4KZSA

Crystal structure of the secreted protein hp1454 from the human pathogen helicobacter pylori
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
254
structure length
242
Chain Sequence
QKGYLYGSGSATSKEASKQKALADLVASISVVVNSQIHIQKSRINLKTDDLELNNVEIVNQEVQKGIYYTRVRINQNLFLQGLRDKYNALYGQFSTLMPKVCKGVFLQQSKSMGDLLAKAMPIERILKAYSVPVGSLENYEKIYYQNAFKPKVQITFDNNSDAEIKAALISAYARVLTPSDEEKLYQIKNEVFTDSANGITRIRVVVSASDCQGTPVLNRSLEVDEKNKNFAITRLQSLLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LPP20 lipofamily protein
publication title Crystal structure of the secreted protein HP1454 from the human pathogen Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori r046wa
molecule tags Unknown function
total genus 68
structure length 242
sequence length 254
ec nomenclature
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02169 LPP20 LPP20 lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.28.20 Alpha Beta Roll Endonuclease I-creI Acetamidase/Formamidase-like domains 4kzsA01
3.30.160.710 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4kzsA03
2F4LA 4KZSA
chains in the Genus database with same CATH superfamily
3C6KA 3EPJA 2LJUA 3OTOE 1HNWE 1T4OA 2K7IA 4IJDA 2UXDE 2F8BA 4ZYEA 3MXBB 2L33A 3TQMA 4Z20A 3HYIA 4YITA 1X48A 4BHCA 2ZM6E 2EMCA 2EPNA 1GTKA 2ENCA 2UU9E 1IBLE 2ENHA 5CFFE 3F6GA 2VBLA 2EMXA 2DIXA 3DF6A 1KJKA 3MHHC 2AB5A 2O7MA 1QU6A 2V86A 1EH7A 4JI3E 4UNAA 2DSYA 4WSGA 5LMNE 4O43A 1GZ6A 4UNCA 2EQ1A 2JOXA 1T4LB 5AC4A 1BP7A 5AK9A 1J5EE 1I94E 1QNTA 2ELZA 2RSMA 2NUGA 1A1LA 3C0WA 1DI2A 1EF0A 2XE0A 5A0MB 4MLVA 5A69A 1A1JA 2A25A 2R76A 1T9IA 1R7MA 2LVHA 3BBGA 2E72A 4ZYDA 2FLDA 2EL5A 1G2DC 2GPIA 4M2ZA 1BBGA 3M99B 4TUGA 2RTXA 4IS1C 2EOHA 5AE1A 3VYYA 1UM2A 2YRMA 1F2IG 2DRPA 2EORA 1MEYC 2KONA 3MIPA 2EQ0A 2JP9A 4UN8G 2HJJA 4F2JC 4B3SE 2EOSA 2LO3A 5ADZA 4DUYE 2I13A 2DCHX 1U0DA 1FJGE 4ZYHA 4GEQB 1B69A 4UNBA 4LF8E 3KZZA 4JI5E 2EN6A 2L3JA 4LTYA 4MLQA 3DJWA 2EPKX 2YTNA 3EH8A 5KL2A 3THOB 2GHFA 1HNXE 4LU9A 2LUPB 1VDEA 5T6JA 2BB8A 5KL7A 5A0MA 3E54A 1ZBQA 2EM9A 2UUBE 2EMBA 5IV8B 5KL5A 5AKNA 3UVFA 2CT1A 