1T0FA

Crystal structure of the tnsa/tnsc(504-555) complex
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
264
structure length
264
Chain Sequence
NSSFSEVQIARRIKEGRGQGHGKDYIPWLTVQEVPSSGRSHRIYSHKTGRVHHLLSDLELAVFLSLEWESSVLDIREQFPLLPSDTRQIAIDSGIKHPVIRGVDQVMSTDFLVDCKDGPFEQFAIQVKPAAALQDERTLEKLELERRYWQQKQIPWFIFTDKEINPVVKENIEWLYSVKTEEVSAELLAQLSPLAHILQEKGDENIINVCKQVDIAYDLELGKTLSEIRALTANGFIKFNIYKSFRANKCADLCISQVVNMEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Transposon Tn7 transposition protein tnsA
publication title The carboxy-terminal portion of TnsC activates the Tn7 transposase through a specific interaction with TnsA.
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08721 Tn7_Tnp_TnsA_C TnsA endonuclease C terminal
A PF08722 Tn7_Tnp_TnsA_N TnsA endonuclease N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t0fA02
3.40.1350.10 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 1t0fA01
3WTSC 2P5VA 4EQQA 1RUOA 4RB1A 4RGUA 5BOXA 1U6GA 3WGHA 5IT3A 2PJPA 2IA2A 2QBYA 2AXLA 1LVAA 1G3TA 1S29A 3F6OA 1KU2A 4IHSA 4NQWA 3VB2A 5L3GA 2XHKA 5HS8A 2IA1A 1ZREA 1GEFA 2XKPA 4HF1A 3I59B 3FMQA 4UV8A 1UCRA 1W7PB 2ZCWA 1EH6A 1PDNC 2DPUA 1F1ZA 4N9IA 1ZRDA 2F5EA 1HW1A 2RC4A 3K1PA 4PCQA 5H20A 3LFKA 4B8XA 4BHCA 1QO0D 3FX3A 1YLFA 4K2EA 1GXQA 2Q2EA 3GFJA 1DPUA 3CDHA 1FPQA 5ERIA 5LEKA 1TW2A 2FSWA 3DEUA 1O3QA 3JTGA 4GXOA 3ZQ7A 4WF2A 2OU2A 3QU6A 3H3ZA 1H0MA 3FWEA 4L5JA 1IN8A 1BIAA 2P4WA 3FOVA 4GO1A 1SD5A 1KU3A 4QBLA 3DPLC 4QWQA 2DAOA 3NQOA 3IRQA 1ZLJA 1SFEA 4P5OA 2RVCA 2COMA 2VXZA 4YG2F 3JAMK 3ZMDA 1T0FA 1OYWA 2WCZA 3RTRA 2CFXA 1IZ1A 4HZFA 1KQ0A 3E6CC 3M1EA 3R61A 2FU4A 2OZ6A 2ZMEB 2LDUA 3I58A 1OR7A 5HS9A 4A6DA 3ZMZA 1BM9A 4WXDA 3K1NA 3FMRA 5BPIA 2A6HF 1LDKB 1ODDA 3RIRA 5TJJA 1J9IA 1YW8A 2HFHA 2L54A 2Q0OA 3AJVB 2YR2A 1FX7A 5E20A 1V3FA 4L0ZB 2ZYZB 5IT9Z 4XLPF 2H94A 4RB2C 5LGTA 4KA4A 3BPXA 2EFNA 4A0ZA 4IF4A 3CUQA 4N9HA 3K1MA 3IWZA 1IXSB 2RNJA 5DUIA 2DQLA 5DV5A 1BC7C 2FF4A 5ED4A 3P1YA 3KP7A 2FMYA 5K5QA 3L09A 2ZBKA 4XRFA 5LBQA 4I98B 2RGVA 3J81Z 3HYIA 4RGRA 2YU3A 1MDMA 4KT5C 1S7OA 1FWZA 3FXQA 3GO5A 3GXOA 1MKMA 2NAZA 1J2XA 3ROUA 2GA2A 5DDGA 2P6SA 3VOEA 2ELHA 2FNAA 3P1ZB 2D2WA 3CTAA 4IRGA 2R7DA 5FFZA 4A0YA 4S04A 4TV7A 1J75A 5K1YA 3WTTC 4LK1F 1U2WA 4BHPA 4OOIA 2BV6A 2O3FA 1RZNA 1MGTA 2L4MA 2VE8A 4GGGA 5D5UB 2PG4A 1I6XA 4ESBA 4EJTA 3LAPA 4I0AA 4U0VA 4G94A 1EV7A 3I59A 3ZMTA 5J8CA 2W24A 5L3BA 1W7PA 2PMUA 2EFOA 2KJBA 3BWGA 1R58A 4KIBA 2XAJA 2VBYA 1T38A 2GZWA 4HLYA 2GXBA 3ZMUA 4LLNA 1R1UA 1HH1A 2XASA 3EYYA 3HRSA 1Z6RA 4G7ZF 3MZHA 5CVVA 3GEZA 3HOTA 4M6XA 4R1HA 1ZP7A 3JSOA 5FD5A 4A0XA 1BN5A 3DP7A 4G9YA 3D0SA 5ICEA 2Z9OA 2QENA 2VE9A 1YS6A 1TQIA 2K86A 5FD6A 4KN4X 1R23A 4KDPA 2DPDA 2X0LA 1I1SA 2ZXJA 2JSCA 2EA4A 5L3FA 4H0EA 2HWVA 5LHHA 1YIOA 5D8KB 5H6QA 3FXUA 4ENJA 5BMZA 3B73A 4RS8A 1SMYF 2EV6A 2YX4A 3GFLA 2BGCA 2J5PA 2O03A 3G73A 2ZMEA 4E70A 2K4BA 2BEOA 1R22A 5LGUA 5A2QK 1Z91A 3E6MA 3LAJA 4YFNF 2G9WA 2W25A 4UVBA 3ML6A 1K78B 1F9NA 3AJVA 5LHIA 3V7CA 1HQCA 3G3ZA 4HV6A 2VN2A 1R7JA 1SD6A 1A04A 2GWRA 2MH9A 5LEJA 1Y1OA 3JTHA 5KVRA 1R5HA 3MQ0A 4N0BA 2RDPA 4MQ9F 2GQQA 1YG2A 4LLLA 5D5WB 2QWWA 2CSOA 4ESJA 2GW6A 1W4MA 3GZ6A 1LQ1A 1B1BA 2OAZA 3LQRA 1FBQA 2M1BA 4KUMA 3U2RA 4ZZDA 1FZPB 3ZMSA 3KFWX 2IA0A 5KK1A 3QRFF 1XCVA 3BOQA 3HRTA 5BQTA 1YYVA 3GVAA 5ICFA 3N97A 3MAJA 3GLXA 4MNUA 2VODA 2QQBA 3E6BA 4ZYDA 4RAYA 3L2CA 3D5LA 3MCZA 1Z7UA 2OKFA 3R60A 4LJZF 4CHUA 3BROA 1OMIA 2YX7A 3ECOA 1QBJA 3ABTA 1O3RA 1AOYA 1XCBA 3C18A 1ZARA 5JVTA 4HLXA 2H6BA 4G8XA 2MBFA 5D6EA 3TDZC 2PQ8A 3DXJF 3RYRA 2VT2A 2CWEA 5LGNA 2RQPA 3GZ5A 1G4DA 2Z99A 2EFPA 3KP5A 3I0TA 3LWFA 2LKPA 3V8JA 1ZLKA 4HX4A 4ZZLA 1ZRCA 4HOBA 3LA7A 4M9ZA 2WIZA 3NRVA 4L0YB 1UB9A 3IC7A 2O8XA 3OOPA 1ZAOA 2V1UA 5HVQC 5JFRA 4LFUA 5D8LB 1XD7A 1W5TA 1SAXA 2W57A 3KZYA 1EH7A 3WGIA 1HKTA 4U88A 1U78A 3J80K 2DT5A 3I71A 3RKYA 2HDCA 4XSZF 1JGSA 2G7HA 3WG9A 1USTA 3KETA 2XV4S 2EV5A 1G3SA 1R00A 5LRRA 4BHBA 3BDDA 2EA2A 3MZYA 1B4AA 4Z2YA 3V7SA 3T8TA 4WXCA 2ISYA 4M6YA 1YW7A 3R4KA 1KU7A 2JPCA 4UVCA 1HXDA 1WWXA 2LSOA 3NEUA 4HW0A 3BPVA 1FBUA 1UHMA 2KIMA 1MZBA 1FYLA 5CJ9A 4G7HF 5BPDA 4BAYA 1QNTA 2O0YA 2Y48A 1QZZA 1K78A 1R36A 3I64A 2P8TA 2PLYA 1BBYA 4Q47A 3RYPA 3GX4X 3ECHA 3E3VA 4AIHA 3L9FA 2CG4A 3HIFA 2XVCA 4HA8A 1F5TA 3LA3A 5ILUA 2MA3A 2V6CA 2EFWA 3QP6A 4F7ZA 1S7AA 1BI3A 1IUYA 1BC8C 2WJ0A 1LDDA 3MEXA 1XDSA 4TKKA 1FP2A 4WCGA 3P9CA 1K6OA 3BJOA 4UHTA 2YSRA 5JHUA 3CJNA 4ESFA 3ABUA 2HTSA 4S05A 2XAFA 5F64A 2EK5A 1OYYA 2FBHA 4CXFA 4IVNA 1T39A 2D1VA 2KKOA 3RJPA 2VBWA 3T0YA 4EVIA 5FO5A 3HUGA 4FHTA 1VTNC 3F23A 4Y17A 5CVRA 2GJWA 1JHFA 3SZTA 2PFBA 2BYVE 4EV0A 2FBKA 3AAFA 2HTJA 2KJCA 3LSTA 1T6SA 4L9TA 2DK8A 3HHHA 1O57A 5F1RA 3GWZA 2W84A 4M73A 4RB0A 3I4PA 4EM2A 2XIGA 3RPQA 3RDIA 4U7BA 3WTVC 1G6NA 1Z1DA 3WU1B 4I7HA 1KGSA 1O7FA 4LD5A 1ZHFA 2L4AA 2A68F 1EH8A 1XDUA 2XROA 1FBSA 2EJRA 3L00A 4LMYA 2FXAA 2Z33A 4IXAA 2HZTA 4EGZA 4AVPA 1PP8F 2M30A 2UWMA 2HGCA 1B59A 3LQQA 3F8MA 4IJAA 2H09A 4I0BA 1T2KA 4KICA 2GA1A 3JAMZ 3ZMVA 4EM0B 3P7NA 2VC0A 4OU0A 1FOKA 5J6XA 2VONA 5F6FA 1OYIA 3GUDA 3HTSB 3QAHA 1X3UA 1L0OC 1WQ2A 2Z3YA 2IP2A 4M72A 5FFXA 1J59A 4JBAA 3IEYA 4I02A 4MQVA 4OIOF 2IT0A 1BJAA 3C3WA 3IKTA 4AIJA 3CUOA 1JXSA 1SD4A 2MLGA 2C6YA 1H9GA 2LF8A 1U8RA 1HKSA 4DQ2A 4I01A 3O3KA 4WXHA 1J0RA 5FLXZ 2DBBA 4AIKA 4KNYA 5HDKA 3R6SA 5ICGA 4O6JA 3T1BA 4IRIA 3K2ZA 4P9FA 3BJAA 3FM3A 4M9XA 5E8GA 3F8BA 5DD4A 3VFZA 4P96A 5HOOA 1D3YA 4UXNA 2KIFA 3E5XA 1ZG3A 2XAGA 2EB7A 1USSA 1P6RA 3E6DA 5DCMB 4HF2A 2QUFA 2OSTA 1ON1A 1WI9A 2V9VA 4RGXA 3HSRA 2WIWA 2KIUA 2E1NA 4BXUA 1IN6A 2VOPA 5AIPA 4MTEA 3HSFA 2STWA 3QP5A 1T98A 1IN5A 1OPCA 1QZYA 4CGZA 3N4MA 3FF5A 4MTDA 3P9IA 2FBIA 5JR3A 5E18F 3ZN1A 4LB5A 2MH2A 2X4HA 3F6VA 2M45A 2FMLA 4U0YA 4BQAA 1SFUA 1I5ZA 2A6EF 3KCCA 1DP7P 2XUBA 4LK0F 1A79A 3F8FA 4HAMA 4Y13A 3IRRA 3M8FA 4ENKA 2R7FA 3FMSA 2O61A 1REPC 4MGRA 3TO7A 4P9UA 1YO5C 3KE2A 1RIOH 2HYGD 1DPRA 5FB2A 3QPTA 1WSUA 4HYEA 4R8HA 1B6AA 3KP3A 3IL2A 4KIGA 1ZRFA 2V79A 2QZ8A 5EEHA 2QLZA 3MFKA 2NRAC 6PAXA 1YFHA 5K5OA 1RLVA 1QQIA 1PUEE 1LNWA 4EJUA 1MJ9A 3SXYA 3O6BB 4TKDA 3COAC 5HDGA 1SFXA 2A3SA 5HLIA 1E2XA 5LRSA 2YPRA 1IN7A 3WE3A 3H3UA 3ULQB 2PMHA 2PEXA 2R3SA 3SHFA 4YIIA 1OB9A 1FYKA 5HS7A 1U5TB 2UXXA 2OZUA 5D5VB 2E7XA 1IN4A 3M8EA 3IWFA 2EO0A 1TW3A 1ZN2A 1S6LA 2BE5F 1O7LA 2J5OA 4LB6B 1B9NA 4HQEA 1P4WA 3OV8A 3EETA 2DTRA 1KU9A 1CGPA 5D6FA 2XAHA 4EGYA 3HSEA 2A07F 2FCOA 3SQNA 1IXRC 2CQKA 2TDXA 1YS7A 4M9SA 1HKQA 3I53A 2B0LA 4CDGA 1H9TA 1TQMA 2D45A 1O3TA 2HKXA 2IRFG 5A2QZ 3TOBA 4HX8A 3KP2A 1R5GA 1WRJA 4I2OA 4GCVA 1XMKA 4L9NA 1SMTA 2DFIA 1O3SA 4KMFA 1S3JA 2H27A 3IKVA 3DV8A 2ETHA 5AIQA 5AONA 3T8RA 3F21A 1Y88A 5CLSA 1SD7A 1STZA 1G3YA 1L3LA 3EDPA 2HR3A 2D1HA 1XB4A 2QYOA 3KP4A 1HSTA 3GYHX 5DCMA 2OD5A 2NS0A 1KA8A 2A5YB 5ILVA 2OA4A 3RKWA 4BH9A 2LF7A 5D5XB 2CW0F 4RGSA 4D0PA 4A12A 4KIFA 3P9KA 3WE2A 2OQRA 5D4SA 1IF1A 2HEOA 4O5VA 2K4JA 4NHJA 1FSHA 2NYXA 3KZZA 2WC2A 3DNXA 4OINF 2JPBA 2GIVA 2FE3A 1ONVA 2BBYA 3QOPA 2A69F 3ERED 2FQ3A 4EJVA 5J8FA 3O2PE 3VEPA 2OQGA 3WTWC 3HRUA 5ILSA 3GF2A 2ADUA 1DDNA 4G6DA 1WKMA 2HOEA 3CO7C 5DUKA 5DYMA 2XAQA 3TO9A 4L9JA 4JK1X 3VODA 3KEOA 1QPMA 1ZH5A 4KN7X 2A61A 1P92A 2ESHA 1XGSA 1W7PD 2VOOA 5E17F 2FOKA 1LB2A 5L3CA 1V4RA 4HQMA 5CVIA 4OMZA 3FM5A 4ENNA 3KLNA 4ENMA 2M5WA 1XSXA 1HSJA 5K5RA 5E1XA 3RI4A 3HOSA 1LEAA 1RI7A 3J80Z 2K27A 1U5TA 1J7KA 2F5CA 3JSPA 2QQAA 4HDVA 1QGPA 1ZG5A 3FZVA 3TKYA 1YQAA 5LLQA 4WK8F 5CVUA 1D5VA 3WODF 3K9TA 5LHGA 2EV0A 2MC3A 3V8LA 3T5XA 5HDNA 4MEYF 1FNNA 3M7GA 3M9AA 4U0WA 2Q8KA 2M8EA 1Z9CA 3WTUC 4M74A 3ISPA 1ZG1A 3L7WA 2RV8A 4CICA 3FHZA 2HQNA 3J7AO 2FRHA 4B09A 2VT3A 3K0LA 2H6CA 2Z5UA 5CVJA 2V1XA 4OMYA 4A2UA 5EEGA 4PGGA 5H6RA 5IT9K 2JZYA 1D8KA 5DD8A 4I09A 3DQVC 1NHAA 4EJOA 2Y75A 4AD9A 1UFMA 2NNYA 3TDUC 1AWCA 3R0AA 5FDKA 1XSDA 3U9GA 2IJLA 2UZKA 4JQFA 4KMUX 3PFIA 1D8JA 3WGGA 4FX0A 3WTYC 2WV0A 5E8IA 3F72A 3J81K 2HYFA 1XGOA 1FY7A 2EFQA 3RPUA 2JRTA 4AWXB 1DUXC 1P2FA 3W6KB 3KEQA 1S8NA 2MD5A 4L5IA 1R1TA 2QVOA 1IXCA 4U7DA 1ZGAA 2M87A 4QLCU 4ON0A 2IW5A 2ZNZA 2CYYA 3E5UA 3I54A 2VLDA 3ZN0A 4O3MA 5ICCA 3E5QA 3EUHA 4OIQF 3CLOA 1GXPA 4Q4ZF 1YTYA 4PZJA 1OB8A 3GFMA 4OIRF 2ZFWA 2EWNA 3CO6C 5FLXK 1B9MA 3R0JA 2F5DA 4ZH4F 5DCFA 4GYGA 3ZPLA 4BNCA 3F22A 2VBXA 4YFXF 1KYWA 1GVJA 4A6EA 3F8CA 4IRHA 3MWMA 1YW9A 4LLGF 3WU0A 1TBXA 4DNCA 2DW4A 2PI0A 1FLIA 3DF8A 3TGNA 2V1DA 3GFIA 2IVMA 5HLGA 4OIPF 2DLLA 4CZZA 1R11A 1FP1D 2HS5A 3BP8A 4YFKF 1FC3A 1G3WA 4UVAA 4XBFA 1BI2A 1Z6TA 2MLKA 2GAUA 2W85A 5D4RA 1JE8A 2UXNA 1RNLA 3C1DA 4M71A 2LNBA 2CO5A 1JHHA 1XGMA 3FXRA 3WTXC 1FYMA 1GHCA 1BI0A 4IPAA 1LJ9A 2QQ9A 1TNSA 4ZYGA 1TTYA 1I27A 4HV5A 1IRFA 4LG0B 2ZO4A 1TNTA 4Q48A 2O6GE 4P55A 2JTVA 1K79A 3JW4A 5DEQA 4RAZA 1F4KA 1MJBA 1ULYA 2ZNYA 1XMXA 4QBNA 3F8NA 3QPHA 3HTUA 5FGMA 3E97A 4HBLA 2FNPA 1E17A 1BIBA 2CGPA 2DI3A 1U3EM 2E7WA 5HLHA 3TQNA 1ZYRF 2PBIA 1CF7B 4XSXF 3IHUA 5L3EA 1I1GA 2STTA 5E1ZB 1XMAA 1ZGJA 4KFCA 1R1VA 1MD0A 3U1DA 3V8KA 2ISZA 3ELKA 1XSVA 4R79A 1OKRA 3HRMA 2QM3A 4UUVA 1KYZA 1KQ8A 4HF0A 2DU9A 1BI1A 4UV9A 1ON2A 3WTZA 1HBXG 1U5TC 2QBYB 1TQPA 2ZYZA 2OBPA 3HHGA 4EM1A 2GXGA 3DPTA 2VBZA 4FT8A 2DK5A 1Q1HA 2P5KA 1W5SA 2WTEA 1IAWA 2KRFA 1Y0UA 2JT1A 1HW5A 4FX4A 5JI6A 4ZYEA 4ZYHA 1K7AA 2XRNA 2DQRA 4G7OF 1P4XA 4QBOA 3REOA 2L02A 2P6TA 3ZP5A 4HDUA 1MJAA 3PQJA 4MHGA 3BJ6A 3QU3A 1PP7U 4A5NA 4PDKA 4CYDA 4A5MA 2ZKZA 3DFGA 3PQKA 1HW2A 2VC1A 3K69A 3P1ZA 3F3XA 1LEBA 3GW2A 2XKOA 2F5FA 2AS5F 2INBA 3KP6A 3TOAA 4KYWA 4GYIA 4CO8A 1RUNA 3EQLF 5E1WA 2DO7A 2WWYA 4L18B 4XLNF 2ACJA 1XGNA 1FT9A 3I5UA 4RB3C 4EMSA 3TO6A 2RKHA 2P7VB 4LGWA 1R0VA 3DKWA 2G7UA 4EJWA 2PN6A 5BS6A 1J5YA 1XN7A 4BYYA 3S2WA 3B02A 3SFZA 4IHTA 1LDJA 2F2EA 3Q5FA 3EYIA 4ETSA 1IW7F 2RN7A 4LG0A 2FEZA 2HQRA 1IRGA 2WCWA 1IPIA 4Q5SF 2K7LA 3H92A 4YIFA 1FSEA 1UHWA 2ZJ2A 2E1CA 2Y0MA 2L3DA 3KLOA 4UNOA 2NNNA 4PGHA 5TRDA 2P7CB 1C0WA 3W6JB 3Q9SA 2HKOA 3BY6A 1BOAA 2FA5A 2CV8A 3CUQB 3LA2A 4G6QA 4HX7A 3V4GA 1P4AA 2IPQX 3RKXA 3C7JA 1CF7A 1TLHB 3CUQC 2P5LC 3SZPA 4Y15A 5CYVA 4WX9A 3V7RA 4WWCA 1MDMB 5L3DA 1RZ4A 2XGXA 3Q9VA 4NB5A 4MEXF 2ESNA 1KQ9A 4L9VA 2K02A 4ASNA 1Z05A 2L01A 3BZ6A
chains in the Genus database with same CATH superfamily
