1F1ZA

Tnsa, a catalytic component of the tn7 transposition system
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
260
structure length
260
Chain Sequence
FSEVQIARRIKEGRGQGHGKDYIPWLTVQEVPSSGRSHRIYSHKTGRVHHLLSDLELAVFLSLEWESSVLDIREQFPLLPSDTRQIAIDSGIKHPVIRGVDQVMSTDFLVDCKDGPFEQFAIQVKPAAALQDERTLEKLELERRYWQQKQIPWFIFTDKEINPVVKENIEWLYSVKTEEVSAELLAQLSPLAHILQEKGDENIINVCKQVDIAYDLELGKTLSEIRALTANGFIKFNIYKSFRANKCADLCISQVVNMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TNSA ENDONUCLEASE
publication title Unexpected structural diversity in DNA recombination: the restriction endonuclease connection.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 91
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08721 Tn7_Tnp_TnsA_C TnsA endonuclease C terminal
A PF08722 Tn7_Tnp_TnsA_N TnsA endonuclease N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1f1zA02
3.40.1350.10 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 1f1zA01
2LNBA 4MEYF 2HGCA 3BY6A 1GXPA 5AIQA 4AIKA 3LQQA 4AIJA 1BBYA 4G7HF 4U0YA 1UHMA 2CG4A 1XN7A 1XSVA 2HTJA 4WF2A 5IT9Z 1B4AA 3ULQB 4D0PA 1ZG1A 5ILUA 3J80Z 5L3FA 1SMTA 3DV8A 4BNCA 4HF0A 3V8LA 1P4WA 3FWEA 2JSCA 1DP7P 4MHGA 3N97A 4IHTA 2NNYA 3ZP5A 3K2ZA 4U7DA 2F5DA 2LF8A 1XGMA 3BPXA 1FC3A 1Y88A 4KMUX 1JE8A 2L3DA 2XAQA 4Q48A 1XGSA 3DXJF 2A5YB 1D5VA 4HF1A 3SZTA 2EFNA 1I1GA 1SAXA 2OBPA 4JK1X 2FMYA 2EV6A 2HQNA 5DCMA 1KGSA 2WIZA 1L0OC 2D1VA 2M8EA 4IJAA 5ICGA 3QAHA 4QBNA 1MKMA 2A3SA 4Y13A 1F1ZA 4ZZLA 2BEOA 1PDNC 5CJ9A 1MDMA 1T98A 2WV0A 3GZ5A 3W6KB 1KYZA 2PI0A 5DYMA 4UVBA 2M1BA 4G7OF 1R00A 4M6XA 1KYWA 1R1UA 3EETA 1R36A 3HRUA 3AAFA 3M1EA 4RGRA 5K5QA 2JRTA 3EUHA 2P7CB 4OOIA 2K86A 4AIHA 3IWZA 3LA7A 2JT1A 3CUQA 3CTAA 3WU0A 5CYVA 1P6RA 1UFMA 1IXRC 2V1UA 2WCZA 4YFKF 2XUBA 2QLZA 2B0LA 3P7NA 4IVNA 1HKTA 3GW2A 3BZ6A 2HFHA 1EH8A 3SXYA 1CF7B 1R1VA 4HDVA 5A2QK 5DD4A 2STWA 3V8JA 2HWVA 2O61A 3BJOA 2VC1A 3TDZC 5E18F 3P9KA 2EA2A 4HQMA 1ZGAA 1HBXG 1JHFA 2TDXA 5CVJA 1FOKA 1DPRA 1K7AA 1GVJA 2PBIA 2FBIA 3QU3A 1ZAOA 2KJCA 1XCBA 3LA3A 5H6QA 5L3GA 1FBQA 3RJPA 1FP1D 4L9NA 3FZVA 1S8NA 4U0VA 2ZFWA 2M30A 4ZH4F 3JTGA 4R1HA 2W24A 3OV8A 3PQJA 4IRGA 3JAMZ 1U8RA 1P2FA 1T6SA 4S04A 1W7PB 3BROA 2OQGA 2LSOA 3DKWA 3GWZA 1ZGJA 4L5IA 2NAZA 4OIRF 2E1NA 3D5LA 1W4MA 3TKYA 2EV5A 2RNJA 3KE2A 2G7UA 2QENA 4FT8A 5DUIA 1ZARA 5HVQC 2FRHA 4EM0B 1U78A 2QZ8A 1PP8F 3P1ZA 1OB8A 1KU7A 1HKSA 1STZA 1WI9A 2WTEA 2W85A 3K9TA 3KP3A 1K78B 2JPBA 2GZWA 2PEXA 1CGPA 4Q4ZF 4N0BA 3BWGA 3ECOA 4UUVA 1SD6A 2G9WA 2H94A 3GFMA 4HW0A 1QPMA 1T2KA 4M74A 4IHSA 3LSTA 3RIRA 2GJWA 5FFZA 1U5TA 2Q0OA 1P4XA 1IXCA 2AXLA 4KICA 2IVMA 2EK5A 3KP5A 2A6HF 2KIUA 4XSZF 4GYGA 2RC4A 5BQTA 2M87A 1OMIA 3MWMA 4UXNA 3ZN1A 1LDJA 1WQ2A 5J6XA 5F1RA 3MEXA 4LLLA 1HQCA 1R5GA 3L09A 5KVRA 2NYXA 3EDPA 3KEOA 4XLPF 1Z9CA 2HKOA 1ZG3A 4HV5A 2NNNA 2PMUA 4HX4A 2IA0A 4WCGA 1FP2A 1FT9A 1SFEA 4F7ZA 1G6NA 3QOPA 1E17A 2ZCWA 4IRIA 2HYFA 4A0YA 2A07F 5L3DA 2WCWA 3C3WA 2MH9A 1IUYA 2WIWA 4TKKA 4A0XA 3V8KA 3V7SA 1S3JA 1SD7A 4UVCA 4BHBA 1S7AA 2OZ6A 1LEBA 1OPCA 2DT5A 2RN7A 4MQVA 1VTNC 2O0YA 1AWCA 2E1CA 5FD6A 2HTSA 2FBHA 4A6DA 2OU2A 1FYKA 4BQAA 1J9IA 2JPCA 5JHUA 1G3YA 4TKDA 1O3SA 3PQKA 5TRDA 4XLNF 4MTDA 3HOTA 2GWRA 5D6EA 3KLOA 1MJ9A 1MJAA 4L9TA 2O3FA 4Y15A 1XB4A 4HDUA 1D8JA 3IL2A 5F64A 2GXGA 5E8IA 1W5SA 1O7FA 1WKMA 4WX9A 1FLIA 2ADUA 3I5UA 3BJ6A 4M6YA 1I6XA 3M9AA 4ASNA 2AS5F 3WTZA 3ZN0A 2XAJA 1YFHA 2IRFG 3QPTA 2HZTA 1O57A 4LFUA 1H0MA 1YS6A 3KP7A 4FHTA 2HQRA 4WXHA 4OIPF 1BI2A 4AWXB 2O8XA 2VBZA 4HA8A 4LG0B 2VBYA 3R61A 4RAZA 3LQRA 4HOBA 3Q5FA 4HLYA 4XBFA 2ESNA 1D8KA 5LBQA 3QP5A 3KP6A 1QNTA 2K27A 1MGTA 2FBKA 3WTVC 3ABUA 3JW4A 4EV0A 2KIFA 3EYIA 3BOQA 3LAJA 1QBJA 3V7RA 2VXZA 2MC3A 1SMYF 1I27A 3NEUA 3GFIA 3HSFA 1CF7A 4P5OA 4G6DA 4NB5A 4EM2A 4I0BA 3RI4A 5LGUA 4RB2C 1B6AA 1G3SA 2GAUA 2XAFA 3GUDA 3Q9VA 3PFIA 4LMYA 1RNLA 4GCVA 2MD5A 2EA4A 2W25A 3EQLF 4HBLA 1RZ4A 2Q8KA 4CDGA 1ZHFA 1XSXA 2ZNYA 3I59B 2V9VA 4Y17A 3TO6A 3HIFA 4I2OA 2PG4A 3IRRA 5CVVA 1B9NA 3RDIA 4O5VA 4PGHA 2GXBA 3MCZA 3MFKA 4KFCA 4UV8A 1TBXA 3O3KA 1SD4A 1W7PA 1QQIA 5FD5A 3F8NA 4E70A 4KN4X 1FYLA 2CW0F 4G7ZF 5BMZA 4BH9A 3U2RA 2F5CA 5D5UB 3DFGA 5D8LB 3DPTA 2HKXA 3RYPA 1QZZA 2O03A 3V4GA 1O3RA 2CV8A 4HX7A 3O6BB 3SZPA 4IRHA 4CICA 1BI3A 3DNXA 3CO7C 4KT5C 4CO8A 1FZPB 1IF1A 3REOA 4R8HA 3H3UA 1R0VA 1ZRFA 2P4WA 3FM5A 3WTUC 1L3LA 1SFUA 2ZMEB 3GX4X 1EH6A 1FNNA 2Z5UA 3TQNA 2BYVE 5IT3A 2CGPA 2DPUA 2FOKA 1DUXC 1F5TA 4KN7X 2X4HA 2OSTA 4L0ZB 4KNYA 4MQ9F 1RUOA 4M71A 3RTRA 1ONVA 2OZUA 5HS8A 3KP2A 3U1DA 1ULYA 4K2EA 4EJTA 2VE8A 3E3VA 1P4AA 1HW5A 4I7HA 5D5XB 2VT2A 3QPHA 2NRAC 4A0ZA 1B59A 1WSUA 2XKPA 5BS6A 4QBOA 3B02A 1RI7A 4WWCA 3WTXC 1S7OA 3BDDA 1J0RA 4RGSA 3V7CA 4ENJA 3I54A 4B09A 3G73A 1GEFA 2FNPA 3T0YA 2HR3A 4IF4A 5E20A 2RDPA 1TQIA 3NRVA 3VB2A 1ZYRF 3HRTA 1R1TA 2D1HA 2ZO4A 1FY7A 4YG2F 4KYWA 2MBFA 5L3BA 4JBAA 1J75A 2FE3A 5HLHA 1SFXA 1R23A 3WTSC 2VOPA 2PMHA 1QZYA 1R7JA 3FHZA 4UVAA 5H6RA 1OB9A 1YW9A 2L4AA 2LF7A 3G3ZA 4EQQA 4P55A 5DEQA 1KA8A 4RGXA 1YG2A 4YFNF 4RB0A 1YTYA 5JFRA 3T5XA 1OKRA 2D2WA 3CO6C 3FX3A 3TOBA 1T39A 4HQEA 1V3FA 4RB3C 3FM3A 2HEOA 3TO9A 2FF4A 5F6FA 5JVTA 4DQ2A 2IA2A 2WJ0A 2YX4A 1TTYA 2L54A 3ZMZA 5DD8A 2FSWA 4MTEA 1S29A 1RIOH 1ZRCA 2H27A 1YO5C 3DQVC 4OU0A 1G3WA 3VODA 3KCCA 4G94A 1RUNA 4ENNA 1G4DA 5KK1A 5L3CA 3FMSA 4MNUA 2HYGD 5LRRA 4LG0A 1XGNA 4PZJA 5D4RA 2DQLA 3DPLC 2MLGA 5HDNA 3KZZA 4UV9A 4RAYA 3ECHA 4OMZA 3HSRA 3GFJA 3R0AA 1J2XA 2FXAA 1LQ1A 3CUQC 1BN5A 2UXXA 4LJZF 3W6JB 1DDNA 1HW1A 2MH2A 5FDKA 2Y48A 1FWZA 5ICEA 4IXAA 1F9NA 3DF8A 3GXOA 2H09A 3HHHA 4AD9A 3C7JA 2P5VA 3E97A 5A2QZ 1ZLKA 1XDSA 2P5KA 4OINF 1U6GA 2X0LA 2DLLA 4EJOA 2DO7A 5FLXK 4BHCA 2VODA 1Q1HA 5J8FA 3K69A 1OYWA 2GA2A 3RPUA 2VONA 3U9GA 5E1ZB 5EEGA 5CVIA 2YSRA 4M72A 4U88A 4QWQA 3WG9A 2L02A 3ML6A 1EV7A 3LAPA 1WRJA 5HDKA 1LNWA 3L9FA 2EV0A 4GYIA 3P9IA 1YIOA 3F22A 4ZYDA 3I59A 4OIQF 5FGMA 4KIFA 4KIGA 2DU9A 5D4SA 1T0FA 5D8KB 3JTHA 1IN8A 3RKWA 1UB9A 2PLYA 1LJ9A 3WU1B 4EM1A 1U3EM 1IZ1A 2INBA 4PDKA 1FYMA 1F4KA 4U0WA 5E1WA 2CWEA 3ISPA 3I0TA 1Z6TA 2L4MA 2D45A 1IW7F 4WXDA 2PQ8A 3ERED 3KP4A 1BIAA 2CQKA 4H0EA 3HRSA 2E7WA 5J8CA 3VEPA 4BXUA 5ICCA 2Q2EA 1FX7A 3SFZA 1RZNA 4L9VA 1IN6A 4LK1F 1G3TA 1MD0A 4UHTA 4EMSA 4YIFA 4L18B 4IPAA 3VOEA 5AIPA 5K5OA 3T1BA 1IN7A 4EGZA 3O2PE 2PJPA 2ETHA 1NHAA 3C1DA 2ZMEA 2VBXA 5LHGA 1Z6RA 2RQPA 4ESBA 1XDUA 4S05A 4MEXF 2ZJ2A 4YFXF 3E6BA 5LGNA 1XSDA 2YX7A 4O6JA 3L7WA 1T38A 2W57A 1HXDA 4M9XA 4EJWA 2BBYA 1USTA 1BI0A 2FCOA 5HLGA 4PCQA 1JGSA 4P9FA 5DCFA 5LEJA 2XROA 3F21A 2A61A 2W84A 2Y0MA 1ZG5A 2XV4S 5LRSA 2PN6A 5BOXA 1YQAA 3E5UA 5LHIA 2VN2A 3I53A 4KUMA 5ICFA 2GW6A 4HZFA 3RKXA 4A6EA 1J59A 1RLVA 1FBSA 3HUGA 1FSEA 2XVCA 4CGZA 2DK8A 2GQQA 2CFXA 2FMLA 5FLXZ 3GZ6A 4QBLA 3COAC 2V79A 5LHHA 3T8TA 1J5YA 1HW2A 4HYEA 1Z05A 3E6MA 2EFOA 2VT3A 4G9YA 2LDUA 2R7DA 2VLDA 1A04A 2V1DA 3K1NA 2HS5A 1TW3A 1XCVA 2FNAA 5LEKA 2CSOA 4HX8A 2NS0A 1C0WA 1B1BA 3M8FA 5LLQA 1LB2A 1QO0D 4EGYA 1IN5A 2DW4A 5L3EA 1A79A 2QWWA 1UCRA 5ILSA 1J7KA 2XKOA 1OR7A 2H6BA 4ENKA 2ZBKA 5LGTA 3MZHA 2QQAA 5E1XA 3J81K 5AONA 2PFBA 3F23A 2FA5A 3QP6A 2P7VB 2O6GE 2IJLA 2DTRA 4NQWA 2Z9OA 3HHGA 1UHWA 4A12A 4HAMA 3IKVA 1YS7A 3B73A 5CLSA 2QYOA 4N9IA 1HKQA 2V6CA 2CO5A 1ON2A 2R3SA 4CHUA 1ON1A 3WE3A 3ELKA 4L5JA 3KZYA 4I98B 3ZMUA 1Z1DA 2EWNA 2XGXA 4MGRA 3E5QA 3D0SA 2ZNZA 4KA4A 2M5WA 4YIIA 4PGGA 3E6CC 2QQ9A 3MAJA 2DFIA 3TO7A 5ERIA 2HOEA 2VC0A 3ZPLA 1W5TA 3IC7A 3IHUA 1B9MA 4HLXA 3R60A 2XRNA 5DDGA 2GIVA 3KFWX 3JSOA 2J5OA 5CVRA 1Z7UA 1ZN2A 1BI1A 3EYYA 3E5XA 1O7LA 2JTVA 4QLCU 2A68F 2P6TA 2DK5A 1K78A 3F8BA 3JAMK 1XGOA 3WGIA 2OKFA 3WTYC 1PUEE 4GXOA 3E6DA 2ZYZB 2YU3A 3IRQA 4A5NA 2Y75A 2KIMA 2WC2A 2E7XA 1TNSA 4GGGA 4ZZDA 3WTWC 1V4RA 4M9ZA 3HSEA 1YYVA 4A5MA 1USSA 2ACJA 4RGUA 1YW7A 3FMQA 3HTSB 3K1PA 3NQOA 4G6QA 2ISYA 4N9HA 3QU6A 2IW5A 1ODDA 2FEZA 5JI6A 3TOAA 4Z2YA 4BAYA 4P9UA 2J5PA 1LVAA 3FF5A 1IPIA 4ENMA 1KQ0A 4I0AA 1P92A 4I09A 3S2WA 1PP7U 2QBYB 2EO0A 4Q47A 4XRFA 4WK8F 1AOYA 3F8MA 4LD5A 1TLHB 1IRFA 2DAOA 1XMXA 1KQ8A 4KIBA 4XSXF 3AJVB 1IRGA 4FX0A 4HV6A 1D3YA 3GEZA 3R4KA 3J81Z 1IAWA 3KLNA 2C6YA 4ON0A 4ESJA 1BJAA 2XIGA 3M7GA 3MQ0A 3K0LA 3TGNA 4I02A 3BJAA 4LLNA 1MJBA 1S6LA 1KQ9A 1R11A 1OYYA 2EFPA 2RVCA 4M9SA 1KU3A 3FXQA 3GYHX 3DEUA 1R58A 5K5RA 1ZLJA 1E2XA 4FX4A 1EH7A 2EFQA 5K1YA 3SQNA 3VFZA 4OIOF 3GO5A 1IN4A 1GXQA 2LKPA 2EJRA 3Q9SA 5D6FA 3P9CA 5FO5A 3CLOA 2DPDA 2UZKA 3F72A 1K6OA 3P1YA 3DP7A 3F3XA 4ESFA 1W7PD 4A2UA 1I1SA 3LFKA 2KJBA 1ZP7A 5HS7A 2XASA 3ZMDA 4CZZA 1OYIA 1H9TA 1BM9A 2RV8A 4AVPA 5E8GA 1KU2A 4EVIA 1FBUA 2F5FA 3RYRA 1IXSB 1XD7A 3H92A 3F8FA 1Y0UA 2ZXJA 2DI3A 2IP2A 3HRMA 1TQPA 3RPQA 2K4JA 4EJVA 3R6SA 2P8TA 1FSHA 2IA1A 1ZRDA 2XAHA 5BPIA 5E17F 4R79A 5BPDA 1BIBA 4M73A 4RS8A 3ABTA 2ISZA 5EEHA 4CYDA 5DUKA 3FMRA 3ZMSA 3CDHA 5ILVA 3BPVA 4LLGF 3I58A 5DCMB 2KKOA 3OOPA 4ZYGA 4LB6B 1WWXA 2Z3YA 1MDMB 5H20A 5JR3A 2UXNA 2QM3A 4GO1A 4ZYHA 3TDUC 1SD5A 1BC8C 3KEQA 1DPUA 5HOOA 2RKHA 1JHHA 2WWYA 1BOAA 1YW8A 5FFXA 1JXSA 3I64A 1HH1A 1R22A 3HTUA 2YR2A 2Z33A 3CUOA 5HS9A 2F5EA 4KMFA 4NHJA 4OMYA 3L2CA 1R5HA 1GHCA 2VOOA 3FOVA 2QVOA 2RGVA 3HYIA 2XHKA 1TW2A 2A69F 3HOSA 4JQFA 2ESHA 2BE5F 4DNCA 3FXUA 1LDDA 2KRFA 1YLFA 4ZYEA 2JZYA 4CXFA 2F2EA 3CUQB 2GA1A 2VBWA 5D5WB 4I01A 4L0YB 3F6OA 3F8CA 2DQRA 4LGWA 3I4PA 2L01A 3QRFF 2P6SA 4G8XA 5TJJA 4O3MA 1KU9A 1HSJA 1LEAA 1REPC 5FB2A 1TNTA 2ZKZA 2COMA 3LWFA 2IPQX 3ZMVA 3K1MA 1H9GA 3JSPA 2QQBA 2OAZA 2STTA 3GVAA 3IEYA 2V1XA 4P96A 2A6EF 3GFLA 3I71A 5IT9K 2OD5A 2M45A 2G7HA 3J80K 2R7FA 4BYYA 3LA2A 1I5ZA 3GLXA 3WODF 4B8XA 1X3UA 1XMAA 2FU4A 4LK0F 1Z91A 3ZQ7A 3H3ZA 3ROUA 2ZYZA 5HLIA 3WTTC 3WGGA 3L00A 2MLKA 2H6CA 2K02A 2YPRA 2CYYA 2HDCA 4TV7A 1TQMA 2VE9A 3ZMTA 3FXRA 2Z99A 1QGPA 1FPQA 1O3QA 4KDPA 4WXCA 2FQ3A 3GF2A 3IKTA 1XMKA 5ED4A 3N4MA 1U5TC 3P1ZB 2OA4A 4Q5SF 2OQRA 4EJUA 4UNOA 2QUFA 2P5LC 1BC7C 3RKYA 3J7AO 2MA3A 3T8RA 2QBYA 4RB1A 3BP8A 3WGHA 1ZREA 2K4BA 2BGCA 6PAXA 2EB7A 5D5VB 5CVUA 3AJVA 2ELHA 1ZH5A 3SHFA 2UWMA 1U2WA 3IWFA 2EFWA 3CJNA 2XAGA 2K7LA 2BV6A 2IT0A 1U5TB 5HDGA 1Y1OA 5DV5A 1LDKB 4HF2A 4ETSA 4U7BA 3M8EA 4L9JA 2DBBA 3R0JA 4BHPA 1K79A 1MZBA 1HSTA 1O3TA 4LB5A 3MZYA 3WE2A 3F6VA 3KETA 3C18A
chains in the Genus database with same CATH superfamily