1PKPA 4TUIA 2NUEA 2K4VA 3JU0A 3OMLA 4YISA 4UN8A 1XNRE 2EOMA 2LE2A 1EH6A 2L2KB 1AAYA 4DR6E 3HPSA 4BCAA 4BMJA 4LF9E 5AASA 4X8WA 4DV6E 1YUIA 1STUA 1UHZA 4DV3E 2UUAE 1P47A 4BS9A 4R2RA 2FTXB 3T1HE 3OORA 3LMLA 2HGHA 3KO2A 1WRJA 4DV0E 2EOQA 4R2AA 2DLKA 3BIDA 2DGCA 1U0CA 2EM0A 4DR1E 1IQOA 5A6AA 2E1MA 2L2MA 1AH5A 1YFHA 2YTEA 1G9YA 1TF6A 2LT7A 3ADGA 4LF5E 4WSPA 2V87A 1LWTA 1UBDC 2PRTA 1YSAC 4R2PA 2J7JA 2V88A 4K0KE 5A78A 2WZOA 1A1GA 4YHHE 4AAFA 2I3PA 4ZYGA 1PDAA 2EPAA 2EE8A 2EMFA 4R2DA 2VBJB 2EN4A 3MX9A 2DB2A 2L8TA 1DGCA 1X6FA 2JR1A 2YZTA 2M1SA 2EN2A 3VHTB 2EPZA 4AADA 4R03A 1YZ9A 3JTZA 2EPCA 1N34E 4D6NA 2B9DA 3ADJA 5AKFA 2LTSA 3C6MA 2IHR1 3HXLA 2EPMX 2EMHA 4DKKA 3J7AG 2LMZA 2RSIA 2MKDA 4FK5C 4JI1E 4WX9A 2YTIA 5FLXC 1T9JA 1N3GA 3P1XA 2VQFE 2HHHE 1UILA 2L92A 1YUJA 2JOBA 4M9VC 5AE3A 2EMWA 2EOXA 4GZNC 3FD2A 3KZYA 2YPNA 2YT4A 5A6KA 2EN8A 3ADIA 2KHXA 3HTXA 4F9AB 4AQYE 5AKMA 4X9JA 2N3GA 1IQSA 2VBJA 4M30A 4LOXA 1N32E 2MDRA 4LF4E 4GKKE 1JK1A 2EPPA 5LLQA 5E5OA 4DV1E 4B3TE 3MHSC 4BHBA 2EZ6A 2N3HA 1IBME 1EH8A 3C0XA 3EPLA 4LFBE 2VS7A 2MC6A 2YTDA 3J80C 4I8OA 1MGTA 2EPUA 2EOZA 4JI8E 1WHQA 2LV2A 2EMYA 3LLHA 4WXCA 2JY9A 3ZOQB 4GKJE 4F54A 2L3CA 3AV0A 2WBUA 4O4KA 2D9HA 2EM5A 1M5XA 3MXAA 2EMGA 5IT9C 2UXCE 2EL4A 2EMLA 4R2CA 3VK6A 2VBNB 1JVAA 3HYJA 2EOIA 4DR4E 2EPOA 3IWBA 2EPXA 1HNZE 4AQUA 3HPZA 3OOLA 2EN3A 4X64E 4AABA 4DV4E 2V85A 2NA2A 5F3WA 4RH8A 1GQEA 2YTQA 4L5NC 4DV5E 1X47A 2HC5A 4DR5E 3T1YE 4UN9G 2ODRC 4LF6E 3MSWA 1PJSA 2YSOA 1RMDA 1KYQA 4UN7G 2JXPA 4LFAE 1IBKE 5IXMB 5AE2A 5KL3A 2EOFA 4F9BB 1HR0E 2YTJA 2YTOA 4JI4E 3BF2A 2EM4A 5BR8E 2MDGA 1WJPA 2LUQA 4N4RB 2UXBE 4R8OA 5A6BA 2EN7A 1N33E 1X5WA 3IWDA 2VBNA 1YPNA 4R2SA 5E67A 2YWQA 4D6OA 2UUCE 4LF7E 5E5SA 2B7TA 1T39A 1T38A 2EOYA 4M0VA 5IWAE 4UN9A 3EPHA 5KL6A 1EKZA 1BBOA 4NHRA 2EP3A 5KL4A 4DR2E 1N36E 4UN7A 1SR9A 3BGHA 1X6HA 1UN6B 4Q35B 1N3EA 2E5LE 2N8XA 4DV2E 4F9CB 4KWYA 2NABA 1TF3A 2CW7A 4Z1ZA 2EL6A 1RQ0A 2V89A 4P78A 5A2QC 4YY3E 2DMYA 1JK2A 1J26A 1XNQE 1X3CA 2DLQA 1X49A 5A72A 5A0WA 1ZAAC 4LQ0A 1Z1BA 3UK3C 4DR3E 2EOJA 4F6NA 1AF5A 2EN1A 5AC5A 1G9ZA 2CSHA 4AAGA 3THNA 