1X2NA 3PO3J 2N8GA 2XF5A 3ZQQA 3WTSC 3VPRA 2P5VA 1K4TA 1Y1VJ 3OMYA 4EQQA 2VI6A 5K7ZA 1RUOA 4RB1A 2BW3B 2XPWA 4RGUA 2M7BA 4M3GA 4XLFA 3BCAA 4LIVA 5BOXA 3RKQA 1FMVA 1U6GA 3WGHA 2MABA 5IT3A 2LBFB 2PJPA 3FXKA 1G2HA 2IA2A 2QBYA 2HXIA 2AXLA 1LVAA 2HNHA 1G3TA 1S29A 2CUEA 5IP6A 2ZXHA 3VDXA 3HOZJ 3F6OA 5J1UA 3BG3A 1MBHA 1KU2A 4IHSA 3HG9A 4NQWA 3VB2A 5L3GA 2XHKA 5HS8A 2IA1A 1BL0A 1ZREA 4FTHA 4G12A 2W82A 3G1MA 1GEFA 3A1YA 4ZDLA 2XKPA 4HF1A 1T95A 3I59B 3HB9A 3FMQA 3E1SA 4A3MJ 4UV8A 1UCRA 5M3FJ 1W7PB 2ZCWA 1EH6A 1VF9A 3CC2I 2ELKA 1PDNC 4B47A 2DPUA 3HBLA 1ERDA 1R71A 4A3CJ 1F1ZA 4N9IA 3MD2A 1ZRDA 2F5EA 1HW1A 2RC4A 3K1PA 4PCQA 5H20A 1IV8A 2DOAA 4C2TA 3LFKA 3ABLH 4B8XA 4BHCA 3GTMJ 5K7HA 4PJLA 1QO0D 3FX3A 1PJRA 1UG2A 1YLFA 3JRBA 2MC4A 2HOTA 4K2EA 4XKCA 1GXQA 1MW7A 2Q2EA 2LOOA 1NTCA 3GFJA 1N25A 1DPUA 3C2GA 4I99C 3CDHA 3HOWJ 3KYLA 4XICA 3S1RJ 1LKXA 1FPQA 5ERIA 5LEKA 2AQEA 1TW2A 2FSWA 3DEUA 1O3QA 3JTGA 4HNUA 4XN0A 4GXOA 3ZQ7A 4WF2A 1D0YA 2OU2A 2GLOA 3QU6A 1MBFA 3C2HA 2XB5A 3GTOJ 1WJEA 3H3ZA 4J19A 2Y0SN 1H0MA 2G0EA 3FWEA 2BHYA 4L5JA 1IN8A 2IGOA 1HOMA 1WH5A 4D7MA 1BIAA 1K83J 5HNHA 3O8GA 5B3SH 2P4WA 3FOVA 4GO1A 1SD5A 1KU3A 1Y56A 4QBLA 3H9JA 3DPLC 2UV1A 4QWQA 2DAOA 4B48A 4PJMA 3DBRB 2KHMA 3NQOA 2IEKA 4HNVA 1ZLJA 5M3MJ 3IRQA 1SFEA 4P5OA 2BXYA 2RVCA 2COMA 2VXZA 4YG2F 1AU7A 3JAMK 2FUG2 3ZMDA 1LE8B 1S5LC 1T0FA 1J09A 3OYAA 5C44J 1OYWA 2WCZA 2CFOA 3RTRA 2CFXA 1IZ1A 4PSXA 4HZFA 2P81A 3QYFA 1KQ0A 3E6CC 3M1EA 4YEJA 1FOXA 3HKZN 3R61A 2DA1A 2FU4A 2OZ6A 3HZJA 2ZMEB 2LDUA 4JX5A 5F04A 1JTXA 2OCEA 1OR7A 3I58A 5HS9A 1MMDA 4YIRX 2LD5A 4A6DA 3ZMZA 2R7ZJ 1JI8A 1BM9A 1OCPA 4WXDA 3K1NA 1GLNA 3FMRA 1ZTRA 5BPIA 1I6HJ 2OV7A 2A6HF 1LDKB 1ODDA 3RIRA 5TJJA 1J9IA 4XOTA 3KZIC 1UAAA 1YW8A 2HFHA 2L54A 2M2EA 4OAYA 3OOUA 3SDBA 5F0FA 2Q0OA 2DN0A 2YR2A 3AJVB 1FX7A 2JA6J 2CU7A 1QU3A 3BZCA 5E20A 3SFIA 3GTPJ 3WU2C 5FJ8J 1V3FA 4L0ZB 2ZYZB 2IXSA 5IT9Z 4XLPF 2XRLA 2H94A 4BS9A 1MNEA 3HOXJ 2WAQA 4RB2C 4CSWA 2KRHA 5LGTA 3CD6I 2KLOA 2KT0A 1WPKA 4KA4A 3GBGA 3BPXA 4AC0A 2EFNA 2JVGA 1N75A 1APLC 3PNYA 4A0ZA 3MZ8A 4IF4A 4LIUA 3CUQA 3ABMH 4N9HA 3K1MA 3FIWA 3IWZA 2X1CA 1IXSB 2RNJA 5DUIA 2DQLA 1ACIA 5DV5A 1BC7C 3I4NJ 2FF4A 5ED4A 3P1YA 3KP7A 4RA2A 2FMYA 5K5QA 4QPOA 3L09A 2KZVA 3VWBA 2ZBKA 4XRFA 2RQQA 2YS9A 5LBQA 4I98B 3CCEI 1K6YA 2RGVA 3J81Z 1WJ5A 3HYIA 2YU3A 4RGRA 1MDMA 1D5YA 4KT5C 3KEYA 1S7OA 1FWZA 3FXQA 3GO5A 2JK3A 5FKNA 3GXOA 1MKMA 5E3OA 2KQRA 2NAZA 1J2XA 3ROUA 2GA2A 3JRFA 5DDGA 2P6SA 3HOUJ 3VOEA 4MIMA 2FQ4A 2ELHA 4LG3A 1WHUA 1A5JA 2FNAA 4UUSA 3P1ZB 2D2WA 3AG3H 3CTAA 4IRGA 2EQRA 2XB0X 2CQ7A 1RKWA 2R7DA 2XPUA 5FFZA 4A0YA 3TW7A 4S04A 4TV7A 5IOZA 1J75A 1ETXA 4C3JJ 2ICWG 5K1YA 3WTTC 1T56A 2BXZA 4LK1F 1U2WA 2BW3A 2FLCA 4RMNA 1A35A 4BHPA 2K9MA 4OOIA 2LBFA 5J40A 2BV6A 1X4PA 2O3FA 3CP2A 1RZNA 1MGTA 1SEUA 2L4MA 2VE8A 4GGGA 5D5UB 2K9LA 3NWTA 4EATA 4J00A 2PG4A 1I6XA 5FKOA 4ESBA 1EJ9A 4EJTA 4CCOA 2OTLI 3LAPA 4FE4A 4ANJA 2E1MB 4XKBA 2DDBA 4A93J 2AO9A 1W1WE 4I0AA 1Y39A 4U0VA 3OS2A 4G94A 1EV7A 3I59A 3ZMTA 5J8CA 1IGNA 2W24A 5L3BA 1W7PA 4B44A 3LNQA 2PMUA 2ZC2A 3P5JA 1OCTC 2EFOA 2KJBA 3BWGA 5F1JA 5M5WJ 1R58A 1TC3C 4KIBA 5EG0B 3CZ6A 2XAJA 2PJRB 2VBYA 3OYLA 2DOFA 1T38A 2GZWA 3H9QA 5JLXA 4HLYA 2GXBA 3ZMUA 2QSGX 4LLNA 1R1UA 1HH1A 2XASA 3EYYA 4BL0B 3HRSA 1H89C 1Z6RA 2E36A 4G7ZF 3MZHA 4DYQA 1XTAA 4MO7A 5CVVA 3GEZA 1HA8A 3HOTA 3S3OA 4X1EA 3LSIA 4DAPA 3OL4A 4M6XA 3MKWB 3Q0VA 4R1HA 1ZP7A 3W6VA 3JSOA 5FD5A 4A0XA 4AM3A 4ZTFA 3K4JA 4FE7A 1BN5A 3DP7A 4G9YA 3SJMA 3H5AA 1RKTA 3H1CA 3D0SA 5ICEA 3ZQHA 2QENA 2VE9A 2Z9OA 3ERMA 2VKVA 1YS6A 4FETA 4ZTJA 1TQIA 2K86A 5FD6A 3QWLA 4KN4X 4BQOA 2EZKA 3CQZJ 4E7JA 1R23A 1F36A 4KDPA 3BQZA 4BBSJ 5EF6A 4U87A 3A0BC 2DPDA 3CJQB 2X0LA 1I1SA 2V9PA 2ZXJA 2NXNB 3QYEA 2JSCA 2EA4A 5L3FA 4H0EA 2BOLA 2CUFA 2HWVA 5LHHA 2AHQA 1YIOA 5D8KB 4D5CA 3H5NA 5H6QA 3FXUA 1LE8A 4ENJA 5BMZA 3B73A 4RS8A 1SMYF 2TRTA 1IV6A 2EV6A 2OPTA 2YX4A 3GFLA 2BGCA 2J5PA 2O03A 1R4NB 4BDYA 5GP9A 3G73A 1Z7LA 2ZMEA 4E70A 2K4BA 2V6EA 2BEOA 1OISA 3QPSA 2HQAA 1R22A 3PO2J 5LGUA 3GTQJ 5A2QK 2Z1DA 1Z91A 3E6MA 2W00A 3LAJA 4YFNF 2G9WA 2W25A 4UVBA 3ML6A 2JVHA 1K78B 3FK6A 2V1NA 1F9NA 4W97A 3AJVA 5LHIA 3DTIA 3V7CA 1HQCA 2DJNA 3G3ZA 4HV6A 2VN2A 2DFEA 3S17J 1R7JA 1SD6A 1ORKA 1A04A 5C4XJ 2GWRA 2MH9A 5LEJA 1Y1OA 3JTHA 4YRVA 5KVRA 1R5HA 3H35A 3MQ0A 4N0BA 2RDPA 4MQ9F 2WB1N 4XLAA 1YJWI 2GQQA 1QVUA 2WAFA 3JRGA 1YG2A 4AUXA 3HPHA 1JKOC 1VQLI 4LLLA 4CA0A 5D5WB 2H1LA 3BR5A 2QWWA 2LY1A 2CSOA 4ESJA 5TISC 2GW6A 3BG5A 1W4MA 4C30A 3GZ6A 1LQ1A 2HU9A 1B1BA 2OAZA 3LQRA 1X1PA 4NUBA 3HL2A 1FBQA 2M1BA 4FISA 2JJQA 4KUMA 3U2RA 2EZIA 4ZZDA 3DTEA 3K10A 2HOSA 1MBJA 2WBMA 1FZPB 3ZMSA 4F91B 3KFWX 2IA0A 5KK1A 4A3FJ 3K4KA 1XCVA 3QRFF 3GTGJ 1MMAA 3BOQA 3HRTA 5BQTA 1TZLA 1YYVA 1X1DA 5EZHA 1B72B 1P7IA 3GVAA 3OIQA 5EEAA 5ICFA 3S8PA 3N97A 3MAJA 3RPUD 3GLXA 4MNUA 2CZRA 3A03A 2VODA 2QQBA 3E6BA 1P7JA 1GV2A 4ZYDA 4RAGA 2L9SA 4ZYAA 4RAYA 3L2CA 4PUSA 3D5LA 2AXTC 3MCZA 1Z7UA 2HZDA 3OYHA 3R60A 2OKFA 2IS4A 4XR6A 2COBA 4LJZF 3BR0A 4CZCA 2HOAA 2Z2SB 4XMYA 4CHUA 2VQLA 3BROA 3DEEA 1OMIA 2YX7A 4BQNA 3ECOA 3M1CA 1QBJA 3ABTA 1O3RA 1AOYA 1XCBA 4EEFG 1HCRA 5GPAA 3C18A 1ZARA 5JVTA 4HLXA 1MNMC 3HUGB 1YX3A 1JTYA 3BTJA 2H6BA 4G8XA 2M8GX 2IGNA 2MBFA 5D6EA 2BZTA 3TDZC 2PQ8A 4XKWA 2TCTA 4CCKA 3DXJF 3RYRA 2VS1A 2VT2A 4W1UA 2CWEA 1YJ9I 5LGNA 1IDYA 2RQPA 3GZ5A 4IO9F 1G4DA 2E2IJ 4Y52J 2Z99A 4NNJA 1ZR2A 2EFPA 1E3HA 1T0FC 3KP5A 1JJ6C 1NK2P 3I0TA 2DMUA 3LWFA 1IDZA 1MMNA 2LKPA 3ZCOA 4G6UA 3V8JA 4XLEA 1QA6A 3FBIB 3O8HA 1ZLKA 4HX4A 3CCYA 1RESA 2IAIA 4ZZLA 1ZRCA 2JA2A 4HOBA 4BJ6C 2DBSA 2K9NA 3LA7A 4M9ZA 2WIZA 5EG0A 3NRVA 2PJRA 4L0YB 1IUFA 1UB9A 1ZK8A 3IC7A 2KPMA 2O8XA 1U0JA 4DYRA 1MH4A 3OOPA 1BR1A 1ZAOA 2ID3A 2V1UA 3D5RC 3H5RA 1YRNB 1HDPA 5HVQC 5FRMA 3PNVA 5JFRA 2H1KA 4PJ0C 1R5ID 4LFUA 4XQFA 3BC8A 5C4JJ 5D8LB 2DA2A 3EUKL 5HNFA 1XD7A 1W5TA 5CPRB 1SAXA 2W57A 3KZYA 3BG7A 1EH7A 3WGIA 1HKTA 1RPWA 2LKXA 4AYBA 4U88A 1U78A 4A69C 3PSIA 3J80K 2DT5A 3BZKA 3I71A 3RKYA 3K4CA 2HDCA 3A0HC 2M0MA 3LSMA 4XSZF 3OY9A 1JGSA 2G7HA 2Y30A 3WG9A 2FKHB 1USTA 3KETA 3G6EI 1KONA 1BR2A 2XV4S 3HC7A 2OJED 2EV5A 2DA7A 1G3SA 1XS9A 3TP3A 3HPGA 2NOGA 5FKKA 3CLQA 4XK4A 3DLAA 4IQJA 1R00A 2R7WA 5LRRA 3G1LA 4BHBA 2R7UA 3BDDA 2EA2A 3OSGA 1WJAA 3MZYA 1ETQA 2I5UA 1B4AA 2HPIA 4Z2YA 3V7SA 4C2MJ 3T8TA 4WXCA 2ISYA 4M6YA 1I3QJ 1YW7A 1UMQA 3R4KA 1KU7A 2VKEA 4IL6C 2JPCA 3PJRA 4UVCA 2EINH 2RNGA 2LYCA 3OR2C 2QKMB 4CYCB 1HXDA 1WWXA 2LSOA 3NEUA 4HW0A 3U1KA 1BR4A 3BPVA 3IEYB 1FBUA 1UHMA 2JRMA 5EYRA 2KIMA 3OR1C 1MZBA 1FYLA 4ZJZA 1HLVA 4NC7A 5CJ9A 4G7HF 5BPDA 4XOPA 2QEXI 3U21A 4BAYA 3K7AJ 3MVPA 2DT7B 3W2VA 1QNTA 2O0YA 2Y48A 1QZZA 1K78A 1PYVA 1R36A 3I64A 2P8TA 2X1EA 2PLYA 1BBYA 3G71I 4Q47A 3RYPA 3GX4X 3ECHA 3E3VA 5KAFC 2B9SA 4AIHA 2ZSIB 3L9FA 2CV2A 3CCVI 2CG4A 3H9GA 1ITYA 3HIFA 1XX5A 1X1AA 4E7KA 1SFOJ 2XVCA 4HA8A 2VKHA 3OYIA 3WHCA 1F5TA 2QSHX 3LA3A 5ILUA 4UY8I 2KRCA 2MA3A 2JA7J 2V6CA 4JX6A 1V5GA 2E5NA 2EFWA 2WV1A 1I39A 1Q1VA 3GZNB 3CMYA 4DBRA 3QP6A 4F7ZA 1X1BA 1S7AA 1SVOA 4ITVA 4Y3OA 3CCQI 1BI3A 4HNTA 3S32A 2HVQA 3CF2A 5J3LA 2F48A 1IUYA 3DLLF 1UG0A 3CDLA 1BC8C 1VQ7I 2LKSA 2WJ0A 2NVYJ 3K4MA 1YIJI 1LDDA 3ONQA 3MEXA 3IH4A 4BEHB 2HQ5A 1H8AC 1XDSA 1B72A 2MYSA 2E2HJ 4TKKA 1FP2A 3LL7A 3D1NI 4WCGA 3P9CA 1K6OA 3BJOA 3F9KA 4UHTA 4CCNA 2X85A 4II3A 2YSRA 4D5FA 5JHUA 3W2WA 3CJNA 3ZQCA 4ESFA 2DJIA 3F0CA 1V5EA 3ABUA 2JJ7A 4M3DA 5GAGJ 2HTSA 2VJIA 3PFYA 1DQUA 4M6VA 3HXLA 4B3XA 2E1OA 2XAFA 4S05A 5F64A 3IV5A 1WGXA 3FISA 2EK5A 5IYDJ 1OYYA 2FBHA 4DIQA 4IVNA 4CXFA 1VQNI 3S1NJ 2L7ZA 2R7TA 4CCLA 3J7ZI 1T39A 3S1MJ 2D1VA 3FHNA 3TP0A 4F55A 2KKOA 2VQCA 1LUJB 2LFBA 3RJPA 2R0QC 1NG6A 2VBWA 2NS8A 3T0YA 4EVIA 4D9JA 2WADA 4UUTA 2DA3A 1Y8QB 5FO5A 3HUGA 5GAHJ 2Y31A 3I4MJ 4FHTA 2NVUB 4A3BJ 2JA8J 1VTNC 3F23A 1VZ0A 4Y17A 1W5CC 3FBNB 5CVRA 2GJWA 1JHFA 1ETVA 2VKDA 3SZTA 2PFBA 2BYVE 4EV0A 1OCZH 1LFBA 4KT6A 2FBKA 2ZFUA 3OYCA 3A4CA 3AAFA 1FJLA 2HTJA 2KJCA 4I76A 2EH3A 2CMPA 1VNDA 1T6SA 3LSTA 2DK8A 4L9TA 3CMMA 3HHHA 1O57A 4NBQA 1WI3A 2CUJA 2ZMEC 5F1RA 3UR3C 3ZQFA 3GWZA 2W84A 4M73A 4RB0A 1D0XA 3I4PA 1Z67A 1W36D 1U8BA 4EM2A 2XIGA 3IAM2 4H4KC 3RPQA 3RDIA 2FL3A 3DU5A 1U9OA 1QHGA 1YRNA 2LVSA 4U7BA 3WTVC 1G6NA 1Z1DA 2EZLA 3WU1B 2LRDA 5BNGA 2QA4I 4I7HA 2FKCA 4A3GJ 3PUBA 5EGOA 2F5VA 3K2AA 1KGSA 1O7FA 4LD5A 4PFOA 1ZHFA 2L4AA 2A68F 1IC8A 1EH8A 1XDUA 2XROA 1FBSA 2EJRA 3L00A 4LMYA 1SANA 2FXAA 2Z33A 4IXAA 2CV0A 2HI3A 2R7XA 2HZTA 5GAEJ 2CH0A 2Y2ZA 3DEWA 4EGZA 3SDGA 4AVPA 2AQFA 1PP8F 2M30A 2E5ZA 2LLKA 3S2DJ 2UWMA 1MMGA 3IUOA 2HGCA 1OQYA 2DA6A 1B59A 3LQQA 3F8MA 4IJAA 2L9NA 4DOZA 3CMEI 2H09A 4I0BA 2E60A 3HOVJ 1T2KA 4KICA 2GA1A 3JAMZ 1SVLA 1YX5A 3ZMVA 4KITB 4EM0B 3P7NA 1Y1WJ 2K9QA 1XG1A 1EKEA 2F4MB 2VC0A 4OU0A 4A3IJ 1FOKA 1WCMJ 2F4OB 5J6XA 1Z3XA 5F6FA 3G4SI 2VONA 1OYIA 3BR6A 3GUDA 3HTSB 5DTDA 1UJ8A 3QAHA 4BY7J 3IH2A 1X3UA 1L0OC 1WQ2A 1OCRH 2Z3YA 2IP2A 4M72A 1DGRM 1ETYA 5FFXA 4CYCA 1J59A 1FMWA 1VQ6I 4JBAA 3IEYA 2MG4A 4B4CA 4QPQA 4I02A 3JRDA 1R4MB 2DDAA 4MQVA 2I8DA 1YOVB 4OIOF 1D0ZA 2IT0A 1BJAA 3I9V2 3C3WA 3SEQA 3IKTA 3VSLA 1T33A 4AIJA 3CUOA 2RREA 3OSFA 1VQ5I 1JXSA 1SD4A 2MLGA 2GOMA 4X0GA 2HPMA 3S2HJ 2C6YA 3JRIA 1H9GA 2WA0A 1MBGA 2XF6A 3CESA 4GDFA 2LF8A 5LFAA 1U8RA 2KIQA 1HKSA 4DQ2A 1JJ8C 4XLHA 2K85A 3HOYJ 4I01A 3O3KA 4WXHA 1J0RA 3WHBA 1N77A 4DBQA 4BXXJ 5FLXZ 3OYKA 2DBBA 2R7VA 4HG2A 3PIPF 2EIMH 4AIKA 4KNYA 5HDKA 3R6SA 2Y9ZA 2VLAA 5JVGF 1U9NA 2ZSHB 5B5EC 4O6JA 3T1BA 3FXOA 5ICGA 3I56I 4IRIA 3K2ZA 4P9FA 3BJAA 4LITA 2L7KA 3OYNA 3BLYA 3FM3A 4M9XA 1K4SA 2W8MA 2E1MC 5E8GA 3F8BA 3TBIA 5DD4A 3VFZA 4P96A 5HOOA 1D3YA 2BY3A 1MIJA 2KIFA 4UXNA 3E5XA 1ZG3A 2XAGA 3IH3A 2EB7A 1VQ4I 1USSA 2KDZA 1P6RA 3E6DA 5DCMB 4OAZA 4BXFA 4HF2A 2QUFA 2OSTA 1ON1A 1WI9A 2V9VA 4RGXA 3HSRA 2WIWA 3HJEA 5J1RA 2OTJI 2KIUA 2E1NA 1M1EB 1WJDA 5FLVA 4BXUA 1IN6A 2VOPA 5IYBJ 5AIPA 4MTEA 3HSFA 4NDLA 1X19A 2W4SA 2IS1A 2Y9YA 4XNFA 3QP5A 2STWA 4BEHA 4HRIA 1T08B 1G8XA 3QODA 1FOWA 1T98A 5B1BH 1IN5A 2GOXB 1OPCA 1QZYA 4PJJA 5H2FC 4CGZA 3H0DA 3FF5A 4MTDA 3N4MA 3PNTA 3P9IA 2FBIA 2M4GA 5JR3A 3ZN1A 5E18F 2CQNA 4LB5A 2QQ8A 4LOCA 2MH2A 2X4HA 3F6VA 3DPUA 2M45A 2FMLA 1WJFA 1EF4A 2EZHA 4U0YA 4BQAA 1OJLA 2CQXA 1SFUA 5CKTA 1I5ZA 2W1OA 1DU6A 2A6EF 3FXLA 3KCCA 1DP7P 2V7FA 4RM2A 1CQTA 3IAS2 1PUFB 2XUBA 1SAUA 4LK0F 1A79A 3F8FA 4HAMA 4Y13A 3IRRA 3AG2H 3M8FA 4ENKA 2R7FA 3FMSA 2K3PA 2O61A 3X2QH 1REPC 4MGRA 2V26A 3TO7A 3DBHB 4DAVA 4P9UA 1YO5C 2HYJA 4IHXA 3KE2A 1TWGJ 2ECCA 5E3MA 3K70D 1RIOH 2E2JJ 2HYGD 1DPRA 5FB2A 1X3WB 2VIXA 3QPTA 3S3MA 3KYCB 1WSUA 4HYEA 4BUPA 3BTCA 4R8HA 5KAIC 1B6AA 3KP3A 3IL2A 3Q0WA 4KIGA 1ZRFA 2DMTA 3B6CA 2V79A 2QZ8A 1NH3A 5EEHA 2QLZA 3MFKA 2NRAC 2ID6A 2X6OA 2QSFX 6PAXA 2EBIA 4RAFA 1YFHA 3IP4B 5K5OA 1RLVA 1QQIA 3ASOH 3QPLA 1PUEE 1LNWA 4M3EA 1RR8C 1D1BA 4DA2A 5CQGA 4YELA 5FRNA 4EJUA 2JMWA 1MJ9A 3SXYA 4F92B 4JX4A 3O6BB 1BW5A 2KP6A 2DYSH 3GTJJ 4TKDA 3AFHA 3COAC 1KZHA 5HDGA 1SFXA 2A3SA 4UB6C 2CS3A 2O8KA 5HLIA 3OYGA 1E2XA 5LRSA 2ME0A 2YPRA 1IN7A 3WE3A 3H3UA 4IHWA 3VYSB 2XGDA 3TMOA 2PMHA 3CP8A 3ULQB 2PEXA 3BR2A 2R3SA 1UHSA 2JUCA 3SHFA 3FDYA 2D5VA 4YIIA 1OB9A 3QYBA 2XAUA 1FYKA 5HS7A 1U5TB 2UXXA 2OZUA 3GMEA 5D5VB 2E7XA 3CCJI 1IN4A 2BY0A 3M8EA 3MKYB 1QHHD 3L1PA 3IWFA 2EO0A 2OF7A 1TW3A 3ZQGA 1ZN2A 2XPVA 1S6LA 2BE5F 1O7LA 2J5OA 4UB8C 1B9NA 4LB6B 4HQEA 1XPXA 1P4WA 3OV8A 3PL8A 3CCLI 1R49A 3EETA 1WFXA 2BVLA 2P0WA 2DTRA 3QQAA 1RRJA 2LK2A 1KU9A 1CGPA 2H8RA 1DGWY 5HODA 1I50J 5D6FA 2XAHA 4EGYA 3HSEA 4A3DJ 2XGEA 2A07F 3CC4I 1TWCJ 2FCOA 3SQNA 2MD0A 1IXRC 3ABKH 2CQKA 2TDXA 1FIPA 1YS7A 2ZJPF 4M9SA 1HKQA 3I53A 3MKLA 2B0LA 2XSDC 1HF0A 4IHVA 4CDGA 2DCEA 1JKQC 1H9TA 1TQMA 4N4OB 2D45A 2L9RA 1O3TA 2HKXA 2WAQN 2CJJA 2OCCH 3CCRI 1VQOI 3NARA 2IRFG 1HC8A 5A2QZ 3TOBA 3V42A 4HX8A 2IGKA 3KP2A 1R5GA 1WRJA 4PSWA 4I2OA 4GCVA 1XMKA 1A36A 1Y0NA 4FQGA 2L5QA 4L9NA 4Y33A 1SMTA 3CJRB 4E7HA 4IEJA 2GXAA 2DFIA 4AU7A 1O3SA 1QVTA 4KMFA 1S3JA 2H27A 3IKVA 3DV8A 2BHZA 2LY2A 5KHDA 2ETHA 5AIQA 5AONA 3T8RA 1VQ8I 2QGUA 3DCFA 2EILH 1DU0A 3F21A 1Y88A 1S72I 3NWSA 3OYMA 5CLSA 2LY9A 4DW6A 1X2MA 2GIZA 2UUZA 1MBEA 3OWTA 4DZPA 2IS2A 1SD7A 1STZA 4NC8A 1G3YA 1WJBA 1L3LA 4FCYA 3EDPA 2HR3A 4JOMA 2D1HA 4E6ZA 1GV5A 3K4NA 2X48A 1XB4A 2QYOA 3TEDA 3KP4A 1HSTA 3GYHX 3Q0UA 4RM3A 3G1OA 2CRGA 3CJTB 5DCMA 3HEFA 2OD5A 2NS0A 1Z3YA 1KA8A 5F0HA 2A5YB 1A6QA 3HGYA 4BQQA 2M9HA 3K6GA 5F0CA 5ILVA 2OA4A 3RKWA 4BH9A 2DA5A 3KPHA 2LF7A 3RCOA 1QPIA 5D5XB 2CW0F 2XC7A 1RETA 4RBOA 4RGSA 1GVDA 3VYRB 1VI0A 4DYCA 4D0PA 4A12A 4KIFA 3P9KA 4PK4A 3WE2A 1ENHA 3JRAA 2OQRA 5D4SA 1XC5A 5EGOB 3L2QA 2IS6A 4C3HJ 3CC7I 4V19K 1IF1A 3FXMA 2IGMA 2HEOA 3SYTA 1SFKA 4O5VA 2E71A 2K4JA 4NHJA 1FSHA 2NYXA 4XL9A 4KJZA 4A3EJ 1LFPA 3KZZA 1FIAA 2WC2A 3DNXA 3ZQLA 4OINF 3FKIJ 4QIWN 4ABZA 2JPBA 2GIVA 2VJ5A 4XM3A 2FE3A 3EUAA 3Q3SA 1PUFA 2Y69H 3HDDA 1ONVA 2DA4A 1ETOA 2VASA 3SEZA 2BBYA 3QOPA 1R9TJ 1N78A 2A69F 3ERED 4E7ZA 2FQ3A 4NC6A 4HEA2 2O5RA 1JGGA 4EJVA 5J8FA 3O2PE 5B66C 3VEPA 2VJJA 1Z77A 2OQGA 3H3VK 3WTWC 1LFUP 1V5FA 3HRUA 4BGDA 5ILSA 1YI2I 3GF2A 2ADUA 1DDNA 1JT6A 4G6DA 1WKMA 2VJ4A 3I3LA 2HOEA 3CO7C 4A3KJ 3EPZA 2PMZA 5DUKA 5DYMA 2IBDA 1V54H 1BA5A 2XAQA 3TO9A 4L9JA 4S0HB 4JK1X 2EIKH 4GRIA 4DGWB 3VODA 3KEOA 3RQ4A 1X1CA 2R4GA 1QPMA 1ZH5A 3KX2A 4KN7X 4A3JJ 3LSJA 2A61A 2PX9A 3DWLE 1P92A 2DOEA 2ESHA 4CUGA 1XGSA 2VUMJ 5FKMA 2M0CA 1SC7A 1W7PD 2VOOA 2ME6A 5E17F 1GDTA 2CW8A 2FOKA 1LB2A 3MMYB 5L3CA 1V4RA 2E19A 1E0EA 4HQMA 5CVIA 4OMZA 2W7NA 4BACA 3FM5A 1ETKA 1TWAJ 4ENNA 3KLNA 4ENMA 2X1DA 1TT5B 4F52A 