4CYCA 2LNBA 4MEYF 1IDYA 2FL3A 2HGCA 2E2HJ 3ZCOA 3GTJJ 3CJQB 3BY6A 1GXPA 5AIQA 2VJ5A 3LQQA 4AIKA 4AIJA 1BBYA 1V5EA 4G7HF 1SVOA 4U0YA 3CC2I 1UHMA 1JUPA 1T33A 1XN7A 2CG4A 3WU2C 1JJ8C 1XSVA 4IHVA 2LYCA 2OF7A 5F0FA 2ECBA 5M3MJ 2HTJA 4WF2A 5IT9Z 2XF5A 3DPUA 2ELKA 1B4AA 3ULQB 2JQ7A 4D0PA 4DJAA 1ZG1A 5IYDJ 5ILUA 2YS9A 3J80Z 5L3FA 1SMTA 3DV8A 4FTHA 1U8BA 1TL8A 4BNCA 3OYLA 4BXXJ 4HF0A 3V8LA 2VUMJ 1P4WA 3FWEA 2V6EA 3QPSA 1YOVB 4A3IJ 2JSCA 1AKHB 3RQ4A 4II3A 2L9SA 2M7AA 1DP7P 3CCVI 4MHGA 3N97A 3EUKL 4IHTA 3FISA 2NNYA 3ZP5A 3K2ZA 4U7DA 3I3LA 3OYBA 2LLKA 2F5DA 2EH3A 1BR1A 2LF8A 2CFOA 1XGMA 1P7IA 3BPXA 3KEYA 4PJLA 1FC3A 5HLTA 1Y88A 5KAIC 4KMUX 2H8WA 1X4PA 2NS8A 1V54H 1JE8A 2L3DA 2XAQA 4Q48A 1XGSA 3DXJF 3FXJA 2A5YB 4LIVA 2Z2SB 1D5VA 3CCRI 3K7AJ 4HF1A 3SZTA 1K83J 2EFNA 1YHQI 1ETXA 5HODA 1LKXA 1I1GA 3QYFA 2Q2EB 1SAXA 2CUFA 1MBGA 4YRVA 2OBPA 4JK1X 4HNVA 3OYJA 1FTZA 4QPQA 4XLAA 2DDBA 2FMYA 2EV6A 3H5AA 1TC3C 2HQNA 1I39A 1YX5A 2W82A 4C3HJ 1AHDP 2CV2A 5DCMA 1KGSA 2WB1A 3ZQCA 4PJNA 1L0OC 2D1VA 2WIZA 2IS1A 2M8EA 4IJAA 5ICGA 3QAHA 4QBNA 1MKMA 2A3SA 4Y13A 1S9HA 2DA3A 3HBLA 1H88C 1F1ZA 2HOTA 3SYTA 3C2BA 4NC8A 1WJEA 1YNMA 4ZZLA 2BEOA 2ZJRF 1PDNC 4V19K 5CJ9A 1MDMA 2XSJC 1T98A 2LTPA 2EIKH 2K40A 2WV0A 2KMUA 3GZ5A 4IZZA 3W6KB 1KYZA 1MIJA 5GPCA 2PI0A 5DYMA 4UVBA 2JK3A 3JR9A 4A69C 3IAS2 1JUSA 1MBKA 2M1BA 4XRSA 1A6IA 4G7OF 2H1KA 1R00A 4M6XA 4M3FA 1KYWA 3C2GA 3HEFA 3TW7A 1R1UA 3DEEA 3A02A 3AFHA 1Z3XA 1HA8A 4E7IA 3HKZN 3EETA 4UB6C 2V9PA 1R36A 3HRUA 3AAFA 1EKEA 5C4XJ 3M1EA 1R4MB 3OY9A 4RGRA 5K5QA 2JRTA 2BXZA 3EUHA 3M8JA 2P7CB 4OOIA 4KITB 4XN3A 2K86A 4AIHA 1JKOC 1FMWA 3IWZA 3LA7A 2JT1A 4C30A 3BG9A 1MBEA 3CUQA 3CTAA 3IH3A 3WU0A 1VI0A 5CYVA 3QOEA 1P6RA 1UFMA 3DU5A 4HSRA 2O7OA 2CW8A 5J4YA 4BEHA 3ZQGA 1IXRC 4FISA 2HQ5A 2V1UA 2WCZA 2WBMA 3OR1C 4YFKF 2XUBA 2QLZA 4J01A 2B0LA 2GIZA 3P7NA 2JA7J 4IVNA 5FKOA 2IGMA 1HKTA 3GW2A 3H5RA 3BZ6A 4MO7A 2WB1N 3S3OA 2HFHA 1EH8A 3SXYA 1CF7B 1R1VA 2IS4A 2KDZA 4HDVA 5A2QK 3CP8A 1HC8A 5DD4A 4G6UA 3A0HC 2STWA 4XICA 2O9LA 2KHMA 3OR2C 3V8JA 2HWVA 2O5RA 2XRLA 2O61A 1FOWA 3CCMI 3BJOA 3K4BA 3H9GA 4V2GA 2VC1A 3S3MA 3TDZC 2E71A 2R7RA 5E18F 3P9KA 2VJJA 2VQLA 1ETWA 1K4TA 2EA2A 3CJRB 1OCRH 4HQMA 4W97A 1ZGAA 3TL4X 1HBXG 1JHFA 1A6QA 2TDXA 5CVJA 3H3VK 1FOKA 2DN0A 2V4JC 1DPRA 4BY1J 2EIMH 2CRGA 1K7AA 2R7ZJ 1GVJA 2PBIA 2KRCA 2FBIA 3QU3A 1MSEC 1ZAOA 2KJCA 2VKVA 1XCBA 3LA3A 4DZJA 5H6QA 5L3GA 3ZGKA 1FBQA 1VQ8I 3RJPA 4JX6A 4BKXA 1AU7A 1FP1D 4L9NA 3FZVA 4OWRB 3M4OJ 3CCYA 1VQKI 1S8NA 4U0VA 3I56I 3B6AA 2ZFWA 2MSYA 3SDGA 2M30A 4ZH4F 3NWTA 3JTGA 4R1HA 2W24A 3OV8A 5CQGA 3PQJA 1SAUA 3JRHA 4IRGA 3JAMZ 5IOZA 1JT0A 1I3AA 2K85A 1U8RA 3NWSA 1P2FA 1T6SA 2R7QA 4S04A 4EEFG 1W7PB 4J00A 1CQTA 4AM3A 3BLYA 3BROA 2OQGA 2LSOA 3DKWA 2AXTC 3GWZA 4HNUA 3OS0A 2GXAA 1ZGJA 1OLTA 4L5IA 2KLOA 2JVGA 2NAZA 4OIRF 2E1NA 3D5LA 1W4MA 1QHGA 3TKYA 1W36C 2EPFA 2EV5A 2RNJA 3KE2A 2G7UA 1NH3A 2QENA 4FT8A 5DUIA 3W6VA 1ZARA 5HVQC 2FRHA 3S32A 4EM0B 1U78A 3S1RJ 2QZ8A 1Y1VJ 4DAVA 2P81A 2ZSHB 1PP8F 3P1ZA 1OB8A 1KU7A 3UNGC 2OCCH 1HKSA 1N78A 1STZA 5F08A 2TRTA 1WI9A 1R49A 2L7ZA 3OYGA 5FRMA 5J4VA 1VQOI 3DKXA 2JUGA 4ANJA 1W36D 2WTEA 4BACA 1LFUP 2MC4A 4BBSJ 2W85A 2V26A 3K9TA 1WGXA 2M0MA 3G1LA 3KP3A 1K78B 4HSTA 3LSRA 5TISC 4AYBA 2HNHA 2JPBA 2GZWA 1JUMA 3G1OA 2PEXA 1CGPA 2L9VA 4Q4ZF 4N0BA 3BWGA 3DU6A 3ECOA 2WADA 1YIJI 4UUVA 4B3AA 4UUSB 3MN2A 1MSFC 1SD6A 2BY1A 4A3DJ 4ZQUA 2G9WA 2H94A 3FXKA 3GFMA 2P0WA 3BG5A 2R0QC 4HW0A 1QPMA 3HC7A 1T2KA 2KRHA 4KJZA 1TT0A 3LSMA 4M74A 1G59A 4IHSA 3LSTA 4RA2A 2DA1A 3RIRA 1UG0A 3GTOJ 2RREA 2GJWA 3FKJA 3PSIA 3L2VA 2NVQJ 5FFZA 2L5QA 2XB5A 4A3MJ 2BVMA 1U5TA 2Q0OA 3VYUB 1P4XA 1IXCA 2KIQA 2AXLA 2DFHA 4E7JA 2DMTA 1R4NB 4KICA 1NG6A 2IVMA 2Z1DA 2EK5A 4IOCF 3GTGJ 3KP5A 2A6HF 2KIUA 4XSZF 5DS9A 4GYGA 2RC4A 3IV5A 5BQTA 2M87A 2NXNB 1OMIA 1Y0NA 2R7WA 2X6XA 2DXIA 4S0HB 3CCJI 3MWMA 1VQPI 2LBFA 1BW6A 1K6YA 2UV1A 4Y7NJ 4UXNA 3ZN1A 1LDJA 1WQ2A 5J6XA 5F1RA 3MEXA 2I8DA 3SFIA 3FK6A 5B5EC 3CF5F 4LLLA 1HQCA 1X3ZB 1R6RA 1R5GA 2X6OA 3L09A 5KVRA 1FMVA 2NYXA 3EDPA 4QPOA 3BR2A 3WHBA 3KEOA 4XLPF 5EZHA 2HKOA 1Z9CA 2FOWA 2DMNA 2VKEA 4UB8C 2N8GA 1ZG3A 3GZNB 4NNJA 4HV5A 5FROA 2X48A 1HDPA 2NNNA 2PMUA 4HX4A 2IA0A 4WCGA 1FP2A 1FT9A 4QSHA 1OCZH 1F36A 1SFEA 4F7ZA 4A3KJ 1G6NA 3QOPA 2CU7A 2VXDA 1E17A 2ZCWA 4IRIA 1Z77A 2HYFA 4B1RA 4A0YA 1JTYA 4GRIA 4AYBN 4EATA 2Y30A 3BZCA 2A07F 4A3JJ 1WJ5A 3K4CA 2HYJA 5L3DA 3C3WA 2HOAA 4DW6A 2WCWA 1WH5A 2MH9A 3DBLB 1IUYA 4TKKA 2WIWA 4PJJA 4A0XA 3BQYA 4AC0A 5EF6A 4N4NB 3V8KA 3V7SA 1S3JA 1SD7A 1AKHA 3A01B 4UVCA 4BHBA 3TP0A 2QKLB 2X1CA 1D1CA 2XC7A 1S7AA 2OZ6A 4HEA2 4LQEA 4ABZA 1LEBA 1OPCA 2DT5A 4NC6A 2RN7A 2XAUA 4MQVA 1VTNC 2O0YA 3JRFA 1AWCA 2E1CA 5FD6A 2HTSA 1ZK8A 2FBHA 4A6DA 2E2JJ 2OU2A 4PFOA 3S3NA 1FYKA 4BQAA 3DTEA 1J9IA 3IF0X 2F6CA 2JPCA 5JHUA 1FOXA 1VNDA 2DODA 4XQFA 1G3YA 1WJFA 4TKDA 2GBYA 2DYRH 1O3SA 3VYSB 1B72B 1VQ9I 2XPWA 2CQXA 4BJ5C 3PQKA 4Y3OA 5TRDA 4XLNF 4MTDA 3HOTA 1V5GA 2GWRA 1YRNB 1XPXA 5D6EA 3KLOA 1MJ9A 4D5CA 3GBGA 2V7FA 2M9HA 1MJAA 4L9TA 2O3FA 4Y15A 1VQ4I 1XB4A 4HDUA 4IHXA 1D8JA 3IL2A 1T08B 5F64A 3BG3A 2GXGA 5E8IA 4NDLA 1W5SA 2LY1A 1O7FA 1WKMA 4WX9A 5EG0B 2E2IJ 1FLIA 5FKNA 2YU9J 2EBIA 2ADUA 3I5UA 5EYRA 3H0GJ 5JVGF 3BJ6A 4M6YA 4P1WA 1I6XA 3OYNA 3M9AA 1T8IA 4IHYA 4ASNA 2AS5F 3WTZA 1U9OA 2EQRA 3A03A 2XAJA 3ZN0A 1YFHA 2IRFG 1XTAA 3QPTA 1U0JA 1O57A 2HZTA 2R5YB 4LFUA 1H0MA 2K9SA 3CQZJ 5IYBJ 2E36A 4QIWN 3HJEA 2Q1ZB 3Q0VA 3OOUA 4BXFA 1YS6A 3KP7A 3OIPA 4FHTA 4C9YA 4M3GA 3CMYA 4IQ4A 2KL4A 4CCJA 2HQRA 2QA4I 4WXHA 3QODA 1DP3A 4OIPF 2PX9A 2OJED 1OCPA 1BI2A 4AWXB 2O8XA 2VBZA 4HA8A 4LG0B 2VBYA 3R61A 1UJ8A 4RAZA 2NVUB 3LQRA 4HOBA 3Q5FA 3H0DA 1Y6IA 5KAFC 1NK2P 1HOMA 4HLYA 4XBFA 2ESNA 1D8KA 5LBQA 1MBHA 3QP5A 3FIWA 1ZTRA 1O4XA 3KP6A 3PJRA 1QNTA 1JGGA 1QA6A 4OAZA 2W00A 3S1NJ 4CA0A 4PSWA 2IBDA 4KISA 2K27A 1MGTA 3CZ6A 2FBKA 3CCUI 3WTVC 2FQ4A 1D0YA 2VI6A 3ABUA 2CUEA 3JW4A 4EV0A 1VQ7I 2KIFA 2HVSA 4FE4A 4BDYA 4CH7A 5K7ZA 3EYIA 3BOQA 3LAJA 5IP6A 1QBJA 3V7RA 2CZRA 1X1BA 1UMQA 1UG2A 2VXZA 2MC3A 3HB9A 1SMYF 1T0FC 2W7NA 1IG7A 1I27A 3NEUA 3GFIA 3SZGA 5E3MA 3CMAI 3HSFA 1CF7A 1XS9A 2ICWG 5KCMA 3RZDJ 3JRAA 4P5OA 3PO3J 4G6DA 1WI3A 2HZDA 1AA7A 4NB5A 4EM2A 4I0BA 3RI4A 1Y39A 3FBIB 2JRMA 3PM1A 3K4LA 5HNHA 2XGEA 2R93J 5LGUA 4RB2C 1B6AA 3PNTA 3A0BC 5J1RA 3HOUJ 1G3SA 2JUCA 4IHWA 2GAUA 2XAFA 3GUDA 3KYCB 4NUBA 3Q9VA 3PFIA 3QYEA 4XONA 3BG7A 5FKMA 1H8AC 4LMYA 3RZOJ 3KYLA 1RNLA 4GCVA 4X0GA 2MD5A 2EA4A 2W25A 3EQLF 4GDFA 4HBLA 1HCRA 1PJRA 1RZ4A 2Q8KA 3TW6A 4CDGA 3ASOH 1EF4A 1ZHFA 1XSXA 4YIRX 4XK4A 2ZNYA 4V2FA 2F4OB 3I59B 2V9VA 3PL8A 4Y17A 3TO6A 3HIFA 3GMEA 4YELA 1ERDA 4I2OA 2PG4A 3IRRA 5CVVA 1B9NA 3RDIA 4O5VA 2ZMEC 5IYCJ 4PGHA 2GXBA 1TP4A 1YITI 3DTIA 3HKZA 3MCZA 4JOMA 3MFKA 4KFCA 1FOYA 4UV8A 1TBXA 3O3KA 1EJ9A 2Y9YA 1MH4A 1SD4A 2R92J 1W7PA 1QQIA 5FD5A 3F8NA 4E70A 3WG7H 3E0JB 4KN4X 1FYLA 2CW0F 3LFUA 3Q0UA 4G7ZF 5BMZA 4BH9A 4JX5A 3U2RA 2F5CA 1S72I 3UR3C 1RESA 4A3CJ 5D5UB 1APLC 5LFAA 3DFGA 3FXLA 4PUSA 4PFPA 1K61A 5D8LB 3DPTA 3BCBA 2HKXA 4JX4A 3CCLI 1P7JA 3K2AA 2WY7Q 1DU6A 3RYPA 1VQ5I 5GPAA 1QZZA 2KFDA 3K4MA 4B44A 1ZR2A 2O03A 3EUAA 1B8IB 3V4GA 2H1LA 1O3RA 2CV8A 2JA2A 4HX7A 4IX7A 2LK2A 3O6BB 3SZPA 1Z3YA 2CMPA 1MW7A 4IRHA 4CICA 1BI3A 3DNXA 3TP3A 1RR8C 2XPVA 3CO7C 4KT5C 4CO8A 2WAEA 1FZPB 2XF7A 1TZLA 3K10A 1IF1A 3REOA 4R8HA 3CCSI 3H3UA 1R0VA 1SC7A 2V9KA 1ZRFA 2MFZA 2VL8A 2M2EA 3DCFA 1POGA 2P4WA 2WV1A 2DBSA 3FM5A 2DJIA 5FKLA 3H9QA 5C3EJ 3WTUC 1L3LA 1SFUA 2ZMEB 3MD2A 2XGCA 3GX4X 1EH6A 1FNNA 1A36A 2ZB9A 2Z5UA 3TQNA 3A4CA 2BYVE 4UY8I 5IT3A 2F4MB 2CGPA 2DPUA 2VPLA 2FOKA 2E1MC 1DUXC 1F5TA 5H2FC 2L7MP 4KN7X 3HOWJ 2X4HA 4UUSA 2OSTA 3BR1A 1IRZA 4L0ZB 4KNYA 4MQ9F 1RUOA 4RM3A 1JKRC 3DLLF 5K7FA 3PNVA 4M71A 4EV1A 3RKQA 4FQGA 3RTRA 1ONVA 2F4IA 2OZUA 2X51A 3S15J 5HS8A 3KP2A 3PIPF 3AG3H 3U1DA 1ULYA 4K2EA 4EJTA 1H89C 1J09A 2VE8A 3E3VA 1P4AA 1HW5A 1SFKA 4I7HA 1WJCA 5D5XB 2VT2A 4B48A 2V1NA 1RR7A 3QPHA 2NRAC 3H35A 2BHZA 4A0ZA 1B59A 2BW3B 1WSUA 1ETKA 2XKPA 4XLFA 1OR7C 2VJIA 4LIUA 5BS6A 4QBOA 3B02A 4G6TB 1RI7A 1ZKGA 4YEJA 4WWCA 3WTXC 4ZYAA 1S7OA 1WHUA 3HUGB 3BDDA 1J0RA 4RGSA 3V7CA 4ENJA 2WY8Q 3I54A 1YJNI 3DKYA 4B09A 3G4SI 2A6TA 3G73A 1GEFA 2ZXHA 5EJCA 2FNPA 3T0YA 2DA5A 2KT0A 5M5XJ 2HR3A 4IF4A 2L0KA 3IAM2 3VYTB 5E20A 2RDPA 1F43A 1TQIA 2JN6A 3NRVA 3VB2A 1ZYRF 3HRTA 3GTKJ 3FDYA 1R1TA 2D1HA 2ZO4A 1N75A 2ME6A 2B9SA 3U1KA 1FY7A 2LMDA 4YG2F 4KYWA 2MBFA 5M3FJ 5L3BA 4HNTA 4JBAA 1ETVA 1BA5A 1J75A 1GLNA 2FE3A 5EGOB 4ZC3A 5HLHA 1SFXA 4X1EA 1R23A 3WTSC 3CC4I 2VOPA 2PMHA 1QZYA 2BH2A 1R7JA 2H8RA 4XL9A 3FHZA 1FIPA 2K3PA 4XN0A 5GAEJ 4UVAA 2VKDA 3SEZA 4Y33A 3BR0A 1T56A 5H6RA 2FD5A 3LSJA 3A01A 1YW9A 1OB9A 2IGOA 2L4AA 2LF7A 3ZOBA 2R7TA 3BZKA 3G3ZA 4EQQA 1OJLA 2CQQA 4P55A 1JKPC 5DEQA 1KA8A 5GTHC 4RGXA 1GUUA 4C3IJ 2LC2A 3S17J 2R5ZA 3ZQFA 4HPQA 3W2AA 4NQWB 4C2UA 1YG2A 3I4MJ 1XG1A 4YFNF 2K9LA 4RB0A 2M3AA 2Y9ZA 1YTYA 1WFXA 5JFRA 1TWFJ 4FE7A 2BXYA 3T5XA 1B72A 1OKRA 1YRNA 1PUFB 2D2WA 3CO6C 4BDZA 2WAFA 3OWTA 3FX3A 3DTKA 3TOBA 1T39A 1YJ9I 4HQEA 3O8HA 1V3FA 4FETA 4RB3C 1OCOH 3I9V2 3FM3A 5B3SH 5EG0A 2HEOA 3PUBA 1OISA 4BE0A 3TO9A 4PSXA 4G6VA 1IV8A 4XRSG 3SJMA 2FJ1A 2L7FP 2FF4A 3AG1H 2K5CA 5F6FA 5JVTA 5DTDA 1FEXA 4CUGA 4B47A 4DQ2A 3OYEA 2IA2A 2WJ0A 2YX4A 1TTYA 2R5YA 4RLQA 2L54A 3ZMZA 3HOYJ 5DD8A 2DT6A 2FSWA 4MTEA 1D0XA 1S29A 3HZJA 3HL2A 1RIOH 1ZRCA 2H27A 2Y31A 4BE2A 1YO5C 5E3LA 3DQVC 2HOSA 4OU0A 1G3WA 1RETA 3VODA 2HQAA 3VYRB 1ETOA 2VS1A 1FTTA 2DA4A 3F9KA 3KCCA 4G94A 4XKWA 1RUNA 4ENNA 1MMGA 1G4DA 5KK1A 5L3CA 2DYSH 3FMSA 1I3QJ 4MNUA 2XPUA 2BY2A 2HYGD 5F0HA 5LRRA 2AQEA 4LG0A 3RQIA 1XGNA 4JYKA 1ZELA 4PZJA 5D4RA 1SANA 2DQLA 3DPLC 2MLGA 3VSLA 2BOLA 5HDNA 2ECCA 5J3LA 4Y52J 3KZZA 4UV9A 2R7UA 4RAYA 3ECHA 3EUHC 4OMZA 1W5CC 3IH4A 4W1UA 3OYFA 4IO9F 3HSRA 3GFJA 3R0AA 4LG3A 1NG7A 3OIQA 1J2XA 2DOEA 3KPHA 2FXAA 3E1SA 1LQ1A 3CUQC 1BN5A 3HPGA 1HF0A 3VWBA 1Z7LA 2NVYJ 2XB0X 4MFEA 9ANTA 4XKVA 2UXXA 3DBHB 4LJZF 1A5JA 2ZSIB 3W6JB 3VPRA 4I99C 2LH9A 2ID3A 1MBFA 3OYAA 2EINH 1GV5A 4DGWB 1DDNA 1HW1A 2LVSA 1E3HA 2ZC2A 2MH2A 5FDKA 2Y48A 3S2DJ 4Z6YA 1FWZA 5ICEA 4IXAA 1F9NA 3DF8A 1GDTA 3GXOA 1VZ0A 4JP0A 2H09A 1QVUA 3HHHA 3AG2H 4AD9A 3C7JA 1LE8B 2P5VA 3ESWB 1P9QC 3E97A 2BZTA 5A2QZ 3HOZJ 1ZLKA 1XDSA 2P5KA 4OINF 2COBA 3GLLA 1U6GA 2X0LA 2DLLA 4EJOA 2DO7A 5FLXK 4BHCA 2R7VA 3LSKA 2VODA 4D7NA 1Q1HA 4XLCA 5J8FA 2FUG2 3K69A 1OYWA 2GA2A 3RPUA 2DT7B 4A3EJ 1MNDA 2VONA 1JI8A 3U9GA 1G8XA 5E1ZB 5EEGA 3J7AY 2A05A 1XX5A 5CVIA 2YSRA 1X1DA 3ONQA 2A5WA 4M72A 4U88A 2K9QA 3MZ8A 2M4KA 1BJZA 4QWQA 3WG9A 2L02A 4XMYA 2OTJI 2JA8J 3ML6A 3TMOA 1EV7A 3LAPA 3BT9A 1RC9A 1ZGWA 1A31A 1WRJA 5HDKA 2W8MA 1LNWA 3L9FA 2EV0A 2BVLA 4GYIA 5IOYA 3P9IA 1YIOA 5EDNA 4ZYDA 3F22A 3HDDA 4HG2A 3I59A 3GTQJ 4OIQF 2E34A 2I10A 4NC7A 5FGMA 3D5SC 1DGRM 4KIFA 1BR2A 2GOMA 3ZQQA 4KIGA 2HVRA 2DU9A 4CCLA 1JKQC 5D4SA 3OYDA 3FXMA 1T0FA 5D8KB 3JTHA 3HOVJ 5B1BH 1IN8A 3S14J 3EPZA 4UUTA 3LSHA 3RKWA 3OYMA 1UB9A 2PLYA 1D0ZA 1LJ9A 3MMYB 3WU1B 4EM1A 1U3EM 4DYCA 1IZ1A 2INBA 4PDKA 4BGDA 1FYMA 1F4KA 2QSHX 4U0WA 5E1WA 4GFBA 4ZDOA 2CWEA 3OSGA 2MW8A 3ISPA 4MIMA 3RCOA 3I0TA 3DLAA 4OAYA 1Z6TA 2L4MA 3UKGA 2D45A 1IW7F 4WXDA 2NVXJ 2L2OA 2M4GA 2PQ8A 5BNGA 2DDAA 2IEKA 3KP4A 1BIAA 2CQKA 3S93A 5EEAA 3ERED 4H0EA 5FLVA 3SEQA 1Y8RB 1WPKA 2M7BA 3HRSA 1YJWI 3AKZA 2DMPA 5DM6F 2E7WA 1RPWA 3VEPA 5J8CA 4BXUA 5ICCA 1B8IA 3BR5A 3M07A 1A35A 1MMDA 2Q2EA 2BY0A 1DGWY 1FX7A 2X9DA 3HM5A 4F55A 3SFZA 1RZNA 3K4NA 1N25A 4L9VA 1IN6A 2IGNA 1G3TA 4LK1F 2CV1A 1MD0A 4UHTA 4EMSA 4YIFA 4L18B 1WJBA 4F93B 4IPAA 5F0CA 3J7YJ 4IL6C 3VOEA 4DYRA 5AIPA 1W0TA 5K5OA 2AHQA 3T1BA 1IN7A 4EGZA 3O2PE 2PJPA 2ETHA 1NHAA 3C1DA 3IUOA 2ZMEA 2VBXA 5LHGA 5E3OA 1Z6RA 5J40A 4CCNA 1VFCA 4RAFA 2RQPA 4ESBA 2XDVA 3DBRB 4AIDA 5DM7F 1XDUA 4D9JA 1X3WB 4S05A 4MEXF 3B6CA 1X1AA 2ZJ2A 4YFXF 3E6BA 4XNFA 2JA5J 5LGNA 3M1CA 1XSDA 3U21A 2YX7A 4O6JA 4BBRJ 2K9NA 4BJTA 3L7WA 1T38A 2W57A 4D7MA 4DIQA 1HXDA 4M9XA 2XF6A 4EJWA 3BR3A 2BBYA 1USTA 1BI0A 2FCOA 5HLGA 1X4OA 4PCQA 1JGSA 1OCCH 4RBOA 1M1EB 4P9FA 1GV2A 2DOAA 5DCFA 5LEJA 2UUZA 2XROA 5GADJ 3F21A 2A61A 2W84A 1E0EA 2Y0MA 1ZG5A 2XV4S 2WA0A 2IS6A 5LRSA 1T95A 1W1WE 3PIOF 2BW3A 2PN6A 2JA6J 2ME0A 2E35A 2L7KA 5BOXA 1YQAA 5C4JJ 3E5UA 1ITYA 5LHIA 2VN2A 2WAQN 3I53A 4KUMA 5ICFA 3OSFA 3W3CA 2GW6A 4HZFA 3RKXA 5JLXA 4A6EA 1J59A 1RLVA 1FBSA 3HUGA 1FSEA 2XVCA 4CGZA 2B63J 3MKYB 4BE1A 2DK8A 2GQQA 5C44J 2E5NA 2CFXA 2FMLA 4HRIA 4E7SA 5E3NA 5FLXZ 3GZ6A 4BS9A 3CMEI 4QBLA 2HPMA 3COAC 2V79A 4F3QA 5LHHA 3T8TA 1J5YA 1YI2I 4PK4A 1HW2A 4IKFA 4HYEA 1Z05A 1Z67A 3E6MA 3BTJA 3QQAA 4XOTA 2EFOA 2QF7A 2VT3A 4G9YA 1XC5A 2LDUA 2R7DA 2VLDA 2JVHA 4CSWA 3JRGA 1LFPA 2O8KA 5EGOA 1A04A 2V1DA 2XSDC 3K1NA 2HS5A 2VKHA 1TW3A 1XCVA 2FNAA 5LEKA 3S1QJ 1TWGJ 2VPRA 2FLCA 3ZRGA 2CSOA 4HX8A 1Y8QB 2NS0A 1C0WA 3OL4A 1B1BA 2M8GX 3M8FA 5LLQA 1LB2A 3CD6I 1QO0D 4EGYA 1GVDA 1IN5A 1OFCX 2DW4A 4M3DA 5L3EA 1A79A 3DWLE 2QWWA 1UCRA 3ERMA 5ILSA 1J7KA 2XKOA 1OR7A 2H6BA 1Z0XA 4LOCA 4ENKA 2ZBKA 2OC6A 1SVLA 4E6KG 2DMQA 3MKZA 2OCEA 2OPTA 1MNMC 3KYDB 5LGTA 2QQAA 3MZHA 5E1XA 3J81K 5AONA 2PFBA 3F23A 2AQFA 2FA5A 3FHNA 3QP6A 2P7VB 2O6GE 2IJLA 2DTZA 2DTRA 4NQWA 2Z9OA 3HHGA 3A1YA 1I6HJ 2IS2A 3L1PA 1UHWA 1ZR4A 4A12A 4HAMA 2NOJB 3IKVA 3K4KA 3NARA 1YS7A 3B73A 5CLSA 1PUFA 2QYOA 4N9IA 3DEWA 3KIOA 1IV6A 2X6YA 3OS2A 1HKQA 2V6CA 2CO5A 4PJMA 5IP9J 4J19A 1ON2A 2R3SA 4ITVA 2DA2A 4CHUA 1ON1A 2E60A 2JWTA 2KQRA 3CESA 5FKKA 3WE3A 3ELKA 1R71A 4IQJA 3A2KA 4L5JA 3G2BA 3KZYA 4I98B 3E7LA 3ZMUA 1Z1DA 2EWNA 1IO2A 2XGXA 4MGRA 1YX3A 3E5QA 3D0SA 2I5UA 5J1YA 3TBIA 3K70C 2ZNZA 4E7LA 4KA4A 2M5WA 4YIIA 