1F1ZA

Tnsa, a catalytic component of the tn7 transposition system
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
260
structure length
260
Chain Sequence
FSEVQIARRIKEGRGQGHGKDYIPWLTVQEVPSSGRSHRIYSHKTGRVHHLLSDLELAVFLSLEWESSVLDIREQFPLLPSDTRQIAIDSGIKHPVIRGVDQVMSTDFLVDCKDGPFEQFAIQVKPAAALQDERTLEKLELERRYWQQKQIPWFIFTDKEINPVVKENIEWLYSVKTEEVSAELLAQLSPLAHILQEKGDENIINVCKQVDIAYDLELGKTLSEIRALTANGFIKFNIYKSFRANKCADLCISQVVNMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unexpected structural diversity in DNA recombination: the restriction endonuclease connection.
pubmed doi rcsb
molecule tags Dna binding protein
molecule keywords TNSA ENDONUCLEASE
total genus 91
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08721 Tn7_Tnp_TnsA_C TnsA endonuclease C terminal
A PF08722 Tn7_Tnp_TnsA_N TnsA endonuclease N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1f1zA02
3.40.1350.10 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 1f1zA01
3WE3A 1UHWA 2KKOA 4IRHA 4HAMA 4YG2F 1LB2A 1T0FA 3F8CA 1F5TA 3MZHA 3CTAA 3TKYA 1EV7A 2UWMA 3J80Z 2CQKA 2DQRA 3IHUA 3FWEA 3K2ZA 3F21A 4AIHA 1GHCA 3BROA 2ZBKA 3CUOA 3IRQA 3LSTA 1IF1A 2L3DA 1QZZA 3E6DA 3TGNA 1R7JA 4PGGA 5F64A 2Z5UA 5ILVA 1VTNC 4O5VA 4HV5A 2VBXA 1ZRCA 1GXQA 3MAJA 4HLYA 3GYHX 2OAZA 3FMQA 1J59A 3HOTA 3ROUA 5E17F 1IXSB 1T39A 5DCMB 2QLZA 2WTEA 5LRSA 1PP7U 1SD4A 2IVMA 2DPDA 4I0AA 3H92A 3ULQB 5F1RA 2OKFA 1EH6A 2FMLA 1MJ9A 1LNWA 2OD5A 1T98A 2OSTA 5L3BA 2GQQA 3IEYA 3LQQA 4QWQA 1XSXA 2IT0A 5D4RA 2JTVA 1O57A 1SD5A 4IVNA 2XAHA 4LB5A 3I71A 3DNXA 3EQLF 2HKOA 3DEUA 4HLXA 1UB9A 2DW4A 4IRGA 2PN6A 4G7ZF 2ZO4A 3GZ6A 3P7NA 5D5XB 2ZNZA 2RKHA 2WWYA 1BC8C 2C6YA 4S05A 3T8RA 3ZN0A 5LGUA 4KMUX 1BOAA 3DXJF 2NS0A 5BS6A 3IC7A 4LGWA 5E1WA 2A6HF 3VOEA 1TQMA 4GYGA 4M72A 3LAPA 1PP8F 3WU0A 2RVCA 2W57A 3P9IA 5LGTA 2QM3A 1ZGJA 5K5RA 2A61A 5DYMA 2GXBA 1HSTA 4EQQA 1U78A 1U3EM 1ZREA 4EMSA 4Q48A 1O3TA 3O6BB 4PZJA 2P7CB 3RJPA 2L01A 5ICFA 4WCGA 4EVIA 1O3RA 4H0EA 2K86A 4A12A 5LRRA 4HF1A 4M6XA 5L3EA 2M5WA 3KZZA 1XD7A 1HBXG 2YPRA 4NQWA 2QQAA 3CDHA 4LD5A 4ZH4F 1F4KA 5JR3A 1LDKB 2WIZA 1XSVA 3ZMSA 2OQRA 2DK5A 1MDMB 5IT9K 2ZFWA 3KP6A 4TV7A 2D2WA 3GFJA 1SFXA 5BQTA 5HDGA 3RKYA 1BIBA 4CDGA 1W4MA 3V8LA 4Y17A 3CUQB 3GEZA 1F1ZA 3TO9A 5HVQC 5BPIA 4RB2C 3KP2A 3F6VA 3KCCA 1H9TA 1LDJA 2Y75A 3P9CA 2HDCA 4A0XA 2O6GE 2V1DA 3T0YA 4RAYA 3L9FA 5D6FA 1BM9A 1EH7A 1BN5A 2PBIA 2L4MA 1DPRA 1RZNA 2R3SA 4FX0A 3WG9A 1P4XA 4HZFA 1QZYA 4AVPA 3AAFA 5DV5A 3U9GA 5TRDA 1W5TA 3K69A 4LMYA 4EV0A 1R58A 2IRFG 3C18A 1IUYA 2DK8A 3M7GA 3TDUC 1IN7A 3E6CC 2ESHA 5BOXA 2OBPA 4G6DA 5H20A 3SFZA 1LQ1A 4BHPA 3OOPA 5EEHA 2FRHA 4Q47A 2PMUA 3CUQC 1XDSA 1Z91A 3G73A 4M6YA 1REPC 3HRUA 3CO7C 1MGTA 5E8GA 2ZYZB 3FMSA 1ZLKA 3LAJA 2R7FA 1SMYF 3J81Z 1FSEA 2CV8A 2K27A 2ZXJA 4XLPF 3R6SA 4UV9A 3RKXA 2WC2A 4ETSA 3T1BA 1I1GA 5DEQA 2OQGA 3J7AO 1I6XA 4ENKA 2LKPA 4A5NA 2E1CA 4Q5SF 2F5FA 1TW2A 2GZWA 1KU2A 4TKDA 4EGYA 2QBYA 4HBLA 4HV6A 1FX7A 1G4DA 4U0VA 1QBJA 1ZRDA 4Y13A 3KFWX 4WXDA 2VBYA 2QUFA 5CVUA 1IN4A 1HKSA 4RB0A 3KE2A 1FBUA 2VLDA 4KMFA 4MQ9F 3V8KA 2Z9OA 1J5YA 2Z99A 2E7WA 3QU6A 5FGMA 4M73A 3WGGA 2PFBA 1FT9A 1P2FA 5J8CA 4NHJA 1Z05A 2DLLA 4UHTA 5BMZA 2G7HA 3FMRA 4HX7A 3WTXC 3G3ZA 2IP2A 3ABUA 1R1UA 3FXUA 3HSFA 4XLNF 3DKWA 1OR7A 3WTYC 1RZ4A 3NRVA 3HTUA 3E6MA 1FP1D 4EJVA 2FCOA 1MJAA 3WGIA 1UFMA 4YFNF 1HQCA 3K9TA 2CFXA 1U2WA 3ZPLA 2MA3A 2IA2A 2CW0F 2LSOA 3HIFA 3W6KB 1H9GA 4M9XA 5LHHA 2MD5A 3D5LA 3WU1B 2PMHA 5KK1A 4AD9A 4HX8A 5FFXA 4CICA 3L00A 1ZRFA 1BI2A 3WTVC 2G7UA 5LEKA 4MTDA 3HYIA 5A2QK 2BE5F 4ZZLA 3GFMA 4GXOA 4U7BA 4U0WA 2FBIA 2JRTA 5CYVA 3TO7A 1NHAA 3ZN1A 2PLYA 4IRIA 3KEOA 2DO7A 2VE8A 2ZCWA 2DT5A 1R5HA 2WJ0A 1RI7A 5CLSA 1H0MA 1CGPA 4YFXF 4HF0A 4M9SA 2ACJA 1BIAA 4ZYEA 3K1NA 5ERIA 4HOBA 1ZG5A 1BI3A 4PGHA 4U0YA 4JQFA 3IL2A 1FOKA 2GWRA 4G94A 5J6XA 2PQ8A 5ICCA 4I2OA 2ZMEA 4KNYA 4AIKA 2P5KA 1DDNA 5D8LB 5KVRA 4CZZA 3MFKA 4GO1A 1P92A 3B73A 2F5DA 1YG2A 1YS6A 3QU3A 4ESBA 1ONVA 4M71A 1IRFA 1RLVA 3D0SA 1XB4A 4KT5C 2NRAC 3L2CA 5D5VB 3F8FA 4G7HF 2EFQA 2RGVA 3FXQA 4QBLA 3WTUC 2EV5A 4L9JA 2HYFA 3P1ZB 2XV4S 5JHUA 1R23A 3FX3A 3WTSC 2JT1A 2ISYA 1O3SA 1LJ9A 1KU9A 1YQAA 2VE9A 3V8JA 4HDUA 3J81K 2XVCA 1O7LA 3F8BA 3S2WA 5AONA 4A6DA 2XIGA 3M1EA 2HGCA 2MH2A 2E7XA 1FPQA 2A07F 1XMKA 3EDPA 3TOBA 1TQPA 2V79A 3R4KA 1WSUA 2BEOA 2GA1A 2BYVE 4LG0A 1XMXA 4EM2A 2MLGA 4UVCA 3RI4A 3I5UA 4M9ZA 2F2EA 3QP6A 4BXUA 5D5UB 1XSDA 1FZPB 2FXAA 4KUMA 5LGNA 2K4JA 3SZTA 4RGUA 1BJAA 5DCMA 4HYEA 4OINF 2P7VB 3KETA 3IKTA 2O61A 2J5OA 2ADUA 2JZYA 3C1DA 3RDIA 2A6EF 1K78B 6PAXA 1XGOA 1G6NA 1GXPA 1S3JA 4BQAA 2QYOA 1J9IA 5AIQA 1U5TB 5JFRA 3TOAA 2HFHA 5FB2A 4QBNA 2EA2A 2DU9A 1Y88A 1Z6TA 4LG0B 4IPAA 1YTYA 2KJBA 3RPUA 1E2XA 1BI0A 4Q4ZF 2EFOA 1R11A 3M8FA 4R79A 2DFIA 5D4SA 3EYYA 2EV6A 5E18F 3K1MA 4OIPF 4Z2YA 5HLGA 4CYDA 1OYYA 4NB5A 3MZYA 1MZBA 4A6EA 2M8EA 1L3LA 3ERED 3ZMUA 4WK8F 1P6RA 1B9NA 3RIRA 2VOOA 3I54A 2KJCA 1ZHFA 5DD4A 4IHTA 3N4MA 4KICA 2MH9A 5HS8A 5FD5A 1JGSA 3NEUA 1ODDA 4BNCA 3HSEA 1KQ0A 3LFKA 3E6BA 3I0TA 2HTSA 3KP7A 1GVJA 4BAYA 2O3FA 3CO6C 4ASNA 3F6OA 5L3CA 1IN8A 2RN7A 4L9TA 3E5QA 3BY6A 2RNJA 1HXDA 3FXRA 1MKMA 4EM1A 1XGSA 4GYIA 1QO0D 1YIOA 3DPTA 4A0ZA 1RIOH 5DD8A 5FFZA 4UXNA 1J2XA 2LF8A 1R0VA 3SQNA 1YO5C 2P5LC 2MLKA 4FHTA 2AXLA 2DPUA 2BV6A 2GIVA 1ZG1A 2HYGD 4OMZA 2L4AA 5ED4A 3WODF 3F3XA 4L9VA 1YFHA 2STTA 2E1NA 1TNSA 3DP7A 4G9YA 4MEYF 1G3SA 1IAWA 2Z33A 1C0WA 2FEZA 4CHUA 5E8IA 4L9NA 2XHKA 4L18B 3KLNA 2XAFA 5FD6A 1XN7A 3DF8A 1FWZA 2P8TA 5CVRA 4R8HA 3VODA 1WWXA 3L09A 3I58A 1FYMA 2X0LA 3BJ6A 4YIFA 3FM3A 2WIWA 2M87A 4N9HA 5HDNA 2RV8A 4HDVA 2PI0A 1G3TA 3ELKA 2VXZA 1LEAA 2UZKA 4MGRA 1XMAA 3I59A 1ZAOA 2LNBA 4OIOF 2KRFA 3C7JA 1OB8A 4OIRF 2YX7A 1S8NA 3IWFA 1LVAA 3DQVC 1L0OC 4WF2A 3ZMDA 2V6CA 3JAMK 4OU0A 5ICGA 1SD6A 5HOOA 3BOQA 1TQIA 3WE2A 2VC0A 2FBHA 2MBFA 5CJ9A 3OV8A 2JPCA 4XBFA 3AJVA 2IJLA 5LHIA 4EGZA 3GF2A 1FNNA 2DQLA 2AS5F 3E97A 4KN4X 4KYWA 3SZPA 3GFLA 3WGHA 1KQ9A 1TLHB 4N0BA 4FX4A 3KP3A 2Z3YA 2XKPA 4G7OF 2O8XA 1G3YA 2EK5A 4B09A 1E17A 1ZG3A 2FA5A 4I98B 4ZYDA 2K02A 4AWXB 3ZMZA 1OYIA 3C3WA 4KIFA 4P96A 2DAOA 4G6QA 3HSRA 1S29A 4XSZF 5CVIA 2INBA 3COAC 3E5UA 1FC3A 3K1PA 4ESFA 1KA8A 4L0YB 1A04A 2FOKA 3QOPA 4P9FA 2HEOA 1WKMA 4ZYHA 1V4RA 4PDKA 5LEJA 2KIFA 2CYYA 2ETHA 4U88A 1J75A 2CG4A 1W7PD 2OU2A 1ZARA 2VT2A 1T38A 1Z1DA 2ZKZA 2PG4A 1RNLA 2G9WA 2L54A 1ON2A 5A2QZ 3E3VA 4GCVA 1S7OA 2QENA 3RTRA 4B8XA 4BHCA 3LA3A 2DTRA 4ENJA 4KFCA 3EETA 1FYLA 2VODA 4RGSA 5CVJA 3IWZA 5ILUA 1B59A 3B02A 5ILSA 2A5YB 2MC3A 2XUBA 2PEXA 5ICEA 3JTHA 1UCRA 1ZYRF 1OYWA 4ON0A 2GJWA 2FF4A 3CUQA 4RGXA 4RB3C 2CO5A 3KZYA 4RAZA 2V9VA 4E70A 4BYYA 2EJRA 2FSWA 1WQ2A 1HH1A 3RYRA 1STZA 1R5GA 2ESNA 2GA2A 1Y0UA 3BDDA 2W85A 1DPUA 4PCQA 1KU7A 2VOPA 3BZ6A 4EJOA 2M45A 1SAXA 1SFUA 2Y48A 5HLHA 2VT3A 1U5TC 2ZNYA 1KGSA 4A5MA 5FLXK 3QPHA 3I59B 3FF5A 1P4AA 3U2RA 3R0AA 2P5VA 2NNYA 3VB2A 2Q2EA 4LK1F 2V1UA 1OKRA 4A2UA 2FNPA 2JSCA 2TDXA 3O2PE 3LWFA 1T6SA 2A68F 5CVVA 1QQIA 5HS7A 4LB6B 3GUDA 2QBYB 3V7RA 2F5CA 2A69F 3VEPA 3FOVA 4Y15A 1HKQA 1U8RA 4LLNA 3BWGA 1FSHA 5E20A 3F22A 4ZZDA 3QPTA 3E5XA 4KIBA 4HA8A 1Q1HA 3P1YA 1BI1A 4LFUA 3KLOA 5FDKA 1QPMA 2B0LA 4YFKF 2VBWA 5EEGA 2H6BA 2ZJ2A 2HQNA 3BP8A 4HQEA 4MTEA 5IT9Z 2Q8KA 1IN6A 4A0YA 3QRFF 3VFZA 2XAQA 4CGZA 3W6JB 4QBOA 1XCVA 1B9MA 1QGPA 2HTJA 3GX4X 2H94A 2K4BA 2NNNA 2YX4A 4L0ZB 2H27A 1MDMA 4EJTA 2BBYA 1KYZA 1Z7UA 2DI3A 5D6EA 3HHHA 3MQ0A 4M74A 3N97A 2H09A 1IN5A 3J80K 3O3KA 2W25A 2BGCA 2D45A 5E1ZB 3V4GA 1R22A 3WTWC 1SMTA 2ELHA 2EV0A 3TO6A 1D8KA 1I5ZA 3Q9VA 5J8FA 2VBZA 3HUGA 5LHGA 1ZLJA 4L5JA 4P55A 1USSA 2P6TA 1S7AA 3TDZC 2RC4A 2YR2A 2XROA 4CO8A 1MD0A 1IW7F 3LA7A 1V3FA 3BPXA 1W7PA 2A3SA 4OMYA 4IF4A 3T5XA 1RUOA 1G3WA 3BPVA 3LQRA 3HRMA 4O3MA 4KDPA 2F5EA 1IXRC 1S6LA 1PUEE 1R00A 3R60A 1T2KA 2P6SA 1B6AA 1O3QA 1XGNA 3GWZA 3GXOA 5L3FA 2HWVA 3ECOA 5D8KB 1TBXA 4UV8A 2EFPA 4AIJA 3BJOA 3JSOA 4JK1X 1P4WA 3GW2A 3GVAA 1GEFA 3QP5A 4LLLA 2ZMEB 5HLIA 2QZ8A 4KA4A 1FP2A 2GAUA 3IRRA 2K7LA 3L7WA 2DBBA 1R36A 1O7FA 4WXCA 4XRFA 3ZMTA 4WX9A 5HDKA 2RQPA 1TTYA 4S04A 2XGXA 1FLIA 1JXSA 2M30A 1AWCA 3ZP5A 3I64A 5H6QA 2RDPA 4IJAA 2X4HA 3I53A 4LJZF 2EA4A 1HW5A 1K78A 2V1XA 2H6CA 1ZH5A 3MWMA 1U5TA 3CLOA 1OB9A 1IRGA 1HW2A 1USTA 2UXNA 1LEBA 3HTSB 3MCZA 1R1VA 1YS7A 1QNTA 5FLXZ 1BBYA 2IPQX 5IT3A 3ABTA 2XASA 1X3UA 1MJBA 1LDDA 2J5PA 3ECHA 4U7DA 5LLQA 1DP7P 1Y1OA 2WCWA 2KIUA 3TQNA 2M1BA 2QQ9A 3IKVA 3DV8A 3I4PA 4YIIA 1J0RA 3ZQ7A 5L3GA 4F7ZA 4K2EA 4N9IA 1JHHA 2VC1A 3GFIA 5DCFA 2HQRA 1ZN2A 2IA1A 3F8MA 3U1DA 2KIMA 1HW1A 2VN2A 1XDUA 4WXHA 3WTZA 2YSRA 2GW6A 1B4AA 3GLXA 4ESJA 2HS5A 4IHSA 5DUIA 4I0BA 1J7KA 2QVOA 2D1VA 4I09A 1D5VA 2YU3A 3NQOA 1Z9CA 2OZ6A 3HOSA 2Q0OA 2ZYZA 3ZMVA 1B1BA 2JPBA 1WRJA 5DUKA 2R7DA 2HR3A 3MEXA 4DQ2A 2WV0A 2FBKA 3BJAA 2WCZA 1PDNC 5L3DA 1ULYA 1TW3A 3KEQA 1FBQA 4UUVA 3PQKA 3ISPA 2FNAA 3REOA 1RUNA 4HX4A 3JTGA 1W5SA 2O03A 2EWNA 2EFNA 1D8JA 4MNUA 1YW9A 3PQJA 2PJPA 2FMYA 1KQ8A 1YYVA 4JBAA 4L5IA 1KU3A 4MEXF 4QLCU 1UHMA 3CJNA 1W7PB 4EJUA 1ZP7A 1CF7B 3V7SA 3RYPA 5K5OA 2O0YA 3K0LA 3AJVB 3SXYA 3EYIA 4HQMA 3DPLC 1R1TA 2CSOA 1DUXC 4ZYGA 1FBSA 4HF2A 2IA0A 4EJWA 2COMA 3KP4A 1D3YA 2FE3A 3R0JA 2HZTA 2EB7A 2XRNA 2FQ3A 4MHGA 4UVBA 4XSXF 4LLGF 2XAGA 5JI6A 1JHFA 3P1ZA 1CF7A 1I1SA 3Q5FA 4IXAA 4RB1A 2EFWA 5JVTA 5BPDA 2Y0MA 3M8EA 2CGPA 3WTTC 2XAJA 3SHFA 1HKTA 2QQBA 2QWWA 4GGGA 1IZ1A 1U6GA 5K5QA 1Z6RA 2L02A 2D1HA 3T8TA 3RPQA 1EH8A 5FO5A 1XGMA 4UVAA 2UXXA 1A79A 4G8XA 1F9NA 3JAMZ 2STWA 4LK0F 1KYWA 3JW4A 3F23A 1IXCA 1FY7A 2IW5A 3JSPA 2GXGA 3PFIA 4ENMA 2HOEA 1JE8A 1SD7A 4RS8A 3F72A 2XKOA 4P5OA 5D5WB 2OZUA 4DNCA 2NYXA 4I01A 4WWCA 1SFEA 4CXFA 5F6FA 1AOYA 1YLFA 3R61A 2W84A 4R1HA 3P9KA 3H3UA 4BH9A 2OA4A 3ML6A 3HRTA 4HW0A 2ISZA 2EO0A 4D0PA 5HS9A 3F8NA 3M9AA 5H6RA 4KIGA 2VONA 1YW7A 3FZVA 4I7HA 1K6OA 5DDGA 3LA2A 4RGRA 3GO5A 3HRSA 3QAHA 1K79A 2FU4A 2LF7A 1FYKA 1ON1A 2P4WA 4EM0B 4TKKA 3V7CA 3HHGA 2NAZA 4P9UA 1OMIA 3Q9SA 4UNOA 1HSJA 3EUHA 1ZGAA 3H3ZA 5AIPA 3RKWA 1BC7C 1IPIA 1I27A 3GZ5A 4KN7X 1OPCA 5K1YA 3KP5A 1K7AA 4ENNA 4O6JA 1TNTA 2W24A 2HKXA 5LBQA 4BHBA 2CWEA 4OIQF 1YW8A 3DFGA 5E1XA 5TJJA 1XCBA 3FHZA 4I02A 4MQVA 2LDUA 4OOIA 1WI9A 3FM5A 4FT8A
chains in the Genus database with same CATH superfamily
