3E54A

Archaeal intron-encoded homing endonuclease i-vdi141i complexed with dna
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
159
structure length
159
Chain Sequence
EEDFKEGYILGFIEAEGSFSVSIKFQRDVFGGVRLDPVFSITQKNREVLEAIKEHLGIGRIMEKAGQPNTYVYVVDNFNELVKLINFLNKYADFMIVKKRQFLMFREIANGLVNGEHLHINGLKRLVKLAYELTKESEKGYRKYDLNHVLSIIDKWDLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RRNA intron-encoded endonuclease
publication title Recognition of a common rDNA target site in archaea and eukarya by analogous LAGLIDADG and His-Cys box homing endonucleases
pubmed doi rcsb
source organism Vulcanisaeta distributa
molecule tags Hydrolase/dna
total genus 52
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2008-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00961 LAGLIDADG_1 LAGLIDADG endonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 3e54A00
1UM2A 4Z20A 3UVFA 4AAEA 3HYIA 5A74A 2VBOB 5AKNA 1EF0A 4LQ0A 3MX9A 5A0MA 5E67A 1JVAA 2DCHX 1DQ3A 1T9IA 2QOJZ 5A0MB 5E63A 3FD2A 2CW7A 2CW8A 4UN9A 2FLDA 2VBLB 4AAFA 2VBNA 1MOWA 3OORA 4Z1XA 4UN7A 2VBJA 1M5XA 1AF5A 4YITA 3E54A 4UN8G 3C0WA 5E5SA 5A77A 4LOXA 4Z1ZA 4AAGA 2VBNB 1BP7A 1G9ZA 2VBJB 2I3PA 2VBLA 5AK9A 1VDEA 3EH8A 1R7MA 2EX5A 4D6OA 5A78A 1B24A 4UN8A 4YHXA 3MIPA 3QQYA 4UNAA 1U0DA 4EFJA 4AADA 2O7MA 3OOLA 4AABA 3C0XA 4YISA 1T9JA 1U0CA 5AKMA 1P8KZ 3MISA 4AQUA 5AKFA 5A0WA 2AB5A 3MXBB 1N3EA 4UNCA 1LWSA 3MXAA 5A72A 4UT0A 2VS7A 2XE0A 2VS8A 3HYJA 4UN9G 3R7PA 1DFAA 1G9YA 3KO2A 4D6NA 4AQXA 4UN7G 1LWTA 5E5OA 2I3QA 1N3FA 2XE0B 3MXBA 4UNBA 2VBOA
chains in the Genus database with same CATH superfamily
1UM2A 4Z20A 3UVFA 4AAEA 3HYIA 5A74A 2VBOB 5AKNA 1EF0A 4LQ0A 3MX9A 5A0MA 5E67A 1JVAA 2DCHX 1DQ3A 1T9IA 2QOJZ 5A0MB 5E63A 3FD2A 2CW7A 2CW8A 4UN9A 2FLDA 2VBLB 4AAFA 2VBNA 1MOWA 3OORA 4Z1XA 4UN7A 2VBJA 1M5XA 1AF5A 4YITA 3E54A 4UN8G 3C0WA 5E5SA 5A77A 4LOXA 4Z1ZA 4AAGA 2VBNB 1BP7A 1G9ZA 2VBJB 2I3PA 2VBLA 5AK9A 1VDEA 3EH8A 1R7MA 2EX5A 4D6OA 5A78A 1B24A 4UN8A 4YHXA 3MIPA 3QQYA 4UNAA 2F4LA 1U0DA 4EFJA 4AADA 2O7MA 3OOLA 4AABA 3C0XA 4YISA 1T9JA 1U0CA 5AKMA 1P8KZ 3MISA 4KZSA 4AQUA 5AKFA 5A0WA 2AB5A 3MXBB 1N3EA 4UNCA 1LWSA 3MXAA 5A72A 4UT0A 2VS7A 2XE0A 2VS8A 3HYJA 4UN9G 3R7PA 1DFAA 1G9YA 3KO2A 4D6NA 4AQXA 4UN7G 1LWTA 5E5OA 2I3QA 1N3FA 2XE0B 3MXBA 4UNBA 2VBOA