2EZLA 4PGGA 3GCMA 1VQMI 3E6CC 2QQ9A 5CPRB 3MAJA 2DFIA 3TO7A 4A3BJ 3HXLA 4BY7J 5ERIA 2ZFUA 2HOEA 2VC0A 3ZPLA 2ZXIA 5HNFA 1W5TA 1E3PA 2LP0A 3IEYB 3IC7A 4A93J 2EZIA 3LSIA 4II2A 3IHUA 1B9MA 4AVZA 3OS1A 2OUMA 4HLXA 3R60A 2XRNA 5DDGA 3K70D 2DJNA 2VJ4A 2GIVA 3KFWX 2K3FA 3JSOA 2J5OA 5CVRA 2W4SA 1Z7UA 1R9TJ 1ZN2A 1BI1A 3EYYA 2LOOA 4IOAF 3E5XA 3TEDA 3CJTB 5EZGA 1O7LA 2JTVA 3BR6A 4QLCU 3AL0C 2A68F 2KISA 2P6TA 1FIAA 2DK5A 4B4CA 2E5ZA 2LKXA 1K78A 1UAAA 3F8BA 4PJ0C 3SDBA 3JAMK 1XGOA 3P5JA 3WGIA 2CW7A 2OKFA 3WTYC 1PUEE 1E3OC 2EZHA 4QTRA 4GXOA 5CKTA 3E6DA 5B1AH 3HGGA 2ZYZB 2YU3A 3LOCA 4A5NA 3IRQA 3FBNB 1NTCA 1I50J 2Y75A 2KIMA 2WC2A 2E7XA 1TNSA 4GGGA 4ZZDA 3WTWC 3JRCA 2PJRB 1V4RA 2RQQA 2R7OA 4M9ZA 3OL3A 1WJDA 1YYVA 3HSEA 4A5MA 1USSA 1MMAA 4ZDPA 2ACJA 1WJAA 4RGUA 5F27A 1YW7A 2NS7A 3FMQA 2ELJA 3D1NI 4XKCA 3VSKA 3HTSB 1UHSA 2R7XA 5CQEA 5IY5H 5IPAA 1KZHA 1BL0A 3K1PA 1IC8A 1MMNA 3NQOA 4G6QA 1WVRA 2ISYA 2KDOA 2KZGA 4N9HA 1Y1WJ 1NK3P 3QU6A 1MMSA 2IW5A 1ODDA 2DFFA 2FEZA 5JI6A 1LE8A 1UELB 3ZQLA 3TOAA 4L5EA 4Z2YA 4BAYA 3HOXJ 3AL0B 4P9UA 2J5PA 2YUSA 1LVAA 3FF5A 1IPIA 4ENMA 1KQ0A 1X1CA 4I0AA 2CH0A 1P92A 4I09A 3S2WA 1PP7U 3L2UA 2QBYB 2EO0A 4XLEA 1WCMJ 4Q47A 1SVMA 4XRFA 4WK8F 2E1MB 1AOYA 2F48A 3F8MA 2JJ7A 4LD5A 1TLHB 2Y69H 1IRFA 2DAOA 2EIJH 1PVEA 1RKTA 1XMXA 1KQ8A 4KIBA 4XSXF 3AJVB 2Y2ZA 2QGUA 4FX0A 4HV6A 1D3YA 3FK7A 3GEZA 3R4KA 1IRGA 3J81Z 4N4OB 1MBJA 3KLNA 1IAWA 2HDWA 2C6YA 4MLOA 4ON0A 4ESJA 1BJAA 2XIGA 2DCEA 4CCOA 1SFOJ 3H5NA 3M7GA 3MQ0A 3K0LA 5IP7J 4E7ZA 3OIOA 3S2HJ 2R7SA 3TGNA 4F92B 1LVKA 3BCAA 4XKBA 4I02A 2JSPA 3BJAA 3CC7I 4LLNA 2LY9A 1MJBA 2LREA 1S6LA 1KQ9A 4E7HA 1R11A 1OYYA 5E79C 4U87A 3H9JA 2EFPA 2K9MA 2RVCA 4M9SA 3H36A 2QSFX 1KU3A 4E7KA 3FXQA 3GYHX 3DEUA 1R58A 1DQUA 5K5RA 1ZLJA 2E1OA 2MABA 2ZJPF 2CV0A 1K4SA 3MKWB 1E2XA 4XM3A 4RDUA 4FX4A 2VB6A 1EH7A 1N77A 3J7ZI 1X2NA 2EFQA 5K1YA 3FKIJ 3SQNA 3VFZA 3BT7A 2E19A 4OIOF 4CYCB 3GO5A 5GAHJ 1IN4A 1GXQA 2LKPA 2MG4A 2LRDA 2EJRA 3Q9SA 3LSPA 2PMZA 3KX2A 2JJQA 3CDIA 2IAIA 5D6FA 3ABKH 3BG6A 3P9CA 5JLWA 4B43A 5FO5A 3CLOA 2DPDA 2UZKA 3F72A 3OYKA 1K6OA 3P1YA 3HG9A 2MD0A 3DP7A 3F3XA 3LSGA 3ZR8X 2DFEA 2L9RA 2HVQA 1OCTC 4ESFA 1W7PD 4A2UA 1I1SA 3LFKA 1UZCA 2KJBA 1ZP7A 1D5YA 1IUFA 2XGDA 1QU3A 4MFDA 5HS7A 2NOGA 2NVTJ 2FX0A 2XASA 1MNEA 3ZMDA 4CZZA 4BQNA 1RRJA 2CUJA 2LR8A 1UWVA 1OYIA 3MVPA 1H9TA 3HGYA 1BM9A 2RV8A 4AVPA 2QSGX 4X6AJ 1EA3A 1JTXA 1KU2A 1S5LC 5E8GA 4BJ6C 5GTIC 4XRMA 5F04A 5M5WJ 4IEJA 2L9NA 4EVIA 1FBUA 3S1MJ 1ACIA 2HPIA 2HU9A 2F5FA 3PNYA 3L2WA 3RYRA 1G2HA 1IXSB 2BHYA 1XD7A 3H92A 3F8FA 1Y0UA 2ZXJA 3NAUA 2DI3A 3OYHA 2FKHB 2IP2A 3I4NJ 3HRMA 1TQPA 3RPQA 2K4JA 2CS3A 2AO9A 4EJVA 1V55H 2LFBA 3QWLA 4G12A 2JMWA 3R6SA 2P8TA 2QQ8A 1FSHA 2IA1A 1ZRDA 2XAHA 3H1CA 5BPIA 1WZ2A 1PYVA 5TGTA 1JT6A 5E17F 4R79A 2X85A 3Q3SA 3CP2A 1Q1VA 5BPDA 1BIBA 1KONA 2TCTA 4M73A 4RS8A 2CQ7A 3ABTA 2ISZA 3AG4H 5EEHA 4CYDA 5DUKA 4DZPA 4DAPA 3CLQA 4XR6A 3FMRA 3ZMSA 3CDHA 5ILVA 5K7HA 3BPVA 3HPHA 4LLGF 5FJ8J 3I58A 4ZTFA 5DCMB 2DOFA 4AUXA 2RAEA 1ETQA 1R5ID 2RNGA 4DBQA 2GM4A 2PMZN 4CCMA 4C2TA 2R4GA 1BR4A 2KKOA 1WH7A 2HXOA 2VASA 3F0CA 3OOPA 4I6ZA 2QKMB 4ZYGA 4LB6B 1WWXA 4F91B 1QRYA 2Z3YA 4A3LJ 1MDMB 5H20A 5JR3A 1QHHD 5FRNA 5GP9A 2UXNA 2QM3A 4GO1A 4BQQA 4ZYHA 3TDUC 3CDLA 1SD5A 4FCYA 2M0CA 3KEQA 1BC8C 1TWAJ 1DPUA 2QEXI 5HOOA 2Y0SA 2RKHA 1JHHA 2Z16A 1LPQA 1BOAA 1YW8A 2DMUA 2WWYA 5FFXA 1JXSA 4A3GJ 1ENHA 3LL7A 3I64A 1D1AA 1HH1A 1ZQ3P 1R22A 3HTUA 2YR2A 2Z33A 1TWHJ 3CUOA 5HS9A 2F5EA 4KMFA 3D5RC 1LUJB 5KNLA 4NHJA 4OMYA 3L2CA 1R5HA 1GHCA 2VOOA 3BTIA 2QVOA 3ZQIA 3FOVA 2G0EA 3K4JA 2RGVA 3HYIA 2XHKA 1TW2A 2A69F 3HOSA 3K6GA 4ZDLA 2FKCA 4JQFA 2ESHA 2BE5F 4DNCA 1RKWA 1LDDA 3FXUA 1S7EA 2KRFA 1YLFA 2LD5A 3LNQA 4ZYEA 4BQOA 2JZYA 4CXFA 2F2EA 2OTLI 3CUQB 3W2VA 2GA1A 2VBWA 5D5WB 3FXOA 2EILH 3S8PA 1DU0A 4I01A 1VQNI 1TWCJ 1U9NA 4RMNA 4L0YB 3JREA 3F6OA 3F8CA 2X1EA 3C2HA 2DQRA 4LGWA 3I4PA 2L01A 4BEHB 3CCQI 3N05A 3QRFF 3X2QH 2P6SA 4G8XA 2X6WA 5TJJA 3RSNA 1KU9A 4O3MA 1VQ6I 2GOXB 2MGQA 1HSJA 1LEAA 3PO2J 4ZTJA 4DBRA 3G6EI 1REPC 5FB2A 2F5VA 2B7EA 3QPLA 2ID6A 3JRDA 1MH3A 1TNTA 1JJ6C 4DYQA 2KP6A 3ZQHA 2ZKZA 2COMA 3LWFA 3I55I 3IH2A 2IPQX 3O8GA 2HDDA 2QCOA 4RLFA 3IP4B 3ZMVA 3K1MA 4F52A 2EZKA 1X2MA 1H9GA 2WAQA 3JSPA 2QQBA 5B66C 4E6ZA 1SEUA 2OAZA 2Y0SN 3OYCA 2STTA 4KT6A 3GVAA 3IEYA 2V1XA 4P96A 2A6EF 3OMYA 3GFLA 3I71A 2M34A 5J1UA 5IT9K 2OD5A 1BW5A 4I76A 2R5ZB 2M45A 2G7HA 4XORA 3J80K 2R7FA 4BYYA 4DOZA 3LA2A 2IXSA 3JRBA 2CUZA 4BUPA 3GTPJ 1I5ZA 3GLXA 3WODF 4B8XA 1BOBA 2VQGA 4NBQA 1FJLA 5LD2C 5KHDA 3OYIA 2CJJA 3BC8A 1X3UA 1XMAA 4ZJZA 2FU4A 4LK0F 2LG4A 4LITA 1Z91A 4D5FA 1LFBA 3ZQ7A 2LY2A 3H3ZA 4RAGA 3ASNH 3GTLJ 3ROUA 1IRXA 2W1OA 1VF9A 1X19A 2KZVA 2VQHA 1ORKA 2ZYZA 5HLIA 3WTTC 3WGGA 3L00A 2HXIA 2X1DA 2BY3A 1Z21A 4DA2A 2DA6A 3CF2A 1X1PA 2PJRA 1TT5B 4C2MJ 2MLKA 2H6CA 3PSFA 2K02A 2YPRA 2CYYA 2HDCA 4TV7A 1TQMA 2IGKA 2VE9A 3ZMTA 3G71I 3MKLA 2MYSA 3ABLH 3FXRA 2Z99A 1QGPA 3CCEI 1FPQA 3L2QA 4H4KC 1O3QA 4KDPA 2KPMA 2LKSA 4WXCA 2FQ3A 2OV7A 3GTMJ 3GF2A 1X58A 1IJWC 3BQZA 3IKTA 1XMKA 5ED4A 3N4MA 1U5TC 3P1ZB 2OA4A 3PUFA 2DA7A 4Q5SF 2VLAA 2OQRA 4EJUA 5GAGJ 4UNOA 3LMMA 3JCUC 1HDDC 4C3JJ 3Q0WA 1IDZA 2QUFA 2P5LC 1Y56A 2HI3A 1BC7C 3VDXA 3RKYA 1VQLI 3J7AO 2MA3A 3T8RA 3CMMA 3KZIC 5F1JA 4CCKA 4RB1A 3JRIA 4A3FJ 3BP8A 2QBYA 3WHCA 3WGHA 4CZCA 1HLVA 1ZREA 3S16J 1QVTA 2K4BA 2BGCA 4BL0B 3L2RA 2ZJQF 6PAXA 2EB7A 4M3EA 4XOPA 5D5VB 1IGNA 5CVUA 3W2WA 3M3YJ 3AJVA 3QYBA 4Y4RA 3BTLA 1ETYA 3BTCA 1QZEA 1QPIA 2ELHA 1ZH5A 4M6VA 5FLMJ 3SHFA 5M5YJ 2UWMA 1U2WA 3IWFA 3ABMH 3PFYA 2VIXA 2CQNA 3CJNA 2EFWA 2XAGA 1W0UA 1YE9A 2VQCA 4RM2A 4FASD 3G1MA 2K7LA 1D1BA 2BV6A 2ZXWH 2IT0A 4XLHA 3RPUD 1GT0C 3V42A 1U5TB 5HDGA 1Y1OA 4D1QA 5DV5A 1LDKB 4XIDA 4HF2A 4ETSA 5J47A 4U7BA 3M8EA 2Z0RA 4L9JA 1OQYA 2DBBA 1V5FA 4AU7A 3R0JA 3ZXSA 2GLOA 4BHPA 2LBFB 5JHFA 1K79A 2D5VA 1MZBA 1HSTA 1O3TA 4LB5A 4E4HA 3MZYA 4BU2A 2W48A 3WE2A 3F6VA 4M3BA 3KETA 3C18A 4B3XA
chains in the Genus database with same CATH topology
2LNBA 4MEYF 2FL3A 2HGCA 3BY6A 1GXPA 5AIQA 4AIKA 3LQQA 4AIJA 1BBYA 4G7HF 4U0YA 1UHMA 2CG4A 1XN7A 1XSVA 2HTJA 4WF2A 5IT9Z 1B4AA 3ULQB 4D0PA 1ZG1A 5ILUA 3J80Z 5L3FA 1SMTA 3DV8A 4BNCA 4HF0A 3V8LA 1P4WA 3FWEA 2JSCA 1DP7P 4MHGA 3N97A 4IHTA 2NNYA 3ZP5A 3K2ZA 4U7DA 2F5DA 2LF8A 1XGMA 3BPXA 1FC3A 1Y88A 4KMUX 1JE8A 2L3DA 2XAQA 4Q48A 1XGSA 3DXJF 2A5YB 1D5VA 4HF1A 3SZTA 2EFNA 1I1GA 1SAXA 2OBPA 4JK1X 2FMYA 2EV6A 2HQNA 5DCMA 1KGSA 2WIZA 1L0OC 2D1VA 2M8EA 4IJAA 5ICGA 3QAHA 4QBNA 1MKMA 2A3SA 4Y13A 1F1ZA 1YNMA 4ZZLA 2BEOA 1PDNC 5CJ9A 1MDMA 1T98A 2WV0A 3GZ5A 3W6KB 1KYZA 2PI0A 5DYMA 4UVBA 2M1BA 4G7OF 1R00A 4M6XA 1KYWA 1R1UA 3EETA 1R36A 3HRUA 3AAFA 3M1EA 4RGRA 5K5QA 2JRTA 3EUHA 2P7CB 4OOIA 2K86A 4AIHA 3IWZA 3LA7A 2JT1A 3CUQA 3CTAA 3WU0A 5CYVA 1P6RA 1UFMA 1IXRC 2V1UA 2WCZA 4YFKF 2XUBA 2QLZA 2B0LA 3P7NA 4IVNA 1HKTA 3GW2A 3BZ6A 2HFHA 1EH8A 3SXYA 1CF7B 1R1VA 4HDVA 5A2QK 5DD4A 4G6UA 2STWA 3V8JA 2HWVA 2O61A 3BJOA 2VC1A 3TDZC 5E18F 3P9KA 2EA2A 4HQMA 1ZGAA 1HBXG 1JHFA 2TDXA 5CVJA 1FOKA 1DPRA 1K7AA 1GVJA 2PBIA 2FBIA 3QU3A 1ZAOA 2KJCA 1XCBA 3LA3A 5H6QA 5L3GA 1FBQA 3RJPA 1FP1D 4L9NA 3FZVA 1S8NA 4U0VA 2ZFWA 2M30A 4ZH4F 3JTGA 4R1HA 2W24A 3OV8A 3PQJA 4IRGA 3JAMZ 1U8RA 1P2FA 1T6SA 4S04A 1W7PB 3BROA 2OQGA 2LSOA 3DKWA 3GWZA 1ZGJA 4L5IA 2NAZA 4OIRF 2E1NA 3D5LA 1W4MA 3TKYA 2EV5A 2RNJA 3KE2A 2G7UA 2QENA 4FT8A 5DUIA 1ZARA 5HVQC 2FRHA 4EM0B 1U78A 2QZ8A 4DAVA 1PP8F 3P1ZA 1OB8A 1KU7A 1HKSA 1STZA 1WI9A 2WTEA 2W85A 3K9TA 3KP3A 1K78B 2JPBA 2GZWA 2PEXA 1CGPA 4Q4ZF 4N0BA 3BWGA 3ECOA 4UUVA 1SD6A 4ZQUA 2G9WA 2H94A 3GFMA 4HW0A 1QPMA 1T2KA 4M74A 4IHSA 3LSTA 3RIRA 2GJWA 5FFZA 1U5TA 2Q0OA 1P4XA 1IXCA 2AXLA 4KICA 2IVMA 2EK5A 3KP5A 2A6HF 2KIUA 4XSZF 4GYGA 2RC4A 5BQTA 2M87A 1OMIA 3MWMA 4UXNA 3ZN1A 1LDJA 1WQ2A 5J6XA 5F1RA 3MEXA 4LLLA 1HQCA 1R5GA 3L09A 5KVRA 2NYXA 3EDPA 3KEOA 4XLPF 1Z9CA 2HKOA 1ZG3A 4HV5A 2NNNA 2PMUA 4HX4A 2IA0A 4WCGA 1FP2A 1FT9A 1SFEA 4F7ZA 1G6NA 3QOPA 1E17A 2ZCWA 4IRIA 2HYFA 4A0YA 2A07F 5L3DA 2WCWA 3C3WA 2MH9A 1IUYA 2WIWA 4TKKA 4A0XA 3V8KA 3V7SA 1S3JA 1SD7A 4UVCA 4BHBA 1S7AA 2OZ6A 4LQEA 1LEBA 1OPCA 2DT5A 2RN7A 4MQVA 1VTNC 2O0YA 1AWCA 2E1CA 5FD6A 2HTSA 2FBHA 4A6DA 2OU2A 1FYKA 4BQAA 1J9IA 3IF0X 2JPCA 5JHUA 1G3YA 4TKDA 1O3SA 3PQKA 5TRDA 4XLNF 4MTDA 3HOTA 2GWRA 5D6EA 3KLOA 1MJ9A 1MJAA 4L9TA 2O3FA 4Y15A 1XB4A 4HDUA 1D8JA 3IL2A 5F64A 2GXGA 5E8IA 1W5SA 1O7FA 1WKMA 4WX9A 1FLIA 2ADUA 3I5UA 3BJ6A 4M6YA 1I6XA 3M9AA 4ASNA 2AS5F 3WTZA 3ZN0A 2XAJA 1YFHA 2IRFG 3QPTA 2HZTA 1O57A 4LFUA 1H0MA 1YS6A 3KP7A 4FHTA 2HQRA 4WXHA 4OIPF 1BI2A 4AWXB 2O8XA 2VBZA 4HA8A 4LG0B 2VBYA 3R61A 4RAZA 3LQRA 4HOBA 3Q5FA 4HLYA 4XBFA 2ESNA 1D8KA 5LBQA 3QP5A 3KP6A 1QNTA 2K27A 1MGTA 2FBKA 3WTVC 3ABUA 3JW4A 4EV0A 2KIFA 3EYIA 3BOQA 3LAJA 1QBJA 3V7RA 2CZRA 2VXZA 2MC3A 1SMYF 1I27A 3NEUA 3GFIA 3HSFA 1CF7A 4P5OA 4G6DA 4NB5A 4EM2A 4I0BA 3RI4A 5LGUA 4RB2C 1B6AA 1G3SA 2GAUA 2XAFA 3GUDA 3Q9VA 3PFIA 4LMYA 1RNLA 4GCVA 2MD5A 2EA4A 2W25A 3EQLF 4HBLA 1RZ4A 2Q8KA 4CDGA 1ZHFA 1XSXA 2ZNYA 3I59B 2V9VA 4Y17A 3TO6A 3HIFA 4I2OA 2PG4A 3IRRA 5CVVA 1B9NA 3RDIA 4O5VA 4PGHA 2GXBA 3MCZA 3MFKA 4KFCA 4UV8A 1TBXA 3O3KA 1SD4A 1W7PA 1QQIA 5FD5A 3F8NA 4E70A 4KN4X 1FYLA 2CW0F 4G7ZF 5BMZA 4BH9A 3U2RA 2F5CA 5D5UB 3DFGA 5D8LB 3DPTA 2HKXA 3RYPA 1QZZA 2O03A 3V4GA 1O3RA 2CV8A 4HX7A 3O6BB 3SZPA 4IRHA 4CICA 1BI3A 3DNXA 3CO7C 4KT5C 4CO8A 1FZPB 1IF1A 3REOA 4R8HA 3H3UA 1R0VA 1ZRFA 2P4WA 2DBSA 3FM5A 3WTUC 1L3LA 1SFUA 2ZMEB 3GX4X 1EH6A 1FNNA 2Z5UA 3TQNA 2BYVE 5IT3A 2CGPA 2DPUA 2FOKA 1DUXC 1F5TA 4KN7X 2X4HA 2OSTA 4L0ZB 4KNYA 4MQ9F 1RUOA 4M71A 4EV1A 3RTRA 1ONVA 2OZUA 5HS8A 3KP2A 3U1DA 1ULYA 4K2EA 4EJTA 2VE8A 3E3VA 1P4AA 1HW5A 4I7HA 5D5XB 2VT2A 3QPHA 2NRAC 4A0ZA 1B59A 1WSUA 2XKPA 5BS6A 4QBOA 3B02A 1RI7A 4WWCA 3WTXC 1S7OA 3BDDA 1J0RA 4RGSA 3V7CA 4ENJA 3I54A 4B09A 3G73A 1GEFA 2FNPA 3T0YA 2HR3A 4IF4A 5E20A 2RDPA 1TQIA 3NRVA 3VB2A 1ZYRF 3HRTA 1R1TA 2D1HA 2ZO4A 1FY7A 4YG2F 4KYWA 2MBFA 5L3BA 4JBAA 1J75A 2FE3A 5HLHA 1SFXA 1R23A 3WTSC 2VOPA 2PMHA 1QZYA 2BH2A 1R7JA 3FHZA 4UVAA 5H6RA 1OB9A 1YW9A 2L4AA 2LF7A 3G3ZA 4EQQA 4P55A 5DEQA 1KA8A 4RGXA 1YG2A 4YFNF 4RB0A 1YTYA 5JFRA 3T5XA 1OKRA 2D2WA 3CO6C 3FX3A 3TOBA 1T39A 4HQEA 1V3FA 4RB3C 3FM3A 2HEOA 3TO9A 4G6VA 2FF4A 5F6FA 5JVTA 4DQ2A 2IA2A 2WJ0A 2YX4A 1TTYA 2L54A 3ZMZA 5DD8A 2FSWA 4MTEA 1S29A 1RIOH 1ZRCA 2H27A 1YO5C 3DQVC 4OU0A 1G3WA 3VODA 2VS1A 3KCCA 4G94A 1RUNA 4ENNA 1G4DA 5KK1A 5L3CA 3FMSA 4MNUA 2HYGD 5LRRA 4LG0A 1XGNA 4PZJA 5D4RA 2DQLA 3DPLC 2MLGA 5HDNA 3KZZA 4UV9A 4RAYA 3ECHA 4OMZA 3HSRA 3GFJA 3R0AA 1J2XA 2FXAA 1LQ1A 3CUQC 1BN5A 2UXXA 4LJZF 3W6JB 1DDNA 1HW1A 2MH2A 5FDKA 2Y48A 1FWZA 5ICEA 4IXAA 1F9NA 3DF8A 3GXOA 2H09A 3HHHA 4AD9A 3C7JA 2P5VA 3E97A 5A2QZ 1ZLKA 1XDSA 2P5KA 4OINF 1U6GA 2X0LA 2DLLA 4EJOA 2DO7A 5FLXK 4BHCA 2VODA 1Q1HA 5J8FA 3K69A 1OYWA 2GA2A 3RPUA 2VONA 3U9GA 5E1ZB 5EEGA 5CVIA 2YSRA 4M72A 4U88A 4QWQA 3WG9A 2L02A 3ML6A 1EV7A 3LAPA 1WRJA 5HDKA 2W8MA 1LNWA 3L9FA 2EV0A 4GYIA 3P9IA 1YIOA 3F22A 4ZYDA 3I59A 4OIQF 5FGMA 4KIFA 4KIGA 2DU9A 5D4SA 1T0FA 5D8KB 3JTHA 1IN8A 3RKWA 1UB9A 2PLYA 1LJ9A 3WU1B 4EM1A 1U3EM 1IZ1A 2INBA 4PDKA 1FYMA 1F4KA 4U0WA 5E1WA 2CWEA 3ISPA 3I0TA 1Z6TA 2L4MA 2D45A 1IW7F 4WXDA 2PQ8A 3ERED 3KP4A 1BIAA 2CQKA 4H0EA 3HRSA 2E7WA 5J8CA 3VEPA 4BXUA 5ICCA 2Q2EA 1FX7A 3SFZA 1RZNA 4L9VA 1IN6A 4LK1F 1G3TA 1MD0A 4UHTA 4EMSA 4YIFA 4L18B 4IPAA 3VOEA 5AIPA 5K5OA 3T1BA 1IN7A 4EGZA 3O2PE 2PJPA 2ETHA 1NHAA 3C1DA 2ZMEA 2VBXA 5LHGA 1Z6RA 2RQPA 4ESBA 1XDUA 4S05A 4MEXF 2ZJ2A 4YFXF 3E6BA 5LGNA 1XSDA 2YX7A 4O6JA 3L7WA 1T38A 2W57A 1HXDA 4M9XA 4EJWA 2BBYA 1USTA 1BI0A 2FCOA 5HLGA 4PCQA 1JGSA 4P9FA 5DCFA 5LEJA 2XROA 3F21A 2A61A 2W84A 2Y0MA 1ZG5A 2XV4S 5LRSA 2PN6A 5BOXA 1YQAA 3E5UA 5LHIA 2VN2A 3I53A 4KUMA 5ICFA 2GW6A 4HZFA 3RKXA 4A6EA 1J59A 1RLVA 1FBSA 3HUGA 1FSEA 2XVCA 4CGZA 2DK8A 2GQQA 2CFXA 2FMLA 5FLXZ 3GZ6A 4QBLA 3COAC 2V79A 5LHHA 3T8TA 1J5YA 1HW2A 4HYEA 1Z05A 3E6MA 