3WE3A 1UHWA 3U21A 1OJLA 2KKOA 4XICA 4YIRX 5KAFC 4IRHA 1JKPC 3OYCA 4HAMA 2WADA 1IV6A 4NC7A 3PNYA 4YG2F 1LB2A 1T0FA 1P7JA 3F8CA 1TWCJ 1F5TA 4BQQA 3MZHA 4IQ4A 3SFIA 1UHSA 2L0KA 3CTAA 3TKYA 1EV7A 2VJIA 3BQYA 2IS2A 1YNMA 2UWMA 3J80Z 2CQKA 2DQRA 3IHUA 3FWEA 3HOXJ 3K2ZA 3F21A 1POGA 1YJNI 1IRXA 2NVUB 2ECCA 4AIHA 1GHCA 2GOXB 4XK4A 2DN0A 3MMYB 3BROA 2ZBKA 3BT9A 1JKQC 4IO9F 3CUOA 3DKYA 1XC5A 3IRQA 2B63J 5HODA 4FETA 3LSTA 2LK2A 1IF1A 3HOVJ 4LQEA 2L3DA 4C3HJ 4HRIA 1QZZA 2L7MP 3S17J 3E6DA 2EZHA 3TGNA 1R7JA 4PGGA 2O9LA 5F64A 2Z5UA 5ILVA 3S1QJ 1VTNC 4BUPA 4O5VA 4HV5A 2VBXA 5J1YA 1ZRCA 3HOYJ 2JA8J 1GXQA 1FMWA 3MAJA 4HLYA 3GYHX 2OAZA 1ZTRA 2K40A 3FMQA 2PMZA 1J59A 2CUEA 2ZJRF 1HOMA 2R7QA 3HOTA 1IV8A 3ROUA 5E17F 1IXSB 3S2HJ 1T39A 5DCMB 3BG3A 2QLZA 2WTEA 3VWBA 5LRSA 4UUSB 1PP7U 1SD4A 2KZGA 2IVMA 3A0BC 2DPDA 4I0AA 3PO3J 2DODA 3H92A 3ULQB 5F1RA 1TT0A 2OKFA 1EH6A 2FMLA 2ID6A 1OLTA 2CQXA 1MJ9A 3OL3A 2XB5A 1LNWA 2OD5A 1JUPA 1T98A 3LFUA 2OSTA 2GOMA 3S1NJ 1D0XA 3S15J 5L3BA 4BKXA 1KONA 2GQQA 3IEYA 3HEFA 3LQQA 3GZNB 4QWQA 1XSXA 2IT0A 5D4RA 4I76A 2JTVA 1O57A 2JVHA 1SD5A 5J1UA 4IVNA 2XAHA 4LB5A 1WZ2A 3I71A 1YRNA 2BVMA 1ZK8A 1WPKA 5J40A 3DNXA 2LRDA 3EQLF 2HKOA 3BTLA 3DEUA 2BY2A 4HLXA 2XGCA 1UB9A 1S9HA 3RQIA 1J09A 2DW4A 4IRGA 1IUFA 2PN6A 1WJ5A 4G7ZF 2ZO4A 3JRFA 3Q0UA 3ZR8X 1WVRA 3P7NA 3VDXA 2ZNZA 5D5XB 2IGNA 2RKHA 3NAUA 4BY7J 2WWYA 3K70D 3GTKJ 1BC8C 2C6YA 5LFAA 2KMUA 5DTDA 1WJCA 3BZKA 1X3ZB 2CFOA 1IDZA 2OJED 4W1UA 3KEYA 3TP0A 4S05A 3T8RA 3ZN0A 3GZ6A 5LGUA 3GBGA 2DMUA 1MMAA 4OAZA 3OYDA 1B72A 4KMUX 1MIJA 2JRMA 2XPUA 1IJWC 1BOAA 3DXJF 4ZJZA 2H8RA 4UB8C 2NS0A 5BS6A 4I6ZA 3EUAA 3EUKL 2CW8A 2FLCA 3AG4H 3G2BA 3IC7A 3VYRB 4LGWA 5E1WA 3VYSB 2A6HF 2WAFA 1AU7A 3VOEA 2OF7A 1TQMA 4GYGA 4M72A 4KISA 2LKXA 1T0FC 2HPMA 3LAPA 4CCMA 2EZIA 1PP8F 3CJQB 1R4NB 1V5GA 3WU0A 2RVCA 4C3JJ 2W57A 3P9IA 3CC7I 2B9SA 5LGTA 2QM3A 1ZGJA 4PUSA 1BR4A 2MSYA 5K5RA 2A61A 5DYMA 2GXBA 5JVGF 3CD6I 2W82A 1HSTA 4A3MJ 1MBKA 2FOWA 3K4JA 4EQQA 3FK7A 1U78A 3K4NA 3K4KA 1U3EM 1ZREA 2VKVA 2K9LA 3W2WA 4EMSA 4Q48A 4X0GA 1O3TA 3O6BB 1H8AC 4PZJA 2BY0A 2P7CB 5DM7F 4M3GA 2E2IJ 3RJPA 4XONA 2L01A 3Q0VA 5ICFA 2Z0RA 4WCGA 2MGQA 4EVIA 1O3RA 1I50J 2E60A 5F0HA 4H0EA 2K86A 4A12A 5LRRA 4HF1A 4M6XA 5L3EA 3HZJA 1X1CA 2M5WA 3KZZA 1XD7A 1K4SA 1HBXG 2YPRA 3OL4A 2QQAA 4NQWA 1U9NA 3CDHA 4XL9A 1UJ8A 4LD5A 2IS6A 4ZH4F 4LIVA 4IHWA 3ZXSA 1BOBA 2LR8A 2KIQA 3OYIA 1F4KA 5JR3A 1LDKB 2WAQA 5KNLA 3O8GA 2WIZA 1XSVA 1JUSA 3ZMSA 2OQRA 2DK5A 2VI6A 1MDMB 1ITYA 5IT9K 2XRLA 2ZFWA 1R49A 3KP6A 4TV7A 4H4KC 1E3OC 1RC9A 2D2WA 1YJWI 3GFJA 1SFXA 3V42A 3JRIA 2ICWG 5BQTA 2Z1DA 2VJJA 5HDGA 2DDAA 4BJ6C 1AKHA 3RKYA 1BIBA 2JK3A 1ORKA 4XLHA 3L2QA 2X6XA 3K4LA 4CDGA 1WH5A 1W4MA 4D5CA 1B8IA 1VQ5I 4E7HA 4QPQA 4Y17A 3V8LA 2A05A 3CUQB 3GEZA 1F1ZA 2HNHA 3TO9A 5HVQC 5BPIA 4RB2C 1MW7A 3KP2A 3F6VA 3KCCA 1H9TA 5KHDA 2K3FA 3BTJA 1LDJA 2Y75A 4D9JA 3P9CA 2E5NA 2HDCA 3H9JA 1VQ6I 3M1CA 1RESA 4A0XA 4MIMA 2V1DA 2O6GE 3RZDJ 1QA6A 1DGRM 3S3MA 3T0YA 4RAYA 3L9FA 5D6FA 1BM9A 1EH7A 3ERMA 1BN5A 2PBIA 2X9DA 1V54H 2L4MA 2W1OA 3K7AJ 3HKZN 1DPRA 2OTJI 1RRJA 1RZNA 2R3SA 4FX0A 3NARA 5E3OA 3WG9A 3ZQLA 4ZDPA 1BW5A 1P4XA 4HZFA 1QZYA 4AVPA 3AAFA 5DV5A 3MKWB 1XS9A 2WBMA 2ZC2A 3U9GA 3PO2J 5TRDA 5EZGA 4RA2A 4PFOA 4IX7A 1V5FA 4ITVA 3GTMJ 3CP8A 1W5TA 3K69A 3AFHA 2O7OA 4LMYA 4EV0A 4DJAA 2E19A 3QYEA 1R58A 2IRFG 3C18A 1IUYA 2DK8A 4YRVA 3OOUA 3M7GA 3PUBA 3TDUC 4BEHA 5E3LA 1IN7A 5FRMA 3E6CC 2ESHA 5BOXA 2OBPA 4G6DA 1Y8QB 5H20A 5GPCA 3OY9A 2LYCA 3IH2A 3SFZA 1LQ1A 4BHPA 3OOPA 5B3SH 5FROA 5EEHA 2LBFA 2FRHA 4A3BJ 1IDYA 4Q47A 3S3OA 2PMUA 3CC4I 3CUQC 3FKJA 5F1JA 1XDSA 3JRGA 1S5LC 2F4MB 3OIPA 3JRAA 1Z91A 3G73A 3TMOA 3ASOH 3KIOA 4HNUA 3IAS2 1GUUA 4M6YA 2LD5A 1VFCA 1N25A 2GXAA 3G1MA 1REPC 3CMEI 3HRUA 1KZHA 2CV0A 2OPTA 2DFFA 4A3LJ 3CO7C 3AG1H 1MGTA 5E8GA 3CCYA 3I4NJ 2ZYZB 3FMSA 1ZLKA 3LAJA 2R7FA 3UKGA 2ZJPF 1SMYF 4B43A 3B6CA 1D5YA 3J81Z 2VUMJ 1FSEA 2CV8A 2K27A 2ZXJA 2GLOA 1X19A 1W36D 4CYCB 3CCRI 4XLPF 3R6SA 1W5CC 4IQJA 4HNVA 2IAIA 2OC6A 4UV9A 4NDLA 2OTLI 1Y1VJ 2KQRA 3RKXA 1PUFA 4S0HB 2WC2A 4ETSA 3T1BA 1I1GA 1RKWA 2VQGA 5DEQA 2OQGA 3J7AO 2ZXIA 1I6XA 4MFDA 4ENKA 3ONQA 2LKPA 1A5JA 4A5NA 2E1CA 4Q5SF 2F5FA 4A3KJ 1TW2A 4DYRA 2GZWA 1TZLA 4X1EA 3CCJI 1KU2A 4TKDA 4NC6A 1EA3A 2JN6A 4EGYA 3HC7A 2QBYA 4HBLA 3CP2A 4HV6A 1FX7A 1YRNB 1G4DA 4U0VA 1QBJA 5BNGA 1ZRDA 1U8BA 1RETA 1GV5A 2ZXHA 4Y13A 2JSPA 2LMDA 3KFWX 4A3JJ 4D7NA 4WXDA 2VBYA 2QUFA 5CVUA 1Y6IA 1IN4A 3JCUC 1HKSA 4RB0A 3KE2A 1FBUA 2VLDA 4JOMA 4KMFA 4MQ9F 4CCJA 1OCTC 3V8KA 1J5YA 2Z9OA 2Z99A 2E7WA 4UY8I 2NVYJ 4KT6A 3OYFA 3ZQGA 3QU6A 5FGMA 4C2TA 3I9V2 4M73A 2XSDC 3WGGA 2PFBA 1JJ8C 1FT9A 1P2FA 5J8CA 1X3WB 4NHJA 1Z05A 4HPQA 2DLLA 4UHTA 5BMZA 2G7HA 4CZCA 2X48A 3RPUD 3FMRA 3H9GA 4HX7A 3S1MJ 2DA3A 3DBLB 4P1WA 3WTXC 3G3ZA 1VQNI 2IP2A 3ABUA 5C44J 1R1UA 2RAEA 3FXUA 1WH7A 3HSFA 4XM3A 4XLNF 2M3AA 3DKWA 2K3PA 1OR7A 3WTYC 1RZ4A 3I3LA 3NRVA 5J4YA 3HTUA 3E6MA 1FP1D 4EJVA 3PIOF 2FCOA 1MJAA 2VASA 3WGIA 1TWFJ 1UFMA 2L9RA 4YFNF 1HQCA 5IP9J 3K9TA 4BXFA 2CFXA 1U2WA 3JRCA 2HOTA 3ZPLA 2MA3A 2IA2A 2CW0F 2LSOA 3DU5A 3HIFA 2DMPA 3NWTA 3W6KB 1WJDA 2EZLA 2DFEA 4HSRA 4XOTA 1H9GA 4M9XA 3OWTA 5LHHA 2GM4A 1PUFB 1D1AA 4BDYA 1QZEA 2CV1A 2MD5A 2FL3A 4B1RA 4CCKA 1DP3A 2KL4A 4HSTA 1G2HA 3D5LA 3WU1B 2PMHA 2L9NA 2K9SA 5KK1A 1F43A 4DZJA 4AD9A 1MSEC 3LSMA 1ZKGA 1HLVA 1E0EA 4HX8A 2HYJA 5FFXA 2VKHA 3FK6A 4CICA 2QQ8A 1AA7A 3L00A 4F3QA 1ZRFA 1BI2A 2KDOA 3WTVC 2PX9A 4Y3OA 3TBIA 2DBSA 2G7UA 2XF7A 4XN3A 1VZ0A 1CQTA 2DMNA 5LEKA 2LP0A 4MTDA 3HYIA 5A2QK 2BE5F 4AUXA 1YI2I 3GMEA 4ZZLA 3GFMA 4C2UA 4GXOA 4U7BA 4U0WA 1WJEA 1IGNA 2FBIA 3VSLA 2JRTA 5CYVA 3TO7A 1NHAA 3ZN1A 5B66C 2PLYA 3LL7A 4IRIA 1T33A 2NS7A 2ZFUA 3KEOA 2HZDA 2HDDA 1SFKA 2DO7A 2BZTA 2VE8A 1ETVA 2ZCWA 2DT5A 1R5HA 2WJ0A 3D5RC 1RI7A 5CLSA 1H0MA 5CKTA 3W2VA 5IOYA 1CGPA 4DAVA 4YFXF 3W2AA 3H1CA 4HF0A 2BHYA 3OS1A 4FE4A 4M9SA 1QHGA 3E1SA 3DLAA 2ACJA 2BVLA 1BIAA 2DFHA 4ZYEA 3K1NA 3C2HA 5ERIA 4HOBA 1ZG5A 1V55H 1BI3A 3OR2C 4PGHA 4U0YA 4JQFA 3IL2A 1SAUA 1FOKA 1VQPI 4GDFA 1M1EB 2GWRA 5M5WJ 4G94A 5J6XA 2CZRA 2PQ8A 5ICCA 2X1EA 3FKIJ 4BEHB 4I2OA 2ZMEA 4KNYA 4AIKA 2P5KA 1DDNA 5D8LB 5KVRA 3HDDA 4XOPA 4CZZA 3MFKA 1IO2A 2IGKA 1OCRH 2M4GA 4GO1A 5F0CA 3D1NI 1P92A 2LBFB 3B73A 5GP9A 4DA2A 4DAPA 2F5DA 1YG2A 2IS1A 4J00A 1YS6A 3QU3A 4ESBA 4QTRA 3A1YA 3L2WA 3BTCA 1ONVA 1WHUA 3G6EI 4M71A 1IRFA 2CW7A 2MYSA 1RLVA 3SDBA 3D0SA 1YIJI 1XB4A 1TWAJ 2E1OA 4KT5C 4PSXA 2NRAC 3L2CA 5D5VB 1SANA 3F8FA 3ZRGA 4G7HF 2EFQA 3H0GJ 2RGVA 3FXQA 4D5FA 1LFPA 4J19A 4QBLA 3WTUC 2KLOA 4EEFG 2EV5A 3L1PA 1TWGJ 1QU3A 4L9JA 4PJJA 1HA8A 2HYFA 2A6TA 3P1ZB 2XV4S 5JHUA 1R23A 3DTKA 3FX3A 4IOCF 2DOEA 3HPHA 3WTSC 3O8HA 2JT1A 2ISYA 3PFYA 1O3SA 4BXXJ 1LJ9A 1Z77A 1KU9A 3PM1A 1YQAA 2VE9A 3V8JA 4DIQA 4HDUA 1A6QA 1FIAA 3J81K 2XVCA 4UUTA 3HOUJ 1ETQA 3HG9A 3ASNH 1O7LA 3F8BA 3S2WA 9ANTA 2KDZA 4LG3A 5AONA 4XORA 4A6DA 2XIGA 3OMYA 4NC8A 2EZKA 3M1EA 2VJ4A 5TGTA 2WB1A 2HGCA 3BG9A 1WJBA 2MH2A 2E7XA 1FPQA 2B7EA 2A07F 1XMKA 4F93B 5DM6F 4YELA 1YX5A 4ZC3A 4AM3A 2XF5A 3RSNA 3EDPA 1LFBA 1SVLA 4D7MA 3FXMA 3TOBA 3IV5A 4KJZA 1TQPA 2V79A 3R4KA 1JJ6C 1WSUA 4ABZA 3FBIB 5EG0B 4CCOA 3IP4B 2YUSA 2BEOA 5F27A 3K4CA 1T56A 1K61A 2WA0A 3DEWA 2E34A 3PNTA 3S2DJ 2ZSIB 1VF9A 2GA1A 2BYVE 3G1OA 1X1PA 4GFBA 4LG0A 1XMXA 4EM2A 5J3LA 4PFPA 2MLGA 3MN2A 2L7KA 3I5UA 4UVCA 3RI4A 4M9ZA 4HNTA 3CCQI 5IY5H 2F2EA 3QP6A 4BXUA 5D5UB 4E7IA 1XSDA 2MG4A 1FZPB 2FXAA 4KUMA 1JGGA 4OAYA 5LGNA 3JRHA 1V5EA 5IYDJ 2K4JA 2JWTA 3HM5A 3QPSA 3SZTA 1OCOH 4RGUA 2COBA 1BJAA 5DCMA 3GTQJ 4HYEA 4OINF 2HVSA 2P7VB 1I3QJ 3BR2A 2Z16A 3BC8A 5KCMA 3KETA 3KZIC 3IKTA 2O61A 2J5OA 3OYAA 2ADUA 3WG7H 4JX5A 2JZYA 3BG7A 3C1DA 3RDIA 2A6EF 1K78B 1E3PA 6PAXA 2XGDA 3FIWA 2V7FA 1XGOA 4A93J 3A02A 1G6NA 1GXPA 1S3JA 4BQAA 1GVDA 4IHXA 2QYOA 1J9IA 5AIQA 2P0WA 4A3FJ 1U5TB 1VQ7I 5JFRA 3TOAA 3ZGKA 2HFHA 1S72I 1HCRA 5FB2A 2NOJB 2DCEA 2TCTA 4QBNA 2EA2A 2F48A 2DU9A 5EGOA 1Y88A 1Z6TA 4LG0B 4IPAA 1YTYA 1JKOC 3E7LA 1D0YA 2KJBA 2EIJH 3RPUA 3KPHA 5FKKA 3KX2A 4JX6A 3EPZA 1HDPA 3RQ4A 2H8WA 1E2XA 1UZCA 2MABA 1X2NA 1BI0A 1R6RA 4Q4ZF 1W0UA 2HI3A 1QVTA 2R92J 2EFOA 1ENHA 1R11A 4G12A 3M8FA 3P5JA 4R79A 2DFIA 5D4SA 4PK4A 2LKSA 3EYYA 4RMNA 1MSFC 2EV6A 1I3AA 5E18F 3K1MA 2QKLB 2VXDA 4NBQA 3SYTA 3JRDA 2LY9A 2DT6A 5C4XJ 4X6AJ 3C2BA 4OIPF 4Z2YA 2W7NA 3JR9A 3TW6A 1K4TA 2O8KA 5HLGA 2Y31A 4CYDA 4ANJA 1OYYA 4NB5A 2QSHX 3MZYA 1MZBA 2ME6A 4BQNA 4A6EA 2M8EA 4RAGA 5E3NA 1L3LA 2NVXJ 3TL4X 2ME0A 3ERED 3ZMUA 4WK8F 1P6RA 1B9NA 2CRGA 3A0HC 3RIRA 5FLMJ 4Y52J 2W00A 2V9PA 2VOOA 3I54A 2KJCA 1FJLA 1ZHFA 5DD4A 4IHTA 3OYHA 3N4MA 4KICA 2MH9A 5HS8A 1Y0NA 5FD5A 3A03A 3CCLI 1JGSA 2R7WA 3NEUA 1ODDA 4CA0A 4BNCA 3HSEA 1KQ0A 3LFKA 1SFOJ 2V1NA 2G0EA 3E6BA 2F6CA 1MMSA 3I0TA 4XMYA 2HTSA 4PJLA 2MFZA 1MH3A 4OWRB 3CCSI 3KP7A 1GVJA 1MBHA 4BAYA 2KRCA 2O3FA 3A2KA 4ASNA 2X6YA 3CO6C 1BA5A 3F6OA 4Z6YA 3DCFA 5L3CA 1IN8A 4II3A 2RN7A 4L9TA 3E5QA 4XKBA 3BY6A 1U0JA 3FXRA 1HXDA 2RNJA 2Y0SN 5J47A 1MKMA 3SEQA 4EM1A 1XGSA 2WAQN 4GYIA 1QO0D 1YIOA 3DPTA 4A0ZA 1RIOH 5DD8A 3L2UA 5FFZA 4UXNA 3H5AA 1U9OA 5EF6A 1J2XA 2LF8A 2IXSA 1R0VA 3SQNA 1YO5C 2P5LC 2MLKA 2NOGA 3MZ8A 4FHTA 2AXLA 2R93J 2DPUA 3BZCA 1XX5A 2BV6A 2GIVA 1ZG1A 2HYGD 4OMZA 1RKTA 2L4AA 4UUSA 5ED4A 3WODF 3F3XA 4L9VA 1YFHA 4B48A 2STTA 3OYGA 3VYTB 2EIKH 2E1NA 4JX4A 1TNSA 2WY8Q 5E3MA 2X6WA 3PUFA 2E1MC 3DP7A 2R5YB 4G9YA 4MEYF 1G3SA 1K6YA 2EBIA 3TW7A 4XNFA 1IAWA 3K2AA 2Z33A 3DPUA 4CCNA 1C0WA 2FEZA 4CHUA 5E8IA 4L9NA 5J1RA 3TEDA 2XHKA 4A3IJ 4L18B 3FXLA 2XAFA 3KLNA 5FD6A 2R7SA 1XN7A 1SVOA 3DF8A 1FWZA 2X85A 2P8TA 2ZJQF 5CVRA 4R8HA 3G4SI 3HGGA 3KYDB 3VODA 1WWXA 2CUFA 3L09A 4IKFA 3I58A 3ZOBA 1FYMA 2F5VA 4MO7A 5JLXA 2CQNA 2DOAA 3BJ6A 2X0LA 2K9NA 2DYRH 3HXLA 3FM3A 4YIFA 3CMAI 2WIWA 2M87A 4N9HA 1UWVA 4DYQA 1X2MA 3GTJJ 3S14J 5HDNA 2RV8A 4HDVA 2PI0A 1G3TA 5M3MJ 3ELKA 2VXZA 3H3VK 5H2FC 1LEAA 2UZKA 2FQ4A 1RPWA 2DA6A 4MGRA 1TL8A 1XMAA 3I59A 1ZAOA 2LNBA 4OIOF 2KRFA 3JREA 3GTLJ 4A3DJ 3C7JA 2TRTA 1OB8A 3H36A 3L2VA 3ZQFA 5EDNA 3OYNA 2ECBA 4OIRF 2YX7A 1S8NA 3IWFA 1LVAA 2F4OB 2K9QA 3QPLA 5GTHC 1A6IA 3DQVC 3LSIA 1A35A 1L0OC 1BR2A 3PIPF 2NVQJ 3B6AA 4WF2A 3ZMDA 2V6CA 1ZELA 5HNFA 3JAMK 4OU0A 3K6GA 5ICGA 4PJ0C 1SD6A 5HOOA 1JTYA 2UV1A 3BOQA 1TQIA 3WE2A 4C30A 2HXIA 2VC0A 3FHNA 2VQCA 5EZHA 2FBHA 4CH7A 2R0QC 3J7AY 2MBFA 1JKRC 5CJ9A 2K5CA 3CDIA 3OV8A 1OR7C 3HB9A 2JPCA 3QWLA 2YU9J 2XAUA 4XBFA 2K85A 3FXOA 3CF5F 4CCLA 3AJVA 2IJLA 5LHIA 1UELB 4EGZA 1YE9A 3GF2A 1FNNA 4XQFA 2DA2A 1O4XA 2DQLA 2AS5F 3E97A 4KN4X 4KYWA 3SZPA 3GFLA 3WGHA 1KQ9A 2LH9A 2BH2A 2EINH 1TLHB 1YOVB 3M8JA 4N0BA 4FX4A 3KP3A 2Z3YA 1Z3XA 2XKPA 2ZMEC 3IH3A 4QSHA 4G7OF 2O8XA 1IRZA 3BT7A 1G3YA 2EK5A 4B09A 1E17A 4AIDA 1ZG3A 2FA5A 4I98B 2FKCA 4NQWB 4ZYDA 2K02A 2OCEA 4BBSJ 4AWXB 3ZMZA 1OYIA 3C3WA 2R5YA 4KIFA 4P96A 2DAOA 1JTXA 4G6QA 1MMNA 2WV1A 3HSRA 1S29A 4XSZF 1MBEA 5EYRA 5CVIA 2VPLA 2INBA 2GBYA 4JYKA 3H0DA 2V6EA 3COAC 2XPVA 3E5UA 3H9QA 1VI0A 1FC3A 1FOYA 3K1PA 1Q1VA 2K9MA 4DW6A 2ID3A 4ESFA 3S3NA 2Q1ZB 2XF6A 4D1QA 5B1AH 3MKZA 1KA8A 2DJIA 1A04A 4L0YB 2X51A 2FOKA 3MKYB 3QOPA 4P9FA 3I56I 1TC3C 2HEOA 2W8MA 4FQGA 1WKMA 4Y4RA 4ZYHA 1V4RA 4PDKA 1DGWY 4YEJA 5LEJA 2KIFA 2CYYA 4ZYAA 2ETHA 2LFBA 5F04A 4U88A 2JUCA 4M3BA 3AG3H 3AL0C 5GADJ 1J75A 2CG4A 4A3CJ 3VYUB 2R7XA 1W7PD 2OU2A 1ZARA 2VT2A 3EUHC 1SEUA 1T38A 4XLFA 2M8GX 3OSFA 1Z1DA 2BXZA 2PG4A 2ZKZA 4DYCA 2HVQA 1RNLA 2L2OA 5CQEA 1DU6A 2G9WA 2L54A 1ON2A 5A2QZ 3E3VA 4GCVA 1S7OA 2QENA 5CQGA 3RTRA 4B8XA 1A36A 4BHCA 3LA3A 2DTRA 2OV7A 4ENJA 4KFCA 3EETA 4BBRJ 1RR8C 1FYLA 2VODA 4RGSA 5CVJA 3IWZA 5ILUA 3K4MA 1B59A 4XLCA 4AU7A 3B02A 5ILSA 3S16J 2E36A 1F36A 2LG4A 4XRSG 3CC2I 2A5YB 2MC3A 2XUBA 2PEXA 1N78A 5ICEA 4LK0F 2OCCH 2L9SA 3JTHA 2V9KA 3CJTB 1AKHB 1UCRA 3ZQQA 1ZYRF 4I99C 1OYWA 4ON0A 2GJWA 1Y39A 3CF2A 2FF4A 2E5ZA 3CUQA 4RGXA 1ETXA 4RB3C 2CO5A 3KZYA 4RAZA 2M34A 1IC8A 2V9VA 4E70A 3HOZJ 4BYYA 2ELJA 2LC2A 2EJRA 2FSWA 1WQ2A 1HH1A 4DBRA 3UNGC 3RYRA 1STZA 1R5GA 2ESNA 2GA2A 3OYLA 3QYFA 1Y0UA 4RM3A 4JP0A 1APLC 3BDDA 1H88C 2N8GA 3AG2H 2W85A 1DPUA 4PCQA 1KU7A 1YJ9I 2VOPA 3BR5A 3BZ6A 1PYVA 4EJOA 2M45A 3FBNB 1SAXA 1OFCX 1Z7LA 4IHVA 3K10A 1A31A 3OYBA 1SFUA 2AQFA 2Y48A 5IP7J 5HLHA 2VT3A 1U5TC 2ZNYA 2CV2A 1VQ9I 1KGSA 4A5MA 5FLXK 3QPHA 2JA5J 3I59B 1TT5B 3QODA 1GDTA 3FF5A 3VSKA 4BJTA 1XPXA 2CQ7A 1P4AA 3OS0A 4IOAF 1N75A 2HQ5A 3U2RA 3J7YJ 3R0AA 2P5VA 2NNYA 3F0CA 3VB2A 3J7ZI 2QSGX 2XGEA 2Q2EA 4W97A 4LK1F 2V1UA 1OKRA 2Y9YA 4RDUA 4A2UA 2FNPA 2JSCA 2TDXA 3QOEA 5F08A 1WJFA 2E2JJ 4MFEA 3O2PE 2KFDA 3LWFA 2V26A 1G8XA 1T6SA 2KHMA 2A68F 5CVVA 1WFXA 4E7SA 3MD2A 5EGOB 1JT0A 1QQIA 4ZQUA 2FUG2 2QKMB 1B72B 4EV1A 5HS7A 1T95A 2FKHB 4LB6B 3GUDA 3FDYA 1X58A 2HXOA 3V7RA 2QBYB 2R7OA 3ABKH 1MMDA 2F5CA 4F52A 3DBHB 2LOOA 3SJMA 3QQAA 4XKCA 2A69F 2I8DA 3VEPA 4BU2A 5GAEJ 3FOVA 4Y15A 5GTIC 1HKQA 1UG0A 5CPRB 4ZTFA 1U8RA 4LLNA 4NNJA 3BWGA 1FSHA 4B44A 4NUBA 3DU6A 5E20A 4MLOA 2Y2ZA 3F22A 4ZZDA 3QPTA 3E5XA 4KIBA 4HA8A 3WHBA 1I39A 2QF7A 1Q1HA 3P1YA 2M2EA 1BI1A 1UAAA 2KISA 4RLFA 4LFUA 4F92B 3KLOA 5FDKA 1QPMA 2B0LA 2RQQA 4YFKF 2KRHA 2ELKA 3ZQIA 2VBWA 5EEGA 2IGOA 2H6BA 1MBFA 1OISA 2ZJ2A 3CESA 1PJRA 2HQNA 2CQQA 2QEXI 3KYCB 3BP8A 1ZR4A 4HQEA 2CS3A 2BW3B 2VLAA 4MTEA 3BQZA 5IT9Z 2Q8KA 2XDVA 2PJRA 4RAFA 5E79C 1IN6A 3BR1A 4A0YA 3QRFF 3VFZA 2XAQA 4CGZA 3W6JB 4QBOA 1XCVA 1GT0C 1B9MA 3DTIA 1QGPA 3IF0X 3I4MJ 2HTJA 3GX4X 1WCMJ 3D5SC 2H94A 2K4BA 2NNNA 2YX4A 4L0ZB 1WJAA 3K4BA 2H27A 1VQMI 1MDMA 4EJTA 2BBYA 4FASD 1KYZA 1Z7UA 2DI3A 5D6EA 3HHHA 1LKXA 1JUMA 2KP6A 3MQ0A 4M74A 1UMQA 5FRNA 3CLQA 2ZB9A 4DOZA 3JRBA 2H09A 3N97A 2MW8A 3NWSA 3HPGA 5K7ZA 