIO H;  3CO6 C;  4KIC A;  3FMS A;  3FXQ A;  1T39 A;  4ZQU A;  2J5O A;  2EFW A;  4A2U A;  3M9A A;  2W24 A;  1U5T C;  2XGX A;  2VOD A;  1U5T B;  3RYR A;  2UWM A;  1YG2 A;  1XGM A;  1I6X A;  4FX4 A;  3BZ6 A;  1J9I A;  5BOX A;  1FT9 A;  1W4M A;  1GXP A;  2ZNY A;  5ED4 A;  2FQ3 A;  2HR3 A;  3RPQ A;  1FBQ A;  2ZME A;  4RB0 A;  1O7L A;  4MTD A;  4IF4 A;  1ZLK A;  1CGP A;  2V1D A;  5HS9 A;  2H94 A;  3Q9V A;  1BIB A;  2KJB A;  4M6X A;  3DXJ F;  3GFJ A;  2ZBK A;  3O3K A;  4Q5S F;  4I09 A;  2HOE A;  2MA3 A;  1O57 A;  2IP2 A;  3LST A;  3SFZ A;  1V3F A;  3GXO A;  3U9G A;  2TDX A;  2VBY A;  1U78 A;  3EYY A;  4ZYG A;  3NEU A;  2PI0 A;  4BHP A;  1GEF A;  5A2Q K;  4WF2 A;  2ISY A;  4XLP F;  2VT3 A;  2KIF A;  2P7C B;  2K4J A;  5L3C A;  4Y13 A;  3LA7 A;  4LK1 F;  3VB2 A;  2YR2 A;  2Y75 A;  2HQR A;  4HYE A;  1I27 A;  4UVB A;  5D6E A;  3QU6 A;  2BGC A;  4G7O F;  1PP8 F;  4WXC A;  2IT0 A;  3KE2 A;  2B0L A;  1OYI A;  2WCZ A;  3TDZ C;  1Q1H A;  2IA2 A;  4GXO A;  4EJV A;  4G7Z F;  3T5X A;  3E5Q A;  2VLD A;  2VOP A;  1IXS B;  2Z3Y A;  3JSO A;  4PGH A;  4Y15 A;  4ENK A;  1O3S A;  1Z91 A;  4L9N A;  4CZZ A;  2LSO A;  3AJV A;  1R5G A;  3WGG A;  1ZRE A;  2HZT A;  3S2W A;  3ZQ7 A;  3IRQ A;  1R7J A;  4M9S A;  1EH8 A;  1IN7 A;  2INB A;  1BBY A;  3B02 A;  2IJL A;  5EEG A;  1F1Z A;  1KU3 A;  4GGG A;  1ZGA A;  2G7U A;  3WE3 A;  4I7H A;  5L3E A;  2M87 A;  3BRO A;  5JVT A;  2EWN A;  1J0R A;  2BH2 A;  3L2C A;  2DK8 A;  3KCC A;  3J81 K;  5DD4 A;  3ML6 A;  5JFR A;  5CVU A;  2UXN A;  3J80 Z;  2EK5 A;  3K0L A;  1Y0U A;  4ZYD A;  4A6D A;  4KT5 C;  2G9W A;  1G3S A;  1EH7 A;  1ZLJ A;  2H6C A;  3IWF A;  5FDK A;  3TO7 A;  2JTV A;  5E17 F;  3ULQ B;  4HV5 A;  3N4M A;  1F4K A;  4YFK F;  3REO A;  1OYY A;  3ERE D;  2MH2 A;  4LB5 A;  4HLX A;  5LHI A;  1JHH A;  3DP7 A;  2DTR A;  1BIA A;  4LLL A;  3BWG A;  4WX9 A;  2M8E A;  4LFU A;  2AXL A;  2MH9 A;  2HKO A;  1G4D A;  2FL3 A;  2GW6 A;  4G6Q A;  3W6K B;  4CDG A;  1LDD A;  1Z9C A;  1MKM A;  5L3B A;  3P1Z B;  4EM0 B;  1W7P B;  1IN4 A;  3WOD F;  1IAW A;  3KET A;  2DW4 A;  1CF7 B;  2CQK A;  