2M5WA 3GCMA 1XSXA 1HSJA 5K5RA 2CW7A 5E1XA 1TL8A 1A6IA 2DYRH 2VB6A 4BE1A 3RI4A 3HOSA 1LEAA 1FTZA 2VPRA 1RI7A 9ANTA 3BT7A 4BJ5C 3J80Z 2K27A 3M07A 1U5TA 4BDZA 5M5YJ 4QSHA 5IP7J 1J7KA 2F5CA 3JSPA 3LSHA 3MKZA 2QQAA 4HDVA 1QGPA 1ZG5A 3FZVA 3TKYA 1YQAA 3L2VA 1RC9A 4F3QA 2M3AA 3CCMI 1TWHJ 5LLQA 4WK8F 5CVUA 2LP0A 1D5VA 3WODF 2VPLA 3K9TA 2M34A 5LHGA 3OYBA 1VQPI 2EV0A 1ZKGA 2MC3A 1BJZA 2EPFA 3T5XA 3V8LA 5HDNA 3DU6A 4MEYF 2V4JC 1FNNA 1YITI 1PVEA 3M7GA 3M9AA 4U0WA 2Q8KA 2M8EA 2F6CA 1Z9CA 5IY5H 3WTUC 5FROA 4M74A 4II2A 4BJTA 3ISPA 4BE2A 1ZG1A 3L7WA 2RV8A 4CICA 3FHZA 2HQNA 2R5YB 3KYDB 1W0TA 3ZXSA 3J7AO 2FRHA 4B09A 2VT3A 3K0LA 2H6CA 2V9KA 3ZGKA 2Z5UA 2X51A 5CVJA 2V1XA 4OMYA 3A01B 4A2UA 5EEGA 3FKJA 4ZC3A 3PSFA 4PGGA 5H6RA 5IT9K 3M4OJ 4XRMA 1WH7A 5DM7F 4IKFA 5J4VA 2JZYA 3CCSI 2JWTA 3CMAI 2BVMA 1D8KA 1UZCA 5DD8A 4I09A 4IZZA 2ELJA 3KIOA 3ZOBA 3DQVC 1NHAA 4EJOA 1Y8RB 4RDUA 5F08A 4XKVA 2Y75A 4AD9A 1UFMA 2KDOA 2NNYA 3TDUC 1AWCA 3R0AA 5FDKA 1XSDA 4BKXA 3U9GA 1JKRC 2KFDA 2IJLA 2UZKA 4JQFA 5TGTA 4KMUX 1S9HA 3PFIA 2W48A 5IP9J 1D8JA 3WGGA 2BH2A 5IOYA 4FX0A 3WTYC 3CDIA 2K9SA 4KISA 2WV0A 5E8IA 2WB1A 3F72A 3J81K 2CUZA 2M7AA 2HYFA 1XGOA 1FY7A 1AA7A 2DXIA 4E7LA 2EFQA 3RPUA 2JRTA 4AWXB 1DUXC 1P2FA 4DJAA 3NAUA 3W6KB 3KEQA 5JLWA 1S8NA 2MD5A 4L5IA 1R1TA 3BCBA 2QVOA 1IXCA 4U7DA 5FLMJ 1ZGAA 4GFBA 5J1YA 4MFEA 4CCMA 2X6XA 2M87A 1E3OC 1SVMA 2L7MP 3AG1H 4QLCU 1VQMI 1WJCA 4ON0A 2IW5A 3TL4X 2LMDA 1BOBA 4JYKA 2CV1A 2ZNZA 3GTLJ 2CYYA 2R7QA 3E5UA 3I54A 2VLDA 2O7OA 3ZN0A 4O3MA 5ICCA 3E5QA 3EUHA 3A2KA 4OIQF 3BR3A 3CLOA 5EJCA 2Z16A 1GXPA 5E79C 4JP0A 4Q4ZF 1YTYA 4F93B 4QTRA 4PZJA 1LPQA 1OB8A 2Z0RA 3GFMA 3DKYA 4OIRF 4X6AJ 2ZFWA 1MSEC 5GTHC 2EWNA 3CO6C 5FLXK 1W0UA 1B9MA 3R0JA 4AIDA 2ZB9A 2F5DA 4ZH4F 5DCFA 2B63J 4GYGA 3ZPLA 4BNCA 3W3CA 5K7FA 3F22A 2L0KA 2VBXA 2WAEA 1YE9A 3G2BA 1OCCH 4YFXF 1FOYA 2GM4A 1KYWA 1GVJA 2X6YA 3JRHA 4A6EA 3F8CA 1MH3A 2DMQA 4IRHA 1BW6A 3MWMA 1W36C 1YW9A 1FTTA 1LVKA 2XSJC 4LLGF 3WU0A 1TBXA 1YJNI 2QF7A 3OYFA 4DNCA 2DW4A 3ZR8X 2NVQJ 3FXJA 1B8IB 2PI0A 4IOCF 4V2FA 2R7SA 1FLIA 3DF8A 3TGNA 1V55H 4AYBN 2V1DA 2YU9J 1VQ9I 3GFIA 2IVMA 5HLGA 4OIPF 3S15J 2DLLA 3K4BA 4OWRB 4CZZA 3JREA 4XORA 1R11A 2RAEA 1FP1D 2HS5A 3LSGA 3BP8A 5KCMA 4YFKF 1FC3A 1AKHB 3W2AA 1G3WA 1ZGWA 4XONA 4UVAA 4XBFA 1BI2A 1Z6TA 3PM1A 2MLKA 2E34A 2GAUA 3UKGA 2W85A 3GLLA 5D4RA 1NG7A 4RLFA 1JE8A 1OFCX 2UXNA 2DMNA 3QOEA 2KMUA 2NVXJ 3PUFA 1I3AA 2PMZN 2FJ1A 3LFUA 1RNLA 1MSFC 1ETWA 3C1DA 2OUMA 4M71A 3M3YJ 2JSPA 3JRCA 3L2UA 2LNBA 2R5ZB 2CO5A 1JHHA 1XGMA 2XDVA 3FXRA 3WTXC 4PJNA 5JHFA 1FYMA 1JKPC 1JT0A 1GHCA 2VQGA 4E6KG 4M3BA 1UWVA 1BI0A 4IPAA 2DFFA 1LJ9A 2QQ9A 2LR8A 1TNSA 4ZYGA 1T8IA 2R93J 1TTYA 5IPAA 1I27A 2A5WA 2XGCA 4CCJA 4HV5A 1IRFA 5FKLA 4LG0B 2ZO4A 3AG4H 1TNTA 4Q48A 3AL0B 2O6GE 3IF0X 2R5YA 4P55A 5B1AH 2JTVA 1K79A 3JW4A 3RZDJ 3AL0C 3ZQIA 5DEQA 4RAZA 1F4KA 5J47A 3OS0A 1JUMA 1X58A 1MJBA 1ULYA 5GADJ 2ZNYA 3FK7A 1TWFJ 1XMXA 2FD5A 3A01A 3JCUC 3S93A 2ZJRF 4V2GA 3C2BA 1OCOH 3F8NA 4BE0A 3BQYA 4QBNA 3QPHA 1MBKA 3HTUA 3N05A 5FGMA 3E97A 3OYEA 4HBLA 4AVZA 4XRSG 3AKZA 2DFHA 4ZDOA 2FNPA 1E17A 4C3IJ 1BIBA 3LOCA 2CGPA 4C9YA 2DI3A 4FASD 1U3EM 1F43A 5EZGA 2E7WA 2A05A 1POGA 3B6AA 5HLHA 3BG9A 3TQNA 2ZXIA 2ZJQF 3RZOJ 1DP3A 1ZYRF 5E3NA 2PBIA 3E7LA 4XN3A 1CF7B 4XSXF 4IX7A 3DTKA 3IHUA 2YUSA 3H0GJ 5L3EA 2JQ7A 1I1GA 2STTA 3VYTB 4XRSA 3RSNA 3DBLB 2NVTJ 5E1ZB 3OIOA 2I10A 1XMAA 1R6RA 2A6TA 3VYUB 1OLTA 1ZGJA 4KFCA 5C3EJ 1R1VA 4P1WA 4Z6YA 3S14J 3OIPA 5GTIC 1FEXA 3OYJA 2L7FP 2K3FA 1MD0A 1P9QC 3U1DA 3DKXA 3S16J 3V8KA 2ISZA 3LSPA 3ELKA 1XSVA 4R79A 1OKRA 3HRMA 2QM3A 3ZRGA 4UUVA 4B1RA 2ZXWH 3SZGA 1KYZA 1KQ8A 4LQEA 4J01A 3J7YJ 1IG7A 4HF0A 1IRXA 3BTIA 2DU9A 1BI1A 4IHYA 5GPCA 4UV9A 5EDNA 4D1QA 1ON2A 2VXDA 2LG4A 4N4NB 2HVRA 2KZGA 3BR1A 3K70C 3WTZA 1IO2A 1HBXG 3ESWB 2EIJH 4Y4RA 2H8WA 1U5TC 2QBYB 1NK3P 1TQPA 2ZYZA 2OBPA 2F4IA 3HHGA 3OL3A 4EM1A 2GXGA 1G59A 3DPTA 2VBZA 4FT8A 2DK5A 3JR9A 1Q1HA 2P5KA 1W5SA 2WTEA 1IAWA 1ZELA 1VFCA 2KRFA 4NQWB 2HXOA 1MNDA 1Y0UA 4RLQA 2JT1A 4D7NA 1HW5A 1ZR4A 4E4HA 4FX4A 2NS7A 4BBRJ 2Y0SA 2JUGA 2X6WA 2FX0A 3S1QJ 2WY7Q 3J7AY 4E7IA 5JI6A 2JA5J 3MN2A 4ZYEA 4ZYHA 1K7AA 2XRNA 1QRYA 2HDDA 2DQRA 2R7RA 1X3ZB 1P4XA 4G7OF 1ZQ3P 4QBOA 3REOA 2L02A 2P6TA 4DZJA 3ZP5A 3GTKJ 4MLOA 4HSRA 4HDUA 1MJAA 1RR7A 3PQJA 3S3NA 2GBYA 1AHDP 2DODA 4MHGA 3BTLA 5IYCJ 3BJ6A 1O4XA 2B7EA 2QKLB 3QU3A 1PP7U 4A5NA 4PDKA 1B8IA 1WZ2A 1K61A 1QZEA 3HGGA 4CYDA 2Q2EB 4A5MA 2ZKZA 2MW8A 3HKZA 4HSTA 3DFGA 3L2RA 3PQKA 1HW2A 1AKHA 2VC1A 3K69A 3P1ZA 3WG7H 4XIDA 3F3XA 1LEBA 3GW2A 2LREA 2XKOA 2F5FA 2AS5F 2ECBA 3PIOF 2INBA 2BY1A 1A31A 5LD2C 1S7EA 3KP6A 3TOAA 4KYWA 3H36A 4GYIA 4CO8A 1HDDC 4ZDPA 3CCUI 4BY1J 2CQQA 5HLTA 1RUNA 3EQLF 5E1WA 2DO7A 2WWYA 4L18B 4XLNF 2ACJA 1D1AA 1XGNA 1FT9A 4CH7A 3I5UA 4IQ4A 4RB3C 4MFDA 2BY2A 3TO6A 4EMSA 2KISA 2RKHA 2P7VB 1E3PA 1H88C 2R5ZA 2DTZA 4LGWA 1R0VA 1WVRA 4G6TB 3DKWA 2G7UA 4EJWA 2PN6A 3VSKA 1J5YA 5BS6A 1XN7A 4G6VA 4BYYA 5M5XJ 3S2WA 5J4YA 1GT0C 3B02A 3SFZA 2E35A 4IHTA 1EA3A 1LDJA 2F2EA 3Q5FA 3EYIA 1GUUA 1IJWC 3ASNH 1IW7F 3RQIA 3HM5A 4ETSA 2RN7A 4LG0A 2FEZA 2HQRA 2K5CA 2HDWA 1IRGA 1OR7C 4PFPA 1IPIA 2WCWA 4Q5SF 2DMPA 2FOWA 4I6ZA 1Z21A 2K7LA 3H92A 5F27A 3CF5F 1TT0A 1YHQI 4YIFA 1MMSA 2M4KA 2MSYA 1FSEA 2MFZA 1UHWA 2ZJ2A 2E1CA 2Y0MA 4EV1A 1VQKI 1TP4A 2L2OA 2LC2A 1D1CA 3I55I 4HPQA 1UELB 5DM6F 2L3DA 3BT9A 3KLOA 2O9LA 3EUHC 4E7SA 4UNOA 4BU2A 2WY8Q 2NNNA 2VQHA 3E0JB 4XLCA 4M3FA 2MGQA 4PGHA 3LMMA 2Q1ZB 3A02A 5TRDA 2R7OA 3OS1A 3OYDA 1C0WA 2P7CB 3W6JB 3Q9SA 2HKOA 3BY6A 1YNMA 1BOAA 5DS9A 2KL4A 1IRZA 2FA5A 4C2UA 2CV8A 5KNLA 3CUQB 3LA2A 4G6QA 3BG6A 3D5SC 2JN6A 2NOJB 4HX7A 3V4GA 1P4AA 2IPQX 3RKXA 3C7JA 1CF7A 1TLHB 3CUQC 2P5LC 4Y7NJ 5CQEA 3SZPA 4Y15A 5E3LA 3LSKA 1Z0XA 4L5EA 2X9DA 5CYVA 4ZQUA 4WX9A 4B3AA 1JUPA 3V7RA 2HVSA 3K4LA 4WWCA 3L2WA 2XF7A 1X4OA 1MDMB 2K40A 5L3DA 1RZ4A 3M8JA 2XGXA 3Q9VA 4NB5A 4MEXF 2LTPA 2ESNA 2R92J 3LSRA 3TW6A 3UNGC 1Y6IA 2L9VA 2VL8A 4B43A 1JUSA 2LH9A 2QCOA 2OC6A 1KQ9A 4L9VA 2K02A 4ASNA 2DT6A 1Z05A 4UUSB 4IOAF 2L01A 3BZ6A 4A3LJ
chains in the Genus database with same CATH topology
3WTSC 2P5VA 4EQQA 1RUOA 4RB1A 4RGUA 5BOXA 1U6GA 3WGHA 5IT3A 2PJPA 2IA2A 2QBYA 2AXLA 1LVAA 1G3TA 1S29A 3F6OA 1KU2A 4IHSA 4NQWA 3VB2A 5L3GA 2XHKA 5HS8A 2IA1A 1ZREA 1GEFA 2XKPA 4HF1A 3I59B 3FMQA 4UV8A 1UCRA 1W7PB 2ZCWA 1EH6A 1PDNC 2DPUA 1F1ZA 4N9IA 1ZRDA 2F5EA 1HW1A 2RC4A 3K1PA 4PCQA 5H20A 3LFKA 4B8XA 4BHCA 1QO0D 3FX3A 1YLFA 4K2EA 1GXQA 2Q2EA 3GFJA 1DPUA 3CDHA 1FPQA 5ERIA 5LEKA 1TW2A 2FSWA 3DEUA 1O3QA 3JTGA 4GXOA 3ZQ7A 4WF2A 2OU2A 3QU6A 3H3ZA 1H0MA 3FWEA 4L5JA 1IN8A 1BIAA 2P4WA 3FOVA 4GO1A 1SD5A 1KU3A 4QBLA 3DPLC 4QWQA 2DAOA 3NQOA 3IRQA 1ZLJA 1SFEA 4P5OA 2RVCA 2COMA 2VXZA 4YG2F 3JAMK 3ZMDA 1T0FA 1OYWA 2WCZA 3RTRA 2CFXA 1IZ1A 4HZFA 1KQ0A 3E6CC 3M1EA 3R61A 2FU4A 2OZ6A 2ZMEB 2LDUA 3I58A 1OR7A 5HS9A 4A6DA 3ZMZA 1BM9A 4WXDA 3K1NA 3FMRA 5BPIA 2A6HF 1LDKB 1ODDA 3RIRA 5TJJA 1J9IA 1YW8A 2HFHA 2L54A 2Q0OA 3AJVB 2YR2A 1FX7A 5E20A 1V3FA 4L0ZB 2ZYZB 2IXSA 5IT9Z 4XLPF 2H94A 4RB2C 5LGTA 4KA4A 3BPXA 2EFNA 4A0ZA 4IF4A 3CUQA 4N9HA 3K1MA 3IWZA 1IXSB 2RNJA 5DUIA 2DQLA 5DV5A 1BC7C 2FF4A 5ED4A 3P1YA 3KP7A 2FMYA 5K5QA 3L09A 2ZBKA 4XRFA 5LBQA 4I98B 2RGVA 3J81Z 3HYIA 4RGRA 2YU3A 1MDMA 4KT5C 1S7OA 1FWZA 3FXQA 3GO5A 3GXOA 1MKMA 2NAZA 1J2XA 3ROUA 2GA2A 5DDGA 2P6SA 3VOEA 2ELHA 2FNAA 3P1ZB 2D2WA 3CTAA 4IRGA 2R7DA 5FFZA 4A0YA 4S04A 4TV7A 1J75A 5K1YA 3WTTC 4LK1F 1U2WA 2FLCA 4BHPA 4OOIA 2BV6A 2O3FA 1RZNA 1MGTA 2L4MA 2VE8A 4GGGA 5D5UB 2PG4A 1I6XA 4ESBA 4EJTA 3LAPA 4I0AA 4U0VA 4G94A 1EV7A 3I59A 3ZMTA 5J8CA 2W24A 5L3BA 1W7PA 2PMUA 2EFOA 2KJBA 3BWGA 1R58A 4KIBA 2XAJA 2VBYA 1T38A 2GZWA 4HLYA 2GXBA 3ZMUA 4LLNA 1R1UA 1HH1A 2XASA 3EYYA 3HRSA 1Z6RA 4G7ZF 3MZHA 5CVVA 3GEZA 3HOTA 4DAPA 4M6XA 4R1HA 1ZP7A 3JSOA 5FD5A 4A0XA 1BN5A 3DP7A 4G9YA 3D0SA 5ICEA 2Z9OA 2QENA 2VE9A 1YS6A 1TQIA 2K86A 5FD6A 4KN4X 1R23A 4KDPA 2DPDA 2X0LA 1I1SA 2ZXJA 2JSCA 2EA4A 5L3FA 4H0EA 2HWVA 5LHHA 1YIOA 5D8KB 5H6QA 3FXUA 4ENJA 5BMZA 3B73A 4RS8A 1SMYF 2EV6A 2YX4A 3GFLA 2BGCA 2J5PA 2O03A 3G73A 2ZMEA 4E70A 2K4BA 2BEOA 1R22A 5LGUA 5A2QK 1Z91A 3E6MA 3LAJA 4YFNF 2G9WA 2W25A 4UVBA 3ML6A 1K78B 1F9NA 3AJVA 5LHIA 3V7CA 1HQCA 3G3ZA 4HV6A 2VN2A 1R7JA 1SD6A 1A04A 2GWRA 2MH9A 5LEJA 1Y1OA 3JTHA 5KVRA 1R5HA 3MQ0A 4N0BA 2RDPA 4MQ9F 2GQQA 1YG2A 4LLLA 5D5WB 2QWWA 2CSOA 4ESJA 2GW6A 1W4MA 3GZ6A 1LQ1A 1B1BA 2OAZA 3LQRA 1FBQA 2M1BA 2JJQA 4KUMA 3U2RA 4ZZDA 1FZPB 3ZMSA 3KFWX 2IA0A 5KK1A 3QRFF 1XCVA 3BOQA 3HRTA 5BQTA 1YYVA 3GVAA 5ICFA 3N97A 3MAJA 3GLXA 4MNUA 2CZRA 2VODA 2QQBA 3E6BA 4ZYDA 4RAYA 3L2CA 3D5LA 3MCZA 1Z7UA 2OKFA 3R60A 4LJZF 4CHUA 3BROA 1OMIA 2YX7A 3ECOA 1QBJA 3ABTA 1O3RA 1AOYA 1XCBA 3C18A 1ZARA 5JVTA 4HLXA 2H6BA 4G8XA 2MBFA 5D6EA 3TDZC 2PQ8A 3DXJF 3RYRA 2VS1A 2VT2A 2CWEA 5LGNA 2RQPA 3GZ5A 1G4DA 2Z99A 2EFPA 3KP5A 3I0TA 3LWFA 2LKPA 4G6UA 3V8JA 1ZLKA 4HX4A 4ZZLA 1ZRCA 4HOBA 2DBSA 3LA7A 4M9ZA 2WIZA 3NRVA 4L0YB 1UB9A 3IC7A 2O8XA 3OOPA 1ZAOA 2V1UA 5HVQC 5JFRA 4LFUA 5D8LB 1XD7A 1W5TA 1SAXA 2W57A 3KZYA 1EH7A 3WGIA 1HKTA 4U88A 1U78A 3J80K 2DT5A 3I71A 3RKYA 2HDCA 4XSZF 1JGSA 2G7HA 3WG9A 2FKHB 1USTA 3KETA 2XV4S 2EV5A 1G3SA 1R00A 5LRRA 4BHBA 3BDDA 2EA2A 3MZYA 1B4AA 4Z2YA 3V7SA 3T8TA 4WXCA 2ISYA 4M6YA 1YW7A 3R4KA 1KU7A 2JPCA 4UVCA 1HXDA 1WWXA 2LSOA 3NEUA 4HW0A 3IEYB 3BPVA 1FBUA 1UHMA 2KIMA 1MZBA 1FYLA 5CJ9A 4G7HF 5BPDA 4BAYA 1QNTA 2O0YA 2Y48A 1QZZA 1K78A 1R36A 3I64A 2P8TA 2PLYA 1BBYA 4Q47A 3RYPA 3GX4X 3ECHA 3E3VA 4AIHA 3L9FA 2CG4A 3HIFA 2XVCA 4HA8A 1F5TA 3LA3A 5ILUA 2MA3A 2V6CA 2EFWA 3QP6A 4F7ZA 1S7AA 1BI3A 1IUYA 1BC8C 2WJ0A 1LDDA 3MEXA 1XDSA 4TKKA 1FP2A 4WCGA 3P9CA 1K6OA 3BJOA 4UHTA 2YSRA 5JHUA 3CJNA 4ESFA 3ABUA 2HTSA 4S05A 2XAFA 5F64A 2EK5A 1OYYA 2FBHA 4CXFA 4IVNA 1T39A 2D1VA 2KKOA 3RJPA 2VBWA 3T0YA 4EVIA 5FO5A 3HUGA 4FHTA 1VTNC 3F23A 4Y17A 5CVRA 2GJWA 1JHFA 3SZTA 2PFBA 2BYVE 4EV0A 2FBKA 3AAFA 2HTJA 2KJCA 3LSTA 1T6SA 4L9TA 2DK8A 3HHHA 1O57A 5F1RA 3GWZA 2W84A 4M73A 4RB0A 3I4PA 4EM2A 2XIGA 3RPQA 3RDIA 2FL3A 4U7BA 3WTVC 1G6NA 1Z1DA 3WU1B 4I7HA 2FKCA 1KGSA 1O7FA 4LD5A 1ZHFA 2L4AA 2A68F 1EH8A 1XDUA 2XROA 1FBSA 2EJRA 3L00A 4LMYA 2FXAA 2Z33A 4IXAA 2HZTA 4EGZA 4AVPA 1PP8F 2M30A 2UWMA 2HGCA 1B59A 3LQQA 3F8MA 4IJAA 2H09A 4I0BA 1T2KA 4KICA 2GA1A 3JAMZ 3ZMVA 4EM0B 3P7NA 2VC0A 4OU0A 1FOKA 5J6XA 2VONA 5F6FA 1OYIA 3GUDA 3HTSB 3QAHA 1X3UA 1L0OC 1WQ2A 2Z3YA 2IP2A 4M72A 5FFXA 1J59A 4JBAA 3IEYA 4I02A 4MQVA 4OIOF 2IT0A 1BJAA 3C3WA 3IKTA 4AIJA 3CUOA 1JXSA 1SD4A 2MLGA 2C6YA 1H9GA 2LF8A 1U8RA 1HKSA 4DQ2A 4I01A 3O3KA 4WXHA 1J0RA 5FLXZ 2DBBA 4AIKA 4KNYA 5HDKA 3R6SA 5ICGA 4O6JA 3T1BA 4IRIA 3K2ZA 4P9FA 3BJAA 3FM3A 4M9XA 2W8MA 5E8GA 3F8BA 5DD4A 3VFZA 4P96A 5HOOA 1D3YA 4UXNA 2KIFA 3E5XA 1ZG3A 2XAGA 2EB7A 1USSA 1P6RA 3E6DA 5DCMB 4HF2A 2QUFA 2OSTA 1ON1A 1WI9A 2V9VA 4RGXA 3HSRA 2WIWA 2KIUA 2E1NA 4BXUA 1IN6A 2VOPA 5AIPA 4MTEA 3HSFA 2STWA 3QP5A 1T98A 1IN5A 1OPCA 1QZYA 4CGZA 3N4MA 3FF5A 4MTDA 3P9IA 2FBIA 5JR3A 5E18F 3ZN1A 4LB5A 2MH2A 2X4HA 3F6VA 2M45A 2FMLA 4U0YA 4BQAA 1SFUA 1I5ZA 2A6EF 3KCCA 1DP7P 2XUBA 4LK0F 1A79A 3F8FA 4HAMA 4Y13A 3IRRA 3M8FA 4ENKA 2R7FA 3FMSA 2O61A 1REPC 4MGRA 3TO7A 4DAVA 4P9UA 1YO5C 3KE2A 1RIOH 2HYGD 1DPRA 5FB2A 3QPTA 1WSUA 4HYEA 4R8HA 1B6AA 3KP3A 3IL2A 4KIGA 1ZRFA 2V79A 2QZ8A 5EEHA 2QLZA 3MFKA 2NRAC 6PAXA 1YFHA 5K5OA 1RLVA 1QQIA 1PUEE 1LNWA 4DA2A 4EJUA 1MJ9A 3SXYA 3O6BB 4TKDA 3COAC 5HDGA 1SFXA 2A3SA 5HLIA 1E2XA 5LRSA 2YPRA 1IN7A 3WE3A 3H3UA 3ULQB 2PMHA 2PEXA 2R3SA 3SHFA 4YIIA 1OB9A 1FYKA 5HS7A 1U5TB 2UXXA 2OZUA 5D5VB 2E7XA 1IN4A 3M8EA 3IWFA 2EO0A 1TW3A 1ZN2A 1S6LA 2BE5F 1O7LA 2J5OA 4LB6B 1B9NA 4HQEA 1P4WA 3OV8A 3EETA 2DTRA 1KU9A 1CGPA 5D6FA 2XAHA 4EGYA 3HSEA 2A07F 2FCOA 3SQNA 1IXRC 2CQKA 2TDXA 1YS7A 4M9SA 1HKQA 3I53A 2B0LA 4CDGA 1H9TA 1TQMA 2D45A 1O3TA 2HKXA 2IRFG 5A2QZ 3TOBA 4HX8A 3KP2A 1R5GA 1WRJA 4I2OA 4GCVA 1XMKA 4L9NA 