2EFOA 2VT3A 4G9YA 2LDUA 2R7DA 2VLDA 1A04A 2V1DA 3K1NA 2HS5A 1TW3A 1XCVA 2FNAA 5LEKA 2FLCA 2CSOA 4HX8A 2NS0A 1C0WA 1B1BA 3M8FA 5LLQA 1LB2A 1QO0D 4EGYA 1IN5A 2DW4A 5L3EA 1A79A 2QWWA 1UCRA 5ILSA 1J7KA 2XKOA 1OR7A 2H6BA 4ENKA 2ZBKA 5LGTA 3MZHA 2QQAA 5E1XA 3J81K 5AONA 2PFBA 3F23A 2FA5A 3QP6A 2P7VB 2O6GE 2IJLA 2DTRA 4NQWA 2Z9OA 3HHGA 1UHWA 4A12A 4HAMA 3IKVA 1YS7A 3B73A 5CLSA 2QYOA 4N9IA 1HKQA 2V6CA 2CO5A 1ON2A 2R3SA 4CHUA 1ON1A 3WE3A 3ELKA 4L5JA 3KZYA 4I98B 3ZMUA 1Z1DA 2EWNA 2XGXA 4MGRA 3E5QA 3D0SA 2ZNZA 4KA4A 2M5WA 4YIIA 4PGGA 3E6CC 2QQ9A 3MAJA 2DFIA 3TO7A 5ERIA 2HOEA 2VC0A 3ZPLA 1W5TA 3IEYB 3IC7A 3IHUA 1B9MA 4HLXA 3R60A 2XRNA 5DDGA 2GIVA 3KFWX 3JSOA 2J5OA 5CVRA 1Z7UA 1ZN2A 1BI1A 3EYYA 3E5XA 1O7LA 2JTVA 4QLCU 2A68F 2P6TA 2DK5A 1K78A 3F8BA 3JAMK 1XGOA 3WGIA 2OKFA 3WTYC 1PUEE 4GXOA 3E6DA 2ZYZB 2YU3A 3IRQA 4A5NA 2Y75A 2KIMA 2WC2A 2E7XA 1TNSA 4GGGA 4ZZDA 3WTWC 1V4RA 4M9ZA 3HSEA 1YYVA 4A5MA 1USSA 2ACJA 4RGUA 1YW7A 3FMQA 3HTSB 3K1PA 3NQOA 4G6QA 2ISYA 4N9HA 3QU6A 2IW5A 1ODDA 2FEZA 5JI6A 3TOAA 4Z2YA 4BAYA 4P9UA 2J5PA 1LVAA 3FF5A 1IPIA 4ENMA 1KQ0A 4I0AA 1P92A 4I09A 3S2WA 1PP7U 2QBYB 2EO0A 4Q47A 4XRFA 4WK8F 1AOYA 3F8MA 4LD5A 1TLHB 1IRFA 2DAOA 1XMXA 1KQ8A 4KIBA 4XSXF 3AJVB 1IRGA 4FX0A 4HV6A 1D3YA 3GEZA 3R4KA 3J81Z 1IAWA 3KLNA 2C6YA 4ON0A 4ESJA 1BJAA 2XIGA 3M7GA 3MQ0A 3K0LA 3TGNA 4I02A 3BJAA 4LLNA 1MJBA 1S6LA 1KQ9A 1R11A 1OYYA 2EFPA 2RVCA 4M9SA 1KU3A 3FXQA 3GYHX 3DEUA 1R58A 5K5RA 1ZLJA 1E2XA 4FX4A 1EH7A 2EFQA 5K1YA 3SQNA 3VFZA 3BT7A 4OIOF 3GO5A 1IN4A 1GXQA 2LKPA 2EJRA 3Q9SA 2JJQA 5D6FA 3P9CA 5FO5A 3CLOA 2DPDA 2UZKA 3F72A 1K6OA 3P1YA 3DP7A 3F3XA 4ESFA 1W7PD 4A2UA 1I1SA 3LFKA 2KJBA 1ZP7A 5HS7A 2XASA 3ZMDA 4CZZA 1UWVA 1OYIA 1H9TA 1BM9A 2RV8A 4AVPA 5E8GA 1KU2A 4EVIA 1FBUA 2F5FA 3RYRA 1IXSB 1XD7A 3H92A 3F8FA 1Y0UA 2ZXJA 2DI3A 2FKHB 2IP2A 3HRMA 1TQPA 3RPQA 2K4JA 4EJVA 3R6SA 2P8TA 1FSHA 2IA1A 1ZRDA 2XAHA 5BPIA 5E17F 4R79A 5BPDA 1BIBA 4M73A 4RS8A 3ABTA 2ISZA 5EEHA 4CYDA 5DUKA 4DAPA 3FMRA 3ZMSA 3CDHA 5ILVA 3BPVA 4LLGF 3I58A 5DCMB 2KKOA 3OOPA 4ZYGA 4LB6B 1WWXA 2Z3YA 1MDMB 5H20A 5JR3A 2UXNA 2QM3A 4GO1A 4ZYHA 3TDUC 1SD5A 1BC8C 3KEQA 1DPUA 5HOOA 2RKHA 1JHHA 2WWYA 1BOAA 1YW8A 5FFXA 1JXSA 3I64A 1HH1A 1R22A 3HTUA 2YR2A 2Z33A 3CUOA 5HS9A 2F5EA 4KMFA 4NHJA 4OMYA 3L2CA 1R5HA 1GHCA 2VOOA 3FOVA 2QVOA 2RGVA 3HYIA 2XHKA 1TW2A 2A69F 3HOSA 2FKCA 4JQFA 2ESHA 2BE5F 4DNCA 3FXUA 1LDDA 2KRFA 1YLFA 4ZYEA 2JZYA 4CXFA 2F2EA 3CUQB 2GA1A 2VBWA 5D5WB 4I01A 4L0YB 3F6OA 3F8CA 2DQRA 4LGWA 3I4PA 2L01A 3QRFF 2P6SA 4G8XA 5TJJA 4O3MA 1KU9A 1HSJA 1LEAA 1REPC 5FB2A 1TNTA 2ZKZA 2COMA 3LWFA 2IPQX 3ZMVA 3K1MA 1H9GA 3JSPA 2QQBA 4E6ZA 2OAZA 2STTA 3GVAA 3IEYA 2V1XA 4P96A 2A6EF 3GFLA 3I71A 5IT9K 2OD5A 2M45A 2G7HA 3J80K 2R7FA 4BYYA 3LA2A 2IXSA 1I5ZA 3GLXA 3WODF 4B8XA 1X3UA 1XMAA 2FU4A 4LK0F 1Z91A 3ZQ7A 3H3ZA 3ROUA 2ZYZA 5HLIA 3WTTC 3WGGA 3L00A 4DA2A 2MLKA 2H6CA 2K02A 2YPRA 2CYYA 2HDCA 4TV7A 1TQMA 2VE9A 3ZMTA 3FXRA 2Z99A 1QGPA 1FPQA 1O3QA 4KDPA 4WXCA 2FQ3A 3GF2A 3IKTA 1XMKA 5ED4A 3N4MA 1U5TC 3P1ZB 2OA4A 4Q5SF 2OQRA 4EJUA 4UNOA 2QUFA 2P5LC 1BC7C 3RKYA 3J7AO 2MA3A 3T8RA 2QBYA 4RB1A 3BP8A 3WGHA 1ZREA 2K4BA 2BGCA 6PAXA 2EB7A 5D5VB 5CVUA 3AJVA 2ELHA 1ZH5A 3SHFA 2UWMA 1U2WA 3IWFA 2EFWA 3CJNA 2XAGA 2K7LA 2BV6A 2IT0A 1U5TB 5HDGA 1Y1OA 5DV5A 1LDKB 4HF2A 4ETSA 4U7BA 3M8EA 2Z0RA 4L9JA 2DBBA 3R0JA 4BHPA 1K79A 1MZBA 1HSTA 1O3TA 4LB5A 3MZYA 3WE2A 3F6VA 3KETA 3C18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LNB A;  4MEY F;  2HGC A;  3BY6 A;  1GXP A;  5AIQ A;  4AIK A;  3LQQ A;  4AIJ A;  1BBY A;  4G7H F;  4U0Y A;  1UHM A;  2CG4 A;  1XN7 A;  1XSV A;  2HTJ A;  4WF2 A;  5IT9 Z;  1B4A A;  3ULQ B;  4D0P A;  1ZG1 A;  5ILU A;  3J80 Z;  5L3F A;  1SMT A;  3DV8 A;  4BNC A;  4HF0 A;  3V8L A;  1P4W A;  3FWE A;  2JSC A;  1DP7 P;  4MHG A;  3N97 A;  4IHT A;  2NNY A;  3ZP5 A;  3K2Z A;  4U7D A;  2F5D A;  2LF8 A;  1XGM A;  3BPX A;  1FC3 A;  1Y88 A;  4KMU X;  1JE8 A;  2L3D A;  2XAQ A;  4Q48 A;  1XGS A;  3DXJ F;  2A5Y B;  1D5V A;  4HF1 A;  3SZT A;  2EFN A;  1I1G A;  1SAX A;  2OBP A;  4JK1 X;  2FMY A;  2EV6 A;  2HQN A;  5DCM A;  1KGS A;  2WIZ A;  1L0O C;  2D1V A;  2M8E A;  4IJA A;  5ICG A;  3QAH A;  4QBN A;  1MKM A;  2A3S A;  4Y13 A;  1F1Z A;  4ZZL A;  2BEO A;  1PDN C;  5CJ9 A;  1MDM A;  1T98 A;  2WV0 A;  3GZ5 A;  3W6K B;  1KYZ A;  2PI0 A;  5DYM A;  4UVB A;  2M1B A;  4G7O F;  1R00 A;  4M6X A;  1KYW A;  1R1U A;  3EET A;  1R36 A;  3HRU A;  3AAF A;  3M1E A;  4RGR A;  5K5Q A;  2JRT A;  3EUH A;  2P7C B;  4OOI A;  2K86 A;  4AIH A;  3IWZ A;  3LA7 A;  2JT1 A;  3CUQ A;  3CTA A;  3WU0 A;  5CYV A;  1P6R A;  1UFM A;  1IXR C;  2V1U A;  2WCZ A;  4YFK F;  2XUB A;  2QLZ A;  2B0L A;  3P7N A;  4IVN A;  1HKT A;  3GW2 A;  3BZ6 A;  2HFH A;  1EH8 A;  3SXY A;  1CF7 B;  1R1V A;  4HDV A;  5A2Q K;  5DD4 A;  2STW A;  3V8J A;  2HWV A;  2O61 A;  3BJO A;  2VC1 A;  3TDZ C;  5E18 F;  3P9K A;  2EA2 A;  4HQM A;  1ZGA A;  1HBX G;  1JHF A;  2TDX A;  5CVJ A;  1FOK A;  1DPR A;  1K7A A;  1GVJ A;  2PBI A;  2FBI A;  3QU3 A;  1ZAO A;  2KJC A;  1XCB A;  3LA3 A;  5H6Q A;  5L3G A;  1FBQ A;  3RJP A;  1FP1 D;  4L9N A;  3FZV A;  1S8N A;  4U0V A;  2ZFW A;  2M30 A;  4ZH4 F;  3JTG A;  4R1H A;  2W24 A;  3OV8 A;  3PQJ A;  4IRG A;  3JAM Z;  1U8R A;  1P2F A;  1T6S A;  4S04 A;  1W7P B;  3BRO A;  2OQG A;  2LSO A;  3DKW A;  3GWZ A;  1ZGJ A;  4L5I A;  2NAZ A;  4OIR F;  2E1N A;  3D5L A;  1W4M A;  3TKY A;  2EV5 A;  2RNJ A;  3KE2 A;  2G7U A;  2QEN A;  4FT8 A;  5DUI A;  1ZAR A;  5HVQ C;  2FRH A;  4EM0 B;  1U78 A;  2QZ8 A;  1PP8 F;  3P1Z A;  1OB8 A;  1KU7 A;  1HKS A;  1STZ A;  1WI9 A;  2WTE A;  2W85 A;  3K9T A;  3KP3 A;  1K78 B;  2JPB A;  2GZW A;  2PEX A;  1CGP A;  4Q4Z F;  4N0B A;  3BWG A;  3ECO A;  4UUV A;  1SD6 A;  2G9W A;  2H94 A;  3GFM A;  4HW0 A;  1QPM A;  1T2K A;  4M74 A;  4IHS A;  3LST A;  3RIR A;  2GJW A;  5FFZ A;  1U5T A;  2Q0O A;  1P4X A;  1IXC A;  2AXL A;  4KIC A;  2IVM A;  2EK5 A;  3KP5 A;  2A6H F;  2KIU A;  4XSZ F;  4GYG A;  2RC4 A;  5BQT A;  2M87 A;  1OMI A;  3MWM A;  4UXN A;  3ZN1 A;  1LDJ A;  1WQ2 A;  5J6X A;  5F1R A;  3MEX A;  4LLL A;  1HQC A;  1R5G A;  3L09 A;  5KVR A;  2NYX A;  3EDP A;  3KEO A;  4XLP F;  1Z9C A;  2HKO A;  1ZG3 A;  4HV5 A;  2NNN A;  2PMU A;  4HX4 A;  2IA0 A;  4WCG A;  1FP2 A;  1FT9 A;  1SFE A;  4F7Z A;  1G6N A;  3QOP A;  1E17 A;  2ZCW A;  4IRI A;  2HYF A;  4A0Y A;  2A07 F;  5L3D A;  2WCW A;  3C3W A;  2MH9 A;  1IUY A;  2WIW A;  4TKK A;  4A0X A;  3V8K A;  3V7S A;  1S3J A;  1SD7 A;  4UVC A;  4BHB A;  1S7A A;  2OZ6 A;  1LEB A;  1OPC A;  2DT5 A;  2RN7 A;  4MQV A;  1VTN C;  2O0Y A;  1AWC A;  2E1C A;  5FD6 A;  2HTS A;  2FBH A;  4A6D A;  2OU2 A;  1FYK A;  4BQA A;  1J9I A;  2JPC A;  5JHU A;  1G3Y A;  4TKD A;  1O3S A;  3PQK A;  5TRD A;  4XLN F;  4MTD A;  3HOT A;  2GWR A;  5D6E A;  3KLO A;  1MJ9 A;  1MJA A;  4L9T A;  2O3F A;  4Y15 A;  1XB4 A;  4HDU A;  1D8J A;  3IL2 A;  5F64 A;  2GXG A;  5E8I A;  1W5S A;  1O7F A;  1WKM A;  4WX9 A;  1FLI A;  2ADU A;  3I5U A;  3BJ6 A;  4M6Y A;  1I6X A;  3M9A A;  4ASN A;  2AS5 F;  3WTZ A;  3ZN0 A;  2XAJ A;  1YFH A;  2IRF G;  3QPT A;  2HZT A;  1O57 A;  4LFU A;  1H0M A;  1YS6 A;  3KP7 A;  4FHT A;  2HQR A;  4WXH A;  4OIP F;  1BI2 A;  4AWX B;  2O8X A;  2VBZ A;  4HA8 A;  4LG0 B;  2VBY A;  3R61 A;  4RAZ A;  3LQR A;  4HOB A;  3Q5F A;  4HLY A;  4XBF A;  2ESN A;  1D8K A;  5LBQ A;  3QP5 A;  3KP6 A;  1QNT A;  2K27 A;  1MGT A;  2FBK A;  3WTV C;  3ABU A;  3JW4 A;  4EV0 A;  2KIF A;  3EYI A;  3BOQ A;  3LAJ A;  1QBJ A;  3V7R A;  2VXZ A;  2MC3 A;  1SMY F;  1I27 A;  3NEU A;  3GFI A;  3HSF A;  1CF7 A;  4P5O A;  4G6D A;  4NB5 A;  4EM2 A;  4I0B A;  3RI4 A;  5LGU A;  4RB2 C;  1B6A A;  1G3S A;  2GAU A;  2XAF A;  3GUD A;  3Q9V A;  3PFI A;  4LMY A;  1RNL A;  4GCV A;  2MD5 A;  2EA4 A;  2W25 A;  3EQL F;  4HBL A;  1RZ4 A;  2Q8K A;  4CDG A;  1ZHF A;  1XSX A;  2ZNY A;  3I59 B;  2V9V A;  4Y17 A;  3TO6 A;  3HIF A;  4I2O A;  2PG4 A;  3IRR A;  5CVV A;  1B9N A;  3RDI A;  4O5V A;  4PGH A;  2GXB A;  3MCZ A;  3MFK A;  4KFC A;  4UV8 A;  1TBX A;  3O3K A;  1SD4 A;  1W7P A;  1QQI A;  5FD5 A;  3F8N A;  4E70 A;  4KN4 X;  1FYL A;  2CW0 F;  4G7Z F;  5BMZ A;  4BH9 A;  3U2R A;  2F5C A;  5D5U B;  3DFG A;  5D8L B;  3DPT A;  2HKX A;  3RYP A;  1QZZ A;  2O03 A;  3V4G A;  1O3R A;  2CV8 A;  4HX7 A;  3O6B B;  3SZP A;  4IRH A;  4CIC A;  1BI3 A;  3DNX A;  3CO7 C;  4KT5 C;  4CO8 A;  1FZP B;  1IF1 A;  3REO A;  4R8H A;  3H3U A;  1R0V A;  1ZRF A;  2P4W A;  3FM5 A;  3WTU C;  1L3L A;  1SFU A;  2ZME B;  3GX4 X;  1EH6 A;  1FNN A;  2Z5U A;  3TQN A;  2BYV E;  5IT3 A;  2CGP A;  2DPU A;  2FOK A;  1DUX C;  1F5T A;  4KN7 X;  2X4H A;  2OST A;  4L0Z B;  4KNY A;  4MQ9 F;  1RUO A;  4M71 A;  3RTR A;  1ONV A;  2OZU A;  5HS8 A;  3KP2 A;  3U1D A;  1ULY A;  4K2E A;  4EJT A;  2VE8 A;  3E3V A;  1P4A A;  1HW5 A;  4I7H A;  5D5X B;  2VT2 A;  3QPH A;  2NRA C;  4A0Z A;  1B59 A;  1WSU A;  2XKP A;  5BS6 A;  4QBO A;  3B02 A;  1RI7 A;  4WWC A;  3WTX C;  1S7O A;  3BDD A;  1J0R A;  4RGS A;  3V7C A;  4ENJ A;  3I54 A;  4B09 A;  3G73 A;  1GEF A;  2FNP A;  3T0Y A;  2HR3 A;  4IF4 A;  5E20 A;  2RDP A;  1TQI A;  3NRV A;  3VB2 A;  1ZYR F;  3HRT A;  1R1T A;  2D1H A;  2ZO4 A;  1FY7 A;  4YG2 F;  4KYW A;  2MBF A;  5L3B A;  4JBA A;  1J75 A;  2FE3 A;  5HLH A;  1SFX A;  1R23 A;  3WTS C;  2VOP A;  2PMH A;  1QZY A;  1R7J A;  3FHZ A;  4UVA A;  5H6R A;  1OB9 A;  1YW9 A;  2L4A A;  2LF7 A;  3G3Z A;  4EQQ A;  4P55 A;  5DEQ A;  1KA8 A;  4RGX A;  1YG2 A;  4YFN F;  4RB0 A;  1YTY A;  5JFR A;  3T5X A;  1OKR A;  2D2W A;  3CO6 C;  3FX3 A;  3TOB A;  1T39 A;  4HQE A;  1V3F A;  4RB3 C;  3FM3 A;  2HEO A;  3TO9 A;  2FF4 A;  5F6F A;  5JVT A;  4DQ2 A;  2IA2 A;  2WJ0 A;  2YX4 A;  1TTY A;  2L54 A;  3ZMZ A;  5DD8 A;  2FSW A;  4MTE A;  1S29 A;  1RIO H;  1ZRC A;  2H27 A;  1YO5 C;  3DQV C;  4OU0 A;  1G3W A;  3VOD A;  3KCC A;  4G94 A;  1RUN A;  4ENN A;  1G4D A;  5KK1 A;  5L3C A;  3FMS A;  4MNU A;  2HYG D;  5LRR A;  4LG0 A;  1XGN A;  4PZJ A;  5D4R A;  2DQL A;  3DPL C;  2MLG A;  5HDN A;  3KZZ A;  4UV9 A;  4RAY A;  3ECH A;  4OMZ A;  3HSR A;  3GFJ A;  3R0A A;  1J2X A;  2FXA A;  1LQ1 A;  3CUQ C;  1BN5 A;  2UXX A;  4LJZ F;  3W6J B;  1DDN A;  1HW1 A;  2MH2 A;  5FDK A;  2Y48 A;  1FWZ A;  5ICE A;  4IXA A;  1F9N A;  3DF8 A;  3GXO A;  2H09 A;  3HHH A;  4AD9 A;  3C7J A;  2P5V A;  3E97 A;  5A2Q Z;  1ZLK A;  1XDS A;  2P5K A;  4OIN F;  1U6G A;  2X0L A;  2DLL A;  4EJO A;  2DO7 A;  5FLX K;  4BHC A;  2VOD A;  1Q1H A;  5J8F A;  3K69 A;  1OYW A;  2GA2 A;  3RPU A;  2VON A;  3U9G A;  5E1Z B;  5EEG A;  5CVI A;  2YSR A;  4M72 A;  4U88 A;  4QWQ A;  3WG9 A;  2L02 A;  3ML6 A;  1EV7 A;  3LAP A;  1WRJ A;  5HDK A;  1LNW A;  3L9F A;  2EV0 A;  4GYI A;  3P9I A;  1YIO A;  3F22 A;  4ZYD A;  3I59 A;  4OIQ F;  5FGM A;  4KIF A;  4KIG A;  2DU9 A;  5D4S A;  1T0F A;  5D8K B;  3JTH A;  1IN8 A;  3RKW A;  1UB9 A;  2PLY A;  1LJ9 A;  3WU1 B;  4EM1 A;  1U3E M;  1IZ1 A;  2INB A;  4PDK A;  1FYM A;  1F4K A;  4U0W A;  5E1W A;  2CWE A;  3ISP A;  3I0T A;  1Z6T A;  2L4M A;  2D45 A;  1IW7 F;  4WXD A;  2PQ8 A;  3ERE D;  3KP4 A;  1BIA A;  2CQK A;  4H0E A;  3HRS A;  2E7W A;  5J8C A;  3VEP A;  4BXU A;  5ICC A;  2Q2E A;  1FX7 A;  3SFZ A;  1RZN A;  4L9V A;  1IN6 A;  4LK1 F;  1G3T A;  1MD0 A;  4UHT A;  4EMS A;  4YIF A;  4L18 B;  4IPA A;  3VOE A;  5AIP A;  5K5O A;  3T1B A;  1IN7 A;  4EGZ A;  3O2P E;  2PJP A;  2ETH A;  1NHA A;  3C1D A;  2ZME A;  2VBX A;  5LHG A;  1Z6R A;  2RQP A;  4ESB A;  1XDU A;  4S05 A;  4MEX F;  2ZJ2 A;  4YFX F;  3E6B A;  5LGN A;  1XSD A;  2YX7 A;  4O6J A;  3L7W A;  1T38 A;  2W57 A;  1HXD A;  4M9X A;  4EJW A;  2BBY A;  1UST A;  1BI0 A;  2FCO A;  5HLG A;  4PCQ A;  1JGS A;  4P9F A;  5DCF A;  5LEJ A;  2XRO A;  3F21 A;  2A61 A;  2W84 A;  2Y0M A;  1ZG5 A;  2XV4 S;  5LRS A;  2PN6 A;  5BOX A;  1YQA A;  3E5U A;  5LHI A;  