2CG4 A;  3JTH A;  1XSD A;  4P9F A;  4RB2 C;  3KEO A;  4ZZD A;  5D5V B;  3JTG A;  1OPC A;  3E97 A;  3ELK A;  1L3L A;  2ESH A;  4MGR A;  4P9U A;  3DQV C;  1HW5 A;  4L0Y B;  2PEX A;  4UXN A;  3ZMU A;  1BOA A;  1U5T A;  4KN7 X;  4CXF A;  2JPC A;  3BP8 A;  1XCV A;  1FPQ A;  1RZ4 A;  3L09 A;  4U0Y A;  2NS0 A;  2QQ9 A;  3F8M A;  1IF1 A;  2CFX A;  5E8I A;  2EA4 A;  1YW9 A;  3BPV A;  4QBN A;  1XD7 A;  2E7X A;  2JRT A;  1D3Y A;  2JPB A;  3P9K A;  1JGS A;  2QYO A;  4L0Z B;  2D2W A;  3K1P A;  4LB6 B;  1TTY A;  2Y0M A;  5HDN A;  4LQE A;  2OU2 A;  4BXU A;  2V6C A;  1LNW A;  4RGX A;  2FML A;  2W57 A;  1XMX A;  5F64 A;  3BJO A;  2LKP A;  4EM2 A;  4G6D A;  2P5K A;  4AIJ A;  3C3W A;  2K7L A;  4G7H F;  4YIF A;  2HYF A;  3EET A;  3V7R A;  1FY7 A;  4JK1 X;  2FBH A;  1LDK B;  2L02 A;  1HST A;  3DPL C;  4WXH A;  2A6E F;  2EFN A;  1KQ9 A;  5ILS A;  5HVQ C;  3BY6 A;  1FP2 A;  5ILV A;  3GO5 A;  3CUQ C;  2V9V A;  3CUQ B;  1STZ A;  1XGS A;  1HKT A;  1XB4 A;  1T6S A;  2WC2 A;  3EQL F;  3MAJ A;  5A2Q Z;  2JJQ A;  2XKO A;  3T0Y A;  1TQI A;  2BE5 F;  1Y1O A;  2K86 A;  4IRG A;  1FYM A;  4LJZ F;  1HH1 A;  1SD6 A;  2BYV E;  2OZU A;  1TW3 A;  3GF2 A;  2OQG A;  2E1C A;  2LF7 A;  3PQK A;  4HAM A;  2PLY A;  1XCB A;  1W5T A;  3WTU C;  2FF4 A;  4A12 A;  4BNC A;  3O6B B;  4EM1 A;  4ZZL A;  3HRU A;  4F7Z A;  3TO9 A;  2ADU A;  2F2E A;  3KP4 A;  4TKK A;  1DUX C;  1YFH A;  3F3X A;  3MWM A;  2STW A;  1KGS A;  1Z7U A;  5CVV A;  4MQ9 F;  4N9I A;  3IEY B;  3HYI A;  3L9F A;  2NAZ A;  2RVC A;  3NQO A;  5ILU A;  3MZH A;  2HWV A;  2DPU A;  2PBI A;  3QAH A;  5TJJ A;  3SZP A;  3R0J A;  2QEN A;  4DA2 A;  1WKM A;  1AWC A;  2OKF A;  1QZY A;  1REP C;  1ZRC A;  3J81 Z;  4RGR A;  2L54 A;  2V1X A;  2O6G E;  4S05 A;  1HQC A;  3ZMD A;  2E7W A;  5D4R A;  1RLV A;  4M72 A;  2GJW A;  4M71 A;  2EV6 A;  2W25 A;  4G9Y A;  2HDC A;  5H6R A;  3HRM A;  4CO8 A;  5E18 F;  3SHF A;  1WSU A;  3RKY A;  1B4A A;  2LF8 A;  1FLI A;  3I54 A;  4HDV A;  3IWZ A;  3R4K A;  4EV0 A;  5DDG A;  1UST A;  2XVC A;  1AOY A;  4NQW A;  3VOD A;  2P7V B;  2FRH A;  2DBB A;  2CSO A;  2DT5 