1SMTA 2DFIA 1O3SA 4KMFA 1S3JA 2H27A 3IKVA 3DV8A 2ETHA 5AIQA 5AONA 3T8RA 3F21A 1Y88A 5CLSA 1SD7A 1STZA 1G3YA 1L3LA 3EDPA 2HR3A 4E6ZA 2D1HA 1XB4A 2QYOA 3KP4A 1HSTA 3GYHX 5DCMA 2OD5A 2NS0A 1KA8A 2A5YB 5ILVA 2OA4A 3RKWA 4BH9A 2LF7A 5D5XB 2CW0F 4RGSA 4D0PA 4A12A 4KIFA 3P9KA 3WE2A 2OQRA 5D4SA 1IF1A 2HEOA 4O5VA 2K4JA 4NHJA 1FSHA 2NYXA 3KZZA 2WC2A 3DNXA 4OINF 2JPBA 2GIVA 2FE3A 1ONVA 2BBYA 3QOPA 2A69F 3ERED 2FQ3A 4EJVA 5J8FA 3O2PE 3VEPA 2OQGA 3WTWC 3HRUA 5ILSA 3GF2A 2ADUA 1DDNA 4G6DA 1WKMA 2HOEA 3CO7C 5DUKA 5DYMA 2XAQA 3TO9A 4L9JA 4JK1X 3VODA 3KEOA 1QPMA 1ZH5A 4KN7X 2A61A 1P92A 2ESHA 1XGSA 1W7PD 2VOOA 5E17F 2FOKA 1LB2A 5L3CA 1V4RA 4HQMA 5CVIA 4OMZA 3FM5A 4ENNA 3KLNA 4ENMA 2M5WA 1XSXA 1HSJA 5K5RA 5E1XA 3RI4A 3HOSA 1LEAA 1RI7A 3BT7A 3J80Z 2K27A 1U5TA 1J7KA 2F5CA 3JSPA 2QQAA 4HDVA 1QGPA 1ZG5A 3FZVA 3TKYA 1YQAA 5LLQA 4WK8F 5CVUA 1D5VA 3WODF 3K9TA 5LHGA 2EV0A 2MC3A 3V8LA 3T5XA 5HDNA 4MEYF 1FNNA 3M7GA 3M9AA 4U0WA 2Q8KA 2M8EA 1Z9CA 3WTUC 4M74A 3ISPA 1ZG1A 3L7WA 2RV8A 4CICA 3FHZA 2HQNA 3J7AO 2FRHA 4B09A 2VT3A 3K0LA 2H6CA 2Z5UA 5CVJA 2V1XA 4OMYA 4A2UA 5EEGA 4PGGA 5H6RA 5IT9K 2JZYA 1D8KA 5DD8A 4I09A 3DQVC 1NHAA 4EJOA 2Y75A 4AD9A 1UFMA 2NNYA 3TDUC 1AWCA 3R0AA 5FDKA 1XSDA 3U9GA 2IJLA 2UZKA 4JQFA 4KMUX 3PFIA 1D8JA 3WGGA 2BH2A 4FX0A 3WTYC 2WV0A 5E8IA 3F72A 3J81K 2HYFA 1XGOA 1FY7A 2EFQA 3RPUA 2JRTA 4AWXB 1DUXC 1P2FA 3W6KB 3KEQA 1S8NA 2MD5A 4L5IA 1R1TA 2QVOA 1IXCA 4U7DA 1ZGAA 2M87A 4QLCU 4ON0A 2IW5A 2ZNZA 2CYYA 3E5UA 3I54A 2VLDA 3ZN0A 4O3MA 5ICCA 3E5QA 3EUHA 4OIQF 3CLOA 1GXPA 4Q4ZF 1YTYA 4PZJA 2Z0RA 1OB8A 3GFMA 4OIRF 2ZFWA 2EWNA 3CO6C 5FLXK 1B9MA 3R0JA 2F5DA 4ZH4F 5DCFA 4GYGA 3ZPLA 4BNCA 3F22A 2VBXA 4YFXF 1KYWA 1GVJA 4A6EA 3F8CA 4IRHA 3MWMA 1YW9A 4LLGF 3WU0A 1TBXA 4DNCA 2DW4A 2PI0A 1FLIA 3DF8A 3TGNA 2V1DA 3GFIA 2IVMA 5HLGA 4OIPF 2DLLA 4CZZA 1R11A 1FP1D 2HS5A 3BP8A 4YFKF 1FC3A 1G3WA 4UVAA 4XBFA 1BI2A 1Z6TA 2MLKA 2GAUA 2W85A 5D4RA 1JE8A 2UXNA 1RNLA 3C1DA 4M71A 2LNBA 2CO5A 1JHHA 1XGMA 3FXRA 3WTXC 1FYMA 1GHCA 1UWVA 1BI0A 4IPAA 1LJ9A 2QQ9A 1TNSA 4ZYGA 1TTYA 1I27A 4HV5A 1IRFA 4LG0B 2ZO4A 1TNTA 4Q48A 2O6GE 3IF0X 4P55A 2JTVA 1K79A 3JW4A 5DEQA 4RAZA 1F4KA 1MJBA 1ULYA 2ZNYA 1XMXA 4QBNA 3F8NA 3QPHA 3HTUA 5FGMA 3E97A 4HBLA 2FNPA 1E17A 1BIBA 2CGPA 2DI3A 1U3EM 2E7WA 5HLHA 3TQNA 1ZYRF 2PBIA 1CF7B 4XSXF 3IHUA 5L3EA 1I1GA 2STTA 5E1ZB 1XMAA 1ZGJA 4KFCA 1R1VA 1MD0A 3U1DA 3V8KA 2ISZA 3ELKA 1XSVA 4R79A 1OKRA 3HRMA 2QM3A 4UUVA 1KYZA 1KQ8A 4LQEA 4HF0A 2DU9A 1BI1A 4UV9A 1ON2A 3WTZA 1HBXG 1U5TC 2QBYB 1TQPA 2ZYZA 2OBPA 3HHGA 4EM1A 2GXGA 3DPTA 2VBZA 4FT8A 2DK5A 1Q1HA 2P5KA 1W5SA 2WTEA 1IAWA 2KRFA 1Y0UA 2JT1A 1HW5A 4FX4A 5JI6A 4ZYEA 4ZYHA 1K7AA 2XRNA 2DQRA 4G7OF 1P4XA 4QBOA 3REOA 2L02A 2P6TA 3ZP5A 4HDUA 1MJAA 3PQJA 4MHGA 3BJ6A 3QU3A 1PP7U 4A5NA 4PDKA 4CYDA 4A5MA 2ZKZA 3DFGA 3PQKA 1HW2A 2VC1A 3K69A 3P1ZA 3F3XA 1LEBA 3GW2A 2XKOA 2F5FA 2AS5F 2INBA 3KP6A 3TOAA 4KYWA 4GYIA 4CO8A 1RUNA 3EQLF 5E1WA 2DO7A 2WWYA 4L18B 4XLNF 2ACJA 1XGNA 1FT9A 3I5UA 4RB3C 4EMSA 3TO6A 2RKHA 2P7VB 4LGWA 1R0VA 3DKWA 2G7UA 4EJWA 2PN6A 5BS6A 1J5YA 1XN7A 4G6VA 4BYYA 3S2WA 3B02A 3SFZA 4IHTA 1LDJA 2F2EA 3Q5FA 3EYIA 4ETSA 1IW7F 2RN7A 4LG0A 2FEZA 2HQRA 1IRGA 2WCWA 1IPIA 4Q5SF 2K7LA 3H92A 4YIFA 1FSEA 1UHWA 2ZJ2A 2E1CA 2Y0MA 4EV1A 2L3DA 3KLOA 4UNOA 2NNNA 4PGHA 5TRDA 2P7CB 1C0WA 3W6JB 3Q9SA 2HKOA 3BY6A 1YNMA 1BOAA 2FA5A 2CV8A 3CUQB 3LA2A 4G6QA 4HX7A 3V4GA 1P4AA 2IPQX 3RKXA 3C7JA 1CF7A 1TLHB 3CUQC 2P5LC 3SZPA 4Y15A 5CYVA 4ZQUA 4WX9A 3V7RA 4WWCA 1MDMB 5L3DA 1RZ4A 2XGXA 3Q9VA 4NB5A 4MEXF 2ESNA 1KQ9A 4L9VA 2K02A 4ASNA 1Z05A 2L01A 3BZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTS C;  2P5V A;  4EQQ A;  1RUO A;  4RB1 A;  4RGU A;  5BOX A;  1U6G A;  3WGH A;  5IT3 A;  2PJP A;  2IA2 A;  2QBY A;  2AXL A;  1LVA A;  1G3T A;  1S29 A;  3F6O A;  1KU2 A;  4IHS A;  4NQW A;  3VB2 A;  5L3G A;  2XHK A;  5HS8 A;  2IA1 A;  1ZRE A;  1GEF A;  2XKP A;  4HF1 A;  3I59 B;  3FMQ A;  4UV8 A;  1UCR A;  1W7P B;  2ZCW A;  1EH6 A;  1PDN C;  2DPU A;  1F1Z A;  4N9I A;  1ZRD A;  2F5E A;  1HW1 A;  2RC4 A;  3K1P A;  4PCQ A;  5H20 A;  3LFK A;  4B8X A;  4BHC A;  1QO0 D;  3FX3 A;  1YLF A;  4K2E A;  1GXQ A;  2Q2E A;  3GFJ A;  1DPU A;  3CDH A;  1FPQ A;  5ERI A;  5LEK A;  1TW2 A;  2FSW A;  3DEU A;  1O3Q A;  3JTG A;  4GXO A;  3ZQ7 A;  4WF2 A;  2OU2 A;  3QU6 A;  3H3Z A;  1H0M A;  3FWE A;  4L5J A;  1IN8 A;  1BIA A;  2P4W A;  3FOV A;  4GO1 A;  1SD5 A;  1KU3 A;  4QBL A;  3DPL C;  4QWQ A;  2DAO A;  3NQO A;  3IRQ A;  1ZLJ A;  1SFE A;  4P5O A;  2RVC A;  2COM A;  2VXZ A;  4YG2 F;  3JAM K;  3ZMD A;  1T0F A;  1OYW A;  2WCZ A;  3RTR A;  2CFX A;  1IZ1 A;  4HZF A;  1KQ0 A;  3E6C C;  3M1E A;  3R61 A;  2FU4 A;  2OZ6 A;  2ZME B;  2LDU A;  3I58 A;  1OR7 A;  5HS9 A;  4A6D A;  3ZMZ A;  1BM9 A;  4WXD A;  3K1N A;  3FMR A;  5BPI A;  2A6H F;  1LDK B;  1ODD A;  3RIR A;  5TJJ A;  1J9I A;  1YW8 A;  2HFH A;  2L54 A;  2Q0O A;  3AJV B;  2YR2 A;  1FX7 A;  5E20 A;  1V3F A;  4L0Z B;  2ZYZ B;  5IT9 Z;  4XLP F;  2H94 A;  4RB2 C;  5LGT A;  4KA4 A;  3BPX A;  2EFN A;  4A0Z A;  4IF4 A;  3CUQ A;  4N9H A;  3K1M A;  3IWZ A;  1IXS B;  2RNJ A;  5DUI A;  2DQL A;  5DV5 A;  1BC7 C;  2FF4 A;  5ED4 A;  3P1Y A;  3KP7 A;  2FMY A;  5K5Q A;  3L09 A;  2ZBK A;  4XRF A;  5LBQ A;  4I98 B;  2RGV A;  3J81 Z;  3HYI A;  4RGR A;  2YU3 A;  1MDM A;  4KT5 C;  1S7O A;  1FWZ A;  3FXQ A;  3GO5 A;  3GXO A;  1MKM A;  2NAZ A;  1J2X A;  3ROU A;  2GA2 A;  5DDG A;  2P6S A;  3VOE A;  2ELH A;  2FNA A;  3P1Z B;  2D2W A;  3CTA A;  4IRG A;  2R7D A;  5FFZ A;  4A0Y A;  4S04 A;  4TV7 A;  1J75 A;  5K1Y A;  3WTT C;  4LK1 F;  1U2W A;  4BHP A;  4OOI A;  2BV6 A;  2O3F A;  1RZN A;  1MGT A;  2L4M A;  2VE8 A;  4GGG A;  5D5U B;  2PG4 A;  1I6X A;  4ESB A;  4EJT A;  3LAP A;  4I0A A;  4U0V A;  4G94 A;  1EV7 A;  3I59 A;  3ZMT A;  5J8C A;  2W24 A;  5L3B A;  1W7P A;  2PMU A;  2EFO A;  2KJB A;  3BWG A;  1R58 A;  4KIB A;  2XAJ A;  2VBY A;  1T38 A;  2GZW A;  4HLY A;  2GXB A;  3ZMU A;  4LLN A;  1R1U A;  1HH1 A;  2XAS A;  3EYY A;  3HRS A;  1Z6R A;  4G7Z F;  3MZH A;  5CVV A;  3GEZ A;  3HOT A;  4M6X A;  4R1H A;  1ZP7 A;  3JSO A;  5FD5 A;  4A0X A;  1BN5 A;  3DP7 A;  4G9Y A;  3D0S A;  5ICE A;  2Z9O A;  2QEN A;  2VE9 A;  1YS6 A;  1TQI A;  2K86 A;  5FD6 A;  4KN4 X;  1R23 A;  4KDP A;  2DPD A;  2X0L A;  1I1S A;  2ZXJ A;  2JSC A;  2EA4 A;  5L3F A;  4H0E A;  2HWV A;  5LHH A;  1YIO A;  5D8K B;  5H6Q A;  3FXU A;  4ENJ A;  5BMZ A;  3B73 A;  4RS8 A;  1SMY F;  2EV6 A;  2YX4 A;  3GFL A;  2BGC A;  2J5P A;  2O03 A;  3G73 A;  2ZME A;  4E70 A;  2K4B A;  2BEO A;  1R22 A;  5LGU A;  5A2Q K;  1Z91 A;  3E6M A;  3LAJ A;  4YFN F;  2G9W A;  2W25 A;  4UVB A;  3ML6 A;  1K78 B;  1F9N A;  3AJV A;  5LHI A;  3V7C A;  1HQC A;  3G3Z A;  4HV6 A;  2VN2 A;  1R7J A;  1SD6 A;  1A04 A;  2GWR A;  2MH9 A;  5LEJ A;  1Y1O A;  3JTH A;  5KVR A;  1R5H A;  3MQ0 A;  4N0B A;  2RDP A;  4MQ9 F;  2GQQ A;  1YG2 A;  4LLL A;  5D5W B;  2QWW A;  2CSO A;  4ESJ A;  2GW6 A;  1W4M A;  3GZ6 A;  1LQ1 A;  1B1B A;  2OAZ A;  3LQR A;  1FBQ A;  2M1B A;  4KUM A;  3U2R A;  4ZZD A;  1FZP B;  3ZMS A;  3KFW X;  2IA0 A;  5KK1 A;  3QRF F;  1XCV A;  3BOQ A;  3HRT A;  5BQT A;  1YYV A;  3GVA A;  5ICF A;  3N97 A;  3MAJ A;  3GLX A;  4MNU A;  2VOD A;  2QQB A;  3E6B A;  4ZYD A;  4RAY A;  3L2C A;  3D5L A;  3MCZ A;  1Z7U A;  2OKF A;  3R60 A;  4LJZ F;  4CHU A;  3BRO A;  1OMI A;  2YX7 A;  3ECO A;  1QBJ A;  3ABT A;  1O3R A;  1AOY A;  1XCB A;  3C18 A;  1ZAR A;  5JVT A;  4HLX A;  2H6B A;  4G8X A;  2MBF A;  5D6E A;  3TDZ C;  2PQ8 A;  3DXJ F;  3RYR A;  2VT2 A;  2CWE A;  5LGN A;  2RQP A;  3GZ5 A;  1G4D A;  2Z99 A;  2EFP A;  3KP5 A;  3I0T A;  3LWF A;  2LKP A;  3V8J A;  1ZLK A;  4HX4 A;  4ZZL A;  1ZRC A;  4HOB A;  3LA7 A;  4M9Z A;  2WIZ A;  3NRV A;  4L0Y B;  1UB9 A;  3IC7 A;  2O8X A;  3OOP A;  1ZAO A;  2V1U A;  5HVQ C;  5JFR A;  4LFU A;  5D8L B;  1XD7 A;  1W5T A;  1SAX A;  2W57 A;  3KZY A;  1EH7 A;  3WGI A;  1HKT A;  4U88 A;  1U78 A;  3J80 K;  2DT5 A;  3I71 A;  3RKY A;  2HDC A;  4XSZ F;  1JGS A;  2G7H A;  3WG9 A;  1UST A;  3KET A;  2XV4 S;  2EV5 A;  1G3S A;  1R00 A;  5LRR A;  4BHB A;  3BDD A;  2EA2 A;  3MZY A;  1B4A A;  4Z2Y A;  3V7S A;  3T8T A;  4WXC A;  2ISY A;  4M6Y A;  1YW7 A;  3R4K A;  1KU7 A;  2JPC A;  4UVC A;  1HXD A;  1WWX A;  2LSO A;  3NEU A;  4HW0 A;  3BPV A;  1FBU A;  1UHM A;  2KIM A;  1MZB A;  1FYL A;  5CJ9 A;  4G7H F;  5BPD A;  4BAY A;  1QNT A;  2O0Y A;  2Y48 A;  1QZZ A;  1K78 A;  1R36 A;  3I64 A;  2P8T A;  2PLY A;  1BBY A;  4Q47 A;  3RYP A;  3GX4 X;  3ECH A;  3E3V A;  4AIH A;  3L9F A;  2CG4 A;  3HIF A;  2XVC A;  4HA8 A;  1F5T A;  3LA3 A;  5ILU A;  2MA3 A;  2V6C A;  2EFW A;  3QP6 A;  4F7Z A;  1S7A A;  1BI3 A;  1IUY A;  1BC8 C;  2WJ0 A;  1LDD A;  3MEX A;  1XDS A;  4TKK A;  1FP2 A;  4WCG A;  3P9C A;  1K6O A;  3BJO A;  4UHT A;  2YSR A;  5JHU A;  3CJN A;  4ESF A;  3ABU A;  2HTS A;  4S05 A;  2XAF A;  5F64 A;  2EK5 A;  1OYY A;  2FBH A;  4CXF A;  4IVN A;  1T39 A;  2D1V A;  2KKO A;  3RJP A;  2VBW A;  3T0Y A;  4EVI A;  5FO5 A;  3HUG A;  4FHT A;  1VTN C;  3F23 A;  4Y17 A;  5CVR A;  2GJW A;  1JHF A;  3SZT A;  2PFB A;  2BYV E;  4EV0 A;  2FBK A;  3AAF A;  2HTJ A;  2KJC A;  3LST A;  1T6S A;  4L9T A;  2DK8 A;  3HHH A;  1O57 A;  5F1R A;  3GWZ A;  2W84 A;  4M73 A;  4RB0 A;  3I4P A;  4EM2 A;  2XIG A;  3RPQ A;  3RDI A;  4U7B A;  3WTV C;  1G6N A;  1Z1D A;  3WU1 B;  4I7H A;  1KGS A;  1O7F A;  4LD5 A;  1ZHF A;  2L4A A;  2A68 F;  1EH8 A;  1XDU A;  2XRO A;  1FBS A;  2EJR A;  3L00 A;  4LMY A;  2FXA A;  2Z33 A;  4IXA A;  2HZT A;  4EGZ A;  4AVP A;  1PP8 F;  2M30 A;  2UWM A;  2HGC A;  1B59 A;  3LQQ A;  3F8M A;  4IJA A;  2H09 A;  4I0B A;  1T2K A;  4KIC A;  2GA1 A;  3JAM Z;  3ZMV A;  4EM0 B;  3P7N A;  2VC0 A;  4OU0 A;  1FOK A;  5J6X A;  2VON A;  5F6F A;  1OYI A;  3GUD A;  3HTS B;  3QAH A;  1X3U A;  1L0O C;  1WQ2 A;  2Z3Y A;  2IP2 A;  4M72 A;  5FFX A;  1J59 A;  4JBA A;  3IEY A;  4I02 A;  4MQV A;  4OIO F;  2IT0 A;  1BJA A;  3C3W A;  3IKT A;  4AIJ A;  3CUO A;  1JXS A;  1SD4 A;  2MLG A;  2C6Y A;  1H9G A;  2LF8 A;  1U8R A;  1HKS A;  4DQ2 A;  4I01 A;  3O3K A;  4WXH A;  1J0R A;  5FLX Z;  2DBB A;  4AIK A;  4KNY A;  5HDK A;  3R6S A;  5ICG A;  4O6J A;  3T1B A;  4IRI A;  3K2Z A;  4P9F A;  3BJA A;  3FM3 A;  4M9X A;  5E8G A;  3F8B A;  5DD4 A;  3VFZ A;  4P96 A;  5HOO A;  1D3Y A;  4UXN A;  2KIF A;  3E5X A;  1ZG3 A;  2XAG A;  2EB7 A;  1USS A;  1P6R A;  3E6D A;  5DCM B;  4HF2 A;  2QUF A;  2OST A;  1ON1 A;  1WI9 A;  2V9V A;  4RGX A;  3HSR A;  2WIW A;  2KIU A;  2E1N A;  4BXU A;  1IN6 A;  2VOP A;  5AIP A;  4MTE A;  3HSF A;  2STW A;  3QP5 A;  1T98 A;  1IN5 A;  1OPC A;  1QZY A;  4CGZ A;  3N4M A;  3FF5 A;  4MTD A;  3P9I A;  2FBI A;  5JR3 A;  5E18 F;  3ZN1 A;  4LB5 A;  2MH2 A;  2X4H A;  3F6V A;  2M45 A;  2FML A;  4U0Y A;  4BQA A;  1SFU A;  1I5Z A;  2A6E F;  3KCC A;  1DP7 P;  2XUB A;  4LK0 F;  1A79 A;  3F8F A;  4HAM A;  4Y13 A;  3IRR A;  3M8F A;  4ENK A;  2R7F A;  3FMS A;  2O61 A;  1REP C;  4MGR A;  3TO7 A;  4P9U A;  1YO5 C;  3KE2 A;  1RIO H;  2HYG D;  1DPR A;  5FB2 A;  3QPT A;  1WSU A;  4HYE A;  4R8H A;  1B6A A;  3KP3 A;  3IL2 A;  4KIG A;  1ZRF A;  2V79 A;  2QZ8 A;  5EEH A;  2QLZ A;  3MFK A;  2NRA C;  6PAX A;  1YFH A;  5K5O A;  1RLV A;  1QQI A;  1PUE E;  1LNW A;  4EJU A;  1MJ9 A;  3SXY A;  3O6B B;  4TKD A;  3COA C;  5HDG A;  1SFX A;  2A3S A;  5HLI A;  1E2X A;  5LRS A;  2YPR A;  1IN7 A;  3WE3 A;  3H3U A;  3ULQ B;  2PMH A;  2PEX A;  2R3S A;  3SHF A;  4YII A;  1OB9 A;  1FYK A;  5HS7 A;  1U5T B;  2UXX A;  2OZU A;  5D5V B;  2E7X A;  1IN4 A;  3M8E A;  3IWF A;  2EO0 A;  1TW3 A;  1ZN2 A;  1S6L A;  2BE5 F;  1O7L A;  2J5O A;  4LB6 B;  1B9N A;  4HQE A;  1P4W A;  3OV8 A;  3EET A;  2DTR A;  1KU9 A;  1CGP A;  5D6F A;  2XAH A;  4EGY A;  3HSE A;  2A07 