2VN2 A;  3I53 A;  4KUM A;  5ICF A;  2GW6 A;  4HZF A;  3RKX A;  4A6E A;  1J59 A;  1RLV A;  1FBS A;  3HUG A;  1FSE A;  2XVC A;  4CGZ A;  2DK8 A;  2GQQ A;  2CFX A;  2FML A;  5FLX Z;  3GZ6 A;  4QBL A;  3COA C;  2V79 A;  5LHH A;  3T8T A;  1J5Y A;  1HW2 A;  4HYE A;  1Z05 A;  3E6M A;  2EFO A;  2VT3 A;  4G9Y A;  2LDU A;  2R7D A;  2VLD A;  1A04 A;  2V1D A;  3K1N A;  2HS5 A;  1TW3 A;  1XCV A;  2FNA A;  5LEK A;  2CSO A;  4HX8 A;  2NS0 A;  1C0W A;  1B1B A;  3M8F A;  5LLQ A;  1LB2 A;  1QO0 D;  4EGY A;  1IN5 A;  2DW4 A;  5L3E A;  1A79 A;  2QWW A;  1UCR A;  5ILS A;  1J7K A;  2XKO A;  1OR7 A;  2H6B A;  4ENK A;  2ZBK A;  5LGT A;  3MZH A;  2QQA A;  5E1X A;  3J81 K;  5AON A;  2PFB A;  3F23 A;  2FA5 A;  3QP6 A;  2P7V B;  2O6G E;  2IJL A;  2DTR A;  4NQW A;  2Z9O A;  3HHG A;  1UHW A;  4A12 A;  4HAM A;  3IKV A;  1YS7 A;  3B73 A;  5CLS A;  2QYO A;  4N9I A;  1HKQ A;  2V6C A;  2CO5 A;  1ON2 A;  2R3S A;  4CHU A;  1ON1 A;  3WE3 A;  3ELK A;  4L5J A;  3KZY A;  4I98 B;  3ZMU A;  1Z1D A;  2EWN A;  2XGX A;  4MGR A;  3E5Q A;  3D0S A;  2ZNZ A;  4KA4 A;  2M5W A;  4YII A;  4PGG A;  3E6C C;  2QQ9 A;  3MAJ A;  2DFI A;  3TO7 A;  5ERI A;  2HOE A;  2VC0 A;  3ZPL A;  1W5T A;  3IC7 A;  3IHU A;  1B9M A;  4HLX A;  3R60 A;  2XRN A;  5DDG A;  2GIV A;  3KFW X;  3JSO A;  2J5O A;  5CVR A;  1Z7U A;  1ZN2 A;  1BI1 A;  3EYY A;  3E5X A;  1O7L A;  2JTV A;  4QLC U;  2A68 F;  2P6T A;  2DK5 A;  1K78 A;  3F8B A;  3JAM K;  1XGO A;  3WGI A;  2OKF A;  3WTY C;  1PUE E;  4GXO A;  3E6D A;  2ZYZ B;  2YU3 A;  3IRQ A;  4A5N A;  2Y75 A;  2KIM A;  2WC2 A;  2E7X A;  1TNS A;  4GGG A;  4ZZD A;  3WTW C;  1V4R A;  4M9Z A;  3HSE A;  1YYV A;  4A5M A;  1USS A;  2ACJ A;  4RGU A;  1YW7 A;  3FMQ A;  3HTS B;  3K1P A;  3NQO A;  4G6Q A;  2ISY A;  4N9H A;  3QU6 A;  2IW5 A;  1ODD A;  2FEZ A;  5JI6 A;  3TOA A;  4Z2Y A;  4BAY A;  4P9U A;  2J5P A;  1LVA A;  3FF5 A;  1IPI A;  4ENM A;  1KQ0 A;  4I0A A;  1P92 A;  4I09 A;  3S2W A;  1PP7 U;  2QBY B;  2EO0 A;  4Q47 A;  4XRF A;  4WK8 F;  1AOY A;  3F8M A;  4LD5 A;  1TLH B;  1IRF A;  2DAO A;  1XMX A;  1KQ8 A;  4KIB A;  4XSX F;  3AJV B;  1IRG A;  4FX0 A;  4HV6 A;  1D3Y A;  3GEZ A;  3R4K A;  3J81 Z;  1IAW A;  3KLN A;  2C6Y A;  4ON0 A;  4ESJ A;  1BJA A;  2XIG A;  3M7G A;  3MQ0 A;  3K0L A;  3TGN A;  4I02 A;  3BJA A;  4LLN A;  1MJB A;  1S6L A;  1KQ9 A;  1R11 A;  1OYY A;  2EFP A;  2RVC A;  4M9S A;  1KU3 A;  3FXQ A;  3GYH X;  3DEU A;  1R58 A;  5K5R A;  1ZLJ A;  1E2X A;  4FX4 A;  1EH7 A;  2EFQ A;  5K1Y A;  3SQN A;  3VFZ A;  4OIO F;  3GO5 A;  1IN4 A;  1GXQ A;  2LKP A;  2EJR A;  3Q9S A;  5D6F A;  3P9C A;  5FO5 A;  3CLO A;  2DPD A;  2UZK A;  3F72 A;  1K6O A;  3P1Y A;  3DP7 A;  3F3X A;  4ESF A;  1W7P D;  4A2U A;  1I1S A;  3LFK A;  2KJB A;  1ZP7 A;  5HS7 A;  2XAS A;  3ZMD A;  4CZZ A;  1OYI A;  1H9T A;  1BM9 A;  2RV8 A;  4AVP A;  5E8G A;  1KU2 A;  4EVI A;  1FBU A;  2F5F A;  3RYR A;  1IXS B;  1XD7 A;  3H92 A;  3F8F A;  1Y0U A;  2ZXJ A;  2DI3 A;  2IP2 A;  3HRM A;  1TQP A;  3RPQ A;  2K4J A;  4EJV A;  3R6S A;  2P8T A;  1FSH A;  2IA1 A;  1ZRD A;  2XAH A;  5BPI A;  5E17 F;  4R79 A;  5BPD A;  1BIB A;  4M73 A;  4RS8 A;  3ABT A;  2ISZ A;  5EEH A;  4CYD A;  5DUK A;  3FMR A;  3ZMS A;  3CDH A;  5ILV A;  3BPV A;  4LLG F;  3I58 A;  5DCM B;  2KKO A;  3OOP A;  4ZYG A;  4LB6 B;  1WWX A;  2Z3Y A;  1MDM B;  5H20 A;  5JR3 A;  2UXN A;  2QM3 A;  4GO1 A;  4ZYH A;  3TDU C;  1SD5 A;  1BC8 C;  3KEQ A;  1DPU A;  5HOO A;  2RKH A;  1JHH A;  2WWY A;  1BOA A;  1YW8 A;  5FFX A;  1JXS A;  3I64 A;  1HH1 A;  1R22 A;  3HTU A;  2YR2 A;  2Z33 A;  3CUO A;  5HS9 A;  2F5E A;  4KMF A;  4NHJ A;  4OMY A;  3L2C A;  1R5H A;  1GHC A;  2VOO A;  3FOV A;  2QVO A;  2RGV A;  3HYI A;  2XHK A;  1TW2 A;  2A69 F;  3HOS A;  4JQF A;  2ESH A;  2BE5 F;  4DNC A;  3FXU A;  1LDD A;  2KRF A;  1YLF A;  4ZYE A;  2JZY A;  4CXF A;  2F2E A;  3CUQ B;  2GA1 A;  2VBW A;  5D5W B;  4I01 A;  4L0Y B;  3F6O A;  3F8C A;  2DQR A;  4LGW A;  3I4P A;  2L01 A;  3QRF F;  2P6S A;  4G8X A;  5TJJ A;  4O3M A;  1KU9 A;  1HSJ A;  1LEA A;  1REP C;  5FB2 A;  1TNT A;  2ZKZ A;  2COM A;  3LWF A;  2IPQ X;  3ZMV A;  3K1M A;  1H9G A;  3JSP A;  2QQB A;  2OAZ A;  2STT A;  3GVA A;  3IEY A;  2V1X A;  4P96 A;  2A6E F;  3GFL A;  3I71 A;  5IT9 K;  2OD5 A;  2M45 A;  2G7H A;  3J80 K;  2R7F A;  4BYY A;  3LA2 A;  1I5Z A;  3GLX A;  3WOD F;  4B8X A;  1X3U A;  1XMA A;  2FU4 A;  4LK0 F;  1Z91 A;  3ZQ7 A;  3H3Z A;  3ROU A;  2ZYZ A;  5HLI A;  3WTT C;  3WGG A;  3L00 A;  2MLK A;  2H6C A;  2K02 A;  2YPR A;  2CYY A;  2HDC A;  4TV7 A;  1TQM A;  2VE9 A;  3ZMT A;  3FXR A;  2Z99 A;  1QGP A;  1FPQ A;  1O3Q A;  4KDP A;  4WXC A;  2FQ3 A;  3GF2 A;  3IKT A;  1XMK A;  5ED4 A;  3N4M A;  1U5T C;  3P1Z B;  2OA4 A;  4Q5S F;  2OQR A;  4EJU A;  4UNO A;  2QUF A;  2P5L C;  1BC7 C;  3RKY A;  3J7A O;  2MA3 A;  3T8R A;  2QBY A;  4RB1 A;  3BP8 A;  3WGH A;  1ZRE A;  2K4B A;  2BGC A;  6PAX A;  2EB7 A;  5D5V B;  5CVU A;  3AJV A;  2ELH A;  1ZH5 A;  3SHF A;  2UWM A;  1U2W A;  3IWF A;  2EFW A;  3CJN A;  2XAG A;  2K7L A;  2BV6 A;  2IT0 A;  1U5T B;  5HDG A;  1Y1O A;  5DV5 A;  1LDK B;  4HF2 A;  4ETS A;  4U7B A;  3M8E A;  4L9J A;  2DBB A;  3R0J A;  4BHP A;  1K79 A;  1MZB A;  1HST A;  1O3T A;  4LB5 A;  3MZY A;  3WE2 A;  3F6V A;  3KET A;  3C18 A; 
#chains in the Genus database with same CATH topology
 4CYC A;  2LNB A;  4MEY F;  1IDY A;  2FL3 A;  2HGC A;  2E2H J;  3ZCO A;  3GTJ J;  3CJQ B;  3BY6 A;  1GXP A;  5AIQ A;  2VJ5 A;  3LQQ A;  4AIK A;  4AIJ A;  1BBY A;  1V5E A;  4G7H F;  1SVO A;  4U0Y A;  3CC2 I;  1UHM A;  1JUP A;  1T33 A;  1XN7 A;  2CG4 A;  3WU2 C;  1JJ8 C;  1XSV A;  4IHV A;  2LYC A;  2OF7 A;  5F0F A;  2ECB A;  5M3M J;  2HTJ A;  4WF2 A;  5IT9 Z;  2XF5 A;  3DPU A;  2ELK A;  1B4A A;  3ULQ B;  2JQ7 A;  4D0P A;  4DJA A;  1ZG1 A;  5IYD J;  5ILU A;  2YS9 A;  3J80 Z;  5L3F A;  1SMT A;  3DV8 A;  4FTH A;  1U8B A;  1TL8 A;  4BNC A;  3OYL A;  4BXX J;  4HF0 A;  3V8L A;  2VUM J;  1P4W A;  3FWE A;  2V6E A;  3QPS A;  1YOV B;  4A3I J;  2JSC A;  1AKH B;  3RQ4 A;  4II3 A;  2L9S A;  2M7A A;  1DP7 P;  3CCV I;  4MHG A;  3N97 A;  3EUK L;  4IHT A;  3FIS A;  2NNY A;  3ZP5 A;  3K2Z A;  4U7D A;  3I3L A;  3OYB A;  2LLK A;  2F5D A;  2EH3 A;  1BR1 A;  2LF8 A;  2CFO A;  1XGM A;  1P7I A;  3BPX A;  3KEY A;  4PJL A;  1FC3 A;  5HLT A;  1Y88 A;  5KAI C;  4KMU X;  2H8W A;  1X4P A;  2NS8 A;  1V54 H;  1JE8 A;  2L3D A;  2XAQ A;  4Q48 A;  1XGS A;  3DXJ F;  3FXJ A;  2A5Y B;  4LIV A;  2Z2S B;  1D5V A;  3CCR I;  3K7A J;  4HF1 A;  3SZT A;  1K83 J;  2EFN A;  1YHQ I;  1ETX A;  5HOD A;  1LKX A;  1I1G A;  3QYF A;  2Q2E B;  1SAX A;  2CUF A;  1MBG A;  4YRV A;  2OBP A;  4JK1 X;  4HNV A;  3OYJ A;  1FTZ A;  4QPQ A;  4XLA A;  2DDB A;  2FMY A;  2EV6 A;  3H5A A;  1TC3 C;  2HQN A;  1I39 A;  1YX5 A;  2W82 A;  4C3H J;  1AHD P;  2CV2 A;  5DCM A;  1KGS A;  2WB1 A;  3ZQC A;  4PJN A;  1L0O C;  2D1V A;  2WIZ A;  2IS1 A;  2M8E A;  4IJA A;  5ICG A;  3QAH A;  4QBN A;  1MKM A;  2A3S A;  4Y13 A;  1S9H A;  2DA3 A;  3HBL A;  1H88 C;  1F1Z A;  2HOT A;  3SYT A;  3C2B A;  4NC8 A;  1WJE A;  1YNM A;  4ZZL A;  2BEO A;  2ZJR F;  1PDN C;  4V19 K;  5CJ9 A;  1MDM A;  2XSJ C;  1T98 A;  2LTP A;  2EIK H;  2K40 A;  2WV0 A;  2KMU A;  3GZ5 A;  4IZZ A;  3W6K B;  1KYZ A;  1MIJ A;  5GPC A;  2PI0 A;  5DYM A;  4UVB A;  2JK3 A;  3JR9 A;  4A69 C;  3IAS 2;  1JUS A;  1MBK A;  2M1B A;  4XRS A;  1A6I A;  4G7O F;  2H1K A;  1R00 A;  4M6X A;  4M3F A;  1KYW A;  3C2G A;  3HEF A;  3TW7 A;  1R1U A;  3DEE A;  3A02 A;  3AFH A;  1Z3X A;  1HA8 A;  4E7I A;  3HKZ N;  3EET A;  4UB6 C;  2V9P A;  1R36 A;  3HRU A;  3AAF A;  1EKE A;  5C4X J;  3M1E A;  1R4M B;  3OY9 A;  4RGR A;  5K5Q A;  2JRT A;  2BXZ A;  3EUH A;  3M8J A;  2P7C B;  4OOI A;  4KIT B;  4XN3 A;  2K86 A;  4AIH A;  1JKO C;  1FMW A;  3IWZ A;  3LA7 A;  2JT1 A;  4C30 A;  3BG9 A;  1MBE A;  3CUQ A;  3CTA A;  3IH3 A;  3WU0 A;  1VI0 A;  5CYV A;  3QOE A;  1P6R A;  1UFM A;  3DU5 A;  4HSR A;  2O7O A;  2CW8 A;  5J4Y A;  4BEH A;  3ZQG A;  1IXR C;  4FIS A;  2HQ5 A;  2V1U A;  2WCZ A;  2WBM A;  3OR1 C;  4YFK F;  2XUB A;  2QLZ A;  4J01 A;  2B0L A;  2GIZ A;  3P7N A;  2JA7 J;  4IVN A;  5FKO A;  2IGM A;  1HKT A;  3GW2 A;  3H5R A;  3BZ6 A;  4MO7 A;  2WB1 N;  3S3O A;  2HFH A;  1EH8 A;  3SXY A;  1CF7 B;  1R1V A;  2IS4 A;  2KDZ A;  4HDV A;  5A2Q K;  3CP8 A;  1HC8 A;  5DD4 A;  4G6U A;  3A0H C;  2STW A;  4XIC A;  2O9L A;  2KHM A;  3OR2 C;  3V8J A;  2HWV A;  2O5R A;  2XRL A;  2O61 A;  1FOW A;  3CCM I;  3BJO A;  3K4B A;  3H9G A;  4V2G A;  2VC1 A;  3S3M A;  3TDZ C;  2E71 A;  2R7R A;  5E18 F;  3P9K A;  2VJJ A;  2VQL A;  1ETW A;  1K4T A;  2EA2 A;  3CJR B;  1OCR H;  4HQM A;  4W97 A;  1ZGA A;  3TL4 X;  1HBX G;  1JHF A;  1A6Q A;  2TDX A;  5CVJ A;  3H3V K;  1FOK A;  2DN0 A;  2V4J C;  1DPR A;  4BY1 J;  2EIM H;  2CRG A;  1K7A A;  2R7Z J;  1GVJ A;  2PBI A;  2KRC A;  2FBI A;  3QU3 A;  1MSE C;  1ZAO A;  2KJC A;  2VKV A;  1XCB A;  3LA3 A;  4DZJ A;  5H6Q A;  5L3G A;  3ZGK A;  1FBQ A;  1VQ8 I;  3RJP A;  4JX6 A;  4BKX A;  1AU7 A;  1FP1 D;  4L9N A;  3FZV A;  4OWR B;  3M4O J;  3CCY A;  1VQK I;  1S8N A;  4U0V A;  3I56 I;  3B6A A;  2ZFW A;  2MSY A;  3SDG A;  2M30 A;  4ZH4 F;  3NWT A;  3JTG A;  4R1H A;  2W24 A;  3OV8 A;  5CQG A;  3PQJ A;  1SAU A;  3JRH A;  4IRG A;  3JAM Z;  5IOZ A;  1JT0 A;  1I3A A;  2K85 A;  1U8R A;  3NWS A;  1P2F A;  1T6S A;  2R7Q A;  4S04 A;  4EEF G;  1W7P B;  4J00 A;  1CQT A;  4AM3 A;  3BLY A;  3BRO A;  2OQG A;  2LSO A;  3DKW A;  2AXT C;  3GWZ A;  4HNU A;  3OS0 A;  2GXA A;  1ZGJ A;  1OLT A;  4L5I A;  2KLO A;  2JVG A;  2NAZ A;  4OIR F;  2E1N A;  3D5L A;  1W4M A;  1QHG A;  3TKY A;  1W36 C;  2EPF A;  2EV5 A;  2RNJ A;  3KE2 A;  2G7U A;  1NH3 A;  2QEN A;  4FT8 A;  5DUI A;  3W6V A;  1ZAR A;  5HVQ C;  2FRH A;  3S32 A;  4EM0 B;  1U78 A;  3S1R J;  2QZ8 A;  1Y1V J;  4DAV A;  2P81 A;  2ZSH B;  1PP8 F;  3P1Z A;  1OB8 A;  1KU7 A;  3UNG C;  2OCC H;  1HKS A;  1N78 A;  1STZ A;  5F08 A;  2TRT A;  1WI9 A;  1R49 A;  2L7Z A;  3OYG A;  5FRM A;  5J4V A;  1VQO I;  3DKX A;  2JUG A;  4ANJ A;  1W36 D;  2WTE A;  4BAC A;  1LFU P;  2MC4 A;  4BBS J;  2W85 A;  2V26 A;  3K9T A;  1WGX A;  2M0M A;  3G1L A;  3KP3 A;  1K78 B;  4HST A;  3LSR A;  5TIS C;  4AYB A;  2HNH A;  2JPB A;  2GZW A;  1JUM A;  3G1O A;  2PEX A;  1CGP A;  2L9V A;  4Q4Z F;  4N0B A;  3BWG A;  3DU6 A;  3ECO A;  2WAD A;  1YIJ I;  4UUV A;  4B3A A;  4UUS B;  3MN2 A;  1MSF C;  1SD6 A;  2BY1 A;  4A3D J;  4ZQU A;  2G9W A;  2H94 A;  3FXK A;  3GFM A;  2P0W A;  3BG5 A;  2R0Q C;  4HW0 A;  1QPM A;  3HC7 A;  1T2K A;  2KRH A;  4KJZ A;  1TT0 A;  3LSM A;  4M74 A;  1G59 A;  4IHS A;  3LST A;  4RA2 A;  2DA1 A;  3RIR A;  1UG0 A;  3GTO J;  2RRE A;  2GJW A;  3FKJ A;  3PSI A;  3L2V A;  2NVQ J;  5FFZ A;  2L5Q A;  2XB5 A;  4A3M J;  2BVM A;  1U5T A;  2Q0O A;  3VYU B;  1P4X A;  1IXC A;  2KIQ A;  2AXL A;  2DFH A;  4E7J A;  2DMT A;  1R4N B;  4KIC A;  1NG6 A;  2IVM A;  2Z1D A;  2EK5 A;  4IOC F;  3GTG J;  3KP5 A;  2A6H F;  2KIU A;  4XSZ F;  5DS9 A;  4GYG A;  2RC4 A;  3IV5 A;  5BQT A;  2M87 A;  2NXN B;  1OMI A;  1Y0N A;  2R7W A;  2X6X A;  2DXI A;  4S0H B;  3CCJ I;  3MWM A;  1VQP I;  2LBF A;  1BW6 A;  1K6Y A;  2UV1 A;  4Y7N J;  4UXN A;  3ZN1 A;  1LDJ A;  1WQ2 A;  5J6X A;  5F1R A;  3MEX A;  2I8D A;  3SFI A;  3FK6 A;  5B5E C;  3CF5 F;  4LLL A;  1HQC A;  1X3Z B;  1R6R A;  1R5G A;  2X6O A;  3L09 A;  5KVR A;  1FMV A;  2NYX A;  3EDP A;  4QPO A;  3BR2 A;  3WHB A;  3KEO A;  4XLP F;  5EZH A;  2HKO A;  1Z9C A;  2FOW A;  2DMN A;  2VKE A;  4UB8 C;  2N8G A;  1ZG3 A;  3GZN B;  4NNJ A;  4HV5 A;  5FRO A;  2X48 A;  1HDP A;  2NNN A;  2PMU A;  4HX4 A;  2IA0 A;  4WCG A;  1FP2 A;  1FT9 A;  4QSH A;  1OCZ H;  1F36 A;  1SFE A;  4F7Z A;  4A3K J;  1G6N A;  3QOP A;  2CU7 A;  2VXD A;  1E17 A;  2ZCW A;  4IRI A;  1Z77 A;  2HYF A;  4B1R A;  4A0Y