A;  5FLX K;  3M7G A;  3Q9S A;  1GHC A;  3MCZ A;  4A0X A;  1W7P A;  3V8L A;  1KU9 A;  1UHM A;  4ZH4 F;  1YQA A;  2GXB A;  1CF7 A;  3BJA A;  3H92 A;  5HOO A;  2WCW A;  5HDK A;  4D0P A;  4L18 B;  2DQR A;  1H9T A;  2IPQ X;  3U1D A;  3G73 A;  3M1E A;  2VS1 A;  4HDU A;  2DI3 A;  3WGI A;  1U3E M;  2XAG A;  2MLG A;  3GZ5 A;  3VEP A;  5DCM B;  2GQQ A;  2EFQ A;  2H09 A;  4N9H A;  1SD7 A;  1HKS A;  2FNP A;  4EV1 A;  3ROU A;  4RGU A;  5BQT A;  4UVA A;  4ENM A;  3IRR A;  2OQR A;  3RTR A;  1KYZ A;  2QBY B;  1XGO A;  5LBQ A;  3RI4 A;  3DPT A;  4DAV A;  2WJ0 A;  1LEA A;  5AON A;  3M8F A;  1XGN A;  4KNY A;  5D8K B;  4ESB A;  5HLI A;  2HQN A;  1O7F A;  3ECO A;  3ZPL A;  1XN7 A;  4IRH A;  3K1M A;  5LRR A;  2HTS A;  4PZJ A;  3F21 A;  4TV7 A;  1WI9 A;  3GVA A;  4Y17 A;  3BDD A;  5ICC A;  2CV8 A;  1KA8 A;  1PUE E;  4I0A A;  5F1R A;  5IT3 A;  2E1N A;  2MLK A;  3FXR A;  2CW0 F;  2Y48 A;  1IZ1 A;  5CVJ A;  1YO5 C;  2YSR A;  4L5J A;  3BJ6 A;  4TKD A;  2YX4 A;  3NRV A;  2YPR A;  1G6N A;  2ZYZ B;  3CUQ A;  1H9G A;  1OYW A;  1U8R A;  1MDM A;  2XKP A;  4IXA A;  3TDU C;  3LQR A;  1R0V A;  1YW8 A;  1JHF A;  4WK8 F;  1TQM A;  3KLO A;  4KIF A;  3ZN1 A;  3ZMS A;  2V1U A;  3H3U A;  6PAX A;  2CWE A;  4I01 A;  4EJU A;  1IUY A;  3EDP A;  3M8E A;  4M9Z A;  5L3G A;  4Z2Y A;  3LQQ A;  3QPT A;  5CLS A;  1D8K A;  3TGN A;  1UFM A;  1U2W A;  3GX4 X;  1W5S A;  4M6Y A;  2WWY A;  1F5T A;  4RGS A;  1XSV A;  4EJO A;  2DLL A;  1YS6 A;  5LGN A;  4L9V A;  2VOO A;  5D5W B;  1J2X A;  3E5U A;  4NB5 A;  5JI6 A;  4M73 A;  3DV8 A;  3RKW A;  4KIB A;  3F22 A;  2HGC A;  4IPA A;  5ICG A;  4LLN A;  2RGV A;  4BAY A;  1FSH A;  1B1B A;  3IEY A;  1ZAO A;  3QP5 A;  2XAJ A;  1LDJ A;  3COA C;  2Z5U A;  2OD5 A;  1HXD A;  2KJC A;  2IA1 A;  5LRS A;  2RKH A;  2QLZ A;  4QBO A;  2VBZ A;  1FYK A;  3IKV A;  3F8B A;  4A5N A;  3GYH X;  4L9J A;  1QQI A;  5F6F A;  1BC7 C;  1S8N A;  1XSX A;  2QVO A;  4MTE A;  1BI0 A;  2UXX A;  3RIR A;  5E20 A;  4UUV A;  1P2F A;  4OU0 A;  2O0Y A;  5CYV A;  3GFI A;  4OIQ F;  2HS5 A;  1RUN A;  1W7P D;  4FHT A;  2PMH A;  4Q47 A;  2DAO