F;  2FCO A;  3SQN A;  1IXR C;  2CQK A;  2TDX A;  1YS7 A;  4M9S A;  1HKQ A;  3I53 A;  2B0L A;  4CDG A;  1H9T A;  1TQM A;  2D45 A;  1O3T A;  2HKX A;  2IRF G;  5A2Q Z;  3TOB A;  4HX8 A;  3KP2 A;  1R5G A;  1WRJ A;  4I2O A;  4GCV A;  1XMK A;  4L9N A;  1SMT A;  2DFI A;  1O3S A;  4KMF A;  1S3J A;  2H27 A;  3IKV A;  3DV8 A;  2ETH A;  5AIQ A;  5AON A;  3T8R A;  3F21 A;  1Y88 A;  5CLS A;  1SD7 A;  1STZ A;  1G3Y A;  1L3L A;  3EDP A;  2HR3 A;  2D1H A;  1XB4 A;  2QYO A;  3KP4 A;  1HST A;  3GYH X;  5DCM A;  2OD5 A;  2NS0 A;  1KA8 A;  2A5Y B;  5ILV A;  2OA4 A;  3RKW A;  4BH9 A;  2LF7 A;  5D5X B;  2CW0 F;  4RGS A;  4D0P A;  4A12 A;  4KIF A;  3P9K A;  3WE2 A;  2OQR A;  5D4S A;  1IF1 A;  2HEO A;  4O5V A;  2K4J A;  4NHJ A;  1FSH A;  2NYX A;  3KZZ A;  2WC2 A;  3DNX A;  4OIN F;  2JPB A;  2GIV A;  2FE3 A;  1ONV A;  2BBY A;  3QOP A;  2A69 F;  3ERE D;  2FQ3 A;  4EJV A;  5J8F A;  3O2P E;  3VEP A;  2OQG A;  3WTW C;  3HRU A;  5ILS A;  3GF2 A;  2ADU A;  1DDN A;  4G6D A;  1WKM A;  2HOE A;  3CO7 C;  5DUK A;  5DYM A;  2XAQ A;  3TO9 A;  4L9J A;  4JK1 X;  3VOD A;  3KEO A;  1QPM A;  1ZH5 A;  4KN7 X;  2A61 A;  1P92 A;  2ESH A;  1XGS A;  1W7P D;  2VOO A;  5E17 F;  2FOK A;  1LB2 A;  5L3C A;  1V4R A;  4HQM A;  5CVI A;  4OMZ A;  3FM5 A;  4ENN A;  3KLN A;  4ENM A;  2M5W A;  1XSX A;  1HSJ A;  5K5R A;  5E1X A;  3RI4 A;  3HOS A;  1LEA A;  1RI7 A;  3J80 Z;  2K27 A;  1U5T A;  1J7K A;  2F5C A;  3JSP A;  2QQA A;  4HDV A;  1QGP A;  1ZG5 A;  3FZV A;  3TKY A;  1YQA A;  5LLQ A;  4WK8 F;  5CVU A;  1D5V A;  3WOD F;  3K9T A;  5LHG A;  2EV0 A;  2MC3 A;  3V8L A;  3T5X A;  5HDN A;  4MEY F;  1FNN A;  3M7G A;  3M9A A;  4U0W A;  2Q8K A;  2M8E A;  1Z9C A;  3WTU C;  4M74 A;  3ISP A;  1ZG1 A;  3L7W A;  2RV8 A;  4CIC A;  3FHZ A;  2HQN A;  3J7A O;  2FRH A;  4B09 A;  2VT3 A;  3K0L A;  2H6C A;  2Z5U A;  5CVJ A;  2V1X A;  4OMY A;  4A2U A;  5EEG A;  4PGG A;  5H6R A;  5IT9 K;  2JZY A;  1D8K A;  5DD8 A;  4I09 A;  3DQV C;  1NHA A;  4EJO A;  2Y75 A;  4AD9 A;  1UFM A;  2NNY A;  3TDU C;  1AWC A;  3R0A A;  5FDK A;  1XSD A;  3U9G A;  2IJL A;  2UZK A;  4JQF A;  4KMU X;  3PFI A;  1D8J A;  3WGG A;  4FX0 A;  3WTY C;  2WV0 A;  5E8I A;  3F72 A;  3J81 K;  2HYF A;  1XGO A;  1FY7 A;  2EFQ A;  3RPU A;  2JRT A;  4AWX B;  1DUX C;  1P2F A;  3W6K B;  3KEQ A;  1S8N A;  2MD5 A;  4L5I A;  1R1T A;  2QVO A;  1IXC A;  4U7D A;  1ZGA A;  2M87 A;  4QLC U;  4ON0 A;  2IW5 A;  2ZNZ A;  2CYY A;  3E5U A;  3I54 A;  2VLD A;  3ZN0 A;  4O3M A;  5ICC A;  3E5Q A;  3EUH A;  4OIQ F;  3CLO A;  1GXP A;  4Q4Z F;  1YTY A;  4PZJ A;  1OB8 A;  3GFM A;  4OIR F;  2ZFW A;  2EWN A;  3CO6 C;  5FLX K;  1B9M A;  3R0J A;  2F5D A;  4ZH4 F;  5DCF A;  4GYG A;  3ZPL A;  4BNC A;  3F22 A;  2VBX A;  4YFX F;  1KYW A;  1GVJ A;  4A6E A;  3F8C A;  4IRH A;  3MWM A;  1YW9 A;  4LLG F;  3WU0 A;  1TBX A;  4DNC A;  2DW4 A;  2PI0 A;  1FLI A;  3DF8 A;  3TGN A;  2V1D A;  3GFI A;  2IVM A;  5HLG A;  4OIP F;  2DLL A;  4CZZ A;  1R11 A;  1FP1 D;  2HS5 A;  3BP8 A;  4YFK F;  1FC3 A;  1G3W A;  4UVA A;  4XBF A;  1BI2 A;  1Z6T A;  2MLK A;  2GAU A;  2W85 A;  5D4R A;  1JE8 A;  2UXN A;  1RNL A;  3C1D A;  4M71 A;  2LNB A;  2CO5 A;  1JHH A;  1XGM A;  3FXR A;  3WTX C;  1FYM A;  1GHC A;  1BI0 A;  4IPA A;  1LJ9 A;  2QQ9 A;  1TNS A;  4ZYG A;  1TTY A;  1I27 A;  4HV5 A;  1IRF A;  4LG0 B;  2ZO4 A;  1TNT A;  4Q48 A;  2O6G E;  4P55 A;  2JTV A;  1K79 A;  3JW4 A;  5DEQ A;  4RAZ A;  1F4K A;  1MJB A;  1ULY A;  2ZNY A;  1XMX A;  4QBN A;  3F8N A;  3QPH A;  3HTU A;  5FGM A;  3E97 A;  4HBL A;  2FNP A;  1E17 A;  1BIB A;  2CGP A;  2DI3 A;  1U3E M;  2E7W A;  5HLH A;  3TQN A;  1ZYR F;  2PBI A;  1CF7 B;  4XSX F;  3IHU A;  5L3E A;  1I1G A;  2STT A;  5E1Z B;  1XMA A;  1ZGJ A;  4KFC A;  1R1V A;  1MD0 A;  3U1D A;  3V8K A;  2ISZ A;  3ELK A;  1XSV A;  4R79 A;  1OKR A;  3HRM A;  2QM3 A;  4UUV A;  1KYZ A;  1KQ8 A;  4HF0 A;  2DU9 A;  1BI1 A;  4UV9 A;  1ON2 A;  3WTZ A;  1HBX G;  1U5T C;  2QBY B;  1TQP A;  2ZYZ A;  2OBP A;  3HHG A;  4EM1 A;  2GXG A;  3DPT A;  2VBZ A;  4FT8 A;  2DK5 A;  1Q1H A;  2P5K A;  1W5S A;  2WTE A;  1IAW A;  2KRF A;  1Y0U A;  2JT1 A;  1HW5 A;  4FX4 A;  5JI6 A;  4ZYE A;  4ZYH A;  1K7A A;  2XRN A;  2DQR A;  4G7O F;  1P4X A;  4QBO A;  3REO A;  2L02 A;  2P6T A;  3ZP5 A;  4HDU A;  1MJA A;  3PQJ A;  4MHG A;  3BJ6 A;  3QU3 A;  1PP7 U;  4A5N A;  4PDK A;  4CYD A;  4A5M A;  2ZKZ A;  3DFG A;  3PQK A;  1HW2 A;  2VC1 A;  3K69 A;  3P1Z A;  3F3X A;  1LEB A;  3GW2 A;  2XKO A;  2F5F A;  2AS5 F;  2INB A;  3KP6 A;  3TOA A;  4KYW A;  4GYI A;  4CO8 A;  1RUN A;  3EQL F;  5E1W A;  2DO7 A;  2WWY A;  4L18 B;  4XLN F;  2ACJ A;  1XGN A;  1FT9 A;  3I5U A;  4RB3 C;  4EMS A;  3TO6 A;  2RKH A;  2P7V B;  4LGW A;  1R0V A;  3DKW A;  2G7U A;  4EJW A;  2PN6 A;  5BS6 A;  1J5Y A;  1XN7 A;  4BYY A;  3S2W A;  3B02 A;  3SFZ A;  4IHT A;  1LDJ A;  2F2E A;  3Q5F A;  3EYI A;  4ETS A;  1IW7 F;  2RN7 A;  4LG0 A;  2FEZ A;  2HQR A;  1IRG A;  2WCW A;  1IPI A;  4Q5S F;  2K7L A;  3H92 A;  4YIF A;  1FSE A;  1UHW A;  2ZJ2 A;  2E1C A;  2Y0M A;  2L3D A;  3KLO A;  4UNO A;  2NNN A;  4PGH A;  5TRD A;  2P7C B;  1C0W A;  3W6J B;  3Q9S A;  2HKO A;  3BY6 A;  1BOA A;  2FA5 A;  2CV8 A;  3CUQ B;  3LA2 A;  4G6Q A;  4HX7 A;  3V4G A;  1P4A A;  2IPQ X;  3RKX A;  3C7J A;  1CF7 A;  1TLH B;  3CUQ C;  2P5L C;  3SZP A;  4Y15 A;  5CYV A;  4WX9 A;  3V7R A;  4WWC A;  1MDM B;  5L3D A;  1RZ4 A;  2XGX A;  3Q9V A;  4NB5 A;  4MEX F;  2ESN A;  1KQ9 A;  4L9V A;  2K02 A;  4ASN A;  1Z05 A;  2L01 A;  3BZ6 A; 
#chains in the Genus database with same CATH topology
 1X2N A;  3PO3 J;  2N8G A;  2XF5 A;  3ZQQ A;  3WTS C;  3VPR A;  2P5V A;  1K4T A;  1Y1V J;  3OMY A;  4EQQ A;  2VI6 A;  5K7Z A;  1RUO A;  4RB1 A;  2BW3 B;  2XPW A;  4RGU A;  2M7B A;  4M3G A;  4XLF A;  3BCA A;  4LIV A;  5BOX A;  3RKQ A;  1FMV A;  1U6G A;  3WGH A;  2MAB A;  5IT3 A;  2LBF B;  2PJP A;  3FXK A;  1G2H A;  2IA2 A;  2QBY A;  2HXI A;  2AXL A;  1LVA A;  2HNH A;  1G3T A;  1S29 A;  2CUE A;  5IP6 A;  2ZXH A;  3VDX A;  3HOZ J;  3F6O A;  5J1U A;  3BG3 A;  1MBH A;  1KU2 A;  4IHS A;  3HG9 A;  4NQW A;  3VB2 A;  5L3G A;  2XHK A;  5HS8 A;  2IA1 A;  1BL0 A;  1ZRE A;  4FTH A;  4G12 A;  2W82 A;  3G1M A;  1GEF A;  3A1Y A;  4ZDL A;  2XKP A;  4HF1 A;  1T95 A;  3I59 B;  3HB9 A;  3FMQ A;  3E1S A;  4A3M J;  4UV8 A;  1UCR A;  5M3F J;  1W7P B;  2ZCW A;  1EH6 A;  1VF9 A;  3CC2 I;  2ELK A;  1PDN C;  4B47 A;  2DPU A;  3HBL A;  1ERD A;  1R71 A;  4A3C J;  1F1Z A;  4N9I A;  3MD2 A;  1ZRD A;  2F5E A;  1HW1 A;  2RC4 A;  3K1P A;  4PCQ A;  5H20 A;  1IV8 A;  2DOA A;  4C2T A;  3LFK A;  3ABL H;  4B8X A;  4BHC A;  3GTM J;  5K7H A;  4PJL A;  1QO0 D;  3FX3 A;  1PJR A;  1UG2 A;  1YLF A;  3JRB A;  2MC4 A;  2HOT A;  4K2E A;  4XKC A;  1GXQ A;  1MW7 A;  2Q2E A;  2LOO A;  1NTC A;  3GFJ A;  1N25 A;  1DPU A;  3C2G A;  4I99 C;  3CDH A;  3HOW J;  3KYL A;  4XIC A;  3S1R J;  1LKX A;  1FPQ A;  5ERI A;  5LEK A;  2AQE A;  1TW2 A;  2FSW A;  3DEU A;  1O3Q A;  3JTG A;  4HNU A;  4XN0 A;  4GXO A;  3ZQ7 A;  4WF2 A;  1D0Y A;  2OU2 A;  2GLO A;  3QU6 A;  1MBF A;  3C2H A;  2XB5 A;  3GTO J;  1WJE A;  3H3Z A;  4J19 A;  2Y0S N;  1H0M A;  2G0E A;  3FWE A;  2BHY A;  4L5J A;  1IN8 A;  2IGO A;  1HOM A;  1WH5 A;  4D7M A;  1BIA A;  1K83 J;  5HNH A;  3O8G A;  5B3S H;  2P4W A;  3FOV A;  4GO1 A;  1SD5 A;  1KU3 A;  1Y56 A;  4QBL A;  3H9J A;  3DPL C;  2UV1 A;  4QWQ A;  2DAO A;  4B48 A;  4PJM A;  3DBR B;  2KHM A;  3NQO A;  2IEK A;  4HNV A;  1ZLJ A;  5M3M J;  3IRQ A;  1SFE A;  4P5O A;  2BXY A;  2RVC A;  2COM A;  2VXZ A;  4YG2 F;  1AU7 A;  3JAM K;  2FUG 2;  3ZMD A;  1LE8 B;  1S5L C;  1T0F A;  1J09 A;  3OYA A;  5C44 J;  1OYW A;  2WCZ A;  2CFO A;  3RTR A;  2CFX A;  1IZ1 A;  4PSX A;  4HZF A;  2P81 A;  3QYF A;  1KQ0 A;  3E6C C;  3M1E A;  4YEJ A;  1FOX A;  3HKZ N;  3R61 A;  2DA1 A;  2FU4 A;  2OZ6 A;  3HZJ A;  2ZME B;  2LDU A;  4JX5 A;  5F04 A;  1JTX A;  2OCE A;  1OR7 A;  3I58 A;  5HS9 A;  1MMD A;  4YIR X;  2LD5 A;  4A6D A;  3ZMZ A;  2R7Z J;  1JI8 A;  1BM9 A;  1OCP A;  4WXD A;  3K1N A;  1GLN A;  3FMR A;  1ZTR A;  5BPI A;  1I6H J;  2OV7 A;  2A6H F;  1LDK B;  1ODD A;  3RIR A;  5TJJ A;  1J9I A;  4XOT A;  3KZI C;  1UAA A;  1YW8 A;  2HFH A;  2L54 A;  2M2E A;  4OAY A;  3OOU A;  3SDB A;  5F0F A;  2Q0O A;  2DN0 A;  2YR2 A;  3AJV B;  1FX7 A;  2JA6 J;  2CU7 A;  1QU3 A;  3BZC A;  5E20 A;  3SFI A;  3GTP J;  3WU2 C;  5FJ8 J;  1V3F A;  4L0Z B;  2ZYZ B;  2IXS A;  5IT9 Z;  4XLP F;  2XRL A;  2H94 A;  4BS9 A;  1MNE A;  3HOX J;  2WAQ A;  4RB2 C;  4CSW A;  2KRH A;  5LGT A;  3CD6 I;  2KLO A;  2KT0 A;  1WPK A;  4KA4 A;  3GBG A;  3BPX A;  4AC0 A;  2EFN A;  2JVG A;  1N75 A;  1APL C;  3PNY A;  4A0Z A;  3MZ8 A;  4IF4 A;  4LIU A;  3CUQ A;  3ABM H;  4N9H A;  3K1M A;  3FIW A;  3IWZ A;  2X1C A;  1IXS B;  2RNJ A;  5DUI A;  2DQL A;  1ACI A;  5DV5 A;  1BC7 C;  3I4N J;  2FF4 A;  5ED4 A;  3P1Y A;  3KP7 A;  4RA2 A;  2FMY A;  5K5Q A;  4QPO A;  3L09 A;  2KZV A;  3VWB A;  2ZBK A;  4XRF A;  2RQQ A;  2YS9 A;  5LBQ A;  4I98 B;  3CCE I;  1K6Y A;  2RGV A;  3J81 Z;  1WJ5 A;  3HYI A;  2YU3 A;  4RGR A;  1MDM A;  1D5Y A;  4KT5 C;  3KEY A;  1S7O A;  1FWZ A;  3FXQ A;  3GO5 A;  2JK3 A;  5FKN A;  3GXO A;  1MKM A;  5E3O A;  2KQR A;  2NAZ A;  1J2X A;  3ROU A;  2GA2 A;  3JRF A;  5DDG A;  2P6S A;  3HOU J;  3VOE A;  4MIM A;  2FQ4 A;  2ELH A;  4LG3 A;  1WHU A;  1A5J A;  2FNA A;  4UUS A;  3P1Z B;  2D2W A;  3AG3 H;  3CTA A;  4IRG A;  2EQR A;  2XB0 X;  2CQ7 A;  1RKW A;  2R7D A;  2XPU A;  5FFZ A;  4A0Y A;  3TW7 A;  4S04 A;  4TV7 A;  5IOZ A;  1J75 A;  1ETX A;  4C3J J;  2ICW G;  5K1Y A;  3WTT C;  1T56 A;  2BXZ A;  4LK1 F;  1U2W A;  2BW3 A;  2FLC A;  4RMN A;  1A35 A;  4BHP A;  2K9M A;  4OOI A;  2LBF A;  5J40 A;  2BV6 A;  1X4P A;  2O3F A;  3CP2 A;  1RZN A;  1MGT A;  1SEU A;  2L4M A;  2VE8 A;  4GGG A;  5D5U B;  2K9L A;  3NWT A;  4EAT A;  4J00 A;  2PG4 A;  1I6X A;  5FKO A;  4ESB A;  1EJ9 A;  4EJT A;  4CCO A;  2OTL I;  3LAP A;  4FE4 A;  4ANJ A;  2E1M B;  4XKB A;  2DDB A;  4A93 J;  2AO9 A;  1W1W E;  4I0A A;  1Y39 A;  4U0V A;  3OS2 A;  4G94 A;  1EV7 A;  3I59 A;  3ZMT A;  5J8C A;  1IGN A;  2W24 A;  5L3B A;  1W7P A;  4B44 A;  3LNQ A;  2PMU A;  2ZC2 A;  3P5J A;  1OCT C;  2EFO A;  2KJB A;  3BWG A;  5F1J A;  5M5W J;  1R58 A;  1TC3 C;  4KIB A;  5EG0 B;  3CZ6 A;  2XAJ A;  2PJR B;  2VBY A;  3OYL A;  2DOF A;  1T38 A;  2GZW A;  3H9Q A;  5JLX A;  4HLY A;  2GXB A;  3ZMU A;  2QSG X;  4LLN A;  1R1U A;  1HH1 A;  2XAS A;  3EYY A;  4BL0 B;  3HRS A;  1H89 C;  1Z6R A;  2E36 A;  4G7Z F;  3MZH A;  4DYQ A;  1XTA A;  4MO7 A;  5CVV A;  3GEZ A;  1HA8 A;  3HOT A;  3S3O A;  4X1E A;  3LSI A;  4DAP A;  3OL4 A;  4M6X A;  3MKW B;  3Q0V A;  4R1H A;  1ZP7 A;  3W6V A;  3JSO A;  5FD5 A;  4A0X A;  4AM3 A;  4ZTF A;  3K4J A;  4FE7 A;  1BN5 A;  3DP7 A;  4G9Y A;  3SJM A;  3H5A A;  1RKT A;  3H1C A;  3D0S A;  5ICE A;  3ZQH A;  2QEN A;  2VE9 A;  2Z9O A;  3ERM A;  2VKV A;  1YS6 A;  4FET A;  4ZTJ A;  1TQI A;  2K86 A;  5FD6 A;  3QWL A;  4KN4 X;  4BQO A;  2EZK A;  3CQZ J;  4E7J A;  1R23 A;  1F36 A;  4KDP A;  3BQZ A;  4BBS J;  5EF6 A;  4U87 A;  3A0B C;  2DPD A;  3CJQ B;  2X0L A;  1I1S A;  2V9P A;  2ZXJ A;  2NXN B;  3QYE A;  2JSC A;  2EA4 A;  5L3F A;  4H0E A;  2BOL A;  2CUF A;  2HWV A;  5LHH A;  2AHQ A;  1YIO A;  5D8K B;  4D5C A;  3H5N A;  5H6Q A;  3FXU A;  1LE8 A;  4ENJ A;  5BMZ A;  3B73 A;  4RS8 A;  1SMY F;  2TRT A;  1IV6 A;  2EV6 A;  2OPT A;  2YX4 A;  3GFL A;  2BGC A;  2J5P A;  2O03 A;  1R4N B;  4BDY A;  5GP9 A;  3G73 A;  1Z7L A;  2ZME A;  4E70 A;  2K4B A;  2V6E A;  2BEO A;  1OIS A;  3QPS A;  2HQA A;  1R22 A;  3PO2 J;  5LGU A;  3GTQ J;  5A2Q K;  2Z1D A;  1Z91 A;  3E6M A;  2W00 A;  3LAJ A;  4YFN F;  2G9W A;  2W25 A;  4UVB A;  3ML6 A;  2JVH A;  1K78 B;  3FK6 A;  