A;  1JTY A;  4GRI A;  4AYB N;  4EAT A;  2Y30 A;  3BZC A;  2A07 F;  4A3J J;  1WJ5 A;  3K4C A;  2HYJ A;  5L3D A;  3C3W A;  2HOA A;  4DW6 A;  2WCW A;  1WH5 A;  2MH9 A;  3DBL B;  1IUY A;  4TKK A;  2WIW A;  4PJJ A;  4A0X A;  3BQY A;  4AC0 A;  5EF6 A;  4N4N B;  3V8K A;  3V7S A;  1S3J A;  1SD7 A;  1AKH A;  3A01 B;  4UVC A;  4BHB A;  3TP0 A;  2QKL B;  2X1C A;  1D1C A;  2XC7 A;  1S7A A;  2OZ6 A;  4HEA 2;  4LQE A;  4ABZ A;  1LEB A;  1OPC A;  2DT5 A;  4NC6 A;  2RN7 A;  2XAU A;  4MQV A;  1VTN C;  2O0Y A;  3JRF A;  1AWC A;  2E1C A;  5FD6 A;  2HTS A;  1ZK8 A;  2FBH A;  4A6D A;  2E2J J;  2OU2 A;  4PFO A;  3S3N A;  1FYK A;  4BQA A;  3DTE A;  1J9I A;  3IF0 X;  2F6C A;  2JPC A;  5JHU A;  1FOX A;  1VND A;  2DOD A;  4XQF A;  1G3Y A;  1WJF A;  4TKD A;  2GBY A;  2DYR H;  1O3S A;  3VYS B;  1B72 B;  1VQ9 I;  2XPW A;  2CQX A;  4BJ5 C;  3PQK A;  4Y3O A;  5TRD A;  4XLN F;  4MTD A;  3HOT A;  1V5G A;  2GWR A;  1YRN B;  1XPX A;  5D6E A;  3KLO A;  1MJ9 A;  4D5C A;  3GBG A;  2V7F A;  2M9H A;  1MJA A;  4L9T A;  2O3F A;  4Y15 A;  1VQ4 I;  1XB4 A;  4HDU A;  4IHX A;  1D8J A;  3IL2 A;  1T08 B;  5F64 A;  3BG3 A;  2GXG A;  5E8I A;  4NDL A;  1W5S A;  2LY1 A;  1O7F A;  1WKM A;  4WX9 A;  5EG0 B;  2E2I J;  1FLI A;  5FKN A;  2YU9 J;  2EBI A;  2ADU A;  3I5U A;  5EYR A;  3H0G J;  5JVG F;  3BJ6 A;  4M6Y A;  4P1W A;  1I6X A;  3OYN A;  3M9A A;  1T8I A;  4IHY A;  4ASN A;  2AS5 F;  3WTZ A;  1U9O A;  2EQR A;  3A03 A;  2XAJ A;  3ZN0 A;  1YFH A;  2IRF G;  1XTA A;  3QPT A;  1U0J A;  1O57 A;  2HZT A;  2R5Y B;  4LFU A;  1H0M A;  2K9S A;  3CQZ J;  5IYB J;  2E36 A;  4QIW N;  3HJE A;  2Q1Z B;  3Q0V A;  3OOU A;  4BXF A;  1YS6 A;  3KP7 A;  3OIP A;  4FHT A;  4C9Y A;  4M3G A;  3CMY A;  4IQ4 A;  2KL4 A;  4CCJ A;  2HQR A;  2QA4 I;  4WXH A;  3QOD A;  1DP3 A;  4OIP F;  2PX9 A;  2OJE D;  1OCP A;  1BI2 A;  4AWX B;  2O8X A;  2VBZ A;  4HA8 A;  4LG0 B;  2VBY A;  3R61 A;  1UJ8 A;  4RAZ A;  2NVU B;  3LQR A;  4HOB A;  3Q5F A;  3H0D A;  1Y6I A;  5KAF C;  1NK2 P;  1HOM A;  4HLY A;  4XBF A;  2ESN A;  1D8K A;  5LBQ A;  1MBH A;  3QP5 A;  3FIW A;  1ZTR A;  1O4X A;  3KP6 A;  3PJR A;  1QNT A;  1JGG A;  1QA6 A;  4OAZ A;  2W00 A;  3S1N J;  4CA0 A;  4PSW A;  2IBD A;  4KIS A;  2K27 A;  1MGT A;  3CZ6 A;  2FBK A;  3CCU I;  3WTV C;  2FQ4 A;  1D0Y A;  2VI6 A;  3ABU A;  2CUE A;  3JW4 A;  4EV0 A;  1VQ7 I;  2KIF A;  2HVS A;  4FE4 A;  4BDY A;  4CH7 A;  5K7Z A;  3EYI A;  3BOQ A;  3LAJ A;  5IP6 A;  1QBJ A;  3V7R A;  2CZR A;  1X1B A;  1UMQ A;  1UG2 A;  2VXZ A;  2MC3 A;  3HB9 A;  1SMY F;  1T0F C;  2W7N A;  1IG7 A;  1I27 A;  3NEU A;  3GFI A;  3SZG A;  5E3M A;  3CMA I;  3HSF A;  1CF7 A;  1XS9 A;  2ICW G;  5KCM A;  3RZD J;  3JRA A;  4P5O A;  3PO3 J;  4G6D A;  1WI3 A;  2HZD A;  1AA7 A;  4NB5 A;  4EM2 A;  4I0B A;  3RI4 A;  1Y39 A;  3FBI B;  2JRM A;  3PM1 A;  3K4L A;  5HNH A;  2XGE A;  2R93 J;  5LGU A;  4RB2 C;  1B6A A;  3PNT A;  3A0B C;  5J1R A;  3HOU J;  1G3S A;  2JUC A;  4IHW A;  2GAU A;  2XAF A;  3GUD A;  3KYC B;  4NUB A;  3Q9V A;  3PFI A;  3QYE A;  4XON A;  3BG7 A;  5FKM A;  1H8A C;  4LMY A;  3RZO J;  3KYL A;  1RNL A;  4GCV A;  4X0G A;  2MD5 A;  2EA4 A;  2W25 A;  3EQL F;  4GDF A;  4HBL A;  1HCR A;  1PJR A;  1RZ4 A;  2Q8K A;  3TW6 A;  4CDG A;  3ASO H;  1EF4 A;  1ZHF A;  1XSX A;  4YIR X;  4XK4 A;  2ZNY A;  4V2F A;  2F4O B;  3I59 B;  2V9V A;  3PL8 A;  4Y17 A;  3TO6 A;  3HIF A;  3GME A;  4YEL A;  1ERD A;  4I2O A;  2PG4 A;  3IRR A;  5CVV A;  1B9N A;  3RDI A;  4O5V A;  2ZME C;  5IYC J;  4PGH A;  2GXB A;  1TP4 A;  1YIT I;  3DTI A;  3HKZ A;  3MCZ A;  4JOM A;  3MFK A;  4KFC A;  1FOY A;  4UV8 A;  1TBX A;  3O3K A;  1EJ9 A;  2Y9Y A;  1MH4 A;  1SD4 A;  2R92 J;  1W7P A;  1QQI A;  5FD5 A;  3F8N A;  4E70 A;  3WG7 H;  3E0J B;  4KN4 X;  1FYL A;  2CW0 F;  3LFU A;  3Q0U A;  4G7Z F;  5BMZ A;  4BH9 A;  4JX5 A;  3U2R A;  2F5C A;  1S72 I;  3UR3 C;  1RES A;  4A3C J;  5D5U B;  1APL C;  5LFA A;  3DFG A;  3FXL A;  4PUS A;  4PFP A;  1K61 A;  5D8L B;  3DPT A;  3BCB A;  2HKX A;  4JX4 A;  3CCL I;  1P7J A;  3K2A A;  2WY7 Q;  1DU6 A;  3RYP A;  1VQ5 I;  5GPA A;  1QZZ A;  2KFD A;  3K4M A;  4B44 A;  1ZR2 A;  2O03 A;  3EUA A;  1B8I B;  3V4G A;  2H1L A;  1O3R A;  2CV8 A;  2JA2 A;  4HX7 A;  4IX7 A;  2LK2 A;  3O6B B;  3SZP A;  1Z3Y A;  2CMP A;  1MW7 A;  4IRH A;  4CIC A;  1BI3 A;  3DNX A;  3TP3 A;  1RR8 C;  2XPV A;  3CO7 C;  4KT5 C;  4CO8 A;  2WAE A;  1FZP B;  2XF7 A;  1TZL A;  3K10 A;  1IF1 A;  3REO A;  4R8H A;  3CCS I;  3H3U A;  1R0V A;  1SC7 A;  2V9K A;  1ZRF A;  2MFZ A;  2VL8 A;  2M2E A;  3DCF A;  1POG A;  2P4W A;  2WV1 A;  2DBS A;  3FM5 A;  2DJI A;  5FKL A;  3H9Q A;  5C3E J;  3WTU C;  1L3L A;  1SFU A;  2ZME B;  3MD2 A;  2XGC A;  3GX4 X;  1EH6 A;  1FNN A;  1A36 A;  2ZB9 A;  2Z5U A;  3TQN A;  3A4C A;  2BYV E;  4UY8 I;  5IT3 A;  2F4M B;  2CGP A;  2DPU A;  2VPL A;  2FOK A;  2E1M C;  1DUX C;  1F5T A;  5H2F C;  2L7M P;  4KN7 X;  3HOW J;  2X4H A;  4UUS A;  2OST A;  3BR1 A;  1IRZ A;  4L0Z B;  4KNY A;  4MQ9 F;  1RUO A;  4RM3 A;  1JKR C;  3DLL F;  5K7F A;  3PNV A;  4M71 A;  4EV1 A;  3RKQ A;  4FQG A;  3RTR A;  1ONV A;  2F4I A;  2OZU A;  2X51 A;  3S15 J;  5HS8 A;  3KP2 A;  3PIP F;  3AG3 H;  3U1D A;  1ULY A;  4K2E A;  4EJT A;  1H89 C;  1J09 A;  2VE8 A;  3E3V A;  1P4A A;  1HW5 A;  1SFK A;  4I7H A;  1WJC A;  5D5X B;  2VT2 A;  4B48 A;  2V1N A;  1RR7 A;  3QPH A;  2NRA C;  3H35 A;  2BHZ A;  4A0Z A;  1B59 A;  2BW3 B;  1WSU A;  1ETK A;  2XKP A;  4XLF A;  1OR7 C;  2VJI A;  4LIU A;  5BS6 A;  4QBO A;  3B02 A;  4G6T B;  1RI7 A;  1ZKG A;  4YEJ A;  4WWC A;  3WTX C;  4ZYA A;  1S7O A;  1WHU A;  3HUG B;  3BDD A;  1J0R A;  4RGS A;  3V7C A;  4ENJ A;  2WY8 Q;  3I54 A;  1YJN I;  3DKY A;  4B09 A;  3G4S I;  2A6T A;  3G73 A;  1GEF A;  2ZXH A;  5EJC A;  2FNP A;  3T0Y A;  2DA5 A;  2KT0 A;  5M5X J;  2HR3 A;  4IF4 A;  2L0K A;  3IAM 2;  3VYT B;  5E20 A;  2RDP A;  1F43 A;  1TQI A;  2JN6 A;  3NRV A;  3VB2 A;  1ZYR F;  3HRT A;  3GTK J;  3FDY A;  1R1T A;  2D1H A;  2ZO4 A;  1N75 A;  2ME6 A;  2B9S A;  3U1K A;  1FY7 A;  2LMD A;  4YG2 F;  4KYW A;  2MBF A;  5M3F J;  5L3B A;  4HNT A;  4JBA A;  1ETV A;  1BA5 A;  1J75 A;  1GLN A;  2FE3 A;  5EGO B;  4ZC3 A;  5HLH A;  1SFX A;  4X1E A;  1R23 A;  3WTS C;  3CC4 I;  2VOP A;  2PMH A;  1QZY A;  2BH2 A;  1R7J A;  2H8R A;  4XL9 A;  3FHZ A;  1FIP A;  2K3P A;  4XN0 A;  5GAE J;  4UVA A;  2VKD A;  3SEZ A;  4Y33 A;  3BR0 A;  1T56 A;  5H6R A;  2FD5 A;  3LSJ A;  3A01 A;  1YW9 A;  1OB9 A;  2IGO A;  2L4A A;  2LF7 A;  3ZOB A;  2R7T A;  3BZK A;  3G3Z A;  4EQQ A;  1OJL A;  2CQQ A;  4P55 A;  1JKP C;  5DEQ A;  1KA8 A;  5GTH C;  4RGX A;  1GUU A;  4C3I J;  2LC2 A;  3S17 J;  2R5Z A;  3ZQF A;  4HPQ A;  3W2A A;  4NQW B;  4C2U A;  1YG2 A;  3I4M J;  1XG1 A;  4YFN F;  2K9L A;  4RB0 A;  2M3A A;  2Y9Z A;  1YTY A;  1WFX A;  5JFR A;  1TWF J;  4FE7 A;  2BXY A;  3T5X A;  1B72 A;  1OKR A;  1YRN A;  1PUF B;  2D2W A;  3CO6 C;  4BDZ A;  2WAF A;  3OWT A;  3FX3 A;  3DTK A;  3TOB A;  1T39 A;  1YJ9 I;  4HQE A;  3O8H A;  1V3F A;  4FET A;  4RB3 C;  1OCO H;  3I9V 2;  3FM3 A;  5B3S H;  5EG0 A;  2HEO A;  3PUB A;  1OIS A;  4BE0 A;  3TO9 A;  4PSX A;  4G6V A;  1IV8 A;  4XRS G;  3SJM A;  2FJ1 A;  2L7F P;  2FF4 A;  3AG1 H;  2K5C A;  5F6F A;  5JVT A;  5DTD A;  1FEX A;  4CUG A;  4B47 A;  4DQ2 A;  3OYE A;  2IA2 A;  2WJ0 A;  2YX4 A;  1TTY A;  2R5Y A;  4RLQ A;  2L54 A;  3ZMZ A;  3HOY J;  5DD8 A;  2DT6 A;  2FSW A;  4MTE A;  1D0X A;  1S29 A;  3HZJ A;  3HL2 A;  1RIO H;  1ZRC A;  2H27 A;  2Y31 A;  4BE2 A;  1YO5 C;  5E3L A;  3DQV C;  2HOS A;  4OU0 A;  1G3W A;  1RET A;  3VOD A;  2HQA A;  3VYR B;  1ETO A;  2VS1 A;  1FTT A;  2DA4 A;  3F9K A;  3KCC A;  4G94 A;  4XKW A;  1RUN A;  4ENN A;  1MMG A;  1G4D A;  5KK1 A;  5L3C A;  2DYS H;  3FMS A;  1I3Q J;  4MNU A;  2XPU A;  2BY2 A;  2HYG D;  5F0H A;  5LRR A;  2AQE A;  4LG0 A;  3RQI A;  1XGN A;  4JYK A;  1ZEL A;  4PZJ A;  5D4R A;  1SAN A;  2DQL A;  3DPL C;  2MLG A;  3VSL A;  2BOL A;  5HDN A;  2ECC A;  5J3L A;  4Y52 J;  3KZZ A;  4UV9 A;  2R7U A;  4RAY A;  3ECH A;  3EUH C;  4OMZ A;  1W5C C;  3IH4 A;  4W1U A;  3OYF A;  4IO9 F;  3HSR A;  3GFJ A;  3R0A A;  4LG3 A;  1NG7 A;  3OIQ A;  1J2X A;  2DOE A;  3KPH A;  2FXA A;  3E1S A;  1LQ1 A;  3CUQ C;  1BN5 A;  3HPG A;  1HF0 A;  3VWB A;  1Z7L A;  2NVY J;  2XB0 X;  4MFE A;  9ANT A;  4XKV A;  2UXX A;  3DBH B;  4LJZ F;  1A5J A;  2ZSI B;  3W6J B;  3VPR A;  4I99 C;  2LH9 A;  2ID3 A;  1MBF A;  3OYA A;  2EIN H;  1GV5 A;  4DGW B;  1DDN A;  1HW1 A;  2LVS A;  1E3H A;  2ZC2 A;  2MH2 A;  5FDK A;  2Y48 A;  3S2D J;  4Z6Y A;  1FWZ A;  5ICE A;  4IXA A;  1F9N A;  3DF8 A;  1GDT A;  3GXO A;  1VZ0 A;  4JP0 A;  2H09 A;  1QVU A;  3HHH A;  3AG2 H;  4AD9 A;  3C7J A;  1LE8 B;  2P5V A;  3ESW B;  1P9Q C;  3E97 A;  2BZT A;  5A2Q Z;  3HOZ J;  1ZLK A;  1XDS A;  2P5K A;  4OIN F;  2COB A;  3GLL A;  1U6G A;  2X0L A;  2DLL A;  4EJO A;  2DO7 A;  5FLX K;  4BHC A;  2R7V A;  3LSK A;  2VOD A;  4D7N A;  1Q1H A;  4XLC A;  5J8F A;  2FUG 2;  3K69 A;  1OYW A;  2GA2 A;  3RPU A;  2DT7 B;  4A3E J;  1MND A;  2VON A;  1JI8 A;  3U9G A;  1G8X A;  5E1Z B;  5EEG A;  3J7A Y;  2A05 A;  1XX5 A;  5CVI A;  2YSR A;  1X1D A;  3ONQ A;  2A5W A;  4M72 A;  4U88 A;  2K9Q A;  3MZ8 A;  2M4K A;  1BJZ A;  4QWQ A;  3WG9 A;  2L02 A;  4XMY A;  2OTJ I;  2JA8 J;  3ML6 A;  3TMO A;  1EV7 A;  3LAP A;  3BT9 A;  1RC9 A;  1ZGW A;  1A31 A;  1WRJ A;  5HDK A;  2W8M A;  1LNW A;  3L9F A;  2EV0 A;  2BVL A;  4GYI A;  5IOY A;  3P9I A;  1YIO A;  5EDN A;  4ZYD A;  3F22 A;  3HDD A;  4HG2 A;  3I59 A;  3GTQ J;  4OIQ F;  2E34 A;  2I10 A;  4NC7 A;  5FGM A;  3D5S C;  1DGR M;  4KIF A;  1BR2 A;  2GOM A;  3ZQQ A;  4KIG A;  2HVR A;  2DU9 A;  4CCL A;  1JKQ C;  5D4S A;  3OYD A;  3FXM A;  1T0F A;  5D8K B;  3JTH A;  3HOV J;  5B1B H;  1IN8 A;  3S14 J;  3EPZ A;  4UUT A;  3LSH A;  3RKW A;  3OYM A;  1UB9 A;  2PLY A;  1D0Z A;  1LJ9 A;  3MMY B;  3WU1 B;  4EM1 A;  1U3E M;  4DYC A;  1IZ1 A;  2INB A;  4PDK A;  4BGD A;  1FYM A;  1F4K A;  2QSH X;  4U0W A;  5E1W A;  4GFB A;  4ZDO A;  2CWE A;  3OSG A;  2MW8 A;  3ISP A;  4MIM A;  3RCO A;  3I0T A;  3DLA A;  4OAY A;  1Z6T A;  2L4M A;  3UKG A;  2D45 A;  1IW7 F;  4WXD A;  2NVX J;  2L2O A;  2M4G A;  2PQ8 A;  5BNG A;  2DDA A;  2IEK A;  3KP4 A;  1BIA A;  2CQK A;  3S93 A;  5EEA A;  3ERE D;  4H0E A;  5FLV A;  3SEQ A;  1Y8R B;  1WPK A;  2M7B A;  3HRS A;  1YJW I;  3AKZ A;  2DMP A;  5DM6 F;  2E7W A;  1RPW A;  3VEP A;  5J8C A;  4BXU A;  5ICC A;  1B8I A;  3BR5 A;  3M07 A;  1A35 A;  1MMD A;  2Q2E A;  2BY0 A;  1DGW Y;  1FX7 A;  2X9D A;  3HM5 A;  4F55 A;  3SFZ A;  1RZN A;  3K4N A;  1N25 A;  4L9V A;  1IN6 A;  2IGN A;  1G3T A;  4LK1 F;  2CV1 A;  1MD0 A;  4UHT A;  4EMS A;  4YIF A;  4L18 B;  1WJB A;  4F93 B;  4IPA A;  5F0C A;  3J7Y J;  4IL6 C;  3VOE A;  4DYR A;  5AIP A;  1W0T A;  5K5O A;  2AHQ A;  3T1B A;  1IN7 A;  4EGZ A;  3O2P E;  2PJP A;  2ETH A;  1NHA A;  3C1D A;  3IUO A;  2ZME A;  2VBX A;  5LHG A;  5E3O A;  1Z6R A;  5J40 A;  4CCN A;  1VFC A;  4RAF A;  2RQP A;  4ESB A;  2XDV A;  3DBR B;  4AID A;  5DM7 F;  1XDU A;  4D9J A;  1X3W B;  4S05 A;  4MEX F;  3B6C A;  1X1A A;  2ZJ2 A;  4YFX F;  3E6B A;  4XNF A;  2JA5 J;  5LGN A;  3M1C A;  1XSD A;  3U21 A;  2YX7 A;  4O6J A;  4BBR J;  2K9N A;  4BJT A;  3L7W A;  1T38 A;  2W57 A;  4D7M A;  4DIQ A;  1HXD A;  4M9X A;  2XF6 A;  4EJW A;  3BR3 A;  2BBY A;  1UST A;  1BI0 A;  2FCO A;  5HLG A;  1X4O A;  4PCQ A;  1JGS A;  1OCC H;  4RBO A;  1M1E B;  4P9F A;  1GV2 A;  2DOA A;  5DCF A;  5LEJ A;  2UUZ A;  2XRO A;  5GAD J;  3F21 A;  2A61 A;  2W84 A;  1E0E A;  2Y0M A;  1ZG5 A;  2XV4 S;  2WA0 A;  2IS6 A;  5LRS A;  1T95 A;  1W1W E;  3PIO F;  2BW3 A;  2PN6 A;  2JA6 J;  2ME0 A;  2E35 A;  2L7K A;  5BOX A;  1YQA A;  5C4J J;  3E5U A;  1ITY A;  5LHI A;  2VN2 A;  2WAQ N;  3I53 A;  4KUM A;  5ICF A;  3OSF A;  3W3C A;  2GW6 A;  