2ZYZB

Pyrobaculum aerophilum splicing endonuclease
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
183
structure length
183
Chain Sequence
MIGYLRGLAVIVEDVEFARRLYKEGFYGRFLGYDKVKRDEVEKINAPLILGLYEALYLAEKGRLKVMGEDGREVAPEELAALGRERMRNFDEIYKIYKYFRDLGYVVKSGLKFGALFSVYEKGPGIDHAPMVVVFLEPDKGISATDITRGGRLSHSVRKTWTLATVLRQTGEVVLLGFGWARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional importance of crenarchaea-specific extra-loop revealed by an X-ray structure of a heterotetrameric crenarchaeal splicing endonuclease
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Splicing
molecule keywords Putative uncharacterized protein PAE0789
total genus 47
structure length 183
sequence length 183
chains with identical sequence D
ec nomenclature ec 4.6.1.16: tRNA-intron lyase.
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01974 tRNA_int_endo tRNA intron endonuclease, catalytic C-terminal domain
B PF02778 tRNA_int_endo_N tRNA intron endonuclease, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1170.20 Alpha Beta 3-Layer(aba) Sandwich MutS, DNA mismatch repair protein, domain I tRNA intron endonuclease, N-terminal domain 2zyzB01
3.40.1350.10 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 2zyzB02
2INBA 4QBLA 2EO0A 1A79A 3IEYA 1F1ZA 1RZNA 1OB8A 3FOVA 2GJWA 5FDKA 2WCWA 1R0VA 3AJVB 1Y88A 1OB9A 1XMXA 1RLVA 2ZYZB 4QBNA 4QBOA 1IPIA 1Y1OA 3P1YA 4TKKA 2OKFA 3P1ZA 2WCZA 2FCOA 1GEFA 2OSTA 2WIWA 4TKDA 2CV8A 3P1ZB 1T0FA 2ZYZA 4FZ2A 2WJ0A 1HH1A 2GW6A 3DNXA 2WIZA 1ZP7A 2VLDA 1R11A 3AJVA
chains in the Genus database with same CATH superfamily
2FZ4A 2DBSA 2GJWA 5FDKA 2O8DB 4G6UA 2O8BB 1OH6A 4DAPA 1NNEA 2WCZA 3THYB 2OSTA 4ZQUA 1W7AA 2BH2A 2IXSA 2GW6A 2O8FB 2W8MA 4QBOA 2INBA 4QBLA 2O8BA 1EWQA 2EO0A 1WBBA 3FOVA 4LQEA 2FWRA 4G6VA 2WCWA 1R0VA 1E3MA 2FL3A 2ZYZB 1IPIA 1FW6A 2O8EA 2O8CA 1WBDA 3P1ZB 2ZYZA 2CZRA 1OH7A 3IEYA 2VS1A 1F1ZA 2O8FA 2Z0RA 1Y88A 4QBNA 2OKFA 2O8EB 1GEFA 2WTUA 1WB9A 2WIWA 2FKHB 1T0FA 4FZ2A 4EV1A 3DNXA 2WIZA 4E6ZA 1R11A 3K0SA 1A79A 1OH8A 1YNMA 3THWB 3THXA 2O8DA 1OB8A 1RZNA 3IEYB 3AJVB 1OB9A 1XMXA 1RLVA 1UWVA 1Y1OA 3P1YA 4TKKA 2FKCA 3P1ZA 2FLCA 3ZLJA 2FCOA 4DA2A 4TKDA 2CV8A 3THYA 2O8CB 2JJQA 4DAVA 1HH1A 1OH5A 2WJ0A 3IF0X 1ZP7A 3THWA 3THXB 3BT7A 1NG9A 2VLDA 3AJVA
chains in the Genus database with same CATH topology