2V1N A;  1F9N A;  4W97 A;  3AJV A;  5LHI A;  3DTI A;  3V7C A;  1HQC A;  2DJN A;  3G3Z A;  4HV6 A;  2VN2 A;  2DFE A;  3S17 J;  1R7J A;  1SD6 A;  1ORK A;  1A04 A;  5C4X J;  2GWR A;  2MH9 A;  5LEJ A;  1Y1O A;  3JTH A;  4YRV A;  5KVR A;  1R5H A;  3H35 A;  3MQ0 A;  4N0B A;  2RDP A;  4MQ9 F;  2WB1 N;  4XLA A;  1YJW I;  2GQQ A;  1QVU A;  2WAF A;  3JRG A;  1YG2 A;  4AUX A;  3HPH A;  1JKO C;  1VQL I;  4LLL A;  4CA0 A;  5D5W B;  2H1L A;  3BR5 A;  2QWW A;  2LY1 A;  2CSO A;  4ESJ A;  5TIS C;  2GW6 A;  3BG5 A;  1W4M A;  4C30 A;  3GZ6 A;  1LQ1 A;  2HU9 A;  1B1B A;  2OAZ A;  3LQR A;  1X1P A;  4NUB A;  3HL2 A;  1FBQ A;  2M1B A;  4FIS A;  2JJQ A;  4KUM A;  3U2R A;  2EZI A;  4ZZD A;  3DTE A;  3K10 A;  2HOS A;  1MBJ A;  2WBM A;  1FZP B;  3ZMS A;  4F91 B;  3KFW X;  2IA0 A;  5KK1 A;  4A3F J;  3K4K A;  1XCV A;  3QRF F;  3GTG J;  1MMA A;  3BOQ A;  3HRT A;  5BQT A;  1TZL A;  1YYV A;  1X1D A;  5EZH A;  1B72 B;  1P7I A;  3GVA A;  3OIQ A;  5EEA A;  5ICF A;  3S8P A;  3N97 A;  3MAJ A;  3RPU D;  3GLX A;  4MNU A;  2CZR A;  3A03 A;  2VOD A;  2QQB A;  3E6B A;  1P7J A;  1GV2 A;  4ZYD A;  4RAG A;  2L9S A;  4ZYA A;  4RAY A;  3L2C A;  4PUS A;  3D5L A;  2AXT C;  3MCZ A;  1Z7U A;  2HZD A;  3OYH A;  3R60 A;  2OKF A;  2IS4 A;  4XR6 A;  2COB A;  4LJZ F;  3BR0 A;  4CZC A;  2HOA A;  2Z2S B;  4XMY A;  4CHU A;  2VQL A;  3BRO A;  3DEE A;  1OMI A;  2YX7 A;  4BQN A;  3ECO A;  3M1C A;  1QBJ A;  3ABT A;  1O3R A;  1AOY A;  1XCB A;  4EEF G;  1HCR A;  5GPA A;  3C18 A;  1ZAR A;  5JVT A;  4HLX A;  1MNM C;  3HUG B;  1YX3 A;  1JTY A;  3BTJ A;  2H6B A;  4G8X A;  2M8G X;  2IGN A;  2MBF A;  5D6E A;  2BZT A;  3TDZ C;  2PQ8 A;  4XKW A;  2TCT A;  4CCK A;  3DXJ F;  3RYR A;  2VS1 A;  2VT2 A;  4W1U A;  2CWE A;  1YJ9 I;  5LGN A;  1IDY A;  2RQP A;  3GZ5 A;  4IO9 F;  1G4D A;  2E2I J;  4Y52 J;  2Z99 A;  4NNJ A;  1ZR2 A;  2EFP A;  1E3H A;  1T0F C;  3KP5 A;  1JJ6 C;  1NK2 P;  3I0T A;  2DMU A;  3LWF A;  1IDZ A;  1MMN A;  2LKP A;  3ZCO A;  4G6U A;  3V8J A;  4XLE A;  1QA6 A;  3FBI B;  3O8H A;  1ZLK A;  4HX4 A;  3CCY A;  1RES A;  2IAI A;  4ZZL A;  1ZRC A;  2JA2 A;  4HOB A;  4BJ6 C;  2DBS A;  2K9N A;  3LA7 A;  4M9Z A;  2WIZ A;  5EG0 A;  3NRV A;  2PJR A;  4L0Y B;  1IUF A;  1UB9 A;  1ZK8 A;  3IC7 A;  2KPM A;  2O8X A;  1U0J A;  4DYR A;  1MH4 A;  3OOP A;  1BR1 A;  1ZAO A;  2ID3 A;  2V1U A;  3D5R C;  3H5R A;  1YRN B;  1HDP A;  5HVQ C;  5FRM A;  3PNV A;  5JFR A;  2H1K A;  4PJ0 C;  1R5I D;  4LFU A;  4XQF A;  3BC8 A;  5C4J J;  5D8L B;  2DA2 A;  3EUK L;  5HNF A;  1XD7 A;  1W5T A;  5CPR B;  1SAX A;  2W57 A;  3KZY A;  3BG7 A;  1EH7 A;  3WGI A;  1HKT A;  1RPW A;  2LKX A;  4AYB A;  4U88 A;  1U78 A;  4A69 C;  3PSI A;  3J80 K;  2DT5 A;  3BZK A;  3I71 A;  3RKY A;  3K4C A;  2HDC A;  3A0H C;  2M0M A;  3LSM A;  4XSZ F;  3OY9 A;  1JGS A;  2G7H A;  2Y30 A;  3WG9 A;  2FKH B;  1UST A;  3KET A;  3G6E I;  1KON A;  1BR2 A;  2XV4 S;  3HC7 A;  2OJE D;  2EV5 A;  2DA7 A;  1G3S A;  1XS9 A;  3TP3 A;  3HPG A;  2NOG A;  5FKK A;  3CLQ A;  4XK4 A;  3DLA A;  4IQJ A;  1R00 A;  2R7W A;  5LRR A;  3G1L A;  4BHB A;  2R7U A;  3BDD A;  2EA2 A;  3OSG A;  1WJA A;  3MZY A;  1ETQ A;  2I5U A;  1B4A A;  2HPI A;  4Z2Y A;  3V7S A;  4C2M J;  3T8T A;  4WXC A;  2ISY A;  4M6Y A;  1I3Q J;  1YW7 A;  1UMQ A;  3R4K A;  1KU7 A;  2VKE A;  4IL6 C;  2JPC A;  3PJR A;  4UVC A;  2EIN H;  2RNG A;  2LYC A;  3OR2 C;  2QKM B;  4CYC B;  1HXD A;  1WWX A;  2LSO A;  3NEU A;  4HW0 A;  3U1K A;  1BR4 A;  3BPV A;  3IEY B;  1FBU A;  1UHM A;  2JRM A;  5EYR A;  2KIM A;  3OR1 C;  1MZB A;  1FYL A;  4ZJZ A;  1HLV A;  4NC7 A;  5CJ9 A;  4G7H F;  5BPD A;  4XOP A;  2QEX I;  3U21 A;  4BAY A;  3K7A J;  3MVP A;  2DT7 B;  3W2V A;  1QNT A;  2O0Y A;  2Y48 A;  1QZZ A;  1K78 A;  1PYV A;  1R36 A;  3I64 A;  2P8T A;  2X1E A;  2PLY A;  1BBY A;  3G71 I;  4Q47 A;  3RYP A;  3GX4 X;  3ECH A;  3E3V A;  5KAF C;  2B9S A;  4AIH A;  2ZSI B;  3L9F A;  2CV2 A;  3CCV I;  2CG4 A;  3H9G A;  1ITY A;  3HIF A;  1XX5 A;  1X1A A;  4E7K A;  1SFO J;  2XVC A;  4HA8 A;  2VKH A;  3OYI A;  3WHC A;  1F5T A;  2QSH X;  3LA3 A;  5ILU A;  4UY8 I;  2KRC A;  2MA3 A;  2JA7 J;  2V6C A;  4JX6 A;  1V5G A;  2E5N A;  2EFW A;  2WV1 A;  1I39 A;  1Q1V A;  3GZN B;  3CMY A;  4DBR A;  3QP6 A;  4F7Z A;  1X1B A;  1S7A A;  1SVO A;  4ITV A;  4Y3O A;  3CCQ I;  1BI3 A;  4HNT A;  3S32 A;  2HVQ A;  3CF2 A;  5J3L A;  2F48 A;  1IUY A;  3DLL F;  1UG0 A;  3CDL A;  1BC8 C;  1VQ7 I;  2LKS A;  2WJ0 A;  2NVY J;  3K4M A;  1YIJ I;  1LDD A;  3ONQ A;  3MEX A;  3IH4 A;  4BEH B;  2HQ5 A;  1H8A C;  1XDS A;  1B72 A;  2MYS A;  2E2H J;  4TKK A;  1FP2 A;  3LL7 A;  3D1N I;  4WCG A;  3P9C A;  1K6O A;  3BJO A;  3F9K A;  4UHT A;  4CCN A;  2X85 A;  4II3 A;  2YSR A;  4D5F A;  5JHU A;  3W2W A;  3CJN A;  3ZQC A;  4ESF A;  2DJI A;  3F0C A;  1V5E A;  3ABU A;  2JJ7 A;  4M3D A;  5GAG J;  2HTS A;  2VJI A;  3PFY A;  1DQU A;  4M6V A;  3HXL A;  4B3X A;  2E1O A;  2XAF A;  4S05 A;  5F64 A;  3IV5 A;  1WGX A;  3FIS A;  2EK5 A;  5IYD J;  1OYY A;  2FBH A;  4DIQ A;  4IVN A;  4CXF A;  1VQN I;  3S1N J;  2L7Z A;  2R7T A;  4CCL A;  3J7Z I;  1T39 A;  3S1M J;  2D1V A;  3FHN A;  3TP0 A;  4F55 A;  2KKO A;  2VQC A;  1LUJ B;  2LFB A;  3RJP A;  2R0Q C;  1NG6 A;  2VBW A;  2NS8 A;  3T0Y A;  4EVI A;  4D9J A;  2WAD A;  4UUT A;  2DA3 A;  1Y8Q B;  5FO5 A;  3HUG A;  5GAH J;  2Y31 A;  3I4M J;  4FHT A;  2NVU B;  4A3B J;  2JA8 J;  1VTN C;  3F23 A;  1VZ0 A;  4Y17 A;  1W5C C;  3FBN B;  5CVR A;  2GJW A;  1JHF A;  1ETV A;  2VKD A;  3SZT A;  2PFB A;  2BYV E;  4EV0 A;  1OCZ H;  1LFB A;  4KT6 A;  2FBK A;  2ZFU A;  3OYC A;  3A4C A;  3AAF A;  1FJL A;  2HTJ A;  2KJC A;  4I76 A;  2EH3 A;  2CMP A;  1VND A;  1T6S A;  3LST A;  2DK8 A;  4L9T A;  3CMM A;  3HHH A;  1O57 A;  4NBQ A;  1WI3 A;  2CUJ A;  2ZME C;  5F1R A;  3UR3 C;  3ZQF A;  3GWZ A;  2W84 A;  4M73 A;  4RB0 A;  1D0X A;  3I4P A;  1Z67 A;  1W36 D;  1U8B A;  4EM2 A;  2XIG A;  3IAM 2;  4H4K C;  3RPQ A;  3RDI A;  2FL3 A;  3DU5 A;  1U9O A;  1QHG A;  1YRN A;  2LVS A;  4U7B A;  3WTV C;  1G6N A;  1Z1D A;  2EZL A;  3WU1 B;  2LRD A;  5BNG A;  2QA4 I;  4I7H A;  2FKC A;  4A3G J;  3PUB A;  5EGO A;  2F5V A;  3K2A A;  1KGS A;  1O7F A;  4LD5 A;  4PFO A;  1ZHF A;  2L4A A;  2A68 F;  1IC8 A;  1EH8 A;  1XDU A;  2XRO A;  1FBS A;  2EJR A;  3L00 A;  4LMY A;  1SAN A;  2FXA A;  2Z33 A;  4IXA A;  2CV0 A;  2HI3 A;  2R7X A;  2HZT A;  5GAE J;  2CH0 A;  2Y2Z A;  3DEW A;  4EGZ A;  3SDG A;  4AVP A;  2AQF A;  1PP8 F;  2M30 A;  2E5Z A;  2LLK A;  3S2D J;  2UWM A;  1MMG A;  3IUO A;  2HGC A;  1OQY A;  2DA6 A;  1B59 A;  3LQQ A;  3F8M A;  4IJA A;  2L9N A;  4DOZ A;  3CME I;  2H09 A;  4I0B A;  2E60 A;  3HOV J;  1T2K A;  4KIC A;  2GA1 A;  3JAM Z;  1SVL A;  1YX5 A;  3ZMV A;  4KIT B;  4EM0 B;  3P7N A;  1Y1W J;  2K9Q A;  1XG1 A;  1EKE A;  2F4M B;  2VC0 A;  4OU0 A;  4A3I J;  1FOK A;  1WCM J;  2F4O B;  5J6X A;  1Z3X A;  5F6F A;  3G4S I;  2VON A;  1OYI A;  3BR6 A;  3GUD A;  3HTS B;  5DTD A;  1UJ8 A;  3QAH A;  4BY7 J;  3IH2 A;  1X3U A;  1L0O C;  1WQ2 A;  1OCR H;  2Z3Y A;  2IP2 A;  4M72 A;  1DGR M;  1ETY A;  5FFX A;  4CYC A;  1J59 A;  1FMW A;  1VQ6 I;  4JBA A;  3IEY A;  2MG4 A;  4B4C A;  4QPQ A;  4I02 A;  3JRD A;  1R4M B;  2DDA A;  4MQV A;  2I8D A;  1YOV B;  4OIO F;  1D0Z A;  2IT0 A;  1BJA A;  3I9V 2;  3C3W A;  3SEQ A;  3IKT A;  3VSL A;  1T33 A;  4AIJ A;  3CUO A;  2RRE A;  3OSF A;  1VQ5 I;  1JXS A;  1SD4 A;  2MLG A;  2GOM A;  4X0G A;  2HPM A;  3S2H J;  2C6Y A;  3JRI A;  1H9G A;  2WA0 A;  1MBG A;  2XF6 A;  3CES A;  4GDF A;  2LF8 A;  5LFA A;  1U8R A;  2KIQ A;  1HKS A;  4DQ2 A;  1JJ8 C;  4XLH A;  2K85 A;  3HOY J;  4I01 A;  3O3K A;  4WXH A;  1J0R A;  3WHB A;  1N77 A;  4DBQ A;  4BXX J;  5FLX Z;  3OYK A;  2DBB A;  2R7V A;  4HG2 A;  3PIP F;  2EIM H;  4AIK A;  4KNY A;  5HDK A;  3R6S A;  2Y9Z A;  2VLA A;  5JVG F;  1U9N A;  2ZSH B;  5B5E C;  4O6J A;  3T1B A;  3FXO A;  5ICG A;  3I56 I;  4IRI A;  3K2Z A;  4P9F A;  3BJA A;  4LIT A;  2L7K A;  3OYN A;  3BLY A;  3FM3 A;  4M9X A;  1K4S A;  2W8M A;  2E1M C;  5E8G A;  3F8B A;  3TBI A;  5DD4 A;  3VFZ A;  4P96 A;  5HOO A;  1D3Y A;  2BY3 A;  1MIJ A;  2KIF A;  4UXN A;  3E5X A;  1ZG3 A;  2XAG A;  3IH3 A;  2EB7 A;  1VQ4 I;  1USS A;  2KDZ A;  1P6R A;  3E6D A;  5DCM B;  4OAZ A;  4BXF A;  4HF2 A;  2QUF A;  2OST A;  1ON1 A;  1WI9 A;  2V9V A;  4RGX A;  3HSR A;  2WIW A;  3HJE A;  5J1R A;  2OTJ I;  2KIU A;  2E1N A;  1M1E B;  1WJD A;  5FLV A;  4BXU A;  1IN6 A;  2VOP A;  5IYB J;  5AIP A;  4MTE A;  3HSF A;  4NDL A;  1X19 A;  2W4S A;  2IS1 A;  2Y9Y A;  4XNF A;  3QP5 A;  2STW A;  4BEH A;  4HRI A;  1T08 B;  1G8X A;  3QOD A;  1FOW A;  1T98 A;  5B1B H;  1IN5 A;  2GOX B;  1OPC A;  1QZY A;  4PJJ A;  5H2F C;  4CGZ A;  3H0D A;  3FF5 A;  4MTD A;  3N4M A;  3PNT A;  3P9I A;  2FBI A;  2M4G A;  5JR3 A;  3ZN1 A;  5E18 F;  2CQN A;  4LB5 A;  2QQ8 A;  4LOC A;  2MH2 A;  2X4H A;  3F6V A;  3DPU A;  2M45 A;  2FML A;  1WJF A;  1EF4 A;  2EZH A;  4U0Y A;  4BQA A;  1OJL A;  2CQX A;  1SFU A;  5CKT A;  1I5Z A;  2W1O A;  1DU6 A;  2A6E F;  3FXL A;  3KCC A;  1DP7 P;  2V7F A;  4RM2 A;  1CQT A;  3IAS 2;  1PUF B;  2XUB A;  1SAU A;  4LK0 F;  1A79 A;  3F8F A;  4HAM A;  4Y13 A;  3IRR A;  3AG2 H;  3M8F A;  4ENK A;  2R7F A;  3FMS A;  2K3P A;  2O61 A;  3X2Q H;  1REP C;  4MGR A;  2V26 A;  3TO7 A;  3DBH B;  4DAV A;  4P9U A;  1YO5 C;  2HYJ A;  4IHX A;  3KE2 A;  1TWG J;  2ECC A;  5E3M A;  3K70 D;  1RIO H;  2E2J J;  2HYG D;  1DPR A;  5FB2 A;  1X3W B;  2VIX A;  3QPT A;  3S3M A;  3KYC B;  1WSU A;  4HYE A;  4BUP A;  3BTC A;  4R8H A;  5KAI C;  1B6A A;  3KP3 A;  3IL2 A;  3Q0W A;  4KIG A;  1ZRF A;  2DMT A;  3B6C A;  2V79 A;  2QZ8 A;  1NH3 A;  5EEH A;  2QLZ A;  3MFK A;  2NRA C;  2ID6 A;  2X6O A;  2QSF X;  6PAX A;  2EBI A;  4RAF A;  1YFH A;  3IP4 B;  5K5O A;  1RLV A;  1QQI A;  3ASO H;  3QPL A;  1PUE E;  1LNW A;  4M3E A;  1RR8 C;  1D1B A;  4DA2 A;  5CQG A;  4YEL A;  5FRN A;  4EJU A;  2JMW A;  1MJ9 A;  3SXY A;  4F92 B;  4JX4 A;  3O6B B;  1BW5 A;  2KP6 A;  2DYS H;  3GTJ J;  4TKD A;  3AFH A;  3COA C;  1KZH A;  5HDG A;  1SFX A;  2A3S A;  4UB6 C;  2CS3 A;  2O8K A;  5HLI A;  3OYG A;  1E2X A;  5LRS A;  2ME0 A;  2YPR A;  1IN7 A;  3WE3 A;  3H3U A;  4IHW A;  3VYS B;  2XGD A;  3TMO A;  2PMH A;  3CP8 A;  3ULQ B;  2PEX A;  3BR2 A;  2R3S A;  1UHS A;  2JUC A;  3SHF A;  3FDY A;  2D5V A;  4YII A;  1OB9 A;  3QYB A;  2XAU A;  1FYK A;  5HS7 A;  1U5T B;  2UXX A;  2OZU A;  3GME A;  5D5V B;  2E7X A;  3CCJ I;  1IN4 A;  2BY0 A;  3M8E A;  3MKY B;  1QHH D;  3L1P A;  3IWF A;  2EO0 A;  2OF7 A;  1TW3 A;  3ZQG A;  1ZN2 A;  2XPV A;  1S6L A;  2BE5 F;  1O7L A;  2J5O A;  4UB8 C;  1B9N A;  4LB6 B;  4HQE A;  1XPX A;  1P4W A;  3OV8 A;  3PL8 A;  3CCL I;  1R49 A;  3EET A;  1WFX A;  2BVL A;  2P0W A;  2DTR A;  3QQA A;  1RRJ A;  2LK2 A;  1KU9 A;  1CGP A;  2H8R A;  1DGW Y;  5HOD A;  1I50 J;  5D6F A;  2XAH A;  4EGY A;  3HSE A;  4A3D J;  2XGE A;  2A07 F;  3CC4 I;  1TWC J;  2FCO A;  3SQN A;  2MD0 A;  1IXR C;  3ABK H;  2CQK A;  2TDX A;  1FIP A;  1YS7 A;  2ZJP F;  4M9S A;  1HKQ A;  3I53 A;  3MKL A;  2B0L A;  2XSD C;  1HF0 A;  4IHV A;  4CDG A;  2DCE A;  1JKQ C;  1H9T A;  1TQM A;  4N4O B;  2D45 A;  2L9R A;  1O3T A;  2HKX A;  2WAQ N;  2CJJ A;  2OCC H;  3CCR I;  1VQO I;  3NAR A;  2IRF G;  1HC8 A;  5A2Q Z;  3TOB A;  3V42 A;  4HX8 A;  2IGK A;  3KP2 A;  1R5G A;  1WRJ A;  4PSW A;  4I2O A;  4GCV A;  1XMK A;  1A36 A;  1Y0N A;  4FQG A;  2L5Q A;  4L9N A;  4Y33 A;  1SMT A;  3CJR B;  4E7H A;  4IEJ A;  2GXA A;  2DFI A;  4AU7 A;  1O3S A;  1QVT A;  4KMF A;  1S3J A;  2H27 A;  3IKV A;  3DV8 A;  2BHZ A;  2LY2 A;  5KHD A;  2ETH A;  5AIQ A;  5AON A;  3T8R A;  1VQ8 I;  2QGU A;  3DCF A;  2EIL H;  1DU0 A;  3F21 A;  1Y88 A;  1S72 I;  3NWS A;  3OYM A;  5CLS A;  2LY9 A;  4DW6 A;  