2BY3A 1IN5A 3H35A 3J80K 3O3KA 2W25A 1X1DA 2BGCA 2D45A 3CDLA 5E1ZB 3V4GA 1R22A 5IYCJ 3WTWC 1SMTA 2M7AA 2ELHA 1MBGA 2EV0A 3CZ6A 1Z3YA 3GCMA 3TO6A 1ETOA 1D8KA 1I5ZA 4XRMA 1ACIA 3DBRB 3Q9VA 5J8FA 1BR1A 2VBZA 3HUGA 3SDGA 3L2RA 5LHGA 2M4KA 2RREA 2R7RA 4HEA2 1ZLJA 4L5JA 2NVTJ 4P55A 3U1KA 1USSA 2L7FP 2P6TA 1S7AA 4A3EJ 3FXJA 3TDZC 2RC4A 4XIDA 1HDDC 2YR2A 3WHCA 2XROA 4CO8A 1MD0A 3OR1C 1IW7F 3LA7A 4N4OB 3G71I 1V3FA 3BPXA 1W7PA 4LITA 2A3SA 4OMYA 4IF4A 3PSFA 3T5XA 4XLEA 1RUOA 1G3WA 5C4JJ 3BPVA 3LQRA 3HRMA 4O3MA 4ZDOA 2M9HA 1YITI 4KDPA 2F5EA 1QPIA 2CJJA 5K7FA 1JT6A 1IXRC 1S6LA 2RNGA 2V4JC 1PUEE 1R00A 2X1CA 3R60A 1T2KA 3ABMH 2P6SA 1B6AA 1R71A 2CH0A 1O3QA 1XGNA 4LOCA 3GXOA 1MBJA 1OQYA 3GWZA 5L3FA 1Z21A 2HWVA 1R4MB 3ECOA 5D8KB 1TBXA 3S8PA 1ETWA 4UV8A 4E6ZA 3HUGB 2EFPA 4AIJA 3BJOA 2BW3A 3JSOA 4JK1X 1W36C 1P9QC 1P4WA 4RBOA 1ERDA 2A5WA 1WI3A 1N77A 3GW2A 3LSJA 3GVAA 4E7ZA 1GEFA 3HOWJ 2EQRA 3QP5A 1DU0A 3M3YJ 4LLLA 1YHQI 2EIMH 2ZMEB 5HLIA 2BXYA 2QZ8A 2WB1N 4KA4A 1FP2A 2GAUA 3RKQA 4ZDLA 3CJRB 3IRRA 2M7BA 5IYBJ 3Q3SA 4U87A 2K7LA 4E6KG 3L7WA 2DBBA 1R36A 1O7FA 2E71A 4WXCA 1Y8RB 4XRFA 3ZMTA 4WX9A 3RZOJ 5HDKA 2RQPA 1TTYA 2IEKA 4S04A 4E7LA 3OYKA 2XGXA 2LTPA 5LD2C 1FLIA 1JXSA 3OIOA 4M3DA 2M30A 1AWCA 3ZP5A 3I64A 5H6QA 1OCPA 2WY7Q 2MC4A 3C2GA 2RDPA 4IJAA 3BR0A 2X4HA 3I53A 4LJZF 2PMZN 2EA4A 1G59A 1HW5A 1K78A 1QHHD 4CUGA 4IHYA 2V1XA 1X4PA 1MH4A 2H6CA 1ZH5A 2Y69H 3HGYA 2ZXWH 3MWMA 2HOAA 1U5TA 2R7TA 4BGDA 1BL0A 4B3AA 3PJRA 1GV2A 3CLOA 3PSIA 3HJEA 4B3XA 1R9TJ 1OB9A 1IRGA 4N4NB 1VNDA 3BCAA 2XC7A 1HW2A 2DJNA 1USTA 2UXNA 2Y30A 3OIQA 2HOSA 2VPRA 1LEBA 3HTSB 3MCZA 2YS9A 2NS8A 3BG6A 1R1VA 3S32A 1YS7A 1QNTA 1EJ9A 5FLXZ 1BBYA 1OCCH 2IPQX 1YX3A 2DYSH 5IT3A 5IP6A 2R7VA 1P7IA 2MD0A 2NXNB 2Q2EB 4AVZA 5GPAA 4BJ5C 3ABTA 1Y1WJ 2JMWA 2XASA 1X3UA 2O5RA 4E7JA 1DQUA 2DMTA 1MJBA 5GAHJ 1LDDA 2J5PA 3ECHA 3DWLE 2VS1A 3W6VA 1NK3P 2R5ZA 1HC8A 4U7DA 2DA7A 2BOLA 1OCZH 3LMMA 3ZQHA 4II2A 5LLQA 2JVGA 1T8IA 1DP7P 3CQZJ 3GLLA 1Y1OA 1MNEA 2WCWA 2DA5A 2VJ5A 4AYBN 2KIUA 3TQNA 2M1BA 4BDZA 4B4CA 5HLTA 2QQ9A 3IKVA 3DV8A 2PJRB 3I4PA 4YIIA 1RR7A 1J0RA 2W4SA 2LREA 3ZQ7A 3K70C 1ZGWA 5L3GA 4C9YA 4F7ZA 4FCYA 2AO9A 4K2EA 4N9IA 3IEYB 1GLNA 3LSGA 1JHHA 2JA7J 2R7ZJ 2VC1A 1NG6A 1SVMA 3GFIA 3OYMA 2JJQA 4G6TB 5DCFA 4QIWN 2HQRA 1ZN2A 3H5NA 4G6UA 5IPAA 2IA1A 3F8MA 4J01A 3U1DA 2KIMA 1HW1A 3FXKA 3CCVI 5IOZA 2VN2A 1XDUA 4WXHA 5M5YJ 1FMVA 3M07A 2Y9ZA 2E1MB 2HDWA 3WTZA 4BE0A 2YSRA 1FOWA 2GW6A 1B4AA 3GLXA 4ESJA 2HS5A 5HNHA 4IHSA 3A01A 5DUIA 4I0BA 2DA1A 3KYLA 1J7KA 3G1LA 2DOFA 2QVOA 2VKEA 5EG0A 2UUZA 3BR3A 2D1VA 4I09A 2JJ7A 1D5VA 4CSWA 2YU3A 3NQOA 1Z9CA 2E35A 1LPQA 2OZ6A 3HOSA 2Q0OA 2ZYZA 4BQOA 3ZMVA 1B1BA 4FISA 2JPBA 1WRJA 5FKLA 4CYCA 3MKLA 2WAEA 3DTEA 5DUKA 2QA4I 2R7DA 2M0CA 4DZPA 1PVEA 2I5UA 4FTHA 2HR3A 3MEXA 5M5XJ 4DQ2A 4M3EA 2Z2SB 2WV0A 2FBKA 3MVPA 3BJAA 3UR3C 4E7KA 2WCZA 1PDNC 5L3DA 1ULYA 2KT0A 1TW3A 3KEQA 2VL8A 1BJZA 1LFUP 1FBQA 4UUVA 3PQKA 3ZCOA 3ISPA 2R7UA 2FNAA 3REOA 1ETYA 1RUNA 4HX4A 3JTGA 4A3GJ 3TP3A 1W5SA 1LUJB 2IBDA 4UB6C 3BR6A 2O03A 2EWNA 2EFNA 1D8JA 2KPMA 4MNUA 2M0MA 1LE8A 1YW9A 3PQJA 4LIUA 3N05A 2PJPA 2FMYA 2R5ZB 1VQKI 1YYVA 1KQ8A 4Y33A 4BE1A 4JBAA 4L5IA 1KU3A 2H1KA 2CUZA 4XR6A 2H1LA 4MEXF 2DMQA 2VB6A 4QLCU 1UHMA 3RCOA 3CJNA 1W7PB 4EJUA 1ZP7A 1FTTA 3DEEA 1CF7B 3V7SA 3LNQA 3RYPA 5K5OA 2VKDA 2XB0X 2O0YA 1WGXA 3K0LA 1QRYA 2I10A 2VQLA 1MNMC 2DXIA 3CMYA 3AJVB 3SXYA 3AKZA 5KAIC 3EYIA 4HQMA 4M3FA 5EEAA 3DPLC 1NH3A 1R1TA 5FKMA 4F55A 2CSOA 1DUXC 1EKEA 4ZYGA 1FBSA 4GRIA 4HF2A 2IA0A 5FKNA 3BG5A 4EJWA 3OYJA 2E2HJ 2COMA 2R4GA 1D3YA 2FE3A 3KP4A 2XPWA 3R0JA 2HZTA 2DTZA 2X1DA 4G6VA 2EILH 5B5EC 4PJMA 3ZQCA 2EB7A 4IEJA 4EATA 2QSFX 2XRNA 2P81A 4DGWB 2X6OA 2DDBA 2FQ3A 1TP4A 2F4IA 4MHGA 2EPFA 4UVBA 3W3CA 2VIXA 2HVRA 2EH3A 3AL0B 4XSXF 2JA2A 4LLGF 4RM2A 2XAGA 5JI6A 1JHFA 3P1ZA 3Q0WA 1CF7A 1AHDP 3ABLH 1I1SA 5JLWA 3Q5FA 2L9VA 2QGUA 4IXAA 4RB1A 2EFWA 5JVTA 5BPDA 3E0JB 5TISC 2Y0MA 2CMPA 1SC7A 2AQEA 1ETKA 3M8EA 2HQAA 2CGPA 5K7HA 3WTTC 1VQ8I 2XAJA 3SHFA 1TWHJ 4BL0B 1HKTA 4B47A 3LSRA 2QQBA 3FISA 3F9KA 1UG2A 2QWWA 3BLYA 3H5RA 4GGGA 1IZ1A 4L5EA 3SEZA 3OSGA 1U6GA 5K5QA 1Z6RA 2L02A 5FKOA 2D1HA 5FLVA 1S7EA 3GTOJ 3T8TA 1EF4A 2HPIA 3RPQA 1EH8A 4IZZA 1FIPA 5FO5A 1XGMA 4UVAA 1Z0XA 2UXXA 1NTCA 4F91B 1H89C 1A79A 4G8XA 3S93A 1F9NA 4QPOA 5JHFA 3LOCA 2L5QA 3JAMZ 2JA6J 2OUMA 2STWA 1X1BA 2GIZA 2ZSHB 1KYWA 3QYBA 3BCBA 2LLKA 3JW4A 1IXCA 1FY7A 5B1BH 2IW5A 3F23A 3IUOA 3JSPA 2GXGA 3PFIA 1FOXA 2KZVA 2BY1A 4ENMA 2HOEA 4XKVA 1JE8A 1SD7A 4RS8A 3OS2A 3LSKA 3F72A 2JQ7A 2XKOA 3LSPA 4P5OA 5D5WB 2OZUA 4DNCA 3DLLF 2NYXA 4HG2A 2IS4A 4BACA 1LE8B 3CCUI 4I01A 4DBQA 1VQLI 4WWCA 2FJ1A 4E4HA 1XTAA 4ZTJA 1SFEA 4AYBA 4CXFA 5F6FA 4XKWA 4BS9A 1Y56A 3VPRA 1AOYA 1YLFA 3DKXA 1FTZA 2VQHA 3R61A 2W84A 3A4CA 4R1HA 3P9KA 3H3UA 3ESWB 4BH9A 2OA4A 3ML6A 2D5VA 3X2QH 3HRTA 4Y7NJ 4HW0A 2ISZA 3M4OJ 2EO0A 4C2MJ 4D0PA 5HS9A 3F8NA 2BHZA 1I6HJ 3M9AA 2JUGA 1R5ID 4XN0A 5H6RA 2Y0SA 4KIGA 2VONA 1YW7A 3FZVA 5DS9A 4I7HA 1K6OA 2XSJC 4XLAA 1LVKA 5DDGA 3LA2A 2DT7B 2AHQA 2CU7A 1E3HA 3GO5A 3HRSA 3QAHA 4RGRA 3IH4A 1K79A 2FU4A 1QVUA 2DA4A 1D1BA 1JI8A 1K83J 2LF7A 1W1WE 2FX0A 1W0TA 1ON1A 1Z67A 1FYKA 2P4WA 4EM0B 4TKKA 4AC0A 3V7CA 2IGMA 1NG7A 3HHGA 1VQ4I 1D0ZA 4A69C 2NAZA 4M6VA 4V2FA 4P9UA 5FJ8J 1ZQ3P 1OMIA 1T08B 3Q9SA 2LY1A 3CCMI 4UNOA 3GTPJ 1HSJA 3EUHA 3IAM2 1ZGAA 1IG7A 3H3ZA 2CUJA 3PNVA 5AIPA 5J4VA 2FD5A 3RKWA 3CMMA 3SZGA 1BC7C 4XRSA 1IPIA 3PL8A 2LVSA 3OYEA 1I27A 1HF0A 3GZ5A 5EJCA 2L7ZA 5F0FA 3HKZA 1ZR2A 1MMGA 4KN7X 3HL2A 1OPCA 5K1YA 3WU2C 3KP5A 1K7AA 4V19K 3CCEI 1D1CA 2LY2A 4ENNA 4O6JA 1NK2P 2HU9A 1TNTA 2W24A 2HKXA 4V2GA 1MNDA 5LBQA 1VQOI 1XG1A 4IL6C 4FE7A 5GAGJ 1B8IB 4BHBA 4PJNA 4KITB 1X4OA 4BE2A 3HBLA 2CWEA 3LSHA 1BW6A 2QCOA 4OIQF 1YW8A 3DFGA 5E1XA 3S1RJ 3GTGJ 3I55I 5TJJA 1XCBA 4C3IJ 3FHZA 2AXTC 4I02A 4MQVA 4RLQA 2LDUA 4PSWA 4OOIA 3A01B 4BY1J 1FEXA 1WI9A 2W48A 3FM5A 5M3FJ 3BTIA 5C3EJ 4FT8A 1X1AA
chains in the Genus database with same CATH topology
3WE3A 1UHWA 2KKOA 4IRHA 4HAMA 4YG2F 1LB2A 1T0FA 3F8CA 1F5TA 3MZHA 3CTAA 3TKYA 1EV7A 1YNMA 2UWMA 3J80Z 2CQKA 2DQRA 3IHUA 3FWEA 3K2ZA 3F21A 4AIHA 1GHCA 3BROA 2ZBKA 3CUOA 3IRQA 3LSTA 1IF1A 4LQEA 2L3DA 1QZZA 3E6DA 3TGNA 1R7JA 4PGGA 5F64A 2Z5UA 5ILVA 1VTNC 4O5VA 4HV5A 2VBXA 1ZRCA 1GXQA 3MAJA 4HLYA 3GYHX 2OAZA 3FMQA 1J59A 3HOTA 3ROUA 5E17F 1IXSB 1T39A 5DCMB 2QLZA 2WTEA 5LRSA 1PP7U 1SD4A 2IVMA 2DPDA 4I0AA 3H92A 3ULQB 5F1RA 2OKFA 1EH6A 2FMLA 1MJ9A 1LNWA 2OD5A 1T98A 2OSTA 5L3BA 2GQQA 3IEYA 3LQQA 4QWQA 1XSXA 2IT0A 5D4RA 2JTVA 1O57A 1SD5A 4IVNA 2XAHA 4LB5A 3I71A 3DNXA 3EQLF 2HKOA 3DEUA 4HLXA 1UB9A 2DW4A 4IRGA 2PN6A 4G7ZF 2ZO4A 3GZ6A 3P7NA 5D5XB 2ZNZA 2RKHA 2WWYA 1BC8C 2C6YA 4S05A 3T8RA 3ZN0A 5LGUA 4KMUX 1BOAA 3DXJF 2NS0A 5BS6A 2FLCA 3IC7A 4LGWA 5E1WA 2A6HF 3VOEA 1TQMA 4GYGA 4M72A 3LAPA 1PP8F 3WU0A 2RVCA 2W57A 3P9IA 5LGTA 2QM3A 1ZGJA 5K5RA 2A61A 5DYMA 2GXBA 1HSTA 4EQQA 1U78A 1U3EM 1ZREA 4EMSA 4Q48A 1O3TA 3O6BB 4PZJA 2P7CB 3RJPA 2L01A 5ICFA 2Z0RA 4WCGA 4EVIA 1O3RA 4H0EA 2K86A 4A12A 5LRRA 4HF1A 4M6XA 5L3EA 2M5WA 3KZZA 1XD7A 1HBXG 2YPRA 4NQWA 2QQAA 3CDHA 4LD5A 4ZH4F 1F4KA 5JR3A 1LDKB 2WIZA 1XSVA 3ZMSA 2OQRA 2DK5A 1MDMB 5IT9K 2ZFWA 3KP6A 4TV7A 2D2WA 3GFJA 1SFXA 5BQTA 5HDGA 3RKYA 1BIBA 4CDGA 1W4MA 3V8LA 4Y17A 3CUQB 3GEZA 1F1ZA 3TO9A 5HVQC 5BPIA 4RB2C 3KP2A 3F6VA 3KCCA 1H9TA 1LDJA 2Y75A 3P9CA 2HDCA 4A0XA 2O6GE 2V1DA 3T0YA 4RAYA 3L9FA 5D6FA 1BM9A 1EH7A 1BN5A 2PBIA 2L4MA 1DPRA 1RZNA 2R3SA 4FX0A 3WG9A 1P4XA 4HZFA 1QZYA 4AVPA 3AAFA 5DV5A 3U9GA 5TRDA 1W5TA 3K69A 4LMYA 4EV0A 1R58A 2IRFG 3C18A 1IUYA 2DK8A 3M7GA 3TDUC 1IN7A 3E6CC 2ESHA 5BOXA 2OBPA 4G6DA 5H20A 3SFZA 1LQ1A 4BHPA 3OOPA 5EEHA 2FRHA 4Q47A 2PMUA 3CUQC 1XDSA 1Z91A 3G73A 4M6YA 1REPC 3HRUA 3CO7C 1MGTA 5E8GA 2ZYZB 3FMSA 1ZLKA 3LAJA 2R7FA 1SMYF 3J81Z 1FSEA 2CV8A 2K27A 2ZXJA 4XLPF 3R6SA 4UV9A 3RKXA 2WC2A 4ETSA 3T1BA 1I1GA 5DEQA 2OQGA 3J7AO 1I6XA 4ENKA 2LKPA 4A5NA 2E1CA 4Q5SF 2F5FA 1TW2A 2GZWA 1KU2A 4TKDA 4EGYA 2QBYA 4HBLA 4HV6A 1FX7A 1G4DA 4U0VA 1QBJA 1ZRDA 4Y13A 3KFWX 4WXDA 2VBYA 2QUFA 5CVUA 1IN4A 1HKSA 4RB0A 3KE2A 1FBUA 2VLDA 4KMFA 4MQ9F 3V8KA 2Z9OA 1J5YA 2Z99A 2E7WA 3QU6A 5FGMA 4M73A 3WGGA 2PFBA 1FT9A 1P2FA 5J8CA 4NHJA 1Z05A 2DLLA 4UHTA 5BMZA 2G7HA 3FMRA 4HX7A 3WTXC 3G3ZA 2IP2A 3ABUA 1R1UA 3FXUA 3HSFA 4XLNF 3DKWA 1OR7A 3WTYC 1RZ4A 3NRVA 3HTUA 3E6MA 1FP1D 4EJVA 2FCOA 1MJAA 3WGIA 1UFMA 4YFNF 1HQCA 3K9TA 2CFXA 1U2WA 3ZPLA 2MA3A 2IA2A 2CW0F 2LSOA 3HIFA 3W6KB 1H9GA 4M9XA 5LHHA 2MD5A 2FL3A 3D5LA 3WU1B 2PMHA 5KK1A 4AD9A 4HX8A 5FFXA 4CICA 3L00A 1ZRFA 1BI2A 3WTVC 2DBSA 2G7UA 5LEKA 4MTDA 3HYIA 5A2QK 2BE5F 4ZZLA 3GFMA 4GXOA 4U7BA 4U0WA 2FBIA 2JRTA 5CYVA 3TO7A 1NHAA 3ZN1A 2PLYA 4IRIA 3KEOA 2DO7A 2VE8A 2ZCWA 2DT5A 1R5HA 2WJ0A 1RI7A 5CLSA 1H0MA 1CGPA 4DAVA 4YFXF 4HF0A 4M9SA 2ACJA 1BIAA 4ZYEA 3K1NA 5ERIA 4HOBA 1ZG5A 1BI3A 4PGHA 4U0YA 4JQFA 3IL2A 1FOKA 2GWRA 4G94A 5J6XA 2CZRA 2PQ8A 5ICCA 4I2OA 2ZMEA 4KNYA 4AIKA 2P5KA 1DDNA 5D8LB 5KVRA 4CZZA 3MFKA 4GO1A 1P92A 3B73A 4DAPA 4DA2A 2F5DA 1YG2A 1YS6A 3QU3A 4ESBA 1ONVA 4M71A 1IRFA 1RLVA 3D0SA 1XB4A 4KT5C 2NRAC 3L2CA 5D5VB 3F8FA 4G7HF 2EFQA 2RGVA 3FXQA 4QBLA 3WTUC 2EV5A 4L9JA 2HYFA 3P1ZB 2XV4S 5JHUA 1R23A 3FX3A 3WTSC 2JT1A 2ISYA 1O3SA 1LJ9A 1KU9A 1YQAA 2VE9A 3V8JA 4HDUA 3J81K 2XVCA 1O7LA 3F8BA 3S2WA 5AONA 4A6DA 2XIGA 3M1EA 2HGCA 2MH2A 2E7XA 1FPQA 2A07F 1XMKA 3EDPA 3TOBA 1TQPA 2V79A 3R4KA 1WSUA 2BEOA 2GA1A 2BYVE 4LG0A 1XMXA 4EM2A 2MLGA 4UVCA 3RI4A 3I5UA 4M9ZA 2F2EA 3QP6A 4BXUA 5D5UB 1XSDA 1FZPB 2FXAA 4KUMA 5LGNA 2K4JA 3SZTA 4RGUA 1BJAA 5DCMA 4HYEA 4OINF 2P7VB 3KETA 3IKTA 2O61A 2J5OA 2ADUA 2JZYA 3C1DA 3RDIA 2A6EF 1K78B 6PAXA 1XGOA 1G6NA 1GXPA 1S3JA 4BQAA 2QYOA 1J9IA 5AIQA 1U5TB 5JFRA 3TOAA 2HFHA 5FB2A 4QBNA 2EA2A 2DU9A 1Y88A 1Z6TA 4LG0B 4IPAA 1YTYA 2KJBA 3RPUA 1E2XA 1BI0A 4Q4ZF 2EFOA 1R11A 3M8FA 4R79A 2DFIA 5D4SA 3EYYA 2EV6A 5E18F 3K1MA 4OIPF 4Z2YA 5HLGA 4CYDA 1OYYA 4NB5A 3MZYA 1MZBA 4A6EA 2M8EA 1L3LA 3ERED 3ZMUA 4WK8F 1P6RA 1B9NA 3RIRA 2VOOA 3I54A 2KJCA 1ZHFA 5DD4A 4IHTA 3N4MA 4KICA 2MH9A 5HS8A 5FD5A 1JGSA 3NEUA 1ODDA 4BNCA 3HSEA 1KQ0A 3LFKA 3E6BA 3I0TA 2HTSA 3KP7A 1GVJA 4BAYA 2O3FA 3CO6C 4ASNA 3F6OA 5L3CA 1IN8A 2RN7A 4L9TA 3E5QA 3BY6A 2RNJA 1HXDA 3FXRA 1MKMA 4EM1A 1XGSA 4GYIA 1QO0D 1YIOA 3DPTA 4A0ZA 1RIOH 5DD8A 5FFZA 4UXNA 1J2XA 2LF8A 1R0VA 2IXSA 3SQNA 1YO5C 2P5LC 2MLKA 4FHTA 2AXLA 2DPUA 2BV6A 2GIVA 1ZG1A 2HYGD 4OMZA 2L4AA 5ED4A 3WODF 3F3XA 4L9VA 1YFHA 2STTA 2E1NA 1TNSA 3DP7A 4G9YA 4MEYF 1G3SA 1IAWA 2Z33A 1C0WA 2FEZA 4CHUA 5E8IA 4L9NA 2XHKA 4L18B 3KLNA 2XAFA 5FD6A 1XN7A 3DF8A 1FWZA 2P8TA 5CVRA 4R8HA 3VODA 1WWXA 3L09A 3I58A 1FYMA 2X0LA 3BJ6A 4YIFA 3FM3A 2WIWA 2M87A 4N9HA 1UWVA 5HDNA 2RV8A 4HDVA 2PI0A 1G3TA 3ELKA 2VXZA 1LEAA 2UZKA 4MGRA 1XMAA 3I59A 1ZAOA 2LNBA 4OIOF 2KRFA 3C7JA 1OB8A 4OIRF 2YX7A 1S8NA 3IWFA 1LVAA 3DQVC 1L0OC 4WF2A 3ZMDA 2V6CA 3JAMK 4OU0A 5ICGA 1SD6A 5HOOA 3BOQA 1TQIA 3WE2A 2VC0A 2FBHA 2MBFA 5CJ9A 3OV8A 2JPCA 4XBFA 3AJVA 2IJLA 5LHIA 4EGZA 3GF2A 1FNNA 2DQLA 2AS5F 3E97A 4KN4X 4KYWA 3SZPA 3GFLA 3WGHA 1KQ9A 2BH2A 1TLHB 4N0BA 4FX4A 3KP3A 2Z3YA 2XKPA 4G7OF 2O8XA 3BT7A 1G3YA 2EK5A 4B09A 1E17A 1ZG3A 2FA5A 4I98B 2FKCA 4ZYDA 2K02A 4AWXB 3ZMZA 1OYIA 3C3WA 4KIFA 4P96A 2DAOA 4G6QA 3HSRA 1S29A 4XSZF 5CVIA 2INBA 3COAC 3E5UA 1FC3A 3K1PA 4ESFA 1KA8A 4L0YB 1A04A 2FOKA 3QOPA 4P9FA 2HEOA 2W8MA 1WKMA 4ZYHA 1V4RA 4PDKA 5LEJA 2KIFA 2CYYA 2ETHA 4U88A 1J75A 2CG4A 1W7PD 2OU2A 1ZARA 2VT2A 1T38A 1Z1DA 2ZKZA 2PG4A 1RNLA 2G9WA 2L54A 1ON2A 5A2QZ 3E3VA 4GCVA 1S7OA 2QENA 3RTRA 4B8XA 4BHCA 3LA3A 2DTRA 4ENJA 4KFCA 3EETA 1FYLA 2VODA 4RGSA 5CVJA 3IWZA 5ILUA 1B59A 3B02A 5ILSA 2A5YB 2MC3A 2XUBA 2PEXA 5ICEA 3JTHA 1UCRA 1ZYRF 1OYWA 4ON0A 2GJWA 2FF4A 3CUQA 4RGXA 4RB3C 2CO5A 3KZYA 4RAZA 2V9VA 4E70A 4BYYA 2EJRA 2FSWA 1WQ2A 1HH1A 3RYRA 1STZA 1R5GA 2ESNA 2GA2A 1Y0UA 3BDDA 2W85A 1DPUA 4PCQA 1KU7A 2VOPA 3BZ6A 4EJOA 2M45A 1SAXA 1SFUA 2Y48A 5HLHA 