4HZF A;  3RKX A;  5JLX A;  4A6E A;  1J59 A;  1RLV A;  1FBS A;  3HUG A;  1FSE A;  2XVC A;  4CGZ A;  2B63 J;  3MKY B;  4BE1 A;  2DK8 A;  2GQQ A;  5C44 J;  2E5N A;  2CFX A;  2FML A;  4HRI A;  4E7S A;  5E3N A;  5FLX Z;  3GZ6 A;  4BS9 A;  3CME I;  4QBL A;  2HPM A;  3COA C;  2V79 A;  4F3Q A;  5LHH A;  3T8T A;  1J5Y A;  1YI2 I;  4PK4 A;  1HW2 A;  4IKF A;  4HYE A;  1Z05 A;  1Z67 A;  3E6M A;  3BTJ A;  3QQA A;  4XOT A;  2EFO A;  2QF7 A;  2VT3 A;  4G9Y A;  1XC5 A;  2LDU A;  2R7D A;  2VLD A;  2JVH A;  4CSW A;  3JRG A;  1LFP A;  2O8K A;  5EGO A;  1A04 A;  2V1D A;  2XSD C;  3K1N A;  2HS5 A;  2VKH A;  1TW3 A;  1XCV A;  2FNA A;  5LEK A;  3S1Q J;  1TWG J;  2VPR A;  2FLC A;  3ZRG A;  2CSO A;  4HX8 A;  1Y8Q B;  2NS0 A;  1C0W A;  3OL4 A;  1B1B A;  2M8G X;  3M8F A;  5LLQ A;  1LB2 A;  3CD6 I;  1QO0 D;  4EGY A;  1GVD A;  1IN5 A;  1OFC X;  2DW4 A;  4M3D A;  5L3E A;  1A79 A;  3DWL E;  2QWW A;  1UCR A;  3ERM A;  5ILS A;  1J7K A;  2XKO A;  1OR7 A;  2H6B A;  1Z0X A;  4LOC A;  4ENK A;  2ZBK A;  2OC6 A;  1SVL A;  4E6K G;  2DMQ A;  3MKZ A;  2OCE A;  2OPT A;  1MNM C;  3KYD B;  5LGT A;  2QQA A;  3MZH A;  5E1X A;  3J81 K;  5AON A;  2PFB A;  3F23 A;  2AQF A;  2FA5 A;  3FHN A;  3QP6 A;  2P7V B;  2O6G E;  2IJL A;  2DTZ A;  2DTR A;  4NQW A;  2Z9O A;  3HHG A;  3A1Y A;  1I6H J;  2IS2 A;  3L1P A;  1UHW A;  1ZR4 A;  4A12 A;  4HAM A;  2NOJ B;  3IKV A;  3K4K A;  3NAR A;  1YS7 A;  3B73 A;  5CLS A;  1PUF A;  2QYO A;  4N9I A;  3DEW A;  3KIO A;  1IV6 A;  2X6Y A;  3OS2 A;  1HKQ A;  2V6C A;  2CO5 A;  4PJM A;  5IP9 J;  4J19 A;  1ON2 A;  2R3S A;  4ITV A;  2DA2 A;  4CHU A;  1ON1 A;  2E60 A;  2JWT A;  2KQR A;  3CES A;  5FKK A;  3WE3 A;  3ELK A;  1R71 A;  4IQJ A;  3A2K A;  4L5J A;  3G2B A;  3KZY A;  4I98 B;  3E7L A;  3ZMU A;  1Z1D A;  2EWN A;  1IO2 A;  2XGX A;  4MGR A;  1YX3 A;  3E5Q A;  3D0S A;  2I5U A;  5J1Y A;  3TBI A;  3K70 C;  2ZNZ A;  4E7L A;  4KA4 A;  2M5W A;  4YII A;  2EZL A;  4PGG A;  3GCM A;  1VQM I;  3E6C C;  2QQ9 A;  5CPR B;  3MAJ A;  2DFI A;  3TO7 A;  4A3B J;  3HXL A;  4BY7 J;  5ERI A;  2ZFU A;  2HOE A;  2VC0 A;  3ZPL A;  2ZXI A;  5HNF A;  1W5T A;  1E3P A;  2LP0 A;  3IEY B;  3IC7 A;  4A93 J;  2EZI A;  3LSI A;  4II2 A;  3IHU A;  1B9M A;  4AVZ A;  3OS1 A;  2OUM A;  4HLX A;  3R60 A;  2XRN A;  5DDG A;  3K70 D;  2DJN A;  2VJ4 A;  2GIV A;  3KFW X;  2K3F A;  3JSO A;  2J5O A;  5CVR A;  2W4S A;  1Z7U A;  1R9T J;  1ZN2 A;  1BI1 A;  3EYY A;  2LOO A;  4IOA F;  3E5X A;  3TED A;  3CJT B;  5EZG A;  1O7L A;  2JTV A;  3BR6 A;  4QLC U;  3AL0 C;  2A68 F;  2KIS A;  2P6T A;  1FIA A;  2DK5 A;  4B4C A;  2E5Z A;  2LKX A;  1K78 A;  1UAA A;  3F8B A;  4PJ0 C;  3SDB A;  3JAM K;  1XGO A;  3P5J A;  3WGI A;  2CW7 A;  2OKF A;  3WTY C;  1PUE E;  1E3O C;  2EZH A;  4QTR A;  4GXO A;  5CKT A;  3E6D A;  5B1A H;  3HGG A;  2ZYZ B;  2YU3 A;  3LOC A;  4A5N A;  3IRQ A;  3FBN B;  1NTC A;  1I50 J;  2Y75 A;  2KIM A;  2WC2 A;  2E7X A;  1TNS A;  4GGG A;  4ZZD A;  3WTW C;  3JRC A;  2PJR B;  1V4R A;  2RQQ A;  2R7O A;  4M9Z A;  3OL3 A;  1WJD A;  1YYV A;  3HSE A;  4A5M A;  1USS A;  1MMA A;  4ZDP A;  2ACJ A;  1WJA A;  4RGU A;  5F27 A;  1YW7 A;  2NS7 A;  3FMQ A;  2ELJ A;  3D1N I;  4XKC A;  3VSK A;  3HTS B;  1UHS A;  2R7X A;  5CQE A;  5IY5 H;  5IPA A;  1KZH A;  1BL0 A;  3K1P A;  1IC8 A;  1MMN A;  3NQO A;  4G6Q A;  1WVR A;  2ISY A;  2KDO A;  2KZG A;  4N9H A;  1Y1W J;  1NK3 P;  3QU6 A;  1MMS A;  2IW5 A;  1ODD A;  2DFF A;  2FEZ A;  5JI6 A;  1LE8 A;  1UEL B;  3ZQL A;  3TOA A;  4L5E A;  4Z2Y A;  4BAY A;  3HOX J;  3AL0 B;  4P9U A;  2J5P A;  2YUS A;  1LVA A;  3FF5 A;  1IPI A;  4ENM A;  1KQ0 A;  1X1C A;  4I0A A;  2CH0 A;  1P92 A;  4I09 A;  3S2W A;  1PP7 U;  3L2U A;  2QBY B;  2EO0 A;  4XLE A;  1WCM J;  4Q47 A;  1SVM A;  4XRF A;  4WK8 F;  2E1M B;  1AOY A;  2F48 A;  3F8M A;  2JJ7 A;  4LD5 A;  1TLH B;  2Y69 H;  1IRF A;  2DAO A;  2EIJ H;  1PVE A;  1RKT A;  1XMX A;  1KQ8 A;  4KIB A;  4XSX F;  3AJV B;  2Y2Z A;  2QGU A;  4FX0 A;  4HV6 A;  1D3Y A;  3FK7 A;  3GEZ A;  3R4K A;  1IRG A;  3J81 Z;  4N4O B;  1MBJ A;  3KLN A;  1IAW A;  2HDW A;  2C6Y A;  4MLO A;  4ON0 A;  4ESJ A;  1BJA A;  2XIG A;  2DCE A;  4CCO A;  1SFO J;  3H5N A;  3M7G A;  3MQ0 A;  3K0L A;  5IP7 J;  4E7Z A;  3OIO A;  3S2H J;  2R7S A;  3TGN A;  4F92 B;  1LVK A;  3BCA A;  4XKB A;  4I02 A;  2JSP A;  3BJA A;  3CC7 I;  4LLN A;  2LY9 A;  1MJB A;  2LRE A;  1S6L A;  1KQ9 A;  4E7H A;  1R11 A;  1OYY A;  5E79 C;  4U87 A;  3H9J A;  2EFP A;  2K9M A;  2RVC A;  4M9S A;  3H36 A;  2QSF X;  1KU3 A;  4E7K A;  3FXQ A;  3GYH X;  3DEU A;  1R58 A;  1DQU A;  5K5R A;  1ZLJ A;  2E1O A;  2MAB A;  2ZJP F;  2CV0 A;  1K4S A;  3MKW B;  1E2X A;  4XM3 A;  4RDU A;  4FX4 A;  2VB6 A;  1EH7 A;  1N77 A;  3J7Z I;  1X2N A;  2EFQ A;  5K1Y A;  3FKI J;  3SQN A;  3VFZ A;  3BT7 A;  2E19 A;  4OIO F;  4CYC B;  3GO5 A;  5GAH J;  1IN4 A;  1GXQ A;  2LKP A;  2MG4 A;  2LRD A;  2EJR A;  3Q9S A;  3LSP A;  2PMZ A;  3KX2 A;  2JJQ A;  3CDI A;  2IAI A;  5D6F A;  3ABK H;  3BG6 A;  3P9C A;  5JLW A;  4B43 A;  5FO5 A;  3CLO A;  2DPD A;  2UZK A;  3F72 A;  3OYK A;  1K6O A;  3P1Y A;  3HG9 A;  2MD0 A;  3DP7 A;  3F3X A;  3LSG A;  3ZR8 X;  2DFE A;  2L9R A;  2HVQ A;  1OCT C;  4ESF A;  1W7P D;  4A2U A;  1I1S A;  3LFK A;  1UZC A;  2KJB A;  1ZP7 A;  1D5Y A;  1IUF A;  2XGD A;  1QU3 A;  4MFD A;  5HS7 A;  2NOG A;  2NVT J;  2FX0 A;  2XAS A;  1MNE A;  3ZMD A;  4CZZ A;  4BQN A;  1RRJ A;  2CUJ A;  2LR8 A;  1UWV A;  1OYI A;  3MVP A;  1H9T A;  3HGY A;  1BM9 A;  2RV8 A;  4AVP A;  2QSG X;  4X6A J;  1EA3 A;  1JTX A;  1KU2 A;  1S5L C;  5E8G A;  4BJ6 C;  5GTI C;  4XRM A;  5F04 A;  5M5W J;  4IEJ A;  2L9N A;  4EVI A;  1FBU A;  3S1M J;  1ACI A;  2HPI A;  2HU9 A;  2F5F A;  3PNY A;  3L2W A;  3RYR A;  1G2H A;  1IXS B;  2BHY A;  1XD7 A;  3H92 A;  3F8F A;  1Y0U A;  2ZXJ A;  3NAU A;  2DI3 A;  3OYH A;  2FKH B;  2IP2 A;  3I4N J;  3HRM A;  1TQP A;  3RPQ A;  2K4J A;  2CS3 A;  2AO9 A;  4EJV A;  1V55 H;  2LFB A;  3QWL A;  4G12 A;  2JMW A;  3R6S A;  2P8T A;  2QQ8 A;  1FSH A;  2IA1 A;  1ZRD A;  2XAH A;  3H1C A;  5BPI A;  1WZ2 A;  1PYV A;  5TGT A;  1JT6 A;  5E17 F;  4R79 A;  2X85 A;  3Q3S A;  3CP2 A;  1Q1V A;  5BPD A;  1BIB A;  1KON A;  2TCT A;  4M73 A;  4RS8 A;  2CQ7 A;  3ABT A;  2ISZ A;  3AG4 H;  5EEH A;  4CYD A;  5DUK A;  4DZP A;  4DAP A;  3CLQ A;  4XR6 A;  3FMR A;  3ZMS A;  3CDH A;  5ILV A;  5K7H A;  3BPV A;  3HPH A;  4LLG F;  5FJ8 J;  3I58 A;  4ZTF A;  5DCM B;  2DOF A;  4AUX A;  2RAE A;  1ETQ A;  1R5I D;  2RNG A;  4DBQ A;  2GM4 A;  2PMZ N;  4CCM A;  4C2T A;  2R4G A;  1BR4 A;  2KKO A;  1WH7 A;  2HXO A;  2VAS A;  3F0C A;  3OOP A;  4I6Z A;  2QKM B;  4ZYG A;  4LB6 B;  1WWX A;  4F91 B;  1QRY A;  2Z3Y A;  4A3L J;  1MDM B;  5H20 A;  5JR3 A;  1QHH D;  5FRN A;  5GP9 A;  2UXN A;  2QM3 A;  4GO1 A;  4BQQ A;  4ZYH A;  3TDU C;  3CDL A;  1SD5 A;  4FCY A;  2M0C A;  3KEQ A;  1BC8 C;  1TWA J;  1DPU A;  2QEX I;  5HOO A;  2Y0S A;  2RKH A;  1JHH A;  2Z16 A;  1LPQ A;  1BOA A;  1YW8 A;  2DMU A;  2WWY A;  5FFX A;  1JXS A;  4A3G J;  1ENH A;  3LL7 A;  3I64 A;  1D1A A;  1HH1 A;  1ZQ3 P;  1R22 A;  3HTU A;  2YR2 A;  2Z33 A;  1TWH J;  3CUO A;  5HS9 A;  2F5E A;  4KMF A;  3D5R C;  1LUJ B;  5KNL A;  4NHJ A;  4OMY A;  3L2C A;  1R5H A;  1GHC A;  2VOO A;  3BTI A;  2QVO A;  3ZQI A;  3FOV A;  2G0E A;  3K4J A;  2RGV A;  3HYI A;  2XHK A;  1TW2 A;  2A69 F;  3HOS A;  3K6G A;  4ZDL A;  2FKC A;  4JQF A;  2ESH A;  2BE5 F;  4DNC A;  1RKW A;  1LDD A;  3FXU A;  1S7E A;  2KRF A;  1YLF A;  2LD5 A;  3LNQ A;  4ZYE A;  4BQO A;  2JZY A;  4CXF A;  2F2E A;  2OTL I;  3CUQ B;  3W2V A;  2GA1 A;  2VBW A;  5D5W B;  3FXO A;  2EIL H;  3S8P A;  1DU0 A;  4I01 A;  1VQN I;  1TWC J;  1U9N A;  4RMN A;  4L0Y B;  3JRE A;  3F6O A;  3F8C A;  2X1E A;  3C2H A;  2DQR A;  4LGW A;  3I4P A;  2L01 A;  4BEH B;  3CCQ I;  3N05 A;  3QRF F;  3X2Q H;  2P6S A;  4G8X A;  2X6W A;  5TJJ A;  3RSN A;  1KU9 A;  4O3M A;  1VQ6 I;  2GOX B;  2MGQ A;  1HSJ A;  1LEA A;  3PO2 J;  4ZTJ A;  4DBR A;  3G6E I;  1REP C;  5FB2 A;  2F5V A;  2B7E A;  3QPL A;  2ID6 A;  3JRD A;  1MH3 A;  1TNT A;  1JJ6 C;  4DYQ A;  2KP6 A;  3ZQH A;  2ZKZ A;  2COM A;  3LWF A;  3I55 I;  3IH2 A;  2IPQ X;  3O8G A;  2HDD A;  2QCO A;  4RLF A;  3IP4 B;  3ZMV A;  3K1M A;  4F52 A;  2EZK A;  1X2M A;  1H9G A;  2WAQ A;  3JSP A;  2QQB A;  5B66 C;  4E6Z A;  1SEU A;  2OAZ A;  2Y0S N;  3OYC A;  2STT A;  4KT6 A;  3GVA A;  3IEY A;  2V1X A;  4P96 A;  2A6E F;  3OMY A;  3GFL A;  3I71 A;  2M34 A;  5J1U A;  5IT9 K;  2OD5 A;  1BW5 A;  4I76 A;  2R5Z B;  2M45 A;  2G7H A;  4XOR A;  3J80 K;  2R7F A;  4BYY A;  4DOZ A;  3LA2 A;  2IXS A;  3JRB A;  2CUZ A;  4BUP A;  3GTP J;  1I5Z A;  3GLX A;  3WOD F;  4B8X A;  1BOB A;  2VQG A;  4NBQ A;  1FJL A;  5LD2 C;  5KHD A;  3OYI A;  2CJJ A;  3BC8 A;  1X3U A;  1XMA A;  4ZJZ A;  2FU4 A;  4LK0 F;  2LG4 A;  4LIT A;  1Z91 A;  4D5F A;  1LFB A;  3ZQ7 A;  2LY2 A;  3H3Z A;  4RAG A;  3ASN H;  3GTL J;  3ROU A;  1IRX A;  2W1O A;  1VF9 A;  1X19 A;  2KZV A;  2VQH A;  1ORK A;  2ZYZ A;  5HLI A;  3WTT C;  3WGG A;  3L00 A;  2HXI A;  2X1D A;  2BY3 A;  1Z21 A;  4DA2 A;  2DA6 A;  3CF2 A;  1X1P A;  2PJR A;  1TT5 B;  4C2M J;  2MLK A;  2H6C A;  3PSF A;  2K02 A;  2YPR A;  2CYY A;  2HDC A;  4TV7 A;  1TQM A;  2IGK A;  2VE9 A;  3ZMT A;  3G71 I;  3MKL A;  2MYS A;  3ABL H;  3FXR A;  2Z99 A;  1QGP A;  3CCE I;  1FPQ A;  3L2Q A;  4H4K C;  1O3Q A;  4KDP A;  2KPM A;  2LKS A;  4WXC A;  2FQ3 A;  2OV7 A;  3GTM J;  3GF2 A;  1X58 A;  1IJW C;  3BQZ A;  3IKT A;  1XMK A;  5ED4 A;  3N4M A;  1U5T C;  3P1Z B;  2OA4 A;  3PUF A;  2DA7 A;  4Q5S F;  2VLA A;  2OQR A;  4EJU A;  5GAG J;  4UNO A;  3LMM A;  3JCU C;  1HDD C;  4C3J J;  3Q0W A;  1IDZ A;  2QUF A;  2P5L C;  1Y56 A;  2HI3 A;  1BC7 C;  3VDX A;  3RKY A;  1VQL I;  3J7A O;  2MA3 A;  3T8R A;  3CMM A;  3KZI C;  5F1J A;  4CCK A;  4RB1 A;  3JRI A;  4A3F J;  3BP8 A;  2QBY A;  3WHC A;  3WGH A;  4CZC A;  1HLV A;  1ZRE A;  3S16 J;  1QVT A;  2K4B A;  2BGC A;  4BL0 B;  3L2R A;  2ZJQ F;  6PAX A;  2EB7 A;  4M3E A;  4XOP A;  5D5V B;  1IGN A;  5CVU A;  3W2W A;  3M3Y J;  3AJV A;  3QYB A;  4Y4R A;  3BTL A;  1ETY A;  3BTC A;  1QZE A;  1QPI A;  2ELH A;  1ZH5 A;  4M6V A;  5FLM J;  3SHF A;  5M5Y J;  2UWM A;  1U2W A;  3IWF A;  3ABM H;  3PFY A;  2VIX A;  2CQN A;  3CJN A;  2EFW A;  2XAG A;  1W0U A;  1YE9 A;  2VQC A;  4RM2 A;  4FAS D;  3G1M A;  2K7L A;  1D1B A;  2BV6 A;  2ZXW H;  2IT0 A;  4XLH A;  3RPU D;  1GT0 C;  3V42 A;  1U5T B;  5HDG A;  1Y1O A;  4D1Q A;  5DV5 A;  1LDK B;  4XID A;  4HF2 A;  4ETS A;  5J47 A;  4U7B A;  3M8E A;  2Z0R A;  4L9J A;  1OQY A;  2DBB A;  1V5F A;  4AU7 A;  3R0J A;  3ZXS A;  2GLO A;  4BHP A;  2LBF B;  5JHF A;  1K79 A;  2D5V A;  1MZB A;  1HST A;  1O3T A;  4LB5 A;  4E4H A;  3MZY A;  4BU2 A;  2W48 A;  3WE2 A;  3F6V A;  4M3B A;  3KET A;  3C18 A;  4B3X A; 
#chains in the Genus database with same CATH homology