1X2M A;  2GIZ A;  2UUZ A;  1MBE A;  3OWT A;  4DZP A;  2IS2 A;  1SD7 A;  1STZ A;  4NC8 A;  1G3Y A;  1WJB A;  1L3L A;  4FCY A;  3EDP A;  2HR3 A;  4JOM A;  2D1H A;  4E6Z A;  1GV5 A;  3K4N A;  2X48 A;  1XB4 A;  2QYO A;  3TED A;  3KP4 A;  1HST A;  3GYH X;  3Q0U A;  4RM3 A;  3G1O A;  2CRG A;  3CJT B;  5DCM A;  3HEF A;  2OD5 A;  2NS0 A;  1Z3Y A;  1KA8 A;  5F0H A;  2A5Y B;  1A6Q A;  3HGY A;  4BQQ A;  2M9H A;  3K6G A;  5F0C A;  5ILV A;  2OA4 A;  3RKW A;  4BH9 A;  2DA5 A;  3KPH A;  2LF7 A;  3RCO A;  1QPI A;  5D5X B;  2CW0 F;  2XC7 A;  1RET A;  4RBO A;  4RGS A;  1GVD A;  3VYR B;  1VI0 A;  4DYC A;  4D0P A;  4A12 A;  4KIF A;  3P9K A;  4PK4 A;  3WE2 A;  1ENH A;  3JRA A;  2OQR A;  5D4S A;  1XC5 A;  5EGO B;  3L2Q A;  2IS6 A;  4C3H J;  3CC7 I;  4V19 K;  1IF1 A;  3FXM A;  2IGM A;  2HEO A;  3SYT A;  1SFK A;  4O5V A;  2E71 A;  2K4J A;  4NHJ A;  1FSH A;  2NYX A;  4XL9 A;  4KJZ A;  4A3E J;  1LFP A;  3KZZ A;  1FIA A;  2WC2 A;  3DNX A;  3ZQL A;  4OIN F;  3FKI J;  4QIW N;  4ABZ A;  2JPB A;  2GIV A;  2VJ5 A;  4XM3 A;  2FE3 A;  3EUA A;  3Q3S A;  1PUF A;  2Y69 H;  3HDD A;  1ONV A;  2DA4 A;  1ETO A;  2VAS A;  3SEZ A;  2BBY A;  3QOP A;  1R9T J;  1N78 A;  2A69 F;  3ERE D;  4E7Z A;  2FQ3 A;  4NC6 A;  4HEA 2;  2O5R A;  1JGG A;  4EJV A;  5J8F A;  3O2P E;  5B66 C;  3VEP A;  2VJJ A;  1Z77 A;  2OQG A;  3H3V K;  3WTW C;  1LFU P;  1V5F A;  3HRU A;  4BGD A;  5ILS A;  1YI2 I;  3GF2 A;  2ADU A;  1DDN A;  1JT6 A;  4G6D A;  1WKM A;  2VJ4 A;  3I3L A;  2HOE A;  3CO7 C;  4A3K J;  3EPZ A;  2PMZ A;  5DUK A;  5DYM A;  2IBD A;  1V54 H;  1BA5 A;  2XAQ A;  3TO9 A;  4L9J A;  4S0H B;  4JK1 X;  2EIK H;  4GRI A;  4DGW B;  3VOD A;  3KEO A;  3RQ4 A;  1X1C A;  2R4G A;  1QPM A;  1ZH5 A;  3KX2 A;  4KN7 X;  4A3J J;  3LSJ A;  2A61 A;  2PX9 A;  3DWL E;  1P92 A;  2DOE A;  2ESH A;  4CUG A;  1XGS A;  2VUM J;  5FKM A;  2M0C A;  1SC7 A;  1W7P D;  2VOO A;  2ME6 A;  5E17 F;  1GDT A;  2CW8 A;  2FOK A;  1LB2 A;  3MMY B;  5L3C A;  1V4R A;  2E19 A;  1E0E A;  4HQM A;  5CVI A;  4OMZ A;  2W7N A;  4BAC A;  3FM5 A;  1ETK A;  1TWA J;  4ENN A;  3KLN A;  4ENM A;  2X1D A;  1TT5 B;  4F52 A;  2M5W A;  3GCM A;  1XSX A;  1HSJ A;  5K5R A;  2CW7 A;  5E1X A;  1TL8 A;  1A6I A;  2DYR H;  2VB6 A;  4BE1 A;  3RI4 A;  3HOS A;  1LEA A;  1FTZ A;  2VPR A;  1RI7 A;  9ANT A;  3BT7 A;  4BJ5 C;  3J80 Z;  2K27 A;  3M07 A;  1U5T A;  4BDZ A;  5M5Y J;  4QSH A;  5IP7 J;  1J7K A;  2F5C A;  3JSP A;  3LSH A;  3MKZ A;  2QQA A;  4HDV A;  1QGP A;  1ZG5 A;  3FZV A;  3TKY A;  1YQA A;  3L2V A;  1RC9 A;  4F3Q A;  2M3A A;  3CCM I;  1TWH J;  5LLQ A;  4WK8 F;  5CVU A;  2LP0 A;  1D5V A;  3WOD F;  2VPL A;  3K9T A;  2M34 A;  5LHG A;  3OYB A;  1VQP I;  2EV0 A;  1ZKG A;  2MC3 A;  1BJZ A;  2EPF A;  3T5X A;  3V8L A;  5HDN A;  3DU6 A;  4MEY F;  2V4J C;  1FNN A;  1YIT I;  1PVE A;  3M7G A;  3M9A A;  4U0W A;  2Q8K A;  2M8E A;  2F6C A;  1Z9C A;  5IY5 H;  3WTU C;  5FRO A;  4M74 A;  4II2 A;  4BJT A;  3ISP A;  4BE2 A;  1ZG1 A;  3L7W A;  2RV8 A;  4CIC A;  3FHZ A;  2HQN A;  2R5Y B;  3KYD B;  1W0T A;  3ZXS A;  3J7A O;  2FRH A;  4B09 A;  2VT3 A;  3K0L A;  2H6C A;  2V9K A;  3ZGK A;  2Z5U A;  2X51 A;  5CVJ A;  2V1X A;  4OMY A;  3A01 B;  4A2U A;  5EEG A;  3FKJ A;  4ZC3 A;  3PSF A;  4PGG A;  5H6R A;  5IT9 K;  3M4O J;  4XRM A;  1WH7 A;  5DM7 F;  4IKF A;  5J4V A;  2JZY A;  3CCS I;  2JWT A;  3CMA I;  2BVM A;  1D8K A;  1UZC A;  5DD8 A;  4I09 A;  4IZZ A;  2ELJ A;  3KIO A;  3ZOB A;  3DQV C;  1NHA A;  4EJO A;  1Y8R B;  4RDU A;  5F08 A;  4XKV A;  2Y75 A;  4AD9 A;  1UFM A;  2KDO A;  2NNY A;  3TDU C;  1AWC A;  3R0A A;  5FDK A;  1XSD A;  4BKX A;  3U9G A;  1JKR C;  2KFD A;  2IJL A;  2UZK A;  4JQF A;  5TGT A;  4KMU X;  1S9H A;  3PFI A;  2W48 A;  5IP9 J;  1D8J A;  3WGG A;  2BH2 A;  5IOY A;  4FX0 A;  3WTY C;  3CDI A;  2K9S A;  4KIS A;  2WV0 A;  5E8I A;  2WB1 A;  3F72 A;  3J81 K;  2CUZ A;  2M7A A;  2HYF A;  1XGO A;  1FY7 A;  1AA7 A;  2DXI A;  4E7L A;  2EFQ A;  3RPU A;  2JRT A;  4AWX B;  1DUX C;  1P2F A;  4DJA A;  3NAU A;  3W6K B;  3KEQ A;  5JLW A;  1S8N A;  2MD5 A;  4L5I A;  1R1T A;  3BCB A;  2QVO A;  1IXC A;  4U7D A;  5FLM J;  1ZGA A;  4GFB A;  5J1Y A;  4MFE A;  4CCM A;  2X6X A;  2M87 A;  1E3O C;  1SVM A;  2L7M P;  3AG1 H;  4QLC U;  1VQM I;  1WJC A;  4ON0 A;  2IW5 A;  3TL4 X;  2LMD A;  1BOB A;  4JYK A;  2CV1 A;  2ZNZ A;  3GTL J;  2CYY A;  2R7Q A;  3E5U A;  3I54 A;  2VLD A;  2O7O A;  3ZN0 A;  4O3M A;  5ICC A;  3E5Q A;  3EUH A;  3A2K A;  4OIQ F;  3BR3 A;  3CLO A;  5EJC A;  2Z16 A;  1GXP A;  5E79 C;  4JP0 A;  4Q4Z F;  1YTY A;  4F93 B;  4QTR A;  4PZJ A;  1LPQ A;  1OB8 A;  2Z0R A;  3GFM A;  3DKY A;  4OIR F;  4X6A J;  2ZFW A;  1MSE C;  5GTH C;  2EWN A;  3CO6 C;  5FLX K;  1W0U A;  1B9M A;  3R0J A;  4AID A;  2ZB9 A;  2F5D A;  4ZH4 F;  5DCF A;  2B63 J;  4GYG A;  3ZPL A;  4BNC A;  3W3C A;  5K7F A;  3F22 A;  2L0K A;  2VBX A;  2WAE A;  1YE9 A;  3G2B A;  1OCC H;  4YFX F;  1FOY A;  2GM4 A;  1KYW A;  1GVJ A;  2X6Y A;  3JRH A;  4A6E A;  3F8C A;  1MH3 A;  2DMQ A;  4IRH A;  1BW6 A;  3MWM A;  1W36 C;  1YW9 A;  1FTT A;  1LVK A;  2XSJ C;  4LLG F;  3WU0 A;  1TBX A;  1YJN I;  2QF7 A;  3OYF A;  4DNC A;  2DW4 A;  3ZR8 X;  2NVQ J;  3FXJ A;  1B8I B;  2PI0 A;  4IOC F;  4V2F A;  2R7S A;  1FLI A;  3DF8 A;  3TGN A;  1V55 H;  4AYB N;  2V1D A;  2YU9 J;  1VQ9 I;  3GFI A;  2IVM A;  5HLG A;  4OIP F;  3S15 J;  2DLL A;  3K4B A;  4OWR B;  4CZZ A;  3JRE A;  4XOR A;  1R11 A;  2RAE A;  1FP1 D;  2HS5 A;  3LSG A;  3BP8 A;  5KCM A;  4YFK F;  1FC3 A;  1AKH B;  3W2A A;  1G3W A;  1ZGW A;  4XON A;  4UVA A;  4XBF A;  1BI2 A;  1Z6T A;  3PM1 A;  2MLK A;  2E34 A;  2GAU A;  3UKG A;  2W85 A;  3GLL A;  5D4R A;  1NG7 A;  4RLF A;  1JE8 A;  1OFC X;  2UXN A;  2DMN A;  3QOE A;  2KMU A;  2NVX J;  3PUF A;  1I3A A;  2PMZ N;  2FJ1 A;  3LFU A;  1RNL A;  1MSF C;  1ETW A;  3C1D A;  2OUM A;  4M71 A;  3M3Y J;  2JSP A;  3JRC A;  3L2U A;  2LNB A;  2R5Z B;  2CO5 A;  1JHH A;  1XGM A;  2XDV A;  3FXR A;  3WTX C;  4PJN A;  5JHF A;  1FYM A;  1JKP C;  1JT0 A;  1GHC A;  2VQG A;  4E6K G;  4M3B A;  1UWV A;  1BI0 A;  4IPA A;  2DFF A;  1LJ9 A;  2QQ9 A;  2LR8 A;  1TNS A;  4ZYG A;  1T8I A;  2R93 J;  1TTY A;  5IPA A;  1I27 A;  2A5W A;  2XGC A;  4CCJ A;  4HV5 A;  1IRF A;  5FKL A;  4LG0 B;  2ZO4 A;  3AG4 H;  1TNT A;  4Q48 A;  3AL0 B;  2O6G E;  3IF0 X;  2R5Y A;  4P55 A;  5B1A H;  2JTV A;  1K79 A;  3JW4 A;  3RZD J;  3AL0 C;  3ZQI A;  5DEQ A;  4RAZ A;  1F4K A;  5J47 A;  3OS0 A;  1JUM A;  1X58 A;  1MJB A;  1ULY A;  5GAD J;  2ZNY A;  3FK7 A;  1TWF J;  1XMX A;  2FD5 A;  3A01 A;  3JCU C;  3S93 A;  2ZJR F;  4V2G A;  3C2B A;  1OCO H;  3F8N A;  4BE0 A;  3BQY A;  4QBN A;  3QPH A;  1MBK A;  3HTU A;  3N05 A;  5FGM A;  3E97 A;  3OYE A;  4HBL A;  4AVZ A;  4XRS G;  3AKZ A;  2DFH A;  4ZDO A;  2FNP A;  1E17 A;  4C3I J;  1BIB A;  3LOC A;  2CGP A;  4C9Y A;  2DI3 A;  4FAS D;  1U3E M;  1F43 A;  5EZG A;  2E7W A;  2A05 A;  1POG A;  3B6A A;  5HLH A;  3BG9 A;  3TQN A;  2ZXI A;  2ZJQ F;  3RZO J;  1DP3 A;  1ZYR F;  5E3N A;  2PBI A;  3E7L A;  4XN3 A;  1CF7 B;  4XSX F;  4IX7 A;  3DTK A;  3IHU A;  2YUS A;  3H0G J;  5L3E A;  2JQ7 A;  1I1G A;  2STT A;  3VYT B;  4XRS A;  3RSN A;  3DBL B;  2NVT J;  5E1Z B;  3OIO A;  2I10 A;  1XMA A;  1R6R A;  2A6T A;  3VYU B;  1OLT A;  1ZGJ A;  4KFC A;  5C3E J;  1R1V A;  4P1W A;  4Z6Y A;  3S14 J;  3OIP A;  5GTI C;  1FEX A;  3OYJ A;  2L7F P;  2K3F A;  1MD0 A;  1P9Q C;  3U1D A;  3DKX A;  3S16 J;  3V8K A;  2ISZ A;  3LSP A;  3ELK A;  1XSV A;  4R79 A;  1OKR A;  3HRM A;  2QM3 A;  3ZRG A;  4UUV A;  4B1R A;  2ZXW H;  3SZG A;  1KYZ A;  1KQ8 A;  4LQE A;  4J01 A;  3J7Y J;  1IG7 A;  4HF0 A;  1IRX A;  3BTI A;  2DU9 A;  1BI1 A;  4IHY A;  5GPC A;  4UV9 A;  5EDN A;  4D1Q A;  1ON2 A;  2VXD A;  2LG4 A;  4N4N B;  2HVR A;  2KZG A;  3BR1 A;  3K70 C;  3WTZ A;  1IO2 A;  1HBX G;  3ESW B;  2EIJ H;  4Y4R A;  2H8W A;  1U5T C;  2QBY B;  1NK3 P;  1TQP A;  2ZYZ A;  2OBP A;  2F4I A;  3HHG A;  3OL3 A;  4EM1 A;  2GXG A;  1G59 A;  3DPT A;  2VBZ A;  4FT8 A;  2DK5 A;  3JR9 A;  1Q1H A;  2P5K A;  1W5S A;  2WTE A;  1IAW A;  1ZEL A;  1VFC A;  2KRF A;  4NQW B;  2HXO A;  1MND A;  1Y0U A;  4RLQ A;  2JT1 A;  4D7N A;  1HW5 A;  1ZR4 A;  4E4H A;  4FX4 A;  2NS7 A;  4BBR J;  2Y0S A;  2JUG A;  2X6W A;  2FX0 A;  3S1Q J;  2WY7 Q;  3J7A Y;  4E7I A;  5JI6 A;  2JA5 J;  3MN2 A;  4ZYE A;  4ZYH A;  1K7A A;  2XRN A;  1QRY A;  2HDD A;  2DQR A;  2R7R A;  1X3Z B;  1P4X A;  4G7O F;  1ZQ3 P;  4QBO A;  3REO A;  2L02 A;  2P6T A;  4DZJ A;  3ZP5 A;  3GTK J;  4MLO A;  4HSR A;  4HDU A;  1MJA A;  1RR7 A;  3PQJ A;  3S3N A;  2GBY A;  1AHD P;  2DOD A;  4MHG A;  3BTL A;  5IYC J;  3BJ6 A;  1O4X A;  2B7E A;  2QKL B;  3QU3 A;  1PP7 U;  4A5N A;  4PDK A;  1B8I A;  1WZ2 A;  1K61 A;  1QZE A;  3HGG A;  4CYD A;  2Q2E B;  4A5M A;  2ZKZ A;  2MW8 A;  3HKZ A;  4HST A;  3DFG A;  3L2R A;  3PQK A;  1HW2 A;  1AKH A;  2VC1 A;  3K69 A;  3P1Z A;  3WG7 H;  4XID A;  3F3X A;  1LEB A;  3GW2 A;  2LRE A;  2XKO A;  2F5F A;  2AS5 F;  2ECB A;  3PIO F;  2INB A;  2BY1 A;  1A31 A;  5LD2 C;  1S7E A;  3KP6 A;  3TOA A;  4KYW A;  3H36 A;  4GYI A;  4CO8 A;  1HDD C;  4ZDP A;  3CCU I;  4BY1 J;  2CQQ A;  5HLT A;  1RUN A;  3EQL F;  5E1W A;  2DO7 A;  2WWY A;  4L18 B;  4XLN F;  2ACJ A;  1D1A A;  1XGN A;  1FT9 A;  4CH7 A;  3I5U A;  4IQ4 A;  4RB3 C;  4MFD A;  2BY2 A;  3TO6 A;  4EMS A;  2KIS A;  2RKH A;  2P7V B;  1E3P A;  1H88 C;  2R5Z A;  2DTZ A;  4LGW A;  1R0V A;  1WVR A;  4G6T B;  3DKW A;  2G7U A;  4EJW A;  2PN6 A;  3VSK A;  1J5Y A;  5BS6 A;  1XN7 A;  4G6V A;  4BYY A;  5M5X J;  3S2W A;  5J4Y A;  1GT0 C;  3B02 A;  3SFZ A;  2E35 A;  4IHT A;  1EA3 A;  1LDJ A;  2F2E A;  3Q5F A;  3EYI A;  1GUU A;  1IJW C;  3ASN H;  1IW7 F;  3RQI A;  3HM5 A;  4ETS A;  2RN7 A;  4LG0 A;  2FEZ A;  2HQR A;  2K5C A;  2HDW A;  1IRG A;  1OR7 C;  4PFP A;  1IPI A;  2WCW A;  4Q5S F;  2DMP A;  2FOW A;  4I6Z A;  1Z21 A;  2K7L A;  3H92 A;  5F27 A;  3CF5 F;  1TT0 A;  1YHQ I;  4YIF A;  1MMS A;  2M4K A;  2MSY A;  1FSE A;  2MFZ A;  1UHW A;  2ZJ2 A;  2E1C A;  2Y0M A;  4EV1 A;  1VQK I;  1TP4 A;  2L2O A;  2LC2 A;  1D1C A;  3I55 I;  4HPQ A;  1UEL B;  5DM6 F;  2L3D A;  3BT9 A;  3KLO A;  2O9L A;  3EUH C;  4E7S A;  4UNO A;  4BU2 A;  2WY8 Q;  2NNN A;  2VQH A;  3E0J B;  4XLC A;  4M3F A;  2MGQ A;  4PGH A;  3LMM A;  2Q1Z B;  3A02 A;  5TRD A;  2R7O A;  3OS1 A;  3OYD A;  1C0W A;  2P7C B;  3W6J B;  3Q9S A;  2HKO A;  3BY6 A;  1YNM A;  1BOA A;  5DS9 A;  2KL4 A;  1IRZ A;  2FA5 A;  4C2U A;  2CV8 A;  5KNL A;  3CUQ B;  3LA2 A;  4G6Q A;  3BG6 A;  3D5S C;  2JN6 A;  2NOJ B;  4HX7 A;  3V4G A;  1P4A A;  2IPQ X;  3RKX A;  3C7J A;  1CF7 A;  1TLH B;  3CUQ C;  2P5L C;  4Y7N J;  5CQE A;  3SZP A;  4Y15 A;  5E3L A;  3LSK A;  1Z0X A;  4L5E A;  2X9D A;  5CYV A;  4ZQU A;  4WX9 A;  4B3A A;  1JUP A;  3V7R A;  2HVS A;  3K4L A;  4WWC A;  3L2W A;  2XF7 A;  1X4O A;  1MDM B;  2K40 A;  5L3D A;  1RZ4 A;  3M8J A;  2XGX A;  3Q9V A;  4NB5 A;  4MEX F;  2LTP A;  2ESN A;  2R92 J;  3LSR A;  3TW6 A;  3UNG C;  1Y6I A;  2L9V A;  2VL8 A;  4B43 A;  1JUS A;  2LH9 A;  2QCO A;  2OC6 A;  1KQ9 A;  4L9V A;  2K02 A;  4ASN A;  2DT6 A;  1Z05 A;  4UUS B;  4IOA F;  2L01 A;  3BZ6 A;  4A3L J; 
#chains in the Genus database with same CATH homology