2VT3A 1U5TC 2ZNYA 1KGSA 4A5MA 5FLXK 3QPHA 3I59B 3FF5A 1P4AA 3U2RA 3R0AA 2P5VA 2NNYA 3VB2A 2Q2EA 4LK1F 2V1UA 1OKRA 4A2UA 2FNPA 2JSCA 2TDXA 3O2PE 3LWFA 1T6SA 2A68F 5CVVA 1QQIA 4ZQUA 4EV1A 5HS7A 2FKHB 4LB6B 3GUDA 2QBYB 3V7RA 2F5CA 2A69F 3VEPA 3FOVA 4Y15A 1HKQA 1U8RA 4LLNA 3BWGA 1FSHA 5E20A 3F22A 4ZZDA 3QPTA 3E5XA 4KIBA 4HA8A 1Q1HA 3P1YA 1BI1A 4LFUA 3KLOA 5FDKA 1QPMA 2B0LA 4YFKF 2VBWA 5EEGA 2H6BA 2ZJ2A 2HQNA 3BP8A 4HQEA 4MTEA 5IT9Z 2Q8KA 1IN6A 4A0YA 3QRFF 3VFZA 2XAQA 4CGZA 3W6JB 4QBOA 1XCVA 1B9MA 1QGPA 3IF0X 2HTJA 3GX4X 2H94A 2K4BA 2NNNA 2YX4A 4L0ZB 2H27A 1MDMA 4EJTA 2BBYA 1KYZA 1Z7UA 2DI3A 5D6EA 3HHHA 3MQ0A 4M74A 3N97A 2H09A 1IN5A 3J80K 3O3KA 2W25A 2BGCA 2D45A 5E1ZB 3V4GA 1R22A 3WTWC 1SMTA 2ELHA 2EV0A 3TO6A 1D8KA 1I5ZA 3Q9VA 5J8FA 2VBZA 3HUGA 5LHGA 1ZLJA 4L5JA 4P55A 1USSA 2P6TA 1S7AA 3TDZC 2RC4A 2YR2A 2XROA 4CO8A 1MD0A 1IW7F 3LA7A 1V3FA 3BPXA 1W7PA 2A3SA 4OMYA 4IF4A 3T5XA 1RUOA 1G3WA 3BPVA 3LQRA 3HRMA 4O3MA 4KDPA 2F5EA 1IXRC 1S6LA 1PUEE 1R00A 3R60A 1T2KA 2P6SA 1B6AA 1O3QA 1XGNA 3GWZA 3GXOA 5L3FA 2HWVA 3ECOA 5D8KB 1TBXA 4UV8A 4E6ZA 2EFPA 4AIJA 3BJOA 3JSOA 4JK1X 1P4WA 3GW2A 3GVAA 1GEFA 3QP5A 4LLLA 2ZMEB 5HLIA 2QZ8A 4KA4A 1FP2A 2GAUA 3IRRA 2K7LA 3L7WA 2DBBA 1R36A 1O7FA 4WXCA 4XRFA 3ZMTA 4WX9A 5HDKA 2RQPA 1TTYA 4S04A 2XGXA 1FLIA 1JXSA 2M30A 1AWCA 3ZP5A 3I64A 5H6QA 2RDPA 4IJAA 2X4HA 3I53A 4LJZF 2EA4A 1HW5A 1K78A 2V1XA 2H6CA 1ZH5A 3MWMA 1U5TA 3CLOA 1OB9A 1IRGA 1HW2A 1USTA 2UXNA 1LEBA 3HTSB 3MCZA 1R1VA 1YS7A 1QNTA 5FLXZ 1BBYA 2IPQX 5IT3A 3ABTA 2XASA 1X3UA 1MJBA 1LDDA 2J5PA 3ECHA 2VS1A 4U7DA 5LLQA 1DP7P 1Y1OA 2WCWA 2KIUA 3TQNA 2M1BA 2QQ9A 3IKVA 3DV8A 3I4PA 4YIIA 1J0RA 3ZQ7A 5L3GA 4F7ZA 4K2EA 4N9IA 3IEYB 1JHHA 2VC1A 3GFIA 2JJQA 5DCFA 2HQRA 1ZN2A 4G6UA 2IA1A 3F8MA 3U1DA 2KIMA 1HW1A 2VN2A 1XDUA 4WXHA 3WTZA 2YSRA 2GW6A 1B4AA 3GLXA 4ESJA 2HS5A 4IHSA 5DUIA 4I0BA 1J7KA 2QVOA 2D1VA 4I09A 1D5VA 2YU3A 3NQOA 1Z9CA 2OZ6A 3HOSA 2Q0OA 2ZYZA 3ZMVA 1B1BA 2JPBA 1WRJA 5DUKA 2R7DA 2HR3A 3MEXA 4DQ2A 2WV0A 2FBKA 3BJAA 2WCZA 1PDNC 5L3DA 1ULYA 1TW3A 3KEQA 1FBQA 4UUVA 3PQKA 3ISPA 2FNAA 3REOA 1RUNA 4HX4A 3JTGA 1W5SA 2O03A 2EWNA 2EFNA 1D8JA 4MNUA 1YW9A 3PQJA 2PJPA 2FMYA 1KQ8A 1YYVA 4JBAA 4L5IA 1KU3A 4MEXF 4QLCU 1UHMA 3CJNA 1W7PB 4EJUA 1ZP7A 1CF7B 3V7SA 3RYPA 5K5OA 2O0YA 3K0LA 3AJVB 3SXYA 3EYIA 4HQMA 3DPLC 1R1TA 2CSOA 1DUXC 4ZYGA 1FBSA 4HF2A 2IA0A 4EJWA 2COMA 3KP4A 1D3YA 2FE3A 3R0JA 2HZTA 4G6VA 2EB7A 2XRNA 2FQ3A 4MHGA 4UVBA 4XSXF 4LLGF 2XAGA 5JI6A 1JHFA 3P1ZA 1CF7A 1I1SA 3Q5FA 4IXAA 4RB1A 2EFWA 5JVTA 5BPDA 2Y0MA 3M8EA 2CGPA 3WTTC 2XAJA 3SHFA 1HKTA 2QQBA 2QWWA 4GGGA 1IZ1A 1U6GA 5K5QA 1Z6RA 2L02A 2D1HA 3T8TA 3RPQA 1EH8A 5FO5A 1XGMA 4UVAA 2UXXA 1A79A 4G8XA 1F9NA 3JAMZ 2STWA 4LK0F 1KYWA 3JW4A 3F23A 1IXCA 1FY7A 2IW5A 3JSPA 2GXGA 3PFIA 4ENMA 2HOEA 1JE8A 1SD7A 4RS8A 3F72A 2XKOA 4P5OA 5D5WB 2OZUA 4DNCA 2NYXA 4I01A 4WWCA 1SFEA 4CXFA 5F6FA 1AOYA 1YLFA 3R61A 2W84A 4R1HA 3P9KA 3H3UA 4BH9A 2OA4A 3ML6A 3HRTA 4HW0A 2ISZA 2EO0A 4D0PA 5HS9A 3F8NA 3M9AA 5H6RA 4KIGA 2VONA 1YW7A 3FZVA 4I7HA 1K6OA 5DDGA 3LA2A 4RGRA 3GO5A 3HRSA 3QAHA 1K79A 2FU4A 2LF7A 1FYKA 1ON1A 2P4WA 4EM0B 4TKKA 3V7CA 3HHGA 2NAZA 4P9UA 1OMIA 3Q9SA 4UNOA 1HSJA 3EUHA 1ZGAA 3H3ZA 5AIPA 3RKWA 1BC7C 1IPIA 1I27A 3GZ5A 4KN7X 1OPCA 5K1YA 3KP5A 1K7AA 4ENNA 4O6JA 1TNTA 2W24A 2HKXA 5LBQA 4BHBA 2CWEA 4OIQF 1YW8A 3DFGA 5E1XA 5TJJA 1XCBA 3FHZA 4I02A 4MQVA 2LDUA 4OOIA 1WI9A 3FM5A 4FT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WE3 A;  1UHW A;  2KKO A;  4IRH A;  4HAM A;  4YG2 F;  1LB2 A;  1T0F A;  3F8C A;  1F5T A;  3MZH A;  3CTA A;  3TKY A;  1EV7 A;  2UWM A;  3J80 Z;  2CQK A;  2DQR A;  3IHU A;  3FWE A;  3K2Z A;  3F21 A;  4AIH A;  1GHC A;  3BRO A;  2ZBK A;  3CUO A;  3IRQ A;  3LST A;  1IF1 A;  2L3D A;  1QZZ A;  3E6D A;  3TGN A;  1R7J A;  4PGG A;  5F64 A;  2Z5U A;  5ILV A;  1VTN C;  4O5V A;  4HV5 A;  2VBX A;  1ZRC A;  1GXQ A;  3MAJ A;  4HLY A;  3GYH X;  2OAZ A;  3FMQ A;  1J59 A;  3HOT A;  3ROU A;  5E17 F;  1IXS B;  1T39 A;  5DCM B;  2QLZ A;  2WTE A;  5LRS A;  1PP7 U;  1SD4 A;  2IVM A;  2DPD A;  4I0A A;  3H92 A;  3ULQ B;  5F1R A;  2OKF A;  1EH6 A;  2FML A;  1MJ9 A;  1LNW A;  2OD5 A;  1T98 A;  2OST A;  5L3B A;  2GQQ A;  3IEY A;  3LQQ A;  4QWQ A;  1XSX A;  2IT0 A;  5D4R A;  2JTV A;  1O57 A;  1SD5 A;  4IVN A;  2XAH A;  4LB5 A;  3I71 A;  3DNX A;  3EQL F;  2HKO A;  3DEU A;  4HLX A;  1UB9 A;  2DW4 A;  4IRG A;  2PN6 A;  4G7Z F;  2ZO4 A;  3GZ6 A;  3P7N A;  5D5X B;  2ZNZ A;  2RKH A;  2WWY A;  1BC8 C;  2C6Y A;  4S05 A;  3T8R A;  3ZN0 A;  5LGU A;  4KMU X;  1BOA A;  3DXJ F;  2NS0 A;  5BS6 A;  3IC7 A;  4LGW A;  5E1W A;  2A6H F;  3VOE A;  1TQM A;  4GYG A;  4M72 A;  3LAP A;  1PP8 F;  3WU0 A;  2RVC A;  2W57 A;  3P9I A;  5LGT A;  2QM3 A;  1ZGJ A;  5K5R A;  2A61 A;  5DYM A;  2GXB A;  1HST A;  4EQQ A;  1U78 A;  1U3E M;  1ZRE A;  4EMS A;  4Q48 A;  1O3T A;  3O6B B;  4PZJ A;  2P7C B;  3RJP A;  2L01 A;  5ICF A;  4WCG A;  4EVI A;  1O3R A;  4H0E A;  2K86 A;  4A12 A;  5LRR A;  4HF1 A;  4M6X A;  5L3E A;  2M5W A;  3KZZ A;  1XD7 A;  1HBX G;  2YPR A;  4NQW A;  2QQA A;  3CDH A;  4LD5 A;  4ZH4 F;  1F4K A;  5JR3 A;  1LDK B;  2WIZ A;  1XSV A;  3ZMS A;  2OQR A;  2DK5 A;  1MDM B;  5IT9 K;  2ZFW A;  3KP6 A;  4TV7 A;  2D2W A;  3GFJ A;  1SFX A;  5BQT A;  5HDG A;  3RKY A;  1BIB A;  4CDG A;  1W4M A;  3V8L A;  4Y17 A;  3CUQ B;  3GEZ A;  1F1Z A;  3TO9 A;  5HVQ C;  5BPI A;  4RB2 C;  3KP2 A;  3F6V A;  3KCC A;  1H9T A;  1LDJ A;  2Y75 A;  3P9C A;  2HDC A;  4A0X A;  2O6G E;  2V1D A;  3T0Y A;  4RAY A;  3L9F A;  5D6F A;  1BM9 A;  1EH7 A;  1BN5 A;  2PBI A;  2L4M A;  1DPR A;  1RZN A;  2R3S A;  4FX0 A;  3WG9 A;  1P4X A;  4HZF A;  1QZY A;  4AVP A;  3AAF A;  5DV5 A;  3U9G A;  5TRD A;  1W5T A;  3K69 A;  4LMY A;  4EV0 A;  1R58 A;  2IRF G;  3C18 A;  1IUY A;  2DK8 A;  3M7G A;  3TDU C;  1IN7 A;  3E6C C;  2ESH A;  5BOX A;  2OBP A;  4G6D A;  5H20 A;  3SFZ A;  1LQ1 A;  4BHP A;  3OOP A;  5EEH A;  2FRH A;  4Q47 A;  2PMU A;  3CUQ C;  1XDS A;  1Z91 A;  3G73 A;  4M6Y A;  1REP C;  3HRU A;  3CO7 C;  1MGT A;  5E8G A;  2ZYZ B;  3FMS A;  1ZLK A;  3LAJ A;  2R7F A;  1SMY F;  3J81 Z;  1FSE A;  2CV8 A;  2K27 A;  2ZXJ A;  4XLP F;  3R6S A;  4UV9 A;  3RKX A;  2WC2 A;  4ETS A;  3T1B A;  1I1G A;  5DEQ A;  2OQG A;  3J7A O;  1I6X A;  4ENK A;  2LKP A;  4A5N A;  2E1C A;  4Q5S F;  2F5F A;  1TW2 A;  2GZW A;  1KU2 A;  4TKD A;  4EGY A;  2QBY A;  4HBL A;  4HV6 A;  1FX7 A;  1G4D A;  4U0V A;  1QBJ A;  1ZRD A;  4Y13 A;  3KFW X;  4WXD A;  2VBY A;  2QUF A;  5CVU A;  1IN4 A;  1HKS A;  4RB0 A;  3KE2 A;  1FBU A;  2VLD A;  4KMF A;  4MQ9 F;  3V8K A;  2Z9O A;  1J5Y A;  2Z99 A;  2E7W A;  3QU6 A;  5FGM A;  4M73 A;  3WGG A;  2PFB A;  1FT9 A;  1P2F A;  5J8C A;  4NHJ A;  1Z05 A;  2DLL A;  4UHT A;  5BMZ A;  2G7H A;  3FMR A;  4HX7 A;  3WTX C;  3G3Z A;  2IP2 A;  3ABU A;  1R1U A;  3FXU A;  3HSF A;  4XLN F;  3DKW A;  1OR7 A;  3WTY C;  1RZ4 A;  3NRV A;  3HTU A;  3E6M A;  1FP1 D;  4EJV A;  2FCO A;  1MJA A;  3WGI A;  1UFM A;  4YFN F;  1HQC A;  3K9T A;  2CFX A;  1U2W A;  3ZPL A;  2MA3 A;  2IA2 A;  2CW0 F;  2LSO A;  3HIF A;  3W6K B;  1H9G A;  4M9X A;  5LHH A;  2MD5 A;  3D5L A;  3WU1 B;  2PMH A;  5KK1 A;  4AD9 A;  4HX8 A;  5FFX A;  4CIC A;  3L00 A;  1ZRF A;  1BI2 A;  3WTV C;  2G7U A;  5LEK A;  4MTD A;  3HYI A;  5A2Q K;  2BE5 F;  4ZZL A;  3GFM A;  4GXO A;  4U7B A;  4U0W A;  2FBI A;  2JRT A;  5CYV A;  3TO7 A;  1NHA A;  3ZN1 A;  2PLY A;  4IRI A;  3KEO A;  2DO7 A;  2VE8 A;  2ZCW A;  2DT5 A;  1R5H A;  2WJ0 A;  1RI7 A;  5CLS A;  1H0M A;  1CGP A;  4YFX F;  4HF0 A;  4M9S A;  2ACJ A;  1BIA A;  4ZYE A;  3K1N A;  5ERI A;  4HOB A;  1ZG5 A;  1BI3 A;  4PGH A;  4U0Y A;  4JQF A;  3IL2 A;  1FOK A;  2GWR A;  4G94 A;  5J6X A;  2PQ8 A;  5ICC A;  4I2O A;  2ZME A;  4KNY A;  4AIK A;  2P5K A;  1DDN A;  5D8L B;  5KVR A;  4CZZ A;  3MFK A;  4GO1 A;  1P92 A;  3B73 A;  2F5D A;  1YG2 A;  1YS6 A;  3QU3 A;  4ESB A;  1ONV A;  4M71 A;  1IRF A;  1RLV A;  3D0S A;  1XB4 A;  4KT5 C;  2NRA C;  3L2C A;  5D5V B;  3F8F A;  4G7H F;  2EFQ A;  2RGV A;  3FXQ A;  4QBL A;  3WTU C;  2EV5 A;  4L9J A;  2HYF A;  3P1Z B;  2XV4 S;  5JHU A;  1R23 A;  3FX3 A;  3WTS C;  2JT1 A;  2ISY A;  1O3S A;  1LJ9 A;  1KU9 A;  1YQA A;  2VE9 A;  3V8J A;  4HDU A;  3J81 K;  2XVC A;  1O7L A;  3F8B A;  3S2W A;  5AON A;  4A6D A;  2XIG A;  3M1E A;  2HGC A;  2MH2 A;  2E7X A;  1FPQ A;  2A07 F;  1XMK A;  3EDP A;  3TOB A;  1TQP A;  2V79 A;  3R4K A;  1WSU A;  2BEO A;  2GA1 A;  2BYV E;  4LG0 A;  1XMX A;  4EM2 A;  2MLG A;  4UVC A;  3RI4 A;  3I5U A;  4M9Z A;  2F2E A;  3QP6 A;  4BXU A;  5D5U B;  1XSD A;  1FZP B;  2FXA A;  4KUM A;  5LGN A;  2K4J A;  3SZT A;  4RGU A;  1BJA A;  5DCM A;  4HYE A;  4OIN F;  2P7V B;  3KET A;  3IKT A;  2O61 A;  2J5O A;  2ADU A;  2JZY A;  3C1D A;  3RDI A;  2A6E F;  1K78 B;  6PAX A;  1XGO A;  1G6N A;  1GXP A;  1S3J A;  4BQA A;  2QYO A;  1J9I A;  5AIQ A;  1U5T B;  5JFR A;  3TOA A;  2HFH A;  5FB2 A;  4QBN A;  2EA2 A;  2DU9 A;  1Y88 A;  1Z6T A;  4LG0 B;  4IPA A;  1YTY A;  2KJB A;  3RPU A;  1E2X A;  1BI0 A;  4Q4Z F;  2EFO A;  1R11 A;  3M8F A;  4R79 A;  2DFI A;  5D4S A;  3EYY A;  2EV6 A;  5E18 F;  3K1M A;  4OIP F;  4Z2Y A;  5HLG A;  4CYD A;  1OYY A;  4NB5 A;  3MZY A;  1MZB A;  4A6E A;  2M8E A;  1L3L A;  3ERE D;  3ZMU A;  4WK8 F;  1P6R A;  1B9N A;  3RIR A;  2VOO A;  3I54 A;  2KJC A;  1ZHF A;  5DD4 A;  4IHT A;  3N4M A;  4KIC A;  2MH9 A;  5HS8 A;  5FD5 A;  1JGS A;  3NEU A;  1ODD A;  4BNC A;  3HSE A;  1KQ0 A;  3LFK A;  3E6B A;  3I0T A;  2HTS A;  3KP7 A;  1GVJ A;  4BAY A;  2O3F A;  3CO6 C;  4ASN A;  3F6O A;  5L3C A;  1IN8 A;  2RN7 A;  4L9T A;  3E5Q A;  3BY6 A;  2RNJ A;  1HXD A;  3FXR A;  1MKM A;  4EM1 A;  1XGS A;  4GYI A;  1QO0 D;  1YIO A;  3DPT A;  4A0Z A;  1RIO H;  5DD8 A;  5FFZ A;  4UXN A;  1J2X A;  2LF8 A;  1R0V A;  3SQN A;  1YO5 C;  2P5L C;  2MLK A;  4FHT A;  2AXL A;  2DPU A;  2BV6 A;  2GIV A;  1ZG1 A;  2HYG D;  4OMZ A;  2L4A A;  5ED4 A;  3WOD F;  3F3X A;  4L9V A;  1YFH A;  2STT A;  2E1N A;  1TNS A;  3DP7 A;  4G9Y A;  4MEY F;  1G3S A;  1IAW A;  2Z33 A;  1C0W A;  2FEZ A;  4CHU A;  5E8I A;  4L9N A;  2XHK A;  4L18 B;  3KLN A;  2XAF A;  5FD6 A;  1XN7 A;  3DF8 A;  1FWZ A;  2P8T A;  5CVR A;  4R8H A;  3VOD A;  1WWX A;  3L09 A;  3I58 A;  1FYM A;  2X0L A;  3BJ6 A;  4YIF A;  3FM3 A;  2WIW A;  2M87 A;  4N9H A;  5HDN A;  2RV8 A;  4HDV A;  2PI0 A;  1G3T A;  3ELK A;  2VXZ A;  1LEA A;  2UZK A;  4MGR A;  1XMA A;  3I59 A;  1ZAO A;  2LNB A;  4OIO F;  2KRF A;  3C7J A;  1OB8 A;  4OIR F;  2YX7 A;  1S8N A;  3IWF A;  1LVA A;  3DQV C;  1L0O C;  4WF2 A;  3ZMD A;  2V6C A;  3JAM K;  4OU0 A;  5ICG A;  1SD6 A;  5HOO A;  3BOQ A;  1TQI A;  3WE2 A;  2VC0 A;  2FBH A;  2MBF A;  5CJ9 A;  3OV8 A;  2JPC A;  4XBF A;  3AJV A;  2IJL A;  5LHI A;  4EGZ A;  3GF2 A;  1FNN A;  2DQL A;  2AS5 F;  3E97 A;  4KN4 X;  4KYW A;  3SZP A;  3GFL A;  3WGH A;  1KQ9 A;  1TLH B;  4N0B A;  4FX4 A;  3KP3 A;  2Z3Y A;  2XKP A;  4G7O F;  2O8X A;  1G3Y A;  2EK5 A;  4B09 A;  1E17 A;  1ZG3 A;  2FA5 A;  4I98 B;  4ZYD A;  2K02 A;  4AWX B;  3ZMZ A;  1OYI A;  3C3W A;  4KIF A;  4P96 A;  2DAO A;  4G6Q A;  3HSR A;  1S29 A;  4XSZ F;  5CVI A;  2INB A;  3COA C;  3E5U A;  1FC3 A;  3K1P A;  4ESF A;  1KA8 A;  4L0Y B;  1A04 A;  2FOK A;  3QOP A;  4P9F A;  2HEO A;  1WKM A;  4ZYH A;  1V4R A;  4PDK A;  5LEJ A;  2KIF A;  2CYY A;  2ETH A;  4U88 A;  1J75 A;  2CG4 A;  1W7P D;  2OU2 A;  1ZAR A;  2VT2 A;  1T38 A;  1Z1D A;  2ZKZ A;  2PG4 A;  1RNL A;  2G9W A;  2L54 A;  1ON2 A;  5A2Q Z;  3E3V A;  4GCV A;  1S7O A;  2QEN A;  3RTR A;  4B8X A;  4BHC A;  3LA3 A;  2DTR A;  4ENJ A;  4KFC A;  3EET A;  1FYL A;  2VOD A;  4RGS A;  5CVJ A;  3IWZ A;  5ILU A;  1B59 A;  3B02 A;  5ILS A;  2A5Y B;  2MC3 A;  2XUB A;  2PEX A;  5ICE A;  3JTH A;  1UCR A;  1ZYR F;  1OYW A;  4ON0 A;  2GJW A;  2FF4 A;  3CUQ A;  4RGX A;  4RB3 C;  2CO5 A;  