2EX5A 2EOOA 2V83A 1X6EA 5TSEA 1P8KZ 2M7QA 1XMQE 1ZBTA 4DMIA 1YYOA 1SFEA 2VE7C 1YYKA 2DMIA 2FV4B 3J81C 2EPLX 4EFJA 2YTPA 2EMIA 3QQYA 2EM3A 2EWLA 2LBSB 2F4LA 2JYAA 5LL6R 1LWSA 2MKNA 3FIGA 4DR7E 2G7HA 3H09A 5LMUE 1G2FC 4Z1XA 3L00A 5E63A 3KWRA 4JI7E 4JI2E 2CW8A 2F4VE 2V8QB 4L8NA 1FKAE 2JVAA 4X65E 4R2QA 1PJTA 2R1FA 1B24A 3C4TA 4NZVA 4AAEA 2FGGA 4X66E 3IWCA 1WXRA 2ELYA 5A77A 2MC5A 2WBSA 4NXME 2YRKA 3JAMC 2EM7A 1T4NA 1IMUA 3RMPA 4WPYA 2VS8A 1ZR9A 1LLMC 5A6JA 3MXBA 3ADLA 2M4IA 2VBOB 2M9AA 4WXDA 2B3TB 1A1KA 2KOUA 2H36X 2RPCA 3C4BA 4BC7A 2VRDA 1A1HA 4B3ME 1TN9A 2RS7A 2ODRD 1PJQA 1A1FA 2EM8A 4J8ZA 1MOWA 3AUZA 2L6MA 4HEIA 2EM6A 4JV5E 2LJHA 2ADRA 3VYXA 2VF1A 2JPAA 2I9IA 2WBTA 4F6MA 4RHBB 1N3FA 2RS6A 3QG5C 1BB8A 4NXNE 1ZU1A 2YTGA 3EPKA 1A1IA 2EQ3A 4WFTA 2CPNA 5A6BD 1DQ3A 4JI6E 2BBGA 2EOEA 4DV7E 4B3RE 4O24A 2YU5A 4OOGC 1DFAA 1YYWA 3EQ1A 2B7VA 1WHNA 2VBOA 2LTRA 2ENAA 3R7PA 2QOJZ 4AQXA 2YTFA 4LFCE 2EMZA 4OX9E 2LCEA 4JI0E 4JYAE 2YU8A 4BBYA 2EMKA 4O5GA 2L2NA 4DUZE 1NEIA 1XMOE 3MISA 2LRSA 2NUFA 4Q28A 2CTDA 5A74A 2EJ4A 2JWOA 2YSPA 1RC7A 3ECRA 4HTGA 4BC9A 4KZSA 4YHXA 4R2EA 2VBLB 5DNYA 3J7Yp 2Q8UA 4WYQB 3F6HA 1L4SA 2RQLA 2I3QA 2EPRA 2WCC3 3K6QA 1NCSA 4KHPE 4X62E 1O0WA 2VQEE 2EMAA 3HQ1A 2XE0B 4P7DA 2GLIA 2YRHA 4UT0A 2EM2A
chains in the Genus database with same CATH topology
3OTOE 1HNWE 4DV4E 1T4OA 2V85A 2UXDE 2NA2A 3C4TA 2F8BA 5F3WA 2FGGA 4X66E 3IWCA 2L33A 1GQEA 1WXRA 4L5NC 4DV5E 1X47A 4DV0E 2E1MA 4DR1E 2L2MA 3T1YE 4DR5E 1X48A 2MC5A 4NXME 2ODRC 3JAMC 3MSWA 2ZM6E 4LF6E 3ADGA 4LF5E 4WSPA 4LFAE 1T4NA 2V87A 2UU9E 1IBKE 3RMPA 4WPYA 5AE2A 1IBLE 2V88A 4F9BB 5CFFE 3F6GA 1HR0E 4K0KE 3ADLA 2WZOA 2M4IA 4YHHE 2B3TB 2KOUA 2H36X 2DIXA 3DF6A 4BC7A 5BR8E 4JI4E 2V86A 1QU6A 4JI3E 2LUQA 4B3ME 2UXBE 2DSYA 4R8OA 5LMNE 2RS7A 1GZ6A 2ODRD 2JOXA 1N33E 3IWDA 4J8ZA 2DB2A 2L8TA 1T4LB 2JR1A 3AUZA 1J5EE 2YZTA 2M1SA 2UUCE 1I94E 2L6MA 4LF7E 2RSMA 4R03A 1YZ9A 2B7TA 2NUGA 1DI2A 3JTZA 1N34E 4M0VA 4JV5E 5IWAE 1EKZA 2LJHA 1N36E 4DR2E 2B9DA 3ADJA 3VYXA 2VF1A 2LTSA 1SR9A 2IHR1 3HXLA 2RS6A 4DKKA 3J7AG 2LMZA 4JI1E 4NXNE 2E5LE 5FLXC 4M2ZA 