 3WTS C;  2P5V A;  4EQQ A;  1RUO A;  4RB1 A;  4RGU A;  5BOX A;  1U6G A;  3WGH A;  5IT3 A;  2PJP A;  2IA2 A;  2QBY A;  2AXL A;  1LVA A;  1G3T A;  1S29 A;  3F6O A;  1KU2 A;  4IHS A;  4NQW A;  3VB2 A;  5L3G A;  2XHK A;  5HS8 A;  2IA1 A;  1ZRE A;  1GEF A;  2XKP A;  4HF1 A;  3I59 B;  3FMQ A;  4UV8 A;  1UCR A;  1W7P B;  2ZCW A;  1EH6 A;  1PDN C;  2DPU A;  1F1Z A;  4N9I A;  1ZRD A;  2F5E A;  1HW1 A;  2RC4 A;  3K1P A;  4PCQ A;  5H20 A;  3LFK A;  4B8X A;  4BHC A;  1QO0 D;  3FX3 A;  1YLF A;  4K2E A;  1GXQ A;  2Q2E A;  3GFJ A;  1DPU A;  3CDH A;  1FPQ A;  5ERI A;  5LEK A;  1TW2 A;  2FSW A;  3DEU A;  1O3Q A;  3JTG A;  4GXO A;  3ZQ7 A;  4WF2 A;  2OU2 A;  3QU6 A;  3H3Z A;  1H0M A;  3FWE A;  4L5J A;  1IN8 A;  1BIA A;  2P4W A;  3FOV A;  4GO1 A;  1SD5 A;  1KU3 A;  4QBL A;  3DPL C;  4QWQ A;  2DAO A;  3NQO A;  3IRQ A;  1ZLJ A;  1SFE A;  4P5O A;  2RVC A;  2COM A;  2VXZ A;  4YG2 F;  3JAM K;  3ZMD A;  1T0F A;  1OYW A;  2WCZ A;  3RTR A;  2CFX A;  1IZ1 A;  4HZF A;  1KQ0 A;  3E6C C;  3M1E A;  3R61 A;  2FU4 A;  2OZ6 A;  2ZME B;  2LDU A;  3I58 A;  1OR7 A;  5HS9 A;  4A6D A;  3ZMZ A;  1BM9 A;  4WXD A;  3K1N A;  3FMR A;  5BPI A;  2A6H F;  1LDK B;  1ODD A;  3RIR A;  5TJJ A;  1J9I A;  1YW8 A;  2HFH A;  2L54 A;  2Q0O A;  3AJV B;  2YR2 A;  1FX7 A;  5E20 A;  1V3F A;  4L0Z B;  2ZYZ B;  2IXS A;  5IT9 Z;  4XLP F;  2H94 A;  4RB2 C;  5LGT A;  4KA4 A;  3BPX A;  2EFN A;  4A0Z A;  4IF4 A;  3CUQ A;  4N9H A;  3K1M A;  3IWZ A;  1IXS B;  2RNJ A;  5DUI A;  2DQL A;  5DV5 A;  1BC7 C;  2FF4 A;  5ED4 A;  3P1Y A;  3KP7 A;  2FMY A;  5K5Q A;  3L09 A;  2ZBK A;  4XRF A;  5LBQ A;  4I98 B;  2RGV A;  3J81 Z;  3HYI A;  4RGR A;  2YU3 A;  1MDM A;  4KT5 C;  1S7O A;  1FWZ A;  3FXQ A;  3GO5 A;  3GXO A;  1MKM A;  2NAZ A;  1J2X A;  3ROU A;  2GA2 A;  5DDG A;  2P6S A;  3VOE A;  2ELH A;  2FNA A;  3P1Z B;  2D2W A;  3CTA A;  4IRG A;  2R7D A;  5FFZ A;  4A0Y A;  4S04 A;  4TV7 A;  1J75 A;  5K1Y A;  3WTT C;  4LK1 F;  1U2W A;  2FLC A;  4BHP A;  4OOI A;  2BV6 A;  2O3F A;  1RZN A;  1MGT A;  2L4M A;  2VE8 A;  4GGG A;  5D5U B;  2PG4 A;  1I6X A;  4ESB A;  4EJT A;  3LAP A;  4I0A A;  4U0V A;  4G94 A;  1EV7 A;  3I59 A;  3ZMT A;  5J8C A;  2W24 A;  5L3B A;  1W7P A;  2PMU A;  2EFO A;  2KJB A;  3BWG A;  1R58 A;  4KIB A;  2XAJ A;  2VBY A;  1T38 A;  2GZW A;  4HLY A;  2GXB A;  3ZMU A;  4LLN A;  1R1U A;  1HH1 A;  2XAS A;  3EYY A;  3HRS A;  1Z6R A;  4G7Z F;  3MZH A;  5CVV A;  3GEZ A;  3HOT A;  4DAP A;  4M6X A;  4R1H A;  1ZP7 A;  3JSO A;  5FD5 A;  4A0X A;  1BN5 A;  3DP7 A;  4G9Y A;  3D0S A;  5ICE A;  2Z9O A;  2QEN A;  2VE9 A;  1YS6 A;  1TQI A;  2K86 A;  5FD6 A;  4KN4 X;  1R23 A;  4KDP A;  2DPD A;  2X0L A;  1I1S A;  2ZXJ A;  2JSC A;  2EA4 A;  5L3F A;  4H0E A;  2HWV A;  5LHH A;  1YIO A;  5D8K B;  5H6Q A;  3FXU A;  4ENJ A;  5BMZ A;  3B73 A;  4RS8 A;  1SMY F;  2EV6 A;  2YX4 A;  3GFL A;  2BGC A;  2J5P A;  2O03 A;  3G73 A;  2ZME A;  4E70 A;  2K4B A;  2BEO A;  1R22 A;  5LGU A;  5A2Q K;  1Z91 A;  3E6M A;  3LAJ A;  4YFN F;  2G9W A;  2W25 A;  4UVB A;  3ML6 A;  1K78 B;  1F9N A;  3AJV A;  5LHI A;  3V7C A;  1HQC A;  3G3Z A;  4HV6 A;  2VN2 A;  1R7J A;  1SD6 A;  1A04 A;  2GWR A;  2MH9 A;  5LEJ A;  1Y1O A;  3JTH A;  5KVR A;  1R5H A;  3MQ0 A;  4N0B A;  2RDP A;  4MQ9 F;  2GQQ A;  1YG2 A;  4LLL A;  5D5W B;  2QWW A;  2CSO A;  4ESJ A;  2GW6 A;  1W4M A;  3GZ6 A;  1LQ1 A;  1B1B A;  2OAZ A;  3LQR A;  1FBQ A;  2M1B A;  2JJQ A;  4KUM A;  3U2R A;  4ZZD A;  1FZP B;  3ZMS A;  3KFW X;  2IA0 A;  5KK1 A;  3QRF F;  1XCV A;  3BOQ A;  3HRT A;  5BQT A;  1YYV A;  3GVA A;  5ICF A;  3N97 A;  3MAJ A;  3GLX A;  4MNU A;  2CZR A;  2VOD A;  2QQB A;  3E6B A;  4ZYD A;  4RAY A;  3L2C A;  3D5L A;  3MCZ A;  1Z7U A;  2OKF A;  3R60 A;  4LJZ F;  4CHU A;  3BRO A;  1OMI A;  2YX7 A;  3ECO A;  1QBJ A;  3ABT A;  1O3R A;  1AOY A;  1XCB A;  3C18 A;  1ZAR A;  5JVT A;  4HLX A;  2H6B A;  4G8X A;  2MBF A;  5D6E A;  3TDZ C;  2PQ8 A;  3DXJ F;  3RYR A;  2VS1 A;  2VT2 A;  2CWE A;  5LGN A;  2RQP A;  3GZ5 A;  1G4D A;  2Z99 A;  2EFP A;  3KP5 A;  3I0T A;  3LWF A;  2LKP A;  4G6U A;  3V8J A;  1ZLK A;  4HX4 A;  4ZZL A;  1ZRC A;  4HOB A;  2DBS A;  3LA7 A;  4M9Z A;  2WIZ A;  3NRV A;  4L0Y B;  1UB9 A;  3IC7 A;  2O8X A;  3OOP A;  1ZAO A;  2V1U A;  5HVQ C;  5JFR A;  4LFU A;  5D8L B;  1XD7 A;  1W5T A;  1SAX A;  2W57 A;  3KZY A;  1EH7 A;  3WGI A;  1HKT A;  4U88 A;  1U78 A;  3J80 K;  2DT5 A;  3I71 A;  3RKY A;  2HDC A;  4XSZ F;  1JGS A;  2G7H A;  3WG9 A;  2FKH B;  1UST A;  3KET A;  2XV4 S;  2EV5 A;  1G3S A;  1R00 A;  5LRR A;  4BHB A;  3BDD A;  2EA2 A;  3MZY A;  1B4A A;  4Z2Y A;  3V7S A;  3T8T A;  4WXC A;  2ISY A;  4M6Y A;  1YW7 A;  3R4K A;  1KU7 A;  2JPC A;  4UVC A;  1HXD A;  1WWX A;  2LSO A;  3NEU A;  4HW0 A;  3IEY B;  3BPV A;  1FBU A;  1UHM A;  2KIM A;  1MZB A;  1FYL A;  5CJ9 A;  4G7H F;  5BPD A;  4BAY A;  1QNT A;  2O0Y A;  2Y48 A;  1QZZ A;  1K78 A;  1R36 A;  3I64 A;  2P8T A;  2PLY A;  1BBY A;  4Q47 A;  3RYP A;  3GX4 X;  3ECH A;  3E3V A;  4AIH A;  3L9F A;  2CG4 A;  3HIF A;  2XVC A;  4HA8 A;  1F5T A;  3LA3 A;  5ILU A;  2MA3 A;  2V6C A;  2EFW A;  3QP6 A;  4F7Z A;  1S7A A;  1BI3 A;  1IUY A;  1BC8 C;  2WJ0 A;  1LDD A;  3MEX A;  1XDS A;  4TKK A;  1FP2 A;  4WCG A;  3P9C A;  1K6O A;  3BJO A;  4UHT A;  2YSR A;  5JHU A;  3CJN A;  4ESF A;  3ABU A;  2HTS A;  4S05 A;  2XAF A;  5F64 A;  2EK5 A;  1OYY A;  2FBH A;  4CXF A;  4IVN A;  1T39 A;  2D1V A;  2KKO A;  3RJP A;  2VBW A;  3T0Y A;  4EVI A;  5FO5 A;  3HUG A;  4FHT A;  1VTN C;  3F23 A;  4Y17 A;  5CVR A;  2GJW A;  1JHF A;  3SZT A;  2PFB A;  2BYV E;  4EV0 A;  2FBK A;  3AAF A;  2HTJ A;  2KJC A;  3LST A;  1T6S A;  4L9T A;  2DK8 A;  3HHH A;  1O57 A;  5F1R A;  3GWZ A;  2W84 A;  4M73 A;  4RB0 A;  3I4P A;  4EM2 A;  2XIG A;  3RPQ A;  3RDI A;  2FL3 A;  4U7B A;  3WTV C;  1G6N A;  1Z1D A;  3WU1 B;  4I7H A;  2FKC A;  1KGS A;  1O7F A;  4LD5 A;  1ZHF A;  2L4A A;  2A68 F;  1EH8 A;  1XDU A;  2XRO A;  1FBS A;  2EJR A;  3L00 A;  4LMY A;  2FXA A;  2Z33 A;  4IXA A;  2HZT A;  4EGZ A;  4AVP A;  1PP8 F;  2M30 A;  2UWM A;  2HGC A;  1B59 A;  3LQQ A;  3F8M A;  4IJA A;  2H09 A;  4I0B A;  1T2K A;  4KIC A;  2GA1 A;  3JAM Z;  3ZMV A;  4EM0 B;  3P7N A;  2VC0 A;  4OU0 A;  1FOK A;  5J6X A;  2VON A;  5F6F A;  1OYI A;  3GUD A;  3HTS B;  3QAH A;  1X3U A;  1L0O C;  1WQ2 A;  2Z3Y A;  2IP2 A;  4M72 A;  5FFX A;  1J59 A;  4JBA A;  3IEY A;  4I02 A;  4MQV A;  4OIO F;  2IT0 A;  1BJA A;  3C3W A;  3IKT A;  4AIJ A;  3CUO A;  1JXS A;  1SD4 A;  2MLG A;  2C6Y A;  1H9G A;  2LF8 A;  1U8R A;  1HKS A;  4DQ2 A;  4I01 A;  3O3K A;  4WXH A;  1J0R A;  5FLX Z;  2DBB A;  4AIK A;  4KNY A;  5HDK A;  3R6S A;  5ICG A;  4O6J A;  3T1B A;  4IRI A;  3K2Z A;  4P9F A;  3BJA A;  3FM3 A;  4M9X A;  2W8M A;  5E8G A;  3F8B A;  5DD4 A;  3VFZ A;  4P96 A;  5HOO A;  1D3Y A;  4UXN A;  2KIF A;  3E5X A;  1ZG3 A;  2XAG A;  2EB7 A;  1USS A;  1P6R A;  3E6D A;  5DCM B;  4HF2 A;  2QUF A;  2OST A;  1ON1 A;  1WI9 A;  2V9V A;  4RGX A;  3HSR A;  2WIW A;  2KIU A;  2E1N A;  4BXU A;  1IN6 A;  2VOP A;  5AIP A;  4MTE A;  3HSF A;  2STW A;  3QP5 A;  1T98 A;  1IN5 A;  1OPC A;  1QZY A;  4CGZ A;  3N4M A;  3FF5 A;  4MTD A;  3P9I A;  2FBI A;  5JR3 A;  5E18 F;  3ZN1 A;  4LB5 A;  2MH2 A;  2X4H A;  3F6V A;  2M45 A;  2FML A;  4U0Y A;  4BQA A;  1SFU A;  1I5Z A;  2A6E F;  3KCC A;  1DP7 P;  2XUB A;  4LK0 F;  1A79 A;  3F8F A;  4HAM A;  4Y13 A;  3IRR A;  3M8F A;  4ENK A;  2R7F A;  3FMS A;  2O61 A;  1REP C;  4MGR A;  3TO7 A;  4DAV A;  4P9U A;  1YO5 C;  3KE2 A;  1RIO H;  2HYG D;  1DPR A;  5FB2 A;  3QPT A;  1WSU A;  4HYE A;  4R8H A;  1B6A A;  3KP3 A;  3IL2 A;  4KIG A;  1ZRF A;  2V79 A;  2QZ8 A;  5EEH A;  2QLZ A;  3MFK A;  2NRA C;  6PAX A;  1YFH A;  5K5O A;  1RLV A;  1QQI A;  1PUE E;  1LNW A;  4DA2 A;  4EJU A;  1MJ9 A;  3SXY A;  3O6B B;  4TKD A;  3COA C;  5HDG A;  1SFX A;  2A3S A;  5HLI A;  1E2X A;  5LRS A;  2YPR A;  1IN7 A;  3WE3 A;  3H3U A;  3ULQ B;  2PMH A;  2PEX A;  2R3S A;  3SHF A;  4YII A;  1OB9 A;  1FYK A;  5HS7 A;  1U5T B;  2UXX A;  2OZU A;  5D5V B;  2E7X A;  1IN4 A;  3M8E A;  3IWF A;  2EO0 A;  1TW3 A;  1ZN2 A;  1S6L A;  2BE5 F;  1O7L A;  2J5O A;  4LB6 B;  1B9N A;  4HQE A;  1P4W A;  3OV8 A;  3EET A;  2DTR A;  1KU9 A;  1CGP A;  5D6F A;  2XAH A;  4EGY A;  3HSE A;  2A07 F;  2FCO A;  3SQN A;  1IXR C;  2CQK A;  2TDX A;  1YS7 A;  4M9S A;  1HKQ A;  3I53 A;  2B0L A;  4CDG A;  1H9T A;  1TQM A;  2D45 A;  1O3T A;  2HKX A;  2IRF G;  5A2Q Z;  3TOB A;  4HX8 A;  3KP2 A;  1R5G A;  1WRJ A;  4I2O A;  4GCV A;  1XMK A;  4L9N A;  1SMT A;  2DFI A;  1O3S A;  4KMF A;  1S3J A;  2H27 A;  3IKV A;  3DV8 A;  2ETH A;  5AIQ A;  5AON A;  3T8R A;  3F21 A;  1Y88 A;  5CLS A;  1SD7 A;  1STZ A;  1G3Y A;  1L3L A;  3EDP A;  2HR3 A;  4E6Z A;  2D1H A;  1XB4 A;  2QYO A;  3KP4 A;  1HST A;  3GYH X;  5DCM A;  2OD5 A;  2NS0 A;  1KA8 A;  2A5Y B;  5ILV A;  2OA4 A;  3RKW A;  4BH9 A;  2LF7 A;  5D5X B;  2CW0 F;  4RGS A;  4D0P A;  4A12 A;  4KIF A;  3P9K A;  3WE2 A;  2OQR A;  5D4S A;  1IF1 A;  2HEO A;  4O5V A;  2K4J A;  4NHJ A;  1FSH A;  2NYX A;  3KZZ A;  2WC2 A;  3DNX A;  4OIN F;  2JPB A;  2GIV A;  2FE3 A;  1ONV A;  2BBY A;  3QOP A;  2A69 F;  3ERE D;  2FQ3 A;  4EJV A;  5J8F A;  3O2P E;  3VEP A;  2OQG A;  3WTW C;  3HRU A;  5ILS A;  3GF2 A;  2ADU A;  1DDN A;  4G6D A;  1WKM A;  2HOE A;  3CO7 C;  5DUK A;  5DYM A;  2XAQ A;  3TO9 A;  4L9J A;  4JK1 X;  3VOD A;  3KEO A;  1QPM A;  1ZH5 A;  4KN7 X;  2A61 A;  1P92 A;  2ESH A;  1XGS A;  1W7P D;  2VOO A;  5E17 F;  2FOK A;  1LB2 A;  5L3C A;  1V4R A;  4HQM A;  5CVI A;  4OMZ A;  3FM5 A;  4ENN A;  3KLN A;  4ENM A;  2M5W A;  1XSX A;  1HSJ A;  5K5R A;  5E1X A;  3RI4 A;  3HOS A;  1LEA A;  1RI7 A;  3BT7 A;  3J80 Z;  2K27 A;  1U5T A;  1J7K A;  2F5C A;  3JSP A;  2QQA A;  4HDV A;  1QGP A;  1ZG5 A;  3FZV A;  3TKY A;  1YQA A;  5LLQ A;  4WK8 F;  5CVU A;  1D5V A;  3WOD F;  3K9T A;  5LHG A;  2EV0 A;  2MC3 A;  3V8L A;  3T5X A;  5HDN A;  4MEY F;  1FNN A;  3M7G A;  3M9A A;  4U0W A;  2Q8K A;  2M8E A;  1Z9C A;  3WTU C;  4M74 A;  3ISP A;  1ZG1 A;  3L7W A;  2RV8 A;  4CIC A;  3FHZ A;  2HQN A;  3J7A O;  2FRH A;  4B09 A;  2VT3 A;  3K0L A;  2H6C A;  2Z5U A;  5CVJ A;  2V1X A;  4OMY A;  4A2U A;  5EEG A;  4PGG A;  5H6R A;  5IT9 K;  2JZY A;  1D8K A;  5DD8 A;  4I09 A;  3DQV C;  1NHA A;  4EJO A;  2Y75 A;  4AD9 A;  1UFM A;  2NNY A;  3TDU C;  1AWC A;  3R0A A;  5FDK A;  1XSD A;  3U9G A;  2IJL A;  2UZK A;  4JQF A;  4KMU X;  3PFI A;  1D8J A;  3WGG A;  2BH2 A;  4FX0 A;  3WTY C;  2WV0 A;  5E8I A;  3F72 A;  3J81 K;  2HYF A;  1XGO A;  1FY7 A;  2EFQ A;  3RPU A;  2JRT A;  4AWX B;  1DUX C;  1P2F A;  3W6K B;  3KEQ A;  1S8N A;  2MD5 A;  4L5I A;  1R1T A;  2QVO A;  1IXC A;  4U7D A;  1ZGA A;  2M87 A;  4QLC U;  4ON0 A;  2IW5 A;  2ZNZ A;  2CYY A;  3E5U A;  3I54 A;  2VLD A;  3ZN0 A;  4O3M A;  5ICC A;  3E5Q A;  3EUH A;  4OIQ F;  3CLO A;  1GXP A;  4Q4Z F;  1YTY A;  4PZJ A;  2Z0R A;  1OB8 A;  3GFM A;  4OIR F;  2ZFW A;  2EWN A;  3CO6 C;  5FLX K;  1B9M A;  3R0J A;  2F5D A;  4ZH4 F;  5DCF A;  4GYG A;  3ZPL A;  4BNC A;  3F22 A;  2VBX A;  4YFX F;  1KYW A;  1GVJ A;  4A6E A;  3F8C A;  4IRH A;  3MWM A;  1YW9 A;  4LLG F;  3WU0 A;  1TBX A;  4DNC A;  2DW4 A;  2PI0 A;  1FLI A;  3DF8 A;  3TGN A;  2V1D A;  3GFI A;  2IVM A;  5HLG A;  4OIP F;  2DLL A;  4CZZ A;  1R11 A;  1FP1 D;  2HS5 A;  3BP8 A;  4YFK F;  1FC3 A;  1G3W A;  4UVA A;  4XBF A;  1BI2 A;  1Z6T A;  2MLK A;  2GAU A;  2W85 A;  5D4R A;  1JE8 A;  2UXN A;  1RNL A;  3C1D A;  4M71 A;  2LNB A;  2CO5 A;  1JHH A;  1XGM A;  3FXR A;  3WTX C;  1FYM A;  1GHC A;  1UWV A;  1BI0 A;  4IPA A;  1LJ9 A;  2QQ9 A;  1TNS A;  4ZYG A;  1TTY A;  1I27 A;  4HV5 A;  1IRF A;  4LG0 B;  2ZO4 A;  1TNT A;  4Q48 A;  2O6G E;  3IF0 X;  4P55 A;  2JTV A;  1K79 A;  3JW4 A;  5DEQ A;  4RAZ A;  1F4K A;  1MJB A;  1ULY A;  2ZNY A;  1XMX A;  4QBN A;  3F8N A;  3QPH A;  3HTU A;  5FGM A;  3E97 A;  4HBL A;  2FNP A;  1E17 A;  1BIB A;  2CGP A;  2DI3 A;  1U3E M;  2E7W A;  5HLH A;  3TQN A;  1ZYR F;  2PBI A;  1CF7 B;  4XSX F;  3IHU A;  5L3E A;  1I1G A;  2STT A;  5E1Z B;  1XMA A;  1ZGJ A;  4KFC A;  1R1V A;  1MD0 A;  3U1D A;  3V8K A;  2ISZ A;  3ELK A;  1XSV A;  4R79 A;  1OKR A;  3HRM A;  2QM3 A;  4UUV A;  1KYZ A;  1KQ8 A;  4LQE A;  4HF0 A;  2DU9 A;  1BI1 A;  4UV9 A;  1ON2 A;  3WTZ A;  1HBX G