3KZY A;  4RAZ A;  2V9V A;  4E70 A;  4BYY A;  2EJR A;  2FSW A;  1WQ2 A;  1HH1 A;  3RYR A;  1STZ A;  1R5G A;  2ESN A;  2GA2 A;  1Y0U A;  3BDD A;  2W85 A;  1DPU A;  4PCQ A;  1KU7 A;  2VOP A;  3BZ6 A;  4EJO A;  2M45 A;  1SAX A;  1SFU A;  2Y48 A;  5HLH A;  2VT3 A;  1U5T C;  2ZNY A;  1KGS A;  4A5M A;  5FLX K;  3QPH A;  3I59 B;  3FF5 A;  1P4A A;  3U2R A;  3R0A A;  2P5V A;  2NNY A;  3VB2 A;  2Q2E A;  4LK1 F;  2V1U A;  1OKR A;  4A2U A;  2FNP A;  2JSC A;  2TDX A;  3O2P E;  3LWF A;  1T6S A;  2A68 F;  5CVV A;  1QQI A;  5HS7 A;  4LB6 B;  3GUD A;  2QBY B;  3V7R A;  2F5C A;  2A69 F;  3VEP A;  3FOV A;  4Y15 A;  1HKQ A;  1U8R A;  4LLN A;  3BWG A;  1FSH A;  5E20 A;  3F22 A;  4ZZD A;  3QPT A;  3E5X A;  4KIB A;  4HA8 A;  1Q1H A;  3P1Y A;  1BI1 A;  4LFU A;  3KLO A;  5FDK A;  1QPM A;  2B0L A;  4YFK F;  2VBW A;  5EEG A;  2H6B A;  2ZJ2 A;  2HQN A;  3BP8 A;  4HQE A;  4MTE A;  5IT9 Z;  2Q8K A;  1IN6 A;  4A0Y A;  3QRF F;  3VFZ A;  2XAQ A;  4CGZ A;  3W6J B;  4QBO A;  1XCV A;  1B9M A;  1QGP A;  2HTJ A;  3GX4 X;  2H94 A;  2K4B A;  2NNN A;  2YX4 A;  4L0Z B;  2H27 A;  1MDM A;  4EJT A;  2BBY A;  1KYZ A;  1Z7U A;  2DI3 A;  5D6E A;  3HHH A;  3MQ0 A;  4M74 A;  3N97 A;  2H09 A;  1IN5 A;  3J80 K;  3O3K A;  2W25 A;  2BGC A;  2D45 A;  5E1Z B;  3V4G A;  1R22 A;  3WTW C;  1SMT A;  2ELH A;  2EV0 A;  3TO6 A;  1D8K A;  1I5Z A;  3Q9V A;  5J8F A;  2VBZ A;  3HUG A;  5LHG A;  1ZLJ A;  4L5J A;  4P55 A;  1USS A;  2P6T A;  1S7A A;  3TDZ C;  2RC4 A;  2YR2 A;  2XRO A;  4CO8 A;  1MD0 A;  1IW7 F;  3LA7 A;  1V3F A;  3BPX A;  1W7P A;  2A3S A;  4OMY A;  4IF4 A;  3T5X A;  1RUO A;  1G3W A;  3BPV A;  3LQR A;  3HRM A;  4O3M A;  4KDP A;  2F5E A;  1IXR C;  1S6L A;  1PUE E;  1R00 A;  3R60 A;  1T2K A;  2P6S A;  1B6A A;  1O3Q A;  1XGN A;  3GWZ A;  3GXO A;  5L3F A;  2HWV A;  3ECO A;  5D8K B;  1TBX A;  4UV8 A;  2EFP A;  4AIJ A;  3BJO A;  3JSO A;  4JK1 X;  1P4W A;  3GW2 A;  3GVA A;  1GEF A;  3QP5 A;  4LLL A;  2ZME B;  5HLI A;  2QZ8 A;  4KA4 A;  1FP2 A;  2GAU A;  3IRR A;  2K7L A;  3L7W A;  2DBB A;  1R36 A;  1O7F A;  4WXC A;  4XRF A;  3ZMT A;  4WX9 A;  5HDK A;  2RQP A;  1TTY A;  4S04 A;  2XGX A;  1FLI A;  1JXS A;  2M30 A;  1AWC A;  3ZP5 A;  3I64 A;  5H6Q A;  2RDP A;  4IJA A;  2X4H A;  3I53 A;  4LJZ F;  2EA4 A;  1HW5 A;  1K78 A;  2V1X A;  2H6C A;  1ZH5 A;  3MWM A;  1U5T A;  3CLO A;  1OB9 A;  1IRG A;  1HW2 A;  1UST A;  2UXN A;  1LEB A;  3HTS B;  3MCZ A;  1R1V A;  1YS7 A;  1QNT A;  5FLX Z;  1BBY A;  2IPQ X;  5IT3 A;  3ABT A;  2XAS A;  1X3U A;  1MJB A;  1LDD A;  2J5P A;  3ECH A;  4U7D A;  5LLQ A;  1DP7 P;  1Y1O A;  2WCW A;  2KIU A;  3TQN A;  2M1B A;  2QQ9 A;  3IKV A;  3DV8 A;  3I4P A;  4YII A;  1J0R A;  3ZQ7 A;  5L3G A;  4F7Z A;  4K2E A;  4N9I A;  1JHH A;  2VC1 A;  3GFI A;  5DCF A;  2HQR A;  1ZN2 A;  2IA1 A;  3F8M A;  3U1D A;  2KIM A;  1HW1 A;  2VN2 A;  1XDU A;  4WXH A;  3WTZ A;  2YSR A;  2GW6 A;  1B4A A;  3GLX A;  4ESJ A;  2HS5 A;  4IHS A;  5DUI A;  4I0B A;  1J7K A;  2QVO A;  2D1V A;  4I09 A;  1D5V A;  2YU3 A;  3NQO A;  1Z9C A;  2OZ6 A;  3HOS A;  2Q0O A;  2ZYZ A;  3ZMV A;  1B1B A;  2JPB A;  1WRJ A;  5DUK A;  2R7D A;  2HR3 A;  3MEX A;  4DQ2 A;  2WV0 A;  2FBK A;  3BJA A;  2WCZ A;  1PDN C;  5L3D A;  1ULY A;  1TW3 A;  3KEQ A;  1FBQ A;  4UUV A;  3PQK A;  3ISP A;  2FNA A;  3REO A;  1RUN A;  4HX4 A;  3JTG A;  1W5S A;  2O03 A;  2EWN A;  2EFN A;  1D8J A;  4MNU A;  1YW9 A;  3PQJ A;  2PJP A;  2FMY A;  1KQ8 A;  1YYV A;  4JBA A;  4L5I A;  1KU3 A;  4MEX F;  4QLC U;  1UHM A;  3CJN A;  1W7P B;  4EJU A;  1ZP7 A;  1CF7 B;  3V7S A;  3RYP A;  5K5O A;  2O0Y A;  3K0L A;  3AJV B;  3SXY A;  3EYI A;  4HQM A;  3DPL C;  1R1T A;  2CSO A;  1DUX C;  4ZYG A;  1FBS A;  4HF2 A;  2IA0 A;  4EJW A;  2COM A;  3KP4 A;  1D3Y A;  2FE3 A;  3R0J A;  2HZT A;  2EB7 A;  2XRN A;  2FQ3 A;  4MHG A;  4UVB A;  4XSX F;  4LLG F;  2XAG A;  5JI6 A;  1JHF A;  3P1Z A;  1CF7 A;  1I1S A;  3Q5F A;  4IXA A;  4RB1 A;  2EFW A;  5JVT A;  5BPD A;  2Y0M A;  3M8E A;  2CGP A;  3WTT C;  2XAJ A;  3SHF A;  1HKT A;  2QQB A;  2QWW A;  4GGG A;  1IZ1 A;  1U6G A;  5K5Q A;  1Z6R A;  2L02 A;  2D1H A;  3T8T A;  3RPQ A;  1EH8 A;  5FO5 A;  1XGM A;  4UVA A;  2UXX A;  1A79 A;  4G8X A;  1F9N A;  3JAM Z;  2STW A;  4LK0 F;  1KYW A;  3JW4 A;  3F23 A;  1IXC A;  1FY7 A;  2IW5 A;  3JSP A;  2GXG A;  3PFI A;  4ENM A;  2HOE A;  1JE8 A;  1SD7 A;  4RS8 A;  3F72 A;  2XKO A;  4P5O A;  5D5W B;  2OZU A;  4DNC A;  2NYX A;  4I01 A;  4WWC A;  1SFE A;  4CXF A;  5F6F A;  1AOY A;  1YLF A;  3R61 A;  2W84 A;  4R1H A;  3P9K A;  3H3U A;  4BH9 A;  2OA4 A;  3ML6 A;  3HRT A;  4HW0 A;  2ISZ A;  2EO0 A;  4D0P A;  5HS9 A;  3F8N A;  3M9A A;  5H6R A;  4KIG A;  2VON A;  1YW7 A;  3FZV A;  4I7H A;  1K6O A;  5DDG A;  3LA2 A;  4RGR A;  3GO5 A;  3HRS A;  3QAH A;  1K79 A;  2FU4 A;  2LF7 A;  1FYK A;  1ON1 A;  2P4W A;  4EM0 B;  4TKK A;  3V7C A;  3HHG A;  2NAZ A;  4P9U A;  1OMI A;  3Q9S A;  4UNO A;  1HSJ A;  3EUH A;  1ZGA A;  3H3Z A;  5AIP A;  3RKW A;  1BC7 C;  1IPI A;  1I27 A;  3GZ5 A;  4KN7 X;  1OPC A;  5K1Y A;  3KP5 A;  1K7A A;  4ENN A;  4O6J A;  1TNT A;  2W24 A;  2HKX A;  5LBQ A;  4BHB A;  2CWE A;  4OIQ F;  1YW8 A;  3DFG A;  5E1X A;  5TJJ A;  1XCB A;  3FHZ A;  4I02 A;  4MQV A;  2LDU A;  4OOI A;  1WI9 A;  3FM5 A;  4FT8 A; 
#chains in the Genus database with same CATH topology
 3WE3 A;  1UHW A;  3U21 A;  1OJL A;  2KKO A;  4XIC A;  4YIR X;  5KAF C;  4IRH A;  1JKP C;  3OYC A;  4HAM A;  2WAD A;  1IV6 A;  4NC7 A;  3PNY A;  4YG2 F;  1LB2 A;  1T0F A;  1P7J A;  3F8C A;  1TWC J;  1F5T A;  4BQQ A;  3MZH A;  4IQ4 A;  3SFI A;  1UHS A;  2L0K A;  3CTA A;  3TKY A;  1EV7 A;  2VJI A;  3BQY A;  2IS2 A;  1YNM A;  2UWM A;  3J80 Z;  2CQK A;  2DQR A;  3IHU A;  3FWE A;  3HOX J;  3K2Z A;  3F21 A;  1POG A;  1YJN I;  1IRX A;  2NVU B;  2ECC A;  4AIH A;  1GHC A;  2GOX B;  4XK4 A;  2DN0 A;  3MMY B;  3BRO A;  2ZBK A;  3BT9 A;  1JKQ C;  4IO9 F;  3CUO A;  3DKY A;  1XC5 A;  3IRQ A;  2B63 J;  5HOD A;  4FET A;  3LST A;  2LK2 A;  1IF1 A;  3HOV J;  4LQE A;  2L3D A;  4C3H J;  4HRI A;  1QZZ A;  2L7M P;  3S17 J;  3E6D A;  2EZH A;  3TGN A;  1R7J A;  4PGG A;  2O9L A;  5F64 A;  2Z5U A;  5ILV A;  3S1Q J;  1VTN C;  4BUP A;  4O5V A;  4HV5 A;  2VBX A;  5J1Y A;  1ZRC A;  3HOY J;  2JA8 J;  1GXQ A;  1FMW A;  3MAJ A;  4HLY A;  3GYH X;  2OAZ A;  1ZTR A;  2K40 A;  3FMQ A;  2PMZ A;  1J59 A;  2CUE A;  2ZJR F;  1HOM A;  2R7Q A;  3HOT A;  1IV8 A;  3ROU A;  5E17 F;  1IXS B;  3S2H J;  1T39 A;  5DCM B;  3BG3 A;  2QLZ A;  2WTE A;  3VWB A;  5LRS A;  4UUS B;  1PP7 U;  1SD4 A;  2KZG A;  2IVM A;  3A0B C;  2DPD A;  4I0A A;  3PO3 J;  2DOD A;  3H92 A;  3ULQ B;  5F1R A;  1TT0 A;  2OKF A;  1EH6 A;  2FML A;  2ID6 A;  1OLT A;  2CQX A;  1MJ9 A;  3OL3 A;  2XB5 A;  1LNW A;  2OD5 A;  1JUP A;  1T98 A;  3LFU A;  2OST A;  2GOM A;  3S1N J;  1D0X A;  3S15 J;  5L3B A;  4BKX A;  1KON A;  2GQQ A;  3IEY A;  3HEF A;  3LQQ A;  3GZN B;  4QWQ A;  1XSX A;  2IT0 A;  5D4R A;  4I76 A;  2JTV A;  1O57 A;  2JVH A;  1SD5 A;  5J1U A;  4IVN A;  2XAH A;  4LB5 A;  1WZ2 A;  3I71 A;  1YRN A;  2BVM A;  1ZK8 A;  1WPK A;  5J40 A;  3DNX A;  2LRD A;  3EQL F;  2HKO A;  3BTL A;  3DEU A;  2BY2 A;  4HLX A;  2XGC A;  1UB9 A;  1S9H A;  3RQI A;  1J09 A;  2DW4 A;  4IRG A;  1IUF A;  2PN6 A;  1WJ5 A;  4G7Z F;  2ZO4 A;  3JRF A;  3Q0U A;  3ZR8 X;  1WVR A;  3P7N A;  3VDX A;  2ZNZ A;  5D5X B;  2IGN A;  2RKH A;  3NAU A;  4BY7 J;  2WWY A;  3K70 D;  3GTK J;  1BC8 C;  2C6Y A;  5LFA A;  2KMU A;  5DTD A;  1WJC A;  3BZK A;  1X3Z B;  2CFO A;  1IDZ A;  2OJE D;  4W1U A;  3KEY A;  3TP0 A;  4S05 A;  3T8R A;  3ZN0 A;  3GZ6 A;  5LGU A;  3GBG A;  2DMU A;  1MMA A;  4OAZ A;  3OYD A;  1B72 A;  4KMU X;  1MIJ A;  2JRM A;  2XPU A;  1IJW C;  1BOA A;  3DXJ F;  4ZJZ A;  2H8R A;  4UB8 C;  2NS0 A;  5BS6 A;  4I6Z A;  3EUA A;  3EUK L;  2CW8 A;  2FLC A;  3AG4 H;  3G2B A;  3IC7 A;  3VYR B;  4LGW A;  5E1W A;  3VYS B;  2A6H F;  2WAF A;  1AU7 A;  3VOE A;  2OF7 A;  1TQM A;  4GYG A;  4M72 A;  4KIS A;  2LKX A;  1T0F C;  2HPM A;  3LAP A;  4CCM A;  2EZI A;  1PP8 F;  3CJQ B;  1R4N B;  1V5G A;  3WU0 A;  2RVC A;  4C3J J;  2W57 A;  3P9I A;  3CC7 I;  2B9S A;  5LGT A;  2QM3 A;  1ZGJ A;  4PUS A;  1BR4 A;  2MSY A;  5K5R A;  2A61 A;  5DYM A;  2GXB A;  5JVG F;  3CD6 I;  2W82 A;  1HST A;  4A3M J;  1MBK A;  2FOW A;  3K4J A;  4EQQ A;  3FK7 A;  1U78 A;  3K4N A;  3K4K A;  1U3E M;  1ZRE A;  2VKV A;  2K9L A;  3W2W A;  4EMS A;  4Q48 A;  4X0G A;  1O3T A;  3O6B B;  1H8A C;  4PZJ A;  2BY0 A;  2P7C B;  5DM7 F;  4M3G A;  2E2I J;  3RJP A;  4XON A;  2L01 A;  3Q0V A;  5ICF A;  2Z0R A;  4WCG A;  2MGQ A;  4EVI A;  1O3R A;  1I50 J;  2E60 A;  5F0H A;  4H0E A;  2K86 A;  4A12 A;  5LRR A;  4HF1 A;  4M6X A;  5L3E A;  3HZJ A;  1X1C A;  2M5W A;  3KZZ A;  1XD7 A;  1K4S A;  1HBX G;  2YPR A;  3OL4 A;  2QQA A;  4NQW A;  1U9N A;  3CDH A;  4XL9 A;  1UJ8 A;  4LD5 A;  2IS6 A;  4ZH4 F;  4LIV A;  4IHW A;  3ZXS A;  1BOB A;  2LR8 A;  2KIQ A;  3OYI A;  1F4K A;  5JR3 A;  1LDK B;  2WAQ A;  5KNL A;  3O8G A;  2WIZ A;  1XSV A;  1JUS A;  3ZMS A;  2OQR A;  2DK5 A;  2VI6 A;  1MDM B;  1ITY A;  5IT9 K;  2XRL A;  2ZFW A;  1R49 A;  3KP6 A;  4TV7 A;  4H4K C;  1E3O C;  1RC9 A;  2D2W A;  1YJW I;  3GFJ A;  1SFX A;  3V42 A;  3JRI A;  2ICW G;  5BQT A;  2Z1D A;  2VJJ A;  5HDG A;  2DDA A;  4BJ6 C;  1AKH A;  3RKY A;  1BIB A;  2JK3 A;  1ORK A;  4XLH A;  3L2Q A;  2X6X A;  3K4L A;  4CDG A;  1WH5 A;  1W4M A;  4D5C A;  1B8I A;  1VQ5 I;  4E7H A;  4QPQ A;  4Y17 A;  3V8L A;  2A05 A;  3CUQ B;  3GEZ A;  1F1Z A;  2HNH A;  3TO9 A;  5HVQ C;  5BPI A;  4RB2 C;  1MW7 A;  3KP2 A;  3F6V A;  3KCC A;  1H9T A;  5KHD A;  2K3F A;  3BTJ A;  1LDJ A;  2Y75 A;  4D9J A;  3P9C A;  2E5N A;  2HDC A;  3H9J A;  1VQ6 I;  3M1C A;  1RES A;  4A0X A;  4MIM A;  2V1D A;  2O6G E;  3RZD J;  1QA6 A;  1DGR M;  3S3M A;  3T0Y A;  4RAY A;  3L9F A;  5D6F A;  1BM9 A;  1EH7 A;  3ERM A;  1BN5 A;  2PBI A;  2X9D A;  1V54 H;  2L4M A;  2W1O A;  3K7A J;  3HKZ N;  1DPR A;  2OTJ I;  1RRJ A;  1RZN A;  2R3S A;  4FX0 A;  3NAR A;  5E3O A;  3WG9 A;  3ZQL A;  4ZDP A;  1BW5 A;  1P4X A;  4HZF A;  1QZY A;  4AVP A;  3AAF A;  5DV5 A;  3MKW B;  1XS9 A;  2WBM A;  2ZC2 A;  3U9G A;  3PO2 J;  5TRD A;  5EZG A;  4RA2 A;  4PFO A;  4IX7 A;  1V5F A;  4ITV A;  3GTM J;  3CP8 A;  1W5T A;  3K69 A;  3AFH A;  2O7O A;  4LMY A;  4EV0 A;  4DJA A;  2E19 A;  3QYE A;  1R58 A;  2IRF G;  3C18 A;  1IUY A;  2DK8 A;  4YRV A;  3OOU A;  3M7G A;  3PUB A;  3TDU C;  4BEH A;  5E3L A;  1IN7 A;  5FRM A;  3E6C C;  2ESH A;  5BOX A;  2OBP A;  4G6D A;  1Y8Q B;  5H20 A;  5GPC A;  3OY9 A;  2LYC A;  3IH2 A;  3SFZ A;  1LQ1 A;  4BHP A;  3OOP A;  5B3S H;  5FRO A;  5EEH A;  2LBF A;  2FRH A;  4A3B J;  1IDY A;  4Q47 A;  3S3O A;  2PMU A;  3CC4 I;  3CUQ C;  3FKJ A;  5F1J A;  1XDS A;  3JRG A;  1S5L C;  2F4M B;  3OIP A;  3JRA A;  1Z91 A;  3G73 A;  3TMO A;  3ASO H;  3KIO A;  4HNU A;  3IAS 2;  1GUU A;  4M6Y A;  2LD5 A;  1VFC A;  1N25 A;  2GXA A;  3G1M A;  1REP C;  3CME I;  3HRU A;  1KZH A;  2CV0 A;  2OPT A;  2DFF A;  4A3L J;  3CO7 C;  3AG1 H;  1MGT A;  5E8G A;  3CCY A;  3I4N J;  2ZYZ B;  3FMS A;  1ZLK A;  3LAJ A;  2R7F A;  3UKG A;  2ZJP F;  1SMY F;  4B43 A;  3B6C A;  1D5Y A;  3J81 Z;  2VUM J;  1FSE A;  2CV8 A;  2K27 A;  2ZXJ A;  2GLO A;  1X19 A;  1W36 D;  4CYC B;  3CCR I;  4XLP F;  3R6S A;  1W5C C;  4IQJ A;  4HNV A;  2IAI A;  2OC6 A;  4UV9 A;  4NDL A;  2OTL I;  1Y1V J;  2KQR A;  3RKX A;  1PUF A;  4S0H B;  2WC2 A;  4ETS A;  3T1B A;  1I1G A;  1RKW A;  2VQG A;  5DEQ A;  2OQG A;  3J7A O;  2ZXI A;  1I6X A;  4MFD A;  4ENK A;  3ONQ A;  2LKP A;  1A5J A;  4A5N A;  2E1C A;  4Q5S F;  2F5F A;  4A3K J;  1TW2 A;  4DYR A;  2GZW A;  1TZL A;  4X1E A;  3CCJ I;  1KU2 A;  4TKD A;  4NC6 A;  1EA3 A;  2JN6 A;  4EGY A;  3HC7 A;  2QBY A;  4HBL A;  3CP2 A;  4HV6 A;  1FX7 A;  1YRN B;  1G4D A;  4U0V A;  