4DV2E 4F9CB 3P1XA 4TUGA 2RTXA 2VQFE 2HHHE 1UILA 2L92A 4WFTA 2CPNA 5AE1A 3VYYA 1RQ0A 1DQ3A 2V89A 4P78A 5A2QC 4X64E 2JOBA 2DMYA 4YY3E 5AE3A 4JI6E 4DV7E 4B3RE 1J26A 2KONA 4OOGC 1YYWA 1XNQE 2B7VA 1WHNA 2YT4A 4B3SE 1X49A 2LTRA 5ADZA 4DUYE 3ADIA 1FJGE 4GEQB 4LFCE 2KHXA 3HTXA 4F9AB 4AQYE 4JI0E 4OX9E 4JYAE 4BBYA 4DR3E 2N3GA 4LF8E 4JI5E 2L2NA 4M30A 4DUZE 1XMOE 2NUFA 2LRSA 4LTYA 2L3JA 3DJWA 2MDRA 1N32E 4Q28A 4LF4E 4GKKE 1HNXE 2V83A 4LU9A 2LUPB 5T6JA 4DV1E 2M7QA 4B3TE 1XMQE 1ZBTA 4DMIA 1YYOA 2N3HA 1IBME 2EZ6A 2VE7C 2JWOA 1ZBQA 1RC7A 2UUBE 2FV4B 1YYKA 3J81C 4LFBE 2MC6A 1PKPA 4KZSA 4BC9A 4TUIA 3J80C 4I8OA 2NUEA 2K4VA 3JU0A 4JI8E 5DNYA 1WHQA 2EWLA 3LLHA 3OMLA 3J7Yp 2LBSB 4WYQB 1XNRE 2F4LA 2JY9A 3F6HA 3ZOQB 2LE2A 4F54A 2L3CA 3AV0A 4GKJE 5LL6R 2L2KB 3FIGA 4DR6E 4DR7E 3HPSA 3K6QA 4BCAA 2G7HA 3H09A 4BMJA 5LMUE 5IT9C 4LF9E 4KHPE 5AASA 2UXCE 3KWRA 4JI7E 3VK6A 4JI2E 2F4VE 4X8WA 2V8QB 4X62E 1STUA 1UHZA 1O0WA 4DV3E 4DV6E 2UUAE 4BS9A 2VQEE 2FTXB 3T1HE 4DR4E 3LMLA 3IWBA 1HNZE 4L8NA 3HQ1A 3HPZA 1FKAE 2JVAA 4P7DA 4X65E 3C4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4L A;  4KZS A; 
#chains in the Genus database with same CATH topology
 3C6K A;  3EPJ A;  2LJU A;  3OTO E;  1HNW E;  1T4O A;  2K7I A;  4IJD A;  2UXD E;  2F8B A;  4ZYE A;  3MXB B;  2L33 A;  3TQM A;  4Z20 A;  3HYI A;  4YIT A;  1X48 A;  4BHC A;  2ZM6 E;  2EMC A;  2EPN A;  1GTK A;  2ENC A;  2UU9 E;  1IBL E;  2ENH A;  5CFF E;  3F6G A;  2VBL A;  2EMX A;  2DIX A;  3DF6 A;  1KJK A;  3MHH C;  2AB5 A;  2O7M A;  1QU6 A;  2V86 A;  1EH7 A;  4JI3 E;  4UNA A;  2DSY A;  4WSG A;  5LMN E;  4O43 A;  1GZ6 A;  4UNC A;  2EQ1 A;  2JOX A;  1T4L B;  5AC4 A;  1BP7 A;  5AK9 A;  1J5E E;  1I94 E;  1QNT A;  2ELZ A;  2RSM A;  2NUG A;  1A1L A;  3C0W A;  1DI2 A;  1EF0 A;  2XE0 A;  5A0M B;  4MLV A;  5A69 A;  1A1J A;  2A25 A;  2R76 A;  1T9I A;  1R7M A;  2LVH A;  3BBG A;  2E72 A;  4ZYD A;  2FLD A;  2EL5 A;  1G2D C;  2GPI A;  4M2Z A;  1BBG A;  3M99 B;  4TUG A;  2RTX A;  4IS1 C;  2EOH A;  5AE1 A;  3VYY A;  1UM2 A;  2YRM A;  1F2I G;  2DRP A;  2EOR A;  1MEY C;  2KON A;  3MIP A;  