A;  3E6M A;  4LK0 F;  5TRD A;  4BHB A;  2QUF A;  1K6O A;  1JXS A;  1T98 A;  3FXU A;  1Z6R A;  4B8X A;  2ZO4 A;  3IKT A;  2GA2 A;  4R1H A;  4L9T A;  1A04 A;  1UB9 A;  3ZMZ A;  1BI1 A;  4IJA A;  2VT2 A;  1R1V A;  3WTW C;  5D5U B;  1YNM A;  1I5Z A;  1XMA A;  5FFX A;  3LFK A;  2ZNZ A;  3ZMT A;  1UCR A;  3HUG A;  4EQQ A;  3BPX A;  5FO5 A;  1FYL A;  5LLQ A;  3HRT A;  4CIC A;  5FLX Z;  5LEJ A;  3HSE A;  1QZZ A;  4CYD A;  1LJ9 A;  1ZGJ A;  2YX7 A;  3DKW A;  2RDP A;  2A6H F;  5AIP A;  1FC3 A;  2W84 A;  4GYG A;  4EGY A;  4R8H A;  2NNY A;  1P4A A;  1KQ8 A;  4A5M A;  1B6A A;  4XRF A;  1IRG A;  2LDU A;  3DFG A;  2P5L C;  3PFI A;  4AVP A;  3DNX A;  4IVN A;  1MD0 A;  4HA8 A;  3IL2 A;  4PGG A;  2L4A A;  4FT8 A;  3GFM A;  2FEZ A;  2FU4 A;  2QBY A;  2H6B A;  2W8M A;  1G3W A;  3GLX A;  3O2P E;  3GW2 A;  3KP2 A;  2WIZ A;  2F5F A;  1R11 A;  2GAU A;  1X3U A;  2A5Y B;  1VTN C;  4NHJ A;  3SXY A;  2KRF A;  4LLG F;  2LNB A;  2HKX A;  2H27 A;  3F23 A;  2Q8K A;  5ERI A;  3EYI A;  2UZK A;  3FX3 A;  2FSW A;  3RJP A;  3F8N A;  1O3R A;  3KEQ A;  3WTY C;  4WWC A;  3LA3 A;  4XLN F;  2R7D A;  4QLC U;  5IT9 K;  1S7O A;  4I02 A;  1B9N A;  1EH6 A;  4H0E A;  4HW0 A;  1HSJ A;  5BMZ A;  1DDN A;  2P4W A;  1FOK A;  3RDI A;  2GZW A;  3I0T A;  1PDN C;  1TNS A;  2DU9 A;  2L01 A;  1MGT A;  1PP7 U;  1U6G A;  2ZYZ A;  1SD5 A;  4JBA A;  1R36 A;  1K79 A;  5DCF A;  2VON A;  1ON2 A;  3CTA A;  3MEX A;  2PG4 A;  2EV5 A;  1JE8 A;  5E1X A;  2ZKZ A;  3R60 A;  3SQN A;  1D8J A;  4HX4 A;  3V7C A;  1HBX G;  1I1G A;  2KIU A;  2VBX A;  5CJ9 A;  4ZYH A;  5HS7 A;  3T8T A;  1FNN A;  2QQA A;  5DYM A;  1QNT A;  3WTV C;  3WGH A;  2VN2 A;  4XSZ F;  1MJA A;  1SFE A;  1K7A A;  4P5O A;  2VE9 A;  1YIO A;  4HLY A;  3JAM K;  4YFN F;  3WTT C;  2L3D A;  4U0W A;  4U88 A;  1NHA A;  2P8T A;  2FMY A;  5FD6 A;  1LEB A;  2F5C A;  5K5R A;  2QZ8 A;  1R58 A;  1Z05 A;  2ELH A;  1R00 A;  5LEK A;  4OMZ A;  2DPD A;  1KU7 A;  1TQP A;  2R7F A;  3TO6 A;  3FOV A;  1ZYR F;  2VBW A;  2Z0R A;  2Q2E A;  2FKC A;  2K4B A;  4OMY A;  1BJA A;  5FB2 A;  2QWW A;  3VOE A;  5L3F A;  5HLH