1QBJ A;  5BNG A;  1ZRD A;  1U8B A;  1RET A;  1GV5 A;  2ZXH A;  4Y13 A;  2JSP A;  2LMD A;  3KFW X;  4A3J J;  4D7N A;  4WXD A;  2VBY A;  2QUF A;  5CVU A;  1Y6I A;  1IN4 A;  3JCU C;  1HKS A;  4RB0 A;  3KE2 A;  1FBU A;  2VLD A;  4JOM A;  4KMF A;  4MQ9 F;  4CCJ A;  1OCT C;  3V8K A;  1J5Y A;  2Z9O A;  2Z99 A;  2E7W A;  4UY8 I;  2NVY J;  4KT6 A;  3OYF A;  3ZQG A;  3QU6 A;  5FGM A;  4C2T A;  3I9V 2;  4M73 A;  2XSD C;  3WGG A;  2PFB A;  1JJ8 C;  1FT9 A;  1P2F A;  5J8C A;  1X3W B;  4NHJ A;  1Z05 A;  4HPQ A;  2DLL A;  4UHT A;  5BMZ A;  2G7H A;  4CZC A;  2X48 A;  3RPU D;  3FMR A;  3H9G A;  4HX7 A;  3S1M J;  2DA3 A;  3DBL B;  4P1W A;  3WTX C;  3G3Z A;  1VQN I;  2IP2 A;  3ABU A;  5C44 J;  1R1U A;  2RAE A;  3FXU A;  1WH7 A;  3HSF A;  4XM3 A;  4XLN F;  2M3A A;  3DKW A;  2K3P A;  1OR7 A;  3WTY C;  1RZ4 A;  3I3L A;  3NRV A;  5J4Y A;  3HTU A;  3E6M A;  1FP1 D;  4EJV A;  3PIO F;  2FCO A;  1MJA A;  2VAS A;  3WGI A;  1TWF J;  1UFM A;  2L9R A;  4YFN F;  1HQC A;  5IP9 J;  3K9T A;  4BXF A;  2CFX A;  1U2W A;  3JRC A;  2HOT A;  3ZPL A;  2MA3 A;  2IA2 A;  2CW0 F;  2LSO A;  3DU5 A;  3HIF A;  2DMP A;  3NWT A;  3W6K B;  1WJD A;  2EZL A;  2DFE A;  4HSR A;  4XOT A;  1H9G A;  4M9X A;  3OWT A;  5LHH A;  2GM4 A;  1PUF B;  1D1A A;  4BDY A;  1QZE A;  2CV1 A;  2MD5 A;  2FL3 A;  4B1R A;  4CCK A;  1DP3 A;  2KL4 A;  4HST A;  1G2H A;  3D5L A;  3WU1 B;  2PMH A;  2L9N A;  2K9S A;  5KK1 A;  1F43 A;  4DZJ A;  4AD9 A;  1MSE C;  3LSM A;  1ZKG A;  1HLV A;  1E0E A;  4HX8 A;  2HYJ A;  5FFX A;  2VKH A;  3FK6 A;  4CIC A;  2QQ8 A;  1AA7 A;  3L00 A;  4F3Q A;  1ZRF A;  1BI2 A;  2KDO A;  3WTV C;  2PX9 A;  4Y3O A;  3TBI A;  2DBS A;  2G7U A;  2XF7 A;  4XN3 A;  1VZ0 A;  1CQT A;  2DMN A;  5LEK A;  2LP0 A;  4MTD A;  3HYI A;  5A2Q K;  2BE5 F;  4AUX A;  1YI2 I;  3GME A;  4ZZL A;  3GFM A;  4C2U A;  4GXO A;  4U7B A;  4U0W A;  1WJE A;  1IGN A;  2FBI A;  3VSL A;  2JRT A;  5CYV A;  3TO7 A;  1NHA A;  3ZN1 A;  5B66 C;  2PLY A;  3LL7 A;  4IRI A;  1T33 A;  2NS7 A;  2ZFU A;  3KEO A;  2HZD A;  2HDD A;  1SFK A;  2DO7 A;  2BZT A;  2VE8 A;  1ETV A;  2ZCW A;  2DT5 A;  1R5H A;  2WJ0 A;  3D5R C;  1RI7 A;  5CLS A;  1H0M A;  5CKT A;  3W2V A;  5IOY A;  1CGP A;  4DAV A;  4YFX F;  3W2A A;  3H1C A;  4HF0 A;  2BHY A;  3OS1 A;  4FE4 A;  4M9S A;  1QHG A;  3E1S A;  3DLA A;  2ACJ A;  2BVL A;  1BIA A;  2DFH A;  4ZYE A;  3K1N A;  3C2H A;  5ERI A;  4HOB A;  1ZG5 A;  1V55 H;  1BI3 A;  3OR2 C;  4PGH A;  4U0Y A;  4JQF A;  3IL2 A;  1SAU A;  1FOK A;  1VQP I;  4GDF A;  1M1E B;  2GWR A;  5M5W J;  4G94 A;  5J6X A;  2CZR A;  2PQ8 A;  5ICC A;  2X1E A;  3FKI J;  4BEH B;  4I2O A;  2ZME A;  4KNY A;  4AIK A;  2P5K A;  1DDN A;  5D8L B;  5KVR A;  3HDD A;  4XOP A;  4CZZ A;  3MFK A;  1IO2 A;  2IGK A;  1OCR H;  2M4G A;  4GO1 A;  5F0C A;  3D1N I;  1P92 A;  2LBF B;  3B73 A;  5GP9 A;  4DA2 A;  4DAP A;  2F5D A;  1YG2 A;  2IS1 A;  4J00 A;  1YS6 A;  3QU3 A;  4ESB A;  4QTR A;  3A1Y A;  3L2W A;  3BTC A;  1ONV A;  1WHU A;  3G6E I;  4M71 A;  1IRF A;  2CW7 A;  2MYS A;  1RLV A;  3SDB A;  3D0S A;  1YIJ I;  1XB4 A;  1TWA J;  2E1O A;  4KT5 C;  4PSX A;  2NRA C;  3L2C A;  5D5V B;  1SAN A;  3F8F A;  3ZRG A;  4G7H F;  2EFQ A;  3H0G J;  2RGV A;  3FXQ A;  4D5F A;  1LFP A;  4J19 A;  4QBL A;  3WTU C;  2KLO A;  4EEF G;  2EV5 A;  3L1P A;  1TWG J;  1QU3 A;  4L9J A;  4PJJ A;  1HA8 A;  2HYF A;  2A6T A;  3P1Z B;  2XV4 S;  5JHU A;  1R23 A;  3DTK A;  3FX3 A;  4IOC F;  2DOE A;  3HPH A;  3WTS C;  3O8H A;  2JT1 A;  2ISY A;  3PFY A;  1O3S A;  4BXX J;  1LJ9 A;  1Z77 A;  1KU9 A;  3PM1 A;  1YQA A;  2VE9 A;  3V8J A;  4DIQ A;  4HDU A;  1A6Q A;  1FIA A;  3J81 K;  2XVC A;  4UUT A;  3HOU J;  1ETQ A;  3HG9 A;  3ASN H;  1O7L A;  3F8B A;  3S2W A;  9ANT A;  2KDZ A;  4LG3 A;  5AON A;  4XOR A;  4A6D A;  2XIG A;  3OMY A;  4NC8 A;  2EZK A;  3M1E A;  2VJ4 A;  5TGT A;  2WB1 A;  2HGC A;  3BG9 A;  1WJB A;  2MH2 A;  2E7X A;  1FPQ A;  2B7E A;  2A07 F;  1XMK A;  4F93 B;  5DM6 F;  4YEL A;  1YX5 A;  4ZC3 A;  4AM3 A;  2XF5 A;  3RSN A;  3EDP A;  1LFB A;  1SVL A;  4D7M A;  3FXM A;  3TOB A;  3IV5 A;  4KJZ A;  1TQP A;  2V79 A;  3R4K A;  1JJ6 C;  1WSU A;  4ABZ A;  3FBI B;  5EG0 B;  4CCO A;  3IP4 B;  2YUS A;  2BEO A;  5F27 A;  3K4C A;  1T56 A;  1K61 A;  2WA0 A;  3DEW A;  2E34 A;  3PNT A;  3S2D J;  2ZSI B;  1VF9 A;  2GA1 A;  2BYV E;  3G1O A;  1X1P A;  4GFB A;  4LG0 A;  1XMX A;  4EM2 A;  5J3L A;  4PFP A;  2MLG A;  3MN2 A;  2L7K A;  3I5U A;  4UVC A;  3RI4 A;  4M9Z A;  4HNT A;  3CCQ I;  5IY5 H;  2F2E A;  3QP6 A;  4BXU A;  5D5U B;  4E7I A;  1XSD A;  2MG4 A;  1FZP B;  2FXA A;  4KUM A;  1JGG A;  4OAY A;  5LGN A;  3JRH A;  1V5E A;  5IYD J;  2K4J A;  2JWT A;  3HM5 A;  3QPS A;  3SZT A;  1OCO H;  4RGU A;  2COB A;  1BJA A;  5DCM A;  3GTQ J;  4HYE A;  4OIN F;  2HVS A;  2P7V B;  1I3Q J;  3BR2 A;  2Z16 A;  3BC8 A;  5KCM A;  3KET A;  3KZI C;  3IKT A;  2O61 A;  2J5O A;  3OYA A;  2ADU A;  3WG7 H;  4JX5 A;  2JZY A;  3BG7 A;  3C1D A;  3RDI A;  2A6E F;  1K78 B;  1E3P A;  6PAX A;  2XGD A;  3FIW A;  2V7F A;  1XGO A;  4A93 J;  3A02 A;  1G6N A;  1GXP A;  1S3J A;  4BQA A;  1GVD A;  4IHX A;  2QYO A;  1J9I A;  5AIQ A;  2P0W A;  4A3F J;  1U5T B;  1VQ7 I;  5JFR A;  3TOA A;  3ZGK A;  2HFH A;  1S72 I;  1HCR A;  5FB2 A;  2NOJ B;  2DCE A;  2TCT A;  4QBN A;  2EA2 A;  2F48 A;  2DU9 A;  5EGO A;  1Y88 A;  1Z6T A;  4LG0 B;  4IPA A;  1YTY A;  1JKO C;  3E7L A;  1D0Y A;  2KJB A;  2EIJ H;  3RPU A;  3KPH A;  5FKK A;  3KX2 A;  4JX6 A;  3EPZ A;  1HDP A;  3RQ4 A;  2H8W A;  1E2X A;  1UZC A;  2MAB A;  1X2N A;  1BI0 A;  1R6R A;  4Q4Z F;  1W0U A;  2HI3 A;  1QVT A;  2R92 J;  2EFO A;  1ENH A;  1R11 A;  4G12 A;  3M8F A;  3P5J A;  4R79 A;  2DFI A;  5D4S A;  4PK4 A;  2LKS A;  3EYY A;  4RMN A;  1MSF C;  2EV6 A;  1I3A A;  5E18 F;  3K1M A;  2QKL B;  2VXD A;  4NBQ A;  3SYT A;  3JRD A;  2LY9 A;  2DT6 A;  5C4X J;  4X6A J;  3C2B A;  4OIP F;  4Z2Y A;  2W7N A;  3JR9 A;  3TW6 A;  1K4T A;  2O8K A;  5HLG A;  2Y31 A;  4CYD A;  4ANJ A;  1OYY A;  4NB5 A;  2QSH X;  3MZY A;  1MZB A;  2ME6 A;  4BQN A;  4A6E A;  2M8E A;  4RAG A;  5E3N A;  1L3L A;  2NVX J;  3TL4 X;  2ME0 A;  3ERE D;  3ZMU A;  4WK8 F;  1P6R A;  1B9N A;  2CRG A;  3A0H C;  3RIR A;  5FLM J;  4Y52 J;  2W00 A;  2V9P A;  2VOO A;  3I54 A;  2KJC A;  1FJL A;  1ZHF A;  5DD4 A;  4IHT A;  3OYH A;  3N4M A;  4KIC A;  2MH9 A;  5HS8 A;  1Y0N A;  5FD5 A;  3A03 A;  3CCL I;  1JGS A;  2R7W A;  3NEU A;  1ODD A;  4CA0 A;  4BNC A;  3HSE A;  1KQ0 A;  3LFK A;  1SFO J;  2V1N A;  2G0E A;  3E6B A;  2F6C A;  1MMS A;  3I0T A;  4XMY A;  2HTS A;  4PJL A;  2MFZ A;  1MH3 A;  4OWR B;  3CCS I;  3KP7 A;  1GVJ A;  1MBH A;  4BAY A;  2KRC A;  2O3F A;  3A2K A;  4ASN A;  2X6Y A;  3CO6 C;  1BA5 A;  3F6O A;  4Z6Y A;  3DCF A;  5L3C A;  1IN8 A;  4II3 A;  2RN7 A;  4L9T A;  3E5Q A;  4XKB A;  3BY6 A;  1U0J A;  3FXR A;  1HXD A;  2RNJ A;  2Y0S N;  5J47 A;  1MKM A;  3SEQ A;  4EM1 A;  1XGS A;  2WAQ N;  4GYI A;  1QO0 D;  1YIO A;  3DPT A;  4A0Z A;  1RIO H;  5DD8 A;  3L2U A;  5FFZ A;  4UXN A;  3H5A A;  1U9O A;  5EF6 A;  1J2X A;  2LF8 A;  2IXS A;  1R0V A;  3SQN A;  1YO5 C;  2P5L C;  2MLK A;  2NOG A;  3MZ8 A;  4FHT A;  2AXL A;  2R93 J;  2DPU A;  3BZC A;  1XX5 A;  2BV6 A;  2GIV A;  1ZG1 A;  2HYG D;  4OMZ A;  1RKT A;  2L4A A;  4UUS A;  5ED4 A;  3WOD F;  3F3X A;  4L9V A;  1YFH A;  4B48 A;  2STT A;  3OYG A;  3VYT B;  2EIK H;  2E1N A;  4JX4 A;  1TNS A;  2WY8 Q;  5E3M A;  2X6W A;  3PUF A;  2E1M C;  3DP7 A;  2R5Y B;  4G9Y A;  4MEY F;  1G3S A;  1K6Y A;  2EBI A;  3TW7 A;  4XNF A;  1IAW A;  3K2A A;  2Z33 A;  3DPU A;  4CCN A;  1C0W A;  2FEZ A;  4CHU A;  5E8I A;  4L9N A;  5J1R A;  3TED A;  2XHK A;  4A3I J;  4L18 B;  3FXL A;  2XAF A;  3KLN A;  5FD6 A;  2R7S A;  1XN7 A;  1SVO A;  3DF8 A;  1FWZ A;  2X85 A;  2P8T A;  2ZJQ F;  5CVR A;  4R8H A;  3G4S I;  3HGG A;  3KYD B;  3VOD A;  1WWX A;  2CUF A;  3L09 A;  4IKF A;  3I58 A;  3ZOB A;  1FYM A;  2F5V A;  4MO7 A;  5JLX A;  2CQN A;  2DOA A;  3BJ6 A;  2X0L A;  2K9N A;  2DYR H;  3HXL A;  3FM3 A;  4YIF A;  3CMA I;  2WIW A;  2M87 A;  4N9H A;  1UWV A;  4DYQ A;  1X2M A;  3GTJ J;  3S14 J;  5HDN A;  2RV8 A;  4HDV A;  2PI0 A;  1G3T A;  5M3M J;  3ELK A;  2VXZ A;  3H3V K;  5H2F C;  1LEA A;  2UZK A;  2FQ4 A;  1RPW A;  2DA6 A;  4MGR A;  1TL8 A;  1XMA A;  3I59 A;  1ZAO A;  2LNB A;  4OIO F;  2KRF A;  3JRE A;  3GTL J;  4A3D J;  3C7J A;  2TRT A;  1OB8 A;  3H36 A;  3L2V A;  3ZQF A;  5EDN A;  3OYN A;  2ECB A;  4OIR F;  2YX7 A;  1S8N A;  3IWF A;  1LVA A;  2F4O B;  2K9Q A;  3QPL A;  5GTH C;  1A6I A;  3DQV C;  3LSI A;  1A35 A;  1L0O C;  1BR2 A;  3PIP F;  2NVQ J;  3B6A A;  4WF2 A;  3ZMD A;  2V6C A;  1ZEL A;  5HNF A;  3JAM K;  4OU0 A;  3K6G A;  5ICG A;  4PJ0 C;  1SD6 A;  5HOO A;  1JTY A;  2UV1 A;  3BOQ A;  1TQI A;  3WE2 A;  4C30 A;  2HXI A;  2VC0 A;  3FHN A;  2VQC A;  5EZH A;  2FBH A;  4CH7 A;  2R0Q C;  3J7A Y;  2MBF A;  1JKR C;  5CJ9 A;  2K5C A;  3CDI A;  3OV8 A;  1OR7 C;  3HB9 A;  2JPC A;  3QWL A;  2YU9 J;  2XAU A;  4XBF A;  2K85 A;  3FXO A;  3CF5 F;  4CCL A;  3AJV A;  2IJL A;  5LHI A;  1UEL B;  4EGZ A;  1YE9 A;  3GF2 A;  1FNN A;  4XQF A;  2DA2 A;  1O4X A;  2DQL A;  2AS5 F;  3E97 A;  4KN4 X;  4KYW A;  3SZP A;  3GFL A;  3WGH A;  1KQ9 A;  2LH9 A;  2BH2 A;  2EIN H;  1TLH B;  1YOV B;  3M8J A;  4N0B A;  4FX4 A;  3KP3 A;  2Z3Y A;  1Z3X A;  2XKP A;  2ZME C;  3IH3 A;  4QSH A;  4G7O F;  2O8X A;  1IRZ A;  3BT7 A;  1G3Y A;  2EK5 A;  4B09 A;  1E17 A;  4AID A;  1ZG3 A;  2FA5 A;  4I98 B;  2FKC A;  4NQW B;  4ZYD A;  2K02 A;  2OCE A;  4BBS J;  4AWX B;  3ZMZ A;  1OYI A;  3C3W A;  2R5Y A;  4KIF A;  4P96 A;  2DAO A;  1JTX A;  4G6Q A;  1MMN A;  2WV1 A;  3HSR A;  1S29 A;  4XSZ F;  1MBE A;  5EYR A;  5CVI A;  2VPL A;  2INB A;  2GBY A;  4JYK A;  3H0D A;  2V6E A;  3COA C;  2XPV A;  3E5U A;  3H9Q A;  1VI0 A;  1FC3 A;  1FOY A;  3K1P A;  1Q1V A;  2K9M A;  4DW6 A;  2ID3 A;  4ESF A;  3S3N A;  2Q1Z B;  2XF6 A;  4D1Q A;  5B1A H;  3MKZ A;  1KA8 A;  2DJI A;  1A04 A;  4L0Y B;  2X51 A;  2FOK A;  3MKY B;  3QOP A;  4P9F A;  3I56 I;  1TC3 C;  2HEO A;  2W8M A;  4FQG A;  1WKM A;  4Y4R A;  4ZYH A;  1V4R A;  4PDK A;  1DGW Y;  4YEJ A;  5LEJ A;  2KIF A;  2CYY A;  4ZYA A;  2ETH A;  2LFB A;  5F04 A;  4U88 A;  2JUC A;  4M3B A;  3AG3 H;  3AL0 C;  5GAD J;  1J75 A;  2CG4 A;  4A3C J;  3VYU B;  2R7X A;  1W7P D;  2OU2 A;  1ZAR A;  2VT2 A;  3EUH C;  1SEU A;  1T38 A;  4XLF A;  2M8G X;  3OSF A;  1Z1D A;  2BXZ A;  2PG4 A;  2ZKZ A;  4DYC A;  2HVQ A;  1RNL A;  2L2O A;  5CQE A;  1DU6 A;  2G9W A;  2L54 A;  1ON2 A;  5A2Q Z;  3E3V A;  4GCV A;  1S7O A;  2QEN A;  5CQG A;  3RTR A;  4B8X A;  1A36 A;  4BHC A;  3LA3 A;  2DTR A;  2OV7 A;  4ENJ A;  4KFC A;  3EET A;  4BBR J;  1RR8 C;  1FYL A;  2VOD A;  4RGS A;  5CVJ A;  3IWZ A;  5ILU A;  3K4M A;  1B59 A;  4XLC A;  4AU7 A;  3B02 A;  5ILS A;  3S16 J;  2E36 A;  1F36 A;  2LG4 A;  4XRS G;  3CC2 I;  2A5Y B;  2MC3 A;  2XUB A;  2PEX A;  1N78 A;  5ICE A;  4LK0 F;  2OCC H;  2L9S A;  3JTH A;  2V9K A;  3CJT B;  1AKH B;  1UCR A;  3ZQQ A;  1ZYR F;  4I99 C;  1OYW A;  4ON0 A;  2GJW A;  1Y39 A;  3CF2 A;  2FF4 A;  2E5Z A;  3CUQ A;  4RGX A;  1ETX A;  4RB3 C;  2CO5 A;  3KZY A;  4RAZ A;  2M34 A;  1IC8 A;  2V9V A;  4E70 A;  3HOZ J;  4BYY A;  2ELJ A;  2LC2 A;  2EJR A;  2FSW A;  1WQ2 A;  1HH1 A;  4DBR A;  3UNG C;  3RYR A;  1STZ A;  1R5G A;  2ESN A;  2GA2 A;  3OYL A;  3QYF A;  1Y0U A;  4RM3 A;  4JP0 A;  1APL C;  3BDD A;  1H88 C;  2N8G A;  3AG2 H;  2W85 A;  1DPU A;  4PCQ A;  1KU7 A;  1YJ9 I;  2VOP A;  3BR5 A;  3BZ6 A;  1PYV A;  4EJO A;  2M45 A;  3FBN B;  1SAX A;  1OFC X;  1Z7L A;  4IHV A;  3K10 A;  1A31 A;  3OYB A;  1SFU A;  2AQF A;  2Y48 A;  5IP7 J;  5HLH A;  2VT3 A;  1U5T C;  2ZNY A;  2CV2 A;  1VQ9 I;  1KGS A;  4A5M A;  5FLX K;  3QPH A;  2JA5 J;  3I59 B;  1TT5 B;  3QOD A;  1GDT A;  3FF5 A;  3VSK A;  4BJT A;  1XPX A;  2CQ7 