 2LNB A;  4MEY F;  2FL3 A;  2HGC A;  3BY6 A;  1GXP A;  5AIQ A;  4AIK A;  3LQQ A;  4AIJ A;  1BBY A;  4G7H F;  4U0Y A;  1UHM A;  2CG4 A;  1XN7 A;  1XSV A;  2HTJ A;  4WF2 A;  5IT9 Z;  1B4A A;  3ULQ B;  4D0P A;  1ZG1 A;  5ILU A;  3J80 Z;  5L3F A;  1SMT A;  3DV8 A;  4BNC A;  4HF0 A;  3V8L A;  1P4W A;  3FWE A;  2JSC A;  1DP7 P;  4MHG A;  3N97 A;  4IHT A;  2NNY A;  3ZP5 A;  3K2Z A;  4U7D A;  2F5D A;  2LF8 A;  1XGM A;  3BPX A;  1FC3 A;  1Y88 A;  4KMU X;  1JE8 A;  2L3D A;  2XAQ A;  4Q48 A;  1XGS A;  3DXJ F;  2A5Y B;  1D5V A;  4HF1 A;  3SZT A;  2EFN A;  1I1G A;  1SAX A;  2OBP A;  4JK1 X;  2FMY A;  2EV6 A;  2HQN A;  5DCM A;  1KGS A;  2WIZ A;  1L0O C;  2D1V A;  2M8E A;  4IJA A;  5ICG A;  3QAH A;  4QBN A;  1MKM A;  2A3S A;  4Y13 A;  1F1Z A;  1YNM A;  4ZZL A;  2BEO A;  1PDN C;  5CJ9 A;  1MDM A;  1T98 A;  2WV0 A;  3GZ5 A;  3W6K B;  1KYZ A;  2PI0 A;  5DYM A;  4UVB A;  2M1B A;  4G7O F;  1R00 A;  4M6X A;  1KYW A;  1R1U A;  3EET A;  1R36 A;  3HRU A;  3AAF A;  3M1E A;  4RGR A;  5K5Q A;  2JRT A;  3EUH A;  2P7C B;  4OOI A;  2K86 A;  4AIH A;  3IWZ A;  3LA7 A;  2JT1 A;  3CUQ A;  3CTA A;  3WU0 A;  5CYV A;  1P6R A;  1UFM A;  1IXR C;  2V1U A;  2WCZ A;  4YFK F;  2XUB A;  2QLZ A;  2B0L A;  3P7N A;  4IVN A;  1HKT A;  3GW2 A;  3BZ6 A;  2HFH A;  1EH8 A;  3SXY A;  1CF7 B;  1R1V A;  4HDV A;  5A2Q K;  5DD4 A;  4G6U A;  2STW A;  3V8J A;  2HWV A;  2O61 A;  3BJO A;  2VC1 A;  3TDZ C;  5E18 F;  3P9K A;  2EA2 A;  4HQM A;  1ZGA A;  1HBX G;  1JHF A;  2TDX A;  5CVJ A;  1FOK A;  1DPR A;  1K7A A;  1GVJ A;  2PBI A;  2FBI A;  3QU3 A;  1ZAO A;  2KJC A;  1XCB A;  3LA3 A;  5H6Q A;  5L3G A;  1FBQ A;  3RJP A;  1FP1 D;  4L9N A;  3FZV A;  1S8N A;  4U0V A;  2ZFW A;  2M30 A;  4ZH4 F;  3JTG A;  4R1H A;  2W24 A;  3OV8 A;  3PQJ A;  4IRG A;  3JAM Z;  1U8R A;  1P2F A;  1T6S A;  4S04 A;  1W7P B;  3BRO A;  2OQG A;  2LSO A;  3DKW A;  3GWZ A;  1ZGJ A;  4L5I A;  2NAZ A;  4OIR F;  2E1N A;  3D5L A;  1W4M A;  3TKY A;  2EV5 A;  2RNJ A;  3KE2 A;  2G7U A;  2QEN A;  4FT8 A;  5DUI A;  1ZAR A;  5HVQ C;  2FRH A;  4EM0 B;  1U78 A;  2QZ8 A;  4DAV A;  1PP8 F;  3P1Z A;  1OB8 A;  1KU7 A;  1HKS A;  1STZ A;  1WI9 A;  2WTE A;  2W85 A;  3K9T A;  3KP3 A;  1K78 B;  2JPB A;  2GZW A;  2PEX A;  1CGP A;  4Q4Z F;  4N0B A;  3BWG A;  3ECO A;  4UUV A;  1SD6 A;  4ZQU A;  2G9W A;  2H94 A;  3GFM A;  4HW0 A;  1QPM A;  1T2K A;  4M74 A;  4IHS A;  3LST A;  3RIR A;  2GJW A;  5FFZ A;  1U5T A;  2Q0O A;  1P4X A;  1IXC A;  2AXL A;  4KIC A;  2IVM A;  2EK5 A;  3KP5 A;  2A6H F;  2KIU A;  4XSZ F;  4GYG A;  2RC4 A;  5BQT A;  2M87 A;  1OMI A;  3MWM A;  4UXN A;  3ZN1 A;  1LDJ A;  1WQ2 A;  5J6X A;  5F1R A;  3MEX A;  4LLL A;  1HQC A;  1R5G A;  3L09 A;  5KVR A;  2NYX A;  3EDP A;  3KEO A;  4XLP F;  1Z9C A;  2HKO A;  1ZG3 A;  4HV5 A;  2NNN A;  2PMU A;  4HX4 A;  2IA0 A;  4WCG A;  1FP2 A;  1FT9 A;  1SFE A;  4F7Z A;  1G6N A;  3QOP A;  1E17 A;  2ZCW A;  4IRI A;  2HYF A;  4A0Y A;  2A07 F;  5L3D A;  2WCW A;  3C3W A;  2MH9 A;  1IUY A;  2WIW A;  4TKK A;  4A0X A;  3V8K A;  3V7S A;  1S3J A;  1SD7 A;  4UVC A;  4BHB A;  1S7A A;  2OZ6 A;  4LQE A;  1LEB A;  1OPC A;  2DT5 A;  2RN7 A;  4MQV A;  1VTN C;  2O0Y A;  1AWC A;  2E1C A;  5FD6 A;  2HTS A;  2FBH A;  4A6D A;  2OU2 A;  1FYK A;  4BQA A;  1J9I A;  3IF0 X;  2JPC A;  5JHU A;  1G3Y A;  4TKD A;  1O3S A;  3PQK A;  5TRD A;  4XLN F;  4MTD A;  3HOT A;  2GWR A;  5D6E A;  3KLO A;  1MJ9 A;  1MJA A;  4L9T A;  2O3F A;  4Y15 A;  1XB4 A;  4HDU A;  1D8J A;  3IL2 A;  5F64 A;  2GXG A;  5E8I A;  1W5S A;  1O7F A;  1WKM A;  4WX9 A;  1FLI A;  2ADU A;  3I5U A;  3BJ6 A;  4M6Y A;  1I6X A;  3M9A A;  4ASN A;  2AS5 F;  3WTZ A;  3ZN0 A;  2XAJ A;  1YFH A;  2IRF G;  3QPT A;  2HZT A;  1O57 A;  4LFU A;  1H0M A;  1YS6 A;  3KP7 A;  4FHT A;  2HQR A;  4WXH A;  4OIP F;  1BI2 A;  4AWX B;  2O8X A;  2VBZ A;  4HA8 A;  4LG0 B;  2VBY A;  3R61 A;  4RAZ A;  3LQR A;  4HOB A;  3Q5F A;  4HLY A;  4XBF A;  2ESN A;  1D8K A;  5LBQ A;  3QP5 A;  3KP6 A;  1QNT A;  2K27 A;  1MGT A;  2FBK A;  3WTV C;  3ABU A;  3JW4 A;  4EV0 A;  2KIF A;  3EYI A;  3BOQ A;  3LAJ A;  1QBJ A;  3V7R A;  2CZR A;  2VXZ A;  2MC3 A;  1SMY F;  1I27 A;  3NEU A;  3GFI A;  3HSF A;  1CF7 A;  4P5O A;  4G6D A;  4NB5 A;  4EM2 A;  4I0B A;  3RI4 A;  5LGU A;  4RB2 C;  1B6A A;  1G3S A;  2GAU A;  2XAF A;  3GUD A;  3Q9V A;  3PFI A;  4LMY A;  1RNL A;  4GCV A;  2MD5 A;  2EA4 A;  2W25 A;  3EQL F;  4HBL A;  1RZ4 A;  2Q8K A;  4CDG A;  1ZHF A;  1XSX A;  2ZNY A;  3I59 B;  2V9V A;  4Y17 A;  3TO6 A;  3HIF A;  4I2O A;  2PG4 A;  3IRR A;  5CVV A;  1B9N A;  3RDI A;  4O5V A;  4PGH A;  2GXB A;  3MCZ A;  3MFK A;  4KFC A;  4UV8 A;  1TBX A;  3O3K A;  1SD4 A;  1W7P A;  1QQI A;  5FD5 A;  3F8N A;  4E70 A;  4KN4 X;  1FYL A;  2CW0 F;  4G7Z F;  5BMZ A;  4BH9 A;  3U2R A;  2F5C A;  5D5U B;  3DFG A;  5D8L B;  3DPT A;  2HKX A;  3RYP A;  1QZZ A;  2O03 A;  3V4G A;  1O3R A;  2CV8 A;  4HX7 A;  3O6B B;  3SZP A;  4IRH A;  4CIC A;  1BI3 A;  3DNX A;  3CO7 C;  4KT5 C;  4CO8 A;  1FZP B;  1IF1 A;  3REO A;  4R8H A;  3H3U A;  1R0V A;  1ZRF A;  2P4W A;  2DBS A;  3FM5 A;  3WTU C;  1L3L A;  1SFU A;  2ZME B;  3GX4 X;  1EH6 A;  1FNN A;  2Z5U A;  3TQN A;  2BYV E;  5IT3 A;  2CGP A;  2DPU A;  2FOK A;  1DUX C;  1F5T A;  4KN7 X;  2X4H A;  2OST A;  4L0Z B;  4KNY A;  4MQ9 F;  1RUO A;  4M71 A;  4EV1 A;  3RTR A;  1ONV A;  2OZU A;  5HS8 A;  3KP2 A;  3U1D A;  1ULY A;  4K2E A;  4EJT A;  2VE8 A;  3E3V A;  1P4A A;  1HW5 A;  4I7H A;  5D5X B;  2VT2 A;  3QPH A;  2NRA C;  4A0Z A;  1B59 A;  1WSU A;  2XKP A;  5BS6 A;  4QBO A;  3B02 A;  1RI7 A;  4WWC A;  3WTX C;  1S7O A;  3BDD A;  1J0R A;  4RGS A;  3V7C A;  4ENJ A;  3I54 A;  4B09 A;  3G73 A;  1GEF A;  2FNP A;  3T0Y A;  2HR3 A;  4IF4 A;  5E20 A;  2RDP A;  1TQI A;  3NRV A;  3VB2 A;  1ZYR F;  3HRT A;  1R1T A;  2D1H A;  2ZO4 A;  1FY7 A;  4YG2 F;  4KYW A;  2MBF A;  5L3B A;  4JBA A;  1J75 A;  2FE3 A;  5HLH A;  1SFX A;  1R23 A;  3WTS C;  2VOP A;  2PMH A;  1QZY A;  2BH2 A;  1R7J A;  3FHZ A;  4UVA A;  5H6R A;  1OB9 A;  1YW9 A;  2L4A A;  2LF7 A;  3G3Z A;  4EQQ A;  4P55 A;  5DEQ A;  1KA8 A;  4RGX A;  1YG2 A;  4YFN F;  4RB0 A;  1YTY A;  5JFR A;  3T5X A;  1OKR A;  2D2W A;  3CO6 C;  3FX3 A;  3TOB A;  1T39 A;  4HQE A;  1V3F A;  4RB3 C;  3FM3 A;  2HEO A;  3TO9 A;  4G6V A;  2FF4 A;  5F6F A;  5JVT A;  4DQ2 A;  2IA2 A;  2WJ0 A;  2YX4 A;  1TTY A;  2L54 A;  3ZMZ A;  5DD8 A;  2FSW A;  4MTE A;  1S29 A;  1RIO H;  1ZRC A;  2H27 A;  1YO5 C;  3DQV C;  4OU0 A;  1G3W A;  3VOD A;  2VS1 A;  3KCC A;  4G94 A;  1RUN A;  4ENN A;  1G4D A;  5KK1 A;  5L3C A;  3FMS A;  4MNU A;  2HYG D;  5LRR A;  4LG0 A;  1XGN A;  4PZJ A;  5D4R A;  2DQL A;  3DPL C;  2MLG A;  5HDN A;  3KZZ A;  4UV9 A;  4RAY A;  3ECH A;  4OMZ A;  3HSR A;  3GFJ A;  3R0A A;  1J2X A;  2FXA A;  1LQ1 A;  3CUQ C;  1BN5 A;  2UXX A;  4LJZ F;  3W6J B;  1DDN A;  1HW1 A;  2MH2 A;  5FDK A;  2Y48 A;  1FWZ A;  5ICE A;  4IXA A;  1F9N A;  3DF8 A;  3GXO A;  2H09 A;  3HHH A;  4AD9 A;  3C7J A;  2P5V A;  3E97 A;  5A2Q Z;  1ZLK A;  1XDS A;  2P5K A;  4OIN F;  1U6G A;  2X0L A;  2DLL A;  4EJO A;  2DO7 A;  5FLX K;  4BHC A;  2VOD A;  1Q1H A;  5J8F A;  3K69 A;  1OYW A;  2GA2 A;  3RPU A;  2VON A;  3U9G A;  5E1Z B;  5EEG A;  5CVI A;  2YSR A;  4M72 A;  4U88 A;  4QWQ A;  3WG9 A;  2L02 A;  3ML6 A;  1EV7 A;  3LAP A;  1WRJ A;  5HDK A;  2W8M A;  1LNW A;  3L9F A;  2EV0 A;  4GYI A;  3P9I A;  1YIO A;  3F22 A;  4ZYD A;  3I59 A;  4OIQ F;  5FGM A;  4KIF A;  4KIG A;  2DU9 A;  5D4S A;  1T0F A;  5D8K B;  3JTH A;  1IN8 A;  3RKW A;  1UB9 A;  2PLY A;  1LJ9 A;  3WU1 B;  4EM1 A;  1U3E M;  1IZ1 A;  2INB A;  4PDK A;  1FYM A;  1F4K A;  4U0W A;  5E1W A;  2CWE A;  3ISP A;  3I0T A;  1Z6T A;  2L4M A;  2D45 A;  1IW7 F;  4WXD A;  2PQ8 A;  3ERE D;  3KP4 A;  1BIA A;  2CQK A;  4H0E A;  3HRS A;  2E7W A;  5J8C A;  3VEP A;  4BXU A;  5ICC A;  2Q2E A;  1FX7 A;  3SFZ A;  1RZN A;  4L9V A;  1IN6 A;  4LK1 F;  1G3T A;  1MD0 A;  4UHT A;  4EMS A;  4YIF A;  4L18 B;  4IPA A;  3VOE A;  5AIP A;  5K5O A;  3T1B A;  1IN7 A;  4EGZ A;  3O2P E;  2PJP A;  2ETH A;  1NHA A;  3C1D A;  2ZME A;  2VBX A;  5LHG A;  1Z6R A;  2RQP A;  4ESB A;  1XDU A;  4S05 A;  4MEX F;  2ZJ2 A;  4YFX F;  3E6B A;  5LGN A;  1XSD A;  2YX7 A;  4O6J A;  3L7W A;  1T38 A;  2W57 A;  1HXD A;  4M9X A;  4EJW A;  2BBY A;  1UST A;  1BI0 A;  2FCO A;  5HLG A;  4PCQ A;  1JGS A;  4P9F A;  5DCF A;  5LEJ A;  2XRO A;  3F21 A;  2A61 A;  2W84 A;  2Y0M A;  1ZG5 A;  2XV4 S;  5LRS A;  2PN6 A;  5BOX A;  1YQA A;  3E5U A;  5LHI A;  2VN2 A;  3I53 A;  4KUM A;  5ICF A;  2GW6 A;  4HZF A;  3RKX A;  4A6E A;  1J59 A;  1RLV A;  1FBS A;  3HUG A;  1FSE A;  2XVC A;  4CGZ A;  2DK8 A;  2GQQ A;  2CFX A;  2FML A;  5FLX Z;  3GZ6 A;  4QBL A;  3COA C;  2V79 A;  5LHH A;  3T8T A;  1J5Y A;  1HW2 A;  4HYE A;  1Z05 A;  3E6M A;  2EFO A;  2VT3 A;  4G9Y A;  2LDU A;  2R7D A;  2VLD A;  1A04 A;  2V1D A;  3K1N A;  2HS5 A;  1TW3 A;  1XCV A;  2FNA A;  5LEK A;  2FLC A;  2CSO A;  4HX8 A;  2NS0 A;  1C0W A;  1B1B A;  3M8F A;  5LLQ A;  1LB2 A;  1QO0 D;  4EGY A;  1IN5 A;  2DW4 A;  5L3E A;  1A79 A;  2QWW A;  1UCR A;  5ILS A;  1J7K A;  2XKO A;  1OR7 A;  2H6B A;  4ENK A;  2ZBK A;  5LGT A;  3MZH A;  2QQA A;  5E1X A;  3J81 K;  5AON A;  2PFB A;  3F23 A;  2FA5 A;  3QP6 A;  2P7V B;  2O6G E;  2IJL A;  2DTR A;  4NQW A;  2Z9O A;  3HHG A;  1UHW A;  4A12 A;  4HAM A;  3IKV A;  1YS7 A;  3B73 A;  5CLS A;  2QYO A;  4N9I A;  1HKQ A;  2V6C A;  2CO5 A;  1ON2 A;  2R3S A;  4CHU A;  1ON1 A;  3WE3 A;  3ELK A;  4L5J A;  3KZY A;  4I98 B;  3ZMU A;  1Z1D A;  2EWN A;  2XGX A;  4MGR A;  3E5Q A;  3D0S A;  2ZNZ A;  4KA4 A;  2M5W A;  4YII A;  4PGG A;  3E6C C;  2QQ9 A;  3MAJ A;  2DFI A;  3TO7 A;  5ERI A;  2HOE A;  2VC0 A;  3ZPL A;  1W5T A;  3IEY B;  3IC7 A;  3IHU A;  1B9M A;  4HLX A;  3R60 A;  2XRN A;  5DDG A;  2GIV A;  3KFW X;  3JSO A;  2J5O A;  5CVR A;  1Z7U A;  1ZN2 A;  1BI1 A;  3EYY A;  3E5X A;  1O7L A;  2JTV A;  4QLC U;  2A68 F;  2P6T A;  2DK5 A;  1K78 A;  3F8B A;  3JAM K;  1XGO A;  3WGI A;  2OKF A;  3WTY C;  1PUE E;  4GXO A;  3E6D A;  2ZYZ B;  2YU3 A;  3IRQ A;  4A5N A;  2Y75 A;  2KIM A;  2WC2 A;  2E7X A;  1TNS A;  4GGG A;  4ZZD A;  3WTW C;  1V4R A;  4M9Z A;  3HSE A;  1YYV A;  4A5M A;  1USS A;  2ACJ A;  4RGU A;  1YW7 A;  3FMQ A;  3HTS B;  3K1P A;  3NQO A;  4G6Q A;  2ISY A;  4N9H A;  3QU6 A;  2IW5 A;  1ODD A;  2FEZ A;  5JI6 A;  3TOA A;  4Z2Y A;  4BAY A;  4P9U A;  2J5P A;  1LVA A;  3FF5 A;  1IPI A;  4ENM A;  1KQ0 A;  4I0A A;  1P92 A;  4I09 A;  3S2W A;  1PP7 U;  2QBY B;  2EO0 A;  4Q47 A;  4XRF A;  4WK8 F;  1AOY A;  3F8M A;  4LD5 A;  1TLH B;  1IRF A;  2DAO A;  1XMX A;  1KQ8 A;  4KIB A;  4XSX F;  3AJV B;  1IRG A;  4FX0 A;  4HV6 A;  1D3Y A;  3GEZ A;  3R4K A;  3J81 Z;  1IAW A;  3KLN A;  2C6Y A;  4ON0 A;  4ESJ A;  1BJA A;  2XIG A;  3M7G A;  3MQ0 A;  3K0L A;  3TGN A;  4I02 A;  3BJA A;  4LLN A;  1MJB A;  1S6L A;  1KQ9 A;  1R11 A;  1OYY A;  2EFP A;  2RVC A;  4M9S A;  1KU3 A;  3FXQ A;  3GYH X;  3DEU A;  1R58 A;  5K5R A;  1ZLJ A;  1E2X A;  4FX4 A;  1EH7 A;  2EFQ A;  5K1Y A;  3SQN A;  3VFZ A;  3BT7 A;  4OIO F;  3GO5 A;  1IN4 A;  1GXQ A;  2LKP A;  2EJR A;  3Q9S A;  2JJQ A;  5D6F A;  3P9C A;  5FO5 A;  3CLO A;  2DPD A;  2UZK A;  3F72 A;  1K6O A;  3P1Y A;  3DP7 A;  3F3X A;  4ESF A;  1W7P D;  4A2U A;  1I1S A;  3LFK A;  2KJB A;  1ZP7 A;  5HS7 A;  2XAS A;  3ZMD A;  4CZZ A;  1UWV A;  1OYI A;  1H9T A;  1BM9 A;  2RV8 A;  4AVP A;  5E8G A;  1KU2 A;  4EVI A;  1FBU A;  2F5F A;  3RYR A;  1IXS B;  1XD7 A;  3H92 A;  3F8F A;  1Y0U A;  2ZXJ A;  2DI3 A;  2FKH B;  2IP2 A;  3HRM A;  1TQP A;  3RPQ A;  2K4J A;  4EJV A;  3R6S A;  2P8T A;  1FSH A;  2IA1 A;  1ZRD A;  2XAH A;  5BPI A;  5E17 F;  4R79 A;  5BPD A;  1BIB A;  4M73 A;  4RS8 A;  3ABT A;  2ISZ A;  5EEH A;  4CYD A;  5DUK A;  4DAP A;  3FMR A;  3ZMS A;  3CDH A;  5ILV A;  3BPV A;  4LLG F;  3I58 A;  5DCM B;  2KKO A;  3OOP A;  4ZYG A;  4LB6 B;  1WWX A;  2Z3Y A;  1MDM B;  5H20 A;  5JR3 A;  2UXN A;  2QM3 A;  4GO1 A;  4ZYH A;  3TDU C;  1SD5 A;  1BC8 C;  3KEQ A;  1DPU A;  5HOO A;  2RKH A;  1JHH A;  2WWY A;  1BOA A;  1YW8 A;  5FFX A;  1JXS A;  3I64 A;  1HH1 A;  1R22 A;  3HTU A;  2YR2 A;  2Z33 A;  3CUO A;  5HS9 A;  2F5E A;  4KMF A;  4NHJ A;  4OMY A;  3L2C A;  1R5H A;  1GHC A;  2VOO A;  3FOV A;  2QVO A;  2RGV A;  3HYI A;  2XHK A;  1TW2 A;  2A69 F;  3HOS A;  2FKC A;  4JQF A;  2ESH A;  2BE5 F;  4DNC A;  3FXU A;  1LDD A;  2KRF A;  1YLF A;  4ZYE A;  2JZY A;  4CXF A;  2F2E A;  3CUQ B;  2GA1 A;  2VBW A;  5D5W B;  4I01 A;  4L0Y B;  3F6O A;  3F8C A;  2DQR A;  4LGW A;  3I4P A;  2L01 A;  3QRF F;  2P6S A;  4G8X A;  5TJJ A;  4O3M A;  1KU9 A;  1HSJ A;  1LEA A;  1REP C;  5FB2 A;  1TNT A;  2ZKZ A;  2COM A;  3LWF A;  2IPQ X;  3ZMV A;  3K1M A;  1H9G A;  3JSP A;  2QQB A;  4E6Z A;  2OAZ A;  2STT A;  3GVA