chains in the Genus database with same CATH topology
1UM2A 4Z20A 3UVFA 4AAEA 3HYIA 5A74A 2VBOB 5AKNA 1EF0A 4LQ0A 3MX9A 5A0MA 5E67A 1JVAA 2DCHX 1DQ3A 1T9IA 2QOJZ 5A0MB 5E63A 3FD2A 2CW7A 2CW8A 4UN9A 2FLDA 2VBLB 4AAFA 2VBNA 1MOWA 3OORA 4Z1XA 4UN7A 2VBJA 1M5XA 1AF5A 4YITA 3E54A 4UN8G 3C0WA 5E5SA 5A77A 4LOXA 4Z1ZA 4AAGA 2VBNB 1BP7A 1G9ZA 2VBJB 2I3PA 2VBLA 5AK9A 1VDEA 3EH8A 1R7MA 2EX5A 4D6OA 5A78A 1B24A 4UN8A 4YHXA 3MIPA 3QQYA 4UNAA 1U0DA 4EFJA 4AADA 2O7MA 3OOLA 4AABA 3C0XA 4YISA 1T9JA 1U0CA 5AKMA 1P8KZ 3MISA 4AQUA 5AKFA 5A0WA 2AB5A 3MXBB 1N3EA 4UNCA 1LWSA 3MXAA 5A72A 4UT0A 2VS7A 2XE0A 2VS8A 3HYJA 4UN9G 3R7PA 1DFAA 1G9YA 3KO2A 4D6NA 4AQXA 4UN7G 1LWTA 5E5OA 2I3QA 1N3FA 2XE0B 3MXBA 4UNBA 2VBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UM2 A;  4Z20 A;  3UVF A;  4AAE A;  3HYI A;  5A74 A;  2VBO B;  5AKN A;  1EF0 A;  4LQ0 A;  3MX9 A;  5A0M A;  5E67 A;  1JVA A;  2DCH X;  1DQ3 A;  1T9I A;  2QOJ Z;  5A0M B;  5E63 A;  3FD2 A;  2CW7 A;  2CW8 A;  4UN9 A;  2FLD A;  2VBL B;  4AAF A;  2VBN A;  1MOW A;  3OOR A;  4Z1X A;  4UN7 A;  2VBJ A;  1M5X A;  1AF5 A;  4YIT A;  3E54 A;  4UN8 G;  3C0W A;  5E5S A;  5A77 A;  4LOX A;  4Z1Z A;  4AAG A;  2VBN B;  1BP7 A;  1G9Z A;  2VBJ B;  2I3P A;  2VBL A;  5AK9 A;  1VDE A;  3EH8 A;  1R7M A;  2EX5 A;  4D6O A;  5A78 A;  1B24 A;  4UN8 A;  4YHX A;  3MIP A;  3QQY A;  4UNA A;  1U0D A;  4EFJ A;  4AAD A;  2O7M A;  3OOL A;  4AAB A;  3C0X A;  4YIS A;  1T9J A;  1U0C A;  5AKM A;  1P8K Z;  3MIS A;  4AQU A;  5AKF A;  5A0W A;  2AB5 A;  3MXB B;  1N3E A;  4UNC A;  1LWS A;  3MXA A;  5A72 A;  4UT0 A;  2VS7 A;  2XE0 A;  2VS8 A;  3HYJ A;  4UN9 G;  3R7P A;  1DFA A;  1G9Y A;  3KO2 A;  4D6N A;  4AQX A;  4UN7 G;  1LWT A;  5E5O A;  2I3Q A;  1N3F A;  2XE0 B;  3MXB A;  4UNB A;  2VBO A; 
#chains in the Genus database with same CATH topology