A;  1P4A A;  3OS0 A;  4IOA F;  1N75 A;  2HQ5 A;  3U2R A;  3J7Y J;  3R0A A;  2P5V A;  2NNY A;  3F0C A;  3VB2 A;  3J7Z I;  2QSG X;  2XGE A;  2Q2E A;  4W97 A;  4LK1 F;  2V1U A;  1OKR A;  2Y9Y A;  4RDU A;  4A2U A;  2FNP A;  2JSC A;  2TDX A;  3QOE A;  5F08 A;  1WJF A;  2E2J J;  4MFE A;  3O2P E;  2KFD A;  3LWF A;  2V26 A;  1G8X A;  1T6S A;  2KHM A;  2A68 F;  5CVV A;  1WFX A;  4E7S A;  3MD2 A;  5EGO B;  1JT0 A;  1QQI A;  4ZQU A;  2FUG 2;  2QKM B;  1B72 B;  4EV1 A;  5HS7 A;  1T95 A;  2FKH B;  4LB6 B;  3GUD A;  3FDY A;  1X58 A;  2HXO A;  3V7R A;  2QBY B;  2R7O A;  3ABK H;  1MMD A;  2F5C A;  4F52 A;  3DBH B;  2LOO A;  3SJM A;  3QQA A;  4XKC A;  2A69 F;  2I8D A;  3VEP A;  4BU2 A;  5GAE J;  3FOV A;  4Y15 A;  5GTI C;  1HKQ A;  1UG0 A;  5CPR B;  4ZTF A;  1U8R A;  4LLN A;  4NNJ A;  3BWG A;  1FSH A;  4B44 A;  4NUB A;  3DU6 A;  5E20 A;  4MLO A;  2Y2Z A;  3F22 A;  4ZZD A;  3QPT A;  3E5X A;  4KIB A;  4HA8 A;  3WHB A;  1I39 A;  2QF7 A;  1Q1H A;  3P1Y A;  2M2E A;  1BI1 A;  1UAA A;  2KIS A;  4RLF A;  4LFU A;  4F92 B;  3KLO A;  5FDK A;  1QPM A;  2B0L A;  2RQQ A;  4YFK F;  2KRH A;  2ELK A;  3ZQI A;  2VBW A;  5EEG A;  2IGO A;  2H6B A;  1MBF A;  1OIS A;  2ZJ2 A;  3CES A;  1PJR A;  2HQN A;  2CQQ A;  2QEX I;  3KYC B;  3BP8 A;  1ZR4 A;  4HQE A;  2CS3 A;  2BW3 B;  2VLA A;  4MTE A;  3BQZ A;  5IT9 Z;  2Q8K A;  2XDV A;  2PJR A;  4RAF A;  5E79 C;  1IN6 A;  3BR1 A;  4A0Y A;  3QRF F;  3VFZ A;  2XAQ A;  4CGZ A;  3W6J B;  4QBO A;  1XCV A;  1GT0 C;  1B9M A;  3DTI A;  1QGP A;  3IF0 X;  3I4M J;  2HTJ A;  3GX4 X;  1WCM J;  3D5S C;  2H94 A;  2K4B A;  2NNN A;  2YX4 A;  4L0Z B;  1WJA A;  3K4B A;  2H27 A;  1VQM I;  1MDM A;  4EJT A;  2BBY A;  4FAS D;  1KYZ A;  1Z7U A;  2DI3 A;  5D6E A;  3HHH A;  1LKX A;  1JUM A;  2KP6 A;  3MQ0 A;  4M74 A;  1UMQ A;  5FRN A;  3CLQ A;  2ZB9 A;  4DOZ A;  3JRB A;  2H09 A;  3N97 A;  2MW8 A;  3NWS A;  3HPG A;  5K7Z A;  2BY3 A;  1IN5 A;  3H35 A;  3J80 K;  3O3K A;  2W25 A;  1X1D A;  2BGC A;  2D45 A;  3CDL A;  5E1Z B;  3V4G A;  1R22 A;  5IYC J;  3WTW C;  1SMT A;  2M7A A;  2ELH A;  1MBG A;  2EV0 A;  3CZ6 A;  1Z3Y A;  3GCM A;  3TO6 A;  1ETO A;  1D8K A;  1I5Z A;  4XRM A;  1ACI A;  3DBR B;  3Q9V A;  5J8F A;  1BR1 A;  2VBZ A;  3HUG A;  3SDG A;  3L2R A;  5LHG A;  2M4K A;  2RRE A;  2R7R A;  4HEA 2;  1ZLJ A;  4L5J A;  2NVT J;  4P55 A;  3U1K A;  1USS A;  2L7F P;  2P6T A;  1S7A A;  4A3E J;  3FXJ A;  3TDZ C;  2RC4 A;  4XID A;  1HDD C;  2YR2 A;  3WHC A;  2XRO A;  4CO8 A;  1MD0 A;  3OR1 C;  1IW7 F;  3LA7 A;  4N4O B;  3G71 I;  1V3F A;  3BPX A;  1W7P A;  4LIT A;  2A3S A;  4OMY A;  4IF4 A;  3PSF A;  3T5X A;  4XLE A;  1RUO A;  1G3W A;  5C4J J;  3BPV A;  3LQR A;  3HRM A;  4O3M A;  4ZDO A;  2M9H A;  1YIT I;  4KDP A;  2F5E A;  1QPI A;  2CJJ A;  5K7F A;  1JT6 A;  1IXR C;  1S6L A;  2RNG A;  2V4J C;  1PUE E;  1R00 A;  2X1C A;  3R60 A;  1T2K A;  3ABM H;  2P6S A;  1B6A A;  1R71 A;  2CH0 A;  1O3Q A;  1XGN A;  4LOC A;  3GXO A;  1MBJ A;  1OQY A;  3GWZ A;  5L3F A;  1Z21 A;  2HWV A;  1R4M B;  3ECO A;  5D8K B;  1TBX A;  3S8P A;  1ETW A;  4UV8 A;  4E6Z A;  3HUG B;  2EFP A;  4AIJ A;  3BJO A;  2BW3 A;  3JSO A;  4JK1 X;  1W36 C;  1P9Q C;  1P4W A;  4RBO A;  1ERD A;  2A5W A;  1WI3 A;  1N77 A;  3GW2 A;  3LSJ A;  3GVA A;  4E7Z A;  1GEF A;  3HOW J;  2EQR A;  3QP5 A;  1DU0 A;  3M3Y J;  4LLL A;  1YHQ I;  2EIM H;  2ZME B;  5HLI A;  2BXY A;  2QZ8 A;  2WB1 N;  4KA4 A;  1FP2 A;  2GAU A;  3RKQ A;  4ZDL A;  3CJR B;  3IRR A;  2M7B A;  5IYB J;  3Q3S A;  4U87 A;  2K7L A;  4E6K G;  3L7W A;  2DBB A;  1R36 A;  1O7F A;  2E71 A;  4WXC A;  1Y8R B;  4XRF A;  3ZMT A;  4WX9 A;  3RZO J;  5HDK A;  2RQP A;  1TTY A;  2IEK A;  4S04 A;  4E7L A;  3OYK A;  2XGX A;  2LTP A;  5LD2 C;  1FLI A;  1JXS A;  3OIO A;  4M3D A;  2M30 A;  1AWC A;  3ZP5 A;  3I64 A;  5H6Q A;  1OCP A;  2WY7 Q;  2MC4 A;  3C2G A;  2RDP A;  4IJA A;  3BR0 A;  2X4H A;  3I53 A;  4LJZ F;  2PMZ N;  2EA4 A;  1G59 A;  1HW5 A;  1K78 A;  1QHH D;  4CUG A;  4IHY A;  2V1X A;  1X4P A;  1MH4 A;  2H6C A;  1ZH5 A;  2Y69 H;  3HGY A;  2ZXW H;  3MWM A;  2HOA A;  1U5T A;  2R7T A;  4BGD A;  1BL0 A;  4B3A A;  3PJR A;  1GV2 A;  3CLO A;  3PSI A;  3HJE A;  4B3X A;  1R9T J;  1OB9 A;  1IRG A;  4N4N B;  1VND A;  3BCA A;  2XC7 A;  1HW2 A;  2DJN A;  1UST A;  2UXN A;  2Y30 A;  3OIQ A;  2HOS A;  2VPR A;  1LEB A;  3HTS B;  3MCZ A;  2YS9 A;  2NS8 A;  3BG6 A;  1R1V A;  3S32 A;  1YS7 A;  1QNT A;  1EJ9 A;  5FLX Z;  1BBY A;  1OCC H;  2IPQ X;  1YX3 A;  2DYS H;  5IT3 A;  5IP6 A;  2R7V A;  1P7I A;  2MD0 A;  2NXN B;  2Q2E B;  4AVZ A;  5GPA A;  4BJ5 C;  3ABT A;  1Y1W J;  2JMW A;  2XAS A;  1X3U A;  2O5R A;  4E7J A;  1DQU A;  2DMT A;  1MJB A;  5GAH J;  1LDD A;  2J5P A;  3ECH A;  3DWL E;  2VS1 A;  3W6V A;  1NK3 P;  2R5Z A;  1HC8 A;  4U7D A;  2DA7 A;  2BOL A;  1OCZ H;  3LMM A;  3ZQH A;  4II2 A;  5LLQ A;  2JVG A;  1T8I A;  1DP7 P;  3CQZ J;  3GLL A;  1Y1O A;  1MNE A;  2WCW A;  2DA5 A;  2VJ5 A;  4AYB N;  2KIU A;  3TQN A;  2M1B A;  4BDZ A;  4B4C A;  5HLT A;  2QQ9 A;  3IKV A;  3DV8 A;  2PJR B;  3I4P A;  4YII A;  1RR7 A;  1J0R A;  2W4S A;  2LRE A;  3ZQ7 A;  3K70 C;  1ZGW A;  5L3G A;  4C9Y A;  4F7Z A;  4FCY A;  2AO9 A;  4K2E A;  4N9I A;  3IEY B;  1GLN A;  3LSG A;  1JHH A;  2JA7 J;  2R7Z J;  2VC1 A;  1NG6 A;  1SVM A;  3GFI A;  3OYM A;  2JJQ A;  4G6T B;  5DCF A;  4QIW N;  2HQR A;  1ZN2 A;  3H5N A;  4G6U A;  5IPA A;  2IA1 A;  3F8M A;  4J01 A;  3U1D A;  2KIM A;  1HW1 A;  3FXK A;  3CCV I;  5IOZ A;  2VN2 A;  1XDU A;  4WXH A;  5M5Y J;  1FMV A;  3M07 A;  2Y9Z A;  2E1M B;  2HDW A;  3WTZ A;  4BE0 A;  2YSR A;  1FOW A;  2GW6 A;  1B4A A;  3GLX A;  4ESJ A;  2HS5 A;  5HNH A;  4IHS A;  3A01 A;  5DUI A;  4I0B A;  2DA1 A;  3KYL A;  1J7K A;  3G1L A;  2DOF A;  2QVO A;  2VKE A;  5EG0 A;  2UUZ A;  3BR3 A;  2D1V A;  4I09 A;  2JJ7 A;  1D5V A;  4CSW A;  2YU3 A;  3NQO A;  1Z9C A;  2E35 A;  1LPQ A;  2OZ6 A;  3HOS A;  2Q0O A;  2ZYZ A;  4BQO A;  3ZMV A;  1B1B A;  4FIS A;  2JPB A;  1WRJ A;  5FKL A;  4CYC A;  3MKL A;  2WAE A;  3DTE A;  5DUK A;  2QA4 I;  2R7D A;  2M0C A;  4DZP A;  1PVE A;  2I5U A;  4FTH A;  2HR3 A;  3MEX A;  5M5X J;  4DQ2 A;  4M3E A;  2Z2S B;  2WV0 A;  2FBK A;  3MVP A;  3BJA A;  3UR3 C;  4E7K A;  2WCZ A;  1PDN C;  5L3D A;  1ULY A;  2KT0 A;  1TW3 A;  3KEQ A;  2VL8 A;  1BJZ A;  1LFU P;  1FBQ A;  4UUV A;  3PQK A;  3ZCO A;  3ISP A;  2R7U A;  2FNA A;  3REO A;  1ETY A;  1RUN A;  4HX4 A;  3JTG A;  4A3G J;  3TP3 A;  1W5S A;  1LUJ B;  2IBD A;  4UB6 C;  3BR6 A;  2O03 A;  2EWN A;  2EFN A;  1D8J A;  2KPM A;  4MNU A;  2M0M A;  1LE8 A;  1YW9 A;  3PQJ A;  4LIU A;  3N05 A;  2PJP A;  2FMY A;  2R5Z B;  1VQK I;  1YYV A;  1KQ8 A;  4Y33 A;  4BE1 A;  4JBA A;  4L5I A;  1KU3 A;  2H1K A;  2CUZ A;  4XR6 A;  2H1L A;  4MEX F;  2DMQ A;  2VB6 A;  4QLC U;  1UHM A;  3RCO A;  3CJN A;  1W7P B;  4EJU A;  1ZP7 A;  1FTT A;  3DEE A;  1CF7 B;  3V7S A;  3LNQ A;  3RYP A;  5K5O A;  2VKD A;  2XB0 X;  2O0Y A;  1WGX A;  3K0L A;  1QRY A;  2I10 A;  2VQL A;  1MNM C;  2DXI A;  3CMY A;  3AJV B;  3SXY A;  3AKZ A;  5KAI C;  3EYI A;  4HQM A;  4M3F A;  5EEA A;  3DPL C;  1NH3 A;  1R1T A;  5FKM A;  4F55 A;  2CSO A;  1DUX C;  1EKE A;  4ZYG A;  1FBS A;  4GRI A;  4HF2 A;  2IA0 A;  5FKN A;  3BG5 A;  4EJW A;  3OYJ A;  2E2H J;  2COM A;  2R4G A;  1D3Y A;  2FE3 A;  3KP4 A;  2XPW A;  3R0J A;  2HZT A;  2DTZ A;  2X1D A;  4G6V A;  2EIL H;  5B5E C;  4PJM A;  3ZQC A;  2EB7 A;  4IEJ A;  4EAT A;  2QSF X;  2XRN A;  2P81 A;  4DGW B;  2X6O A;  2DDB A;  2FQ3 A;  1TP4 A;  2F4I A;  4MHG A;  2EPF A;  4UVB A;  3W3C A;  2VIX A;  2HVR A;  2EH3 A;  3AL0 B;  4XSX F;  2JA2 A;  4LLG F;  4RM2 A;  2XAG A;  5JI6 A;  1JHF A;  3P1Z A;  3Q0W A;  1CF7 A;  1AHD P;  3ABL H;  1I1S A;  5JLW A;  3Q5F A;  2L9V A;  2QGU A;  4IXA A;  4RB1 A;  2EFW A;  5JVT A;  5BPD A;  3E0J B;  5TIS C;  2Y0M A;  2CMP A;  1SC7 A;  2AQE A;  1ETK A;  3M8E A;  2HQA A;  2CGP A;  5K7H A;  3WTT C;  1VQ8 I;  2XAJ A;  3SHF A;  1TWH J;  4BL0 B;  1HKT A;  4B47 A;  3LSR A;  2QQB A;  3FIS A;  3F9K A;  1UG2 A;  2QWW A;  3BLY A;  3H5R A;  4GGG A;  1IZ1 A;  4L5E A;  3SEZ A;  3OSG A;  1U6G A;  5K5Q A;  1Z6R A;  2L02 A;  5FKO A;  2D1H A;  5FLV A;  1S7E A;  3GTO J;  3T8T A;  1EF4 A;  2HPI A;  3RPQ A;  1EH8 A;  4IZZ A;  1FIP A;  5FO5 A;  1XGM A;  4UVA A;  1Z0X A;  2UXX A;  1NTC A;  4F91 B;  1H89 C;  1A79 A;  4G8X A;  3S93 A;  1F9N A;  4QPO A;  5JHF A;  3LOC A;  2L5Q A;  3JAM Z;  2JA6 J;  2OUM A;  2STW A;  1X1B A;  2GIZ A;  2ZSH B;  1KYW A;  3QYB A;  3BCB A;  2LLK A;  3JW4 A;  1IXC A;  1FY7 A;  5B1B H;  2IW5 A;  3F23 A;  3IUO A;  3JSP A;  2GXG A;  3PFI A;  1FOX A;  2KZV A;  2BY1 A;  4ENM A;  2HOE A;  4XKV A;  1JE8 A;  1SD7 A;  4RS8 A;  3OS2 A;  3LSK A;  3F72 A;  2JQ7 A;  2XKO A;  3LSP A;  4P5O A;  5D5W B;  2OZU A;  4DNC A;  3DLL F;  2NYX A;  4HG2 A;  2IS4 A;  4BAC A;  1LE8 B;  3CCU I;  4I01 A;  4DBQ A;  1VQL I;  4WWC A;  2FJ1 A;  4E4H A;  1XTA A;  4ZTJ A;  1SFE A;  4AYB A;  4CXF A;  5F6F A;  4XKW A;  4BS9 A;  1Y56 A;  3VPR A;  1AOY A;  1YLF A;  3DKX A;  1FTZ A;  2VQH A;  3R61 A;  2W84 A;  3A4C A;  4R1H A;  3P9K A;  3H3U A;  3ESW B;  4BH9 A;  2OA4 A;  3ML6 A;  2D5V A;  3X2Q H;  3HRT A;  4Y7N J;  4HW0 A;  2ISZ A;  3M4O J;  2EO0 A;  4C2M J;  4D0P A;  5HS9 A;  3F8N A;  2BHZ A;  1I6H J;  3M9A A;  2JUG A;  1R5I D;  4XN0 A;  5H6R A;  2Y0S A;  4KIG A;  2VON A;  1YW7 A;  3FZV A;  5DS9 A;  4I7H A;  1K6O A;  2XSJ C;  4XLA A;  1LVK A;  5DDG A;  3LA2 A;  2DT7 B;  2AHQ A;  2CU7 A;  1E3H A;  3GO5 A;  3HRS A;  3QAH A;  4RGR A;  3IH4 A;  1K79 A;  2FU4 A;  1QVU A;  2DA4 A;  1D1B A;  1JI8 A;  1K83 J;  2LF7 A;  1W1W E;  2FX0 A;  1W0T A;  1ON1 A;  1Z67 A;  1FYK A;  2P4W A;  4EM0 B;  4TKK A;  4AC0 A;  3V7C A;  2IGM A;  1NG7 A;  3HHG A;  1VQ4 I;  1D0Z A;  4A69 C;  2NAZ A;  4M6V A;  4V2F A;  4P9U A;  5FJ8 J;  1ZQ3 P;  1OMI A;  1T08 B;  3Q9S A;  2LY1 A;  3CCM I;  4UNO A;  3GTP J;  1HSJ A;  3EUH A;  3IAM 2;  1ZGA A;  1IG7 A;  3H3Z A;  2CUJ A;  3PNV A;  5AIP A;  5J4V A;  2FD5 A;  3RKW A;  3CMM A;  3SZG A;  1BC7 C;  4XRS A;  1IPI A;  3PL8 A;  2LVS A;  3OYE A;  1I27 A;  1HF0 A;  3GZ5 A;  5EJC A;  2L7Z A;  5F0F A;  3HKZ A;  1ZR2 A;  1MMG A;  4KN7 X;  3HL2 A;  1OPC A;  5K1Y A;  3WU2 C;  3KP5 A;  1K7A A;  4V19 K;  3CCE I;  1D1C A;  2LY2 A;  4ENN A;  4O6J A;  1NK2 P;  2HU9 A;  1TNT A;  2W24 A;  2HKX A;  4V2G A;  1MND A;  5LBQ A;  1VQO I;  1XG1 A;  4IL6 C;  4FE7 A;  5GAG J;  1B8I B;  4BHB A;  4PJN A;  4KIT B;  1X4O A;  4BE2 A;  3HBL A;  2CWE A;  3LSH A;  1BW6 A;  2QCO A;  4OIQ F;  1YW8 A;  3DFG A;  5E1X A;  3S1R J;  3GTG J;  3I55 I;  5TJJ A;  1XCB A;  4C3I J;  3FHZ A;  2AXT C;  4I02 A;  4MQV A;  4RLQ A;  2LDU A;  4PSW A;  4OOI A;  3A01 B;  4BY1 J;  1FEX A;  1WI9 A;  2W48 A;  3FM5 A;  5M3F J;  3BTI A;  5C3E J;  4FT8 A;  1X1A A; 
#chains in the Genus database with same CATH homology