2INBA 4QBLA 2EO0A 1A79A 3IEYA 2VS1A 1YNMA 1F1ZA 1RZNA 1OB8A 2DBSA 3FOVA 2GJWA 3IEYB 4LQEA 2W8MA 5FDKA 4G6VA 2WCWA 2Z0RA 1R0VA 3AJVB 1Y88A 4G6UA 1OB9A 1XMXA 1RLVA 2ZYZB 4QBNA 4QBOA 2FL3A 1IPIA 1UWVA 1Y1OA 3P1YA 4TKKA 2OKFA 2FKCA 3P1ZA 2FLCA 4DAPA 2WCZA 2FCOA 1GEFA 2OSTA 4ZQUA 4DA2A 2WJ0A 2WIWA 2FKHB 4TKDA 2CV8A 3P1ZB 1T0FA 2ZYZA 2BH2A 2CZRA 2JJQA 4FZ2A 2IXSA 1HH1A 2GW6A 3DNXA 4EV1A 4E6ZA 4DAVA 3IF0X 1ZP7A 2WIZA 3BT7A 2VLDA 1R11A 3AJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2INB A;  4QBL A;  2EO0 A;  1A79 A;  3IEY A;  1F1Z A;  1RZN A;  1OB8 A;  3FOV A;  2GJW A;  5FDK A;  2WCW A;  1R0V A;  3AJV B;  1Y88 A;  1OB9 A;  1XMX A;  1RLV A;  2ZYZ B;  4QBN A;  4QBO A;  1IPI A;  1Y1O A;  3P1Y A;  4TKK A;  2OKF A;  3P1Z A;  2WCZ A;  2FCO A;  1GEF A;  2OST A;  2WIW A;  4TKD A;  2CV8 A;  3P1Z B;  1T0F A;  2ZYZ A;  4FZ2 A;  2WJ0 A;  1HH1 A;  2GW6 A;  3DNX A;  2WIZ A;  1ZP7 A;  2VLD A;  1R11 A;  3AJV A; 
#chains in the Genus database with same CATH topology
 2FZ4 A;  2DBS A;  2GJW A;  5FDK A;  2O8D B;  4G6U A;  2O8B B;  1OH6 A;  4DAP A;  1NNE A;  2WCZ A;  3THY B;  2OST A;  4ZQU A;  1W7A A;  2BH2 A;  2IXS A;  2GW6 A;  2O8F B;  2W8M A;  4QBO A;  2INB A;  4QBL A;  2O8B A;  1EWQ A;  2EO0 A;  1WBB A;  3FOV A;  4LQE A;  2FWR A;  4G6V A;  2WCW A;  1R0V A;  1E3M A;  2FL3 A;  2ZYZ B;  1IPI A;  1FW6 A;  2O8E A;  2O8C A;  1WBD A;  3P1Z B;  2ZYZ A;  2CZR A;  1OH7 A;  3IEY A;  2VS1 A;  1F1Z A;  2O8F A;  2Z0R A;  1Y88 A;  4QBN A;  2OKF A;  2O8E B;  1GEF A;  2WTU A;  1WB9 A;  2WIW A;  2FKH B;  1T0F A;  4FZ2 A;  4EV1 A;  3DNX A;  2WIZ A;  4E6Z A;  1R11 A;  3K0S A;  1A79 A;  1OH8 A;  1YNM A;  3THW B;  3THX A;  2O8D A;  1OB8 A;  1RZN A;  3IEY B;  3AJV B;  1OB9 A;  1XMX A;  1RLV A;  1UWV A;  1Y1O A;  3P1Y A;  4TKK A;  2FKC A;  3P1Z A;  2FLC A;  3ZLJ A;  2FCO A;  4DA2 A;  4TKD A;  2CV8 A;  3THY A;  2O8C B;  2JJQ A;  4DAV A;  1HH1 A;  1OH5 A;  2WJ0 A;  3IF0 X;  1ZP7 A;  3THW A;  3THX B;  3BT7 A;  1NG9 A;  2VLD A;  3AJV A; 
#chains in the Genus database with same CATH homology
 2INB A;  4QBL A;  2EO0 A;  1A79 A;  3IEY A;  2VS1 A;  1YNM A;  1F1Z A;  1RZN A;  1OB8 A;  2DBS A;  3FOV A;  2GJW A;  3IEY B;  4LQE A;  2W8M A;  5FDK A;  4G6V A;  2WCW A;  2Z0R A;  1R0V A;  3AJV B;  1Y88 A;  4G6U A;  1OB9 A;  1XMX A;  1RLV A;  2ZYZ B;  4QBN A;  4QBO A;  2FL3 A;  1IPI A;  1UWV A;  1Y1O A;  3P1Y A;  4TKK A;  2OKF A;  2FKC A;  3P1Z A;  2FLC A;  4DAP A;  2WCZ A;  2FCO A;  1GEF A;  2OST A;  4ZQU A;  4DA2 A;  2WJ0 A;  2WIW A;  2FKH B;  4TKD A;  2CV8 A;  3P1Z B;  1T0F A;  2ZYZ A;  2BH2 A;  2CZR A;  2JJQ A;  4FZ2 A;  2IXS A;  1HH1 A;  2GW6 A;  3DNX A;  4EV1 A;  4E6Z A;  4DAV A;  3IF0 X;  1ZP7 A;  2WIZ A;  3BT7 A;  2VLD A;  1R11 A;  3AJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...