 1UM2 A;  4Z20 A;  3UVF A;  4AAE A;  3HYI A;  5A74 A;  2VBO B;  5AKN A;  1EF0 A;  4LQ0 A;  3MX9 A;  5A0M A;  5E67 A;  1JVA A;  2DCH X;  1DQ3 A;  1T9I A;  2QOJ Z;  5A0M B;  5E63 A;  3FD2 A;  2CW7 A;  2CW8 A;  4UN9 A;  2FLD A;  2VBL B;  4AAF A;  2VBN A;  1MOW A;  3OOR A;  4Z1X A;  4UN7 A;  2VBJ A;  1M5X A;  1AF5 A;  4YIT A;  3E54 A;  4UN8 G;  3C0W A;  5E5S A;  5A77 A;  4LOX A;  4Z1Z A;  4AAG A;  2VBN B;  1BP7 A;  1G9Z A;  2VBJ B;  2I3P A;  2VBL A;  5AK9 A;  1VDE A;  3EH8 A;  1R7M A;  2EX5 A;  4D6O A;  5A78 A;  1B24 A;  4UN8 A;  4YHX A;  3MIP A;  3QQY A;  4UNA A;  2F4L A;  1U0D A;  4EFJ A;  4AAD A;  2O7M A;  3OOL A;  4AAB A;  3C0X A;  4YIS A;  1T9J A;  1U0C A;  5AKM A;  1P8K Z;  3MIS A;  4KZS A;  4AQU A;  5AKF A;  5A0W A;  2AB5 A;  3MXB B;  1N3E A;  4UNC A;  1LWS A;  3MXA A;  5A72 A;  4UT0 A;  2VS7 A;  2XE0 A;  2VS8 A;  3HYJ A;  4UN9 G;  3R7P A;  1DFA A;  1G9Y A;  3KO2 A;  4D6N A;  4AQX A;  4UN7 G;  1LWT A;  5E5O A;  2I3Q A;  1N3F A;  2XE0 B;  3MXB A;  4UNB A;  2VBO A; 
#chains in the Genus database with same CATH homology
 1UM2 A;  4Z20 A;  3UVF A;  4AAE A;  3HYI A;  5A74 A;  2VBO B;  5AKN A;  1EF0 A;  4LQ0 A;  3MX9 A;  5A0M A;  5E67 A;  1JVA A;  2DCH X;  1DQ3 A;  1T9I A;  2QOJ Z;  5A0M B;  5E63 A;  3FD2 A;  2CW7 A;  2CW8 A;  4UN9 A;  2FLD A;  2VBL B;  4AAF A;  2VBN A;  1MOW A;  3OOR A;  4Z1X A;  4UN7 A;  2VBJ A;  1M5X A;  1AF5 A;  4YIT A;  3E54 A;  4UN8 G;  3C0W A;  5E5S A;  5A77 A;  4LOX A;  4Z1Z A;  4AAG A;  2VBN B;  1BP7 A;  1G9Z A;  2VBJ B;  2I3P A;  2VBL A;  5AK9 A;  1VDE A;  3EH8 A;  1R7M A;  2EX5 A;  4D6O A;  5A78 A;  1B24 A;  4UN8 A;  4YHX A;  3MIP A;  3QQY A;  4UNA A;  1U0D A;  4EFJ A;  4AAD A;  2O7M A;  3OOL A;  4AAB A;  3C0X A;  4YIS A;  1T9J A;  1U0C A;  5AKM A;  1P8K Z;  3MIS A;  4AQU A;  5AKF A;  5A0W A;  2AB5 A;  3MXB B;  1N3E A;  4UNC A;  1LWS A;  3MXA A;  5A72 A;  4UT0 A;  2VS7 A;  2XE0 A;  2VS8 A;  3HYJ A;  4UN9 G;  3R7P A;  1DFA A;  1G9Y A;  3KO2 A;  4D6N A;  4AQX A;  4UN7 G;  1LWT A;  5E5O A;  2I3Q A;  1N3F A;  2XE0 B;  3MXB A;  4UNB A;  2VBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...