 3WE3 A;  1UHW A;  2KKO A;  4IRH A;  4HAM A;  4YG2 F;  1LB2 A;  1T0F A;  3F8C A;  1F5T A;  3MZH A;  3CTA A;  3TKY A;  1EV7 A;  1YNM A;  2UWM A;  3J80 Z;  2CQK A;  2DQR A;  3IHU A;  3FWE A;  3K2Z A;  3F21 A;  4AIH A;  1GHC A;  3BRO A;  2ZBK A;  3CUO A;  3IRQ A;  3LST A;  1IF1 A;  4LQE A;  2L3D A;  1QZZ A;  3E6D A;  3TGN A;  1R7J A;  4PGG A;  5F64 A;  2Z5U A;  5ILV A;  1VTN C;  4O5V A;  4HV5 A;  2VBX A;  1ZRC A;  1GXQ A;  3MAJ A;  4HLY A;  3GYH X;  2OAZ A;  3FMQ A;  1J59 A;  3HOT A;  3ROU A;  5E17 F;  1IXS B;  1T39 A;  5DCM B;  2QLZ A;  2WTE A;  5LRS A;  1PP7 U;  1SD4 A;  2IVM A;  2DPD A;  4I0A A;  3H92 A;  3ULQ B;  5F1R A;  2OKF A;  1EH6 A;  2FML A;  1MJ9 A;  1LNW A;  2OD5 A;  1T98 A;  2OST A;  5L3B A;  2GQQ A;  3IEY A;  3LQQ A;  4QWQ A;  1XSX A;  2IT0 A;  5D4R A;  2JTV A;  1O57 A;  1SD5 A;  4IVN A;  2XAH A;  4LB5 A;  3I71 A;  3DNX A;  3EQL F;  2HKO A;  3DEU A;  4HLX A;  1UB9 A;  2DW4 A;  4IRG A;  2PN6 A;  4G7Z F;  2ZO4 A;  3GZ6 A;  3P7N A;  5D5X B;  2ZNZ A;  2RKH A;  2WWY A;  1BC8 C;  2C6Y A;  4S05 A;  3T8R A;  3ZN0 A;  5LGU A;  4KMU X;  1BOA A;  3DXJ F;  2NS0 A;  5BS6 A;  2FLC A;  3IC7 A;  4LGW A;  5E1W A;  2A6H F;  3VOE A;  1TQM A;  4GYG A;  4M72 A;  3LAP A;  1PP8 F;  3WU0 A;  2RVC A;  2W57 A;  3P9I A;  5LGT A;  2QM3 A;  1ZGJ A;  5K5R A;  2A61 A;  5DYM A;  2GXB A;  1HST A;  4EQQ A;  1U78 A;  1U3E M;  1ZRE A;  4EMS A;  4Q48 A;  1O3T A;  3O6B B;  4PZJ A;  2P7C B;  3RJP A;  2L01 A;  5ICF A;  2Z0R A;  4WCG A;  4EVI A;  1O3R A;  4H0E A;  2K86 A;  4A12 A;  5LRR A;  4HF1 A;  4M6X A;  5L3E A;  2M5W A;  3KZZ A;  1XD7 A;  1HBX G;  2YPR A;  4NQW A;  2QQA A;  3CDH A;  4LD5 A;  4ZH4 F;  1F4K A;  5JR3 A;  1LDK B;  2WIZ A;  1XSV A;  3ZMS A;  2OQR A;  2DK5 A;  1MDM B;  5IT9 K;  2ZFW A;  3KP6 A;  4TV7 A;  2D2W A;  3GFJ A;  1SFX A;  5BQT A;  5HDG A;  3RKY A;  1BIB A;  4CDG A;  1W4M A;  3V8L A;  4Y17 A;  3CUQ B;  3GEZ A;  1F1Z A;  3TO9 A;  5HVQ C;  5BPI A;  4RB2 C;  3KP2 A;  3F6V A;  3KCC A;  1H9T A;  1LDJ A;  2Y75 A;  3P9C A;  2HDC A;  4A0X A;  2O6G E;  2V1D A;  3T0Y A;  4RAY A;  3L9F A;  5D6F A;  1BM9 A;  1EH7 A;  1BN5 A;  2PBI A;  2L4M A;  1DPR A;  1RZN A;  2R3S A;  4FX0 A;  3WG9 A;  1P4X A;  4HZF A;  1QZY A;  4AVP A;  3AAF A;  5DV5 A;  3U9G A;  5TRD A;  1W5T A;  3K69 A;  4LMY A;  4EV0 A;  1R58 A;  2IRF G;  3C18 A;  1IUY A;  2DK8 A;  3M7G A;  3TDU C;  1IN7 A;  3E6C C;  2ESH A;  5BOX A;  2OBP A;  4G6D A;  5H20 A;  3SFZ A;  1LQ1 A;  4BHP A;  3OOP A;  5EEH A;  2FRH A;  4Q47 A;  2PMU A;  3CUQ C;  1XDS A;  1Z91 A;  3G73 A;  4M6Y A;  1REP C;  3HRU A;  3CO7 C;  1MGT A;  5E8G A;  2ZYZ B;  3FMS A;  1ZLK A;  3LAJ A;  2R7F A;  1SMY F;  3J81 Z;  1FSE A;  2CV8 A;  2K27 A;  2ZXJ A;  4XLP F;  3R6S A;  4UV9 A;  3RKX A;  2WC2 A;  4ETS A;  3T1B A;  1I1G A;  5DEQ A;  2OQG A;  3J7A O;  1I6X A;  4ENK A;  2LKP A;  4A5N A;  2E1C A;  4Q5S F;  2F5F A;  1TW2 A;  2GZW A;  1KU2 A;  4TKD A;  4EGY A;  2QBY A;  4HBL A;  4HV6 A;  1FX7 A;  1G4D A;  4U0V A;  1QBJ A;  1ZRD A;  4Y13 A;  3KFW X;  4WXD A;  2VBY A;  2QUF A;  5CVU A;  1IN4 A;  1HKS A;  4RB0 A;  3KE2 A;  1FBU A;  2VLD A;  4KMF A;  4MQ9 F;  3V8K A;  2Z9O A;  1J5Y A;  2Z99 A;  2E7W A;  3QU6 A;  5FGM A;  4M73 A;  3WGG A;  2PFB A;  1FT9 A;  1P2F A;  5J8C A;  4NHJ A;  1Z05 A;  2DLL A;  4UHT A;  5BMZ A;  2G7H A;  3FMR A;  4HX7 A;  3WTX C;  3G3Z A;  2IP2 A;  3ABU A;  1R1U A;  3FXU A;  3HSF A;  4XLN F;  3DKW A;  1OR7 A;  3WTY C;  1RZ4 A;  3NRV A;  3HTU A;  3E6M A;  1FP1 D;  4EJV A;  2FCO A;  1MJA A;  3WGI A;  1UFM A;  4YFN F;  1HQC A;  3K9T A;  2CFX A;  1U2W A;  3ZPL A;  2MA3 A;  2IA2 A;  2CW0 F;  2LSO A;  3HIF A;  3W6K B;  1H9G A;  4M9X A;  5LHH A;  2MD5 A;  2FL3 A;  3D5L A;  3WU1 B;  2PMH A;  5KK1 A;  4AD9 A;  4HX8 A;  5FFX A;  4CIC A;  3L00 A;  1ZRF A;  1BI2 A;  3WTV C;  2DBS A;  2G7U A;  5LEK A;  4MTD A;  3HYI A;  5A2Q K;  2BE5 F;  4ZZL A;  3GFM A;  4GXO A;  4U7B A;  4U0W A;  2FBI A;  2JRT A;  5CYV A;  3TO7 A;  1NHA A;  3ZN1 A;  2PLY A;  4IRI A;  3KEO A;  2DO7 A;  2VE8 A;  2ZCW A;  2DT5 A;  1R5H A;  2WJ0 A;  1RI7 A;  5CLS A;  1H0M A;  1CGP A;  4DAV A;  4YFX F;  4HF0 A;  4M9S A;  2ACJ A;  1BIA A;  4ZYE A;  3K1N A;  5ERI A;  4HOB A;  1ZG5 A;  1BI3 A;  4PGH A;  4U0Y A;  4JQF A;  3IL2 A;  1FOK A;  2GWR A;  4G94 A;  5J6X A;  2CZR A;  2PQ8 A;  5ICC A;  4I2O A;  2ZME A;  4KNY A;  4AIK A;  2P5K A;  1DDN A;  5D8L B;  5KVR A;  4CZZ A;  3MFK A;  4GO1 A;  1P92 A;  3B73 A;  4DAP A;  4DA2 A;  2F5D A;  1YG2 A;  1YS6 A;  3QU3 A;  4ESB A;  1ONV A;  4M71 A;  1IRF A;  1RLV A;  3D0S A;  1XB4 A;  4KT5 C;  2NRA C;  3L2C A;  5D5V B;  3F8F A;  4G7H F;  2EFQ A;  2RGV A;  3FXQ A;  4QBL A;  3WTU C;  2EV5 A;  4L9J A;  2HYF A;  3P1Z B;  2XV4 S;  5JHU A;  1R23 A;  3FX3 A;  3WTS C;  2JT1 A;  2ISY A;  1O3S A;  1LJ9 A;  1KU9 A;  1YQA A;  2VE9 A;  3V8J A;  4HDU A;  3J81 K;  2XVC A;  1O7L A;  3F8B A;  3S2W A;  5AON A;  4A6D A;  2XIG A;  3M1E A;  2HGC A;  2MH2 A;  2E7X A;  1FPQ A;  2A07 F;  1XMK A;  3EDP A;  3TOB A;  1TQP A;  2V79 A;  3R4K A;  1WSU A;  2BEO A;  2GA1 A;  2BYV E;  4LG0 A;  1XMX A;  4EM2 A;  2MLG A;  4UVC A;  3RI4 A;  3I5U A;  4M9Z A;  2F2E A;  3QP6 A;  4BXU A;  5D5U B;  1XSD A;  1FZP B;  2FXA A;  4KUM A;  5LGN A;  2K4J A;  3SZT A;  4RGU A;  1BJA A;  5DCM A;  4HYE A;  4OIN F;  2P7V B;  3KET A;  3IKT A;  2O61 A;  2J5O A;  2ADU A;  2JZY A;  3C1D A;  3RDI A;  2A6E F;  1K78 B;  6PAX A;  1XGO A;  1G6N A;  1GXP A;  1S3J A;  4BQA A;  2QYO A;  1J9I A;  5AIQ A;  1U5T B;  5JFR A;  3TOA A;  2HFH A;  5FB2 A;  4QBN A;  2EA2 A;  2DU9 A;  1Y88 A;  1Z6T A;  4LG0 B;  4IPA A;  1YTY A;  2KJB A;  3RPU A;  1E2X A;  1BI0 A;  4Q4Z F;  2EFO A;  1R11 A;  3M8F A;  4R79 A;  2DFI A;  5D4S A;  3EYY A;  2EV6 A;  5E18 F;  3K1M A;  4OIP F;  4Z2Y A;  5HLG A;  4CYD A;  1OYY A;  4NB5 A;  3MZY A;  1MZB A;  4A6E A;  2M8E A;  1L3L A;  3ERE D;  3ZMU A;  4WK8 F;  1P6R A;  1B9N A;  3RIR A;  2VOO A;  3I54 A;  2KJC A;  1ZHF A;  5DD4 A;  4IHT A;  3N4M A;  4KIC A;  2MH9 A;  5HS8 A;  5FD5 A;  1JGS A;  3NEU A;  1ODD A;  4BNC A;  3HSE A;  1KQ0 A;  3LFK A;  3E6B A;  3I0T A;  2HTS A;  3KP7 A;  1GVJ A;  4BAY A;  2O3F A;  3CO6 C;  4ASN A;  3F6O A;  5L3C A;  1IN8 A;  2RN7 A;  4L9T A;  3E5Q A;  3BY6 A;  2RNJ A;  1HXD A;  3FXR A;  1MKM A;  4EM1 A;  1XGS A;  4GYI A;  1QO0 D;  1YIO A;  3DPT A;  4A0Z A;  1RIO H;  5DD8 A;  5FFZ A;  4UXN A;  1J2X A;  2LF8 A;  1R0V A;  2IXS A;  3SQN A;  1YO5 C;  2P5L C;  2MLK A;  4FHT A;  2AXL A;  2DPU A;  2BV6 A;  2GIV A;  1ZG1 A;  2HYG D;  4OMZ A;  2L4A A;  5ED4 A;  3WOD F;  3F3X A;  4L9V A;  1YFH A;  2STT A;  2E1N A;  1TNS A;  3DP7 A;  4G9Y A;  4MEY F;  1G3S A;  1IAW A;  2Z33 A;  1C0W A;  2FEZ A;  4CHU A;  5E8I A;  4L9N A;  2XHK A;  4L18 B;  3KLN A;  2XAF A;  5FD6 A;  1XN7 A;  3DF8 A;  1FWZ A;  2P8T A;  5CVR A;  4R8H A;  3VOD A;  1WWX A;  3L09 A;  3I58 A;  1FYM A;  2X0L A;  3BJ6 A;  4YIF A;  3FM3 A;  2WIW A;  2M87 A;  4N9H A;  1UWV A;  5HDN A;  2RV8 A;  4HDV A;  2PI0 A;  1G3T A;  3ELK A;  2VXZ A;  1LEA A;  2UZK A;  4MGR A;  1XMA A;  3I59 A;  1ZAO A;  2LNB A;  4OIO F;  2KRF A;  3C7J A;  1OB8 A;  4OIR F;  2YX7 A;  1S8N A;  3IWF A;  1LVA A;  3DQV C;  1L0O C;  4WF2 A;  3ZMD A;  2V6C A;  3JAM K;  4OU0 A;  5ICG A;  1SD6 A;  5HOO A;  3BOQ A;  1TQI A;  3WE2 A;  2VC0 A;  2FBH A;  2MBF A;  5CJ9 A;  3OV8 A;  2JPC A;  4XBF A;  3AJV A;  2IJL A;  5LHI A;  4EGZ A;  3GF2 A;  1FNN A;  2DQL A;  2AS5 F;  3E97 A;  4KN4 X;  4KYW A;  3SZP A;  3GFL A;  3WGH A;  1KQ9 A;  2BH2 A;  1TLH B;  4N0B A;  4FX4 A;  3KP3 A;  2Z3Y A;  2XKP A;  4G7O F;  2O8X A;  3BT7 A;  1G3Y A;  2EK5 A;  4B09 A;  1E17 A;  1ZG3 A;  2FA5 A;  4I98 B;  2FKC A;  4ZYD A;  2K02 A;  4AWX B;  3ZMZ A;  1OYI A;  3C3W A;  4KIF A;  4P96 A;  2DAO A;  4G6Q A;  3HSR A;  1S29 A;  4XSZ F;  5CVI A;  2INB A;  3COA C;  3E5U A;  1FC3 A;  3K1P A;  4ESF A;  1KA8 A;  4L0Y B;  1A04 A;  2FOK A;  3QOP A;  4P9F A;  2HEO A;  2W8M A;  1WKM A;  4ZYH A;  1V4R A;  4PDK A;  5LEJ A;  2KIF A;  2CYY A;  2ETH A;  4U88 A;  1J75 A;  2CG4 A;  1W7P D;  2OU2 A;  1ZAR A;  2VT2 A;  1T38 A;  1Z1D A;  2ZKZ A;  2PG4 A;  1RNL A;  2G9W A;  2L54 A;  1ON2 A;  5A2Q Z;  3E3V A;  4GCV A;  1S7O A;  2QEN A;  3RTR A;  4B8X A;  4BHC A;  3LA3 A;  2DTR A;  4ENJ A;  4KFC A;  3EET A;  1FYL A;  2VOD A;  4RGS A;  5CVJ A;  3IWZ A;  5ILU A;  1B59 A;  3B02 A;  5ILS A;  2A5Y B;  2MC3 A;  2XUB A;  2PEX A;  5ICE A;  3JTH A;  1UCR A;  1ZYR F;  1OYW A;  4ON0 A;  2GJW A;  2FF4 A;  3CUQ A;  4RGX A;  4RB3 C;  2CO5 A;  3KZY A;  4RAZ A;  2V9V A;  4E70 A;  4BYY A;  2EJR A;  2FSW A;  1WQ2 A;  1HH1 A;  3RYR A;  1STZ A;  1R5G A;  2ESN A;  2GA2 A;  1Y0U A;  3BDD A;  2W85 A;  1DPU A;  4PCQ A;  1KU7 A;  2VOP A;  3BZ6 A;  4EJO A;  2M45 A;  1SAX A;  1SFU A;  2Y48 A;  5HLH A;  2VT3 A;  1U5T C;  2ZNY A;  1KGS A;  4A5M A;  5FLX K;  3QPH A;  3I59 B;  3FF5 A;  1P4A A;  3U2R A;  3R0A A;  2P5V A;  2NNY A;  3VB2 A;  2Q2E A;  4LK1 F;  2V1U A;  1OKR A;  4A2U A;  2FNP A;  2JSC A;  2TDX A;  3O2P E;  3LWF A;  1T6S A;  2A68 F;  5CVV A;  1QQI A;  4ZQU A;  4EV1 A;  5HS7 A;  2FKH B;  4LB6 B;  3GUD A;  2QBY B;  3V7R A;  2F5C A;  2A69 F;  3VEP A;  3FOV A;  4Y15 A;  1HKQ A;  1U8R A;  4LLN A;  3BWG A;  1FSH A;  5E20 A;  3F22 A;  4ZZD A;  3QPT A;  3E5X A;  4KIB A;  4HA8 A;  1Q1H A;  3P1Y A;  1BI1 A;  4LFU A;  3KLO A;  5FDK A;  1QPM A;  2B0L A;  4YFK F;  2VBW A;  5EEG A;  2H6B A;  2ZJ2 A;  2HQN A;  3BP8 A;  4HQE A;  4MTE A;  5IT9 Z;  2Q8K A;  1IN6 A;  4A0Y A;  3QRF F;  3VFZ A;  2XAQ A;  4CGZ A;  3W6J B;  4QBO A;  1XCV A;  1B9M A;  1QGP A;  3IF0 X;  2HTJ A;  3GX4 X;  2H94 A;  2K4B A;  2NNN A;  2YX4 A;  4L0Z B;  2H27 A;  1MDM A;  4EJT A;  2BBY A;  1KYZ A;  1Z7U A;  2DI3 A;  5D6E A;  3HHH A;  3MQ0 A;  4M74 A;  3N97 A;  2H09 A;  1IN5 A;  3J80 K;  3O3K A;  2W25 A;  2BGC A;  2D45 A;  5E1Z B;  3V4G A;  1R22 A;  3WTW C;  1SMT A;  2ELH A;  2EV0 A;  3TO6 A;  1D8K A;  1I5Z A;  3Q9V A;  5J8F A;  2VBZ A;  3HUG A;  5LHG A;  1ZLJ A;  4L5J A;  4P55 A;  1USS A;  2P6T A;  1S7A A;  3TDZ C;  2RC4 A;  2YR2 A;  2XRO A;  4CO8 A;  1MD0 A;  1IW7 F;  3LA7 A;  1V3F A;  3BPX A;  1W7P A;  2A3S A;  4OMY A;  4IF4 A;  3T5X A;  1RUO A;  1G3W A;  3BPV A;  3LQR A;  3HRM A;  4O3M A;  4KDP A;  2F5E A;  1IXR C;  1S6L A;  1PUE E;  1R00 A;  3R60 A;  1T2K A;  2P6S A;  1B6A A;  1O3Q A;  1XGN A;  3GWZ A;  3GXO A;  5L3F A;  2HWV A;  3ECO A;  5D8K B;  1TBX A;  4UV8 A;  4E6Z A;  2EFP A;  4AIJ A;  3BJO A;  3JSO A;  4JK1 X;  1P4W A;  3GW2 A;  3GVA A;  1GEF A;  3QP5 A;  4LLL A;  2ZME B;  5HLI A;  2QZ8 A;  4KA4 A;  1FP2 A;  2GAU A;  3IRR A;  2K7L A;  3L7W A;  2DBB A;  1R36 A;  1O7F A;  4WXC A;  4XRF A;  3ZMT A;  4WX9 A;  5HDK A;  2RQP A;  1TTY A;  4S04 A;  2XGX A;  1FLI A;  1JXS A;  2M30 A;  1AWC A;  3ZP5 A;  3I64 A;  5H6Q A;  2RDP A;  4IJA A;  2X4H A;  3I53 A;  4LJZ F;  2EA4 A;  1HW5 A;  1K78 A;  2V1X A;  2H6C A;  1ZH5 A;  3MWM A;  1U5T A;  3CLO A;  1OB9 A;  1IRG A;  1HW2 A;  1UST A;  2UXN A;  1LEB A;  3HTS B;  3MCZ A;  1R1V A;  1YS7 A;  1QNT A;  5FLX Z;  1BBY A;  2IPQ X;  5IT3 A;  3ABT A;  2XAS A;  1X3U A;  1MJB A;  1LDD A;  2J5P A;  3ECH A;  2VS1 A;  4U7D A;  5LLQ A;  1DP7 P;  1Y1O A;  2WCW A;  2KIU A;  3TQN A;  2M1B A;  2QQ9 A;  3IKV A;  3DV8 A;  3I4P A;  4YII A;  1J0R A;  3ZQ7 A;  5L3G A;  4F7Z A;  4K2E A;  4N9I A;  3IEY B;  1JHH A;  2VC1 A;  3GFI A;  2JJQ A;  5DCF A;  2HQR A;  1ZN2 A;  4G6U A;  2IA1 A;  3F8M A;  3U1D A;  2KIM A;  1HW1 A;  2VN2 A;  1XDU A;  4WXH A;  3WTZ A;  2YSR A;  2GW6 A;  1B4A A;  3GLX A;  4ESJ A;  2HS5 A;  4IHS A;  5DUI A;  4I0B A;  1J7K A;  2QVO A;  2D1V A;  4I09 A;  1D5V A;  2YU3 A;  3NQO A;  1Z9C A;  2OZ6 A;  3HOS A;  2Q0O A;  2ZYZ A;  3ZMV A;  1B1B A;  2JPB A;  1WRJ A;  5DUK A;  2R7D A;  2HR3 A;  3MEX A;  4DQ2 A;  2WV0 A;  2FBK A;  3BJA A;  2WCZ A;  1PDN C;  5L3D A;  1ULY A;  1TW3 A;  3KEQ A;  1FBQ A;  4UUV A;  3PQK A;  3ISP A;  2FNA A;  3REO A;  1RUN A;  4HX4 A;  3JTG A;  1W5S A;  2O03 A;  2EWN A;  2EFN A;  1D8J A;  4MNU A;  1YW9 A;  3PQJ A;  2PJP A;  2FMY A;  1KQ8 A;  1YYV A;  4JBA A;  4L5I A;  1KU3 A;  4MEX F;  4QLC U;  1UHM A;  3CJN A;  1W7P B;  4EJU A;  1ZP7 A;  1CF7 B;  3V7S A;  3RYP A;  5K5O A;  2O0Y A;  3K0L A;  3AJV B;  3SXY A;  3EYI A;  4HQM A;  3DPL C;  1R1T A;  2CSO A;  1DUX C;  4ZYG A;  1FBS A;  4HF2 A;  2IA0 A;  4EJW A;  2COM A;  3KP4 A;  1D3Y A;  2FE3 A;  3R0J A;  2HZT A;  4G6V A;  2EB7 A;  2XRN A;  2FQ3 A;  4MHG A;  4UVB A;  4XSX F;  4LLG F;  2XAG A;  5JI6 A;  1JHF A;  3P1Z A;  1CF7 A;  1I1S A;  3Q5F A;  4IXA A;  4RB1 A;  2EFW A;  5JVT A;  5BPD A;  2Y0M A;  3M8E A;  2CGP A;  3WTT C;  2XAJ A;  3SHF A;  1HKT A;  2QQB A;  2QWW A;  4GGG A;  1IZ1 A;  1U6G A;  5K5Q A;  1Z6R A;  2L02 A;  2D1H A;  3T8T A;  3RPQ A;  1EH8 A;  5FO5 A;  1XGM A;  4UVA A;  2UXX A;