2EQ0 A;  2JP9 A;  4UN8 G;  2HJJ A;  4F2J C;  4B3S E;  2EOS A;  2LO3 A;  5ADZ A;  4DUY E;  2I13 A;  2DCH X;  1U0D A;  1FJG E;  4ZYH A;  4GEQ B;  1B69 A;  4UNB A;  4LF8 E;  3KZZ A;  4JI5 E;  2EN6 A;  2L3J A;  4LTY A;  4MLQ A;  3DJW A;  2EPK X;  2YTN A;  3EH8 A;  5KL2 A;  3THO B;  2GHF A;  1HNX E;  4LU9 A;  2LUP B;  1VDE A;  5T6J A;  2BB8 A;  5KL7 A;  5A0M A;  3E54 A;  1ZBQ A;  2EM9 A;  2UUB E;  2EMB A;  5IV8 B;  5KL5 A;  5AKN A;  3UVF A;  2CT1 A;  1PKP A;  4TUI A;  2NUE A;  2K4V A;  3JU0 A;  3OML A;  4YIS A;  4UN8 A;  1XNR E;  2EOM A;  2LE2 A;  1EH6 A;  2L2K B;  1AAY A;  4DR6 E;  3HPS A;  4BCA A;  4BMJ A;  4LF9 E;  5AAS A;  4X8W A;  4DV6 E;  1YUI A;  1STU A;  1UHZ A;  4DV3 E;  2UUA E;  1P47 A;  4BS9 A;  4R2R A;  2FTX B;  3T1H E;  3OOR A;  3LML A;  2HGH A;  3KO2 A;  1WRJ A;  4DV0 E;  2EOQ A;  4R2A A;  2DLK A;  3BID A;  2DGC A;  1U0C A;  2EM0 A;  4DR1 E;  1IQO A;  5A6A A;  2E1M A;  2L2M A;  1AH5 A;  1YFH A;  2YTE A;  1G9Y A;  1TF6 A;  2LT7 A;  3ADG A;  4LF5 E;  4WSP A;  2V87 A;  1LWT A;  1UBD C;  2PRT A;  1YSA C;  4R2P A;  2J7J A;  2V88 A;  4K0K E;  5A78 A;  2WZO A;  1A1G A;  4YHH E;  4AAF A;  2I3P A;  4ZYG A;  1PDA A;  2EPA A;  2EE8 A;  2EMF A;  4R2D A;  2VBJ B;  2EN4 A;  3MX9 A;  2DB2 A;  2L8T A;  1DGC A;  1X6F A;  2JR1 A;  2YZT A;  2M1S A;  2EN2 A;  3VHT B;  2EPZ A;  4AAD A;  4R03 A;  1YZ9 A;  3JTZ A;  2EPC A;  1N34 E;  4D6N A;  2B9D A;  3ADJ A;  5AKF A;  2LTS A;  3C6M A;  2IHR 1;  3HXL A;  2EPM X;  2EMH A;  4DKK A;  3J7A G;  2LMZ A;  2RSI A;  2MKD A;  4FK5 C;  4JI1 E;  4WX9 A;  2YTI A;  5FLX C;  1T9J A;  1N3G A;  3P1X A;  2VQF E;  2HHH E;  1UIL A;  2L92 A;  1YUJ A;  2JOB A;  4M9V C;  5AE3 A;  2EMW A;  2EOX A;  4GZN C;  3FD2 A;  3KZY A;  2YPN A;  2YT4 A;  5A6K A;  2EN8 A;  3ADI A;  2KHX A;  3HTX A;  4F9A B;  4AQY E;  5AKM A;  4X9J A;  2N3G A;  1IQS A;  2VBJ A;  4M30 A;  4LOX A;  1N32 E;  2MDR A;  4LF4 E;  4GKK E;  1JK1 A;  2EPP A;  5LLQ A;  5E5O A;  4DV1 E;  4B3T E;  3MHS C;  4BHB A;  2EZ6 A;  2N3H A;  1IBM E;  1EH8 A;  3C0X A;  3EPL A;  4LFB E;  2VS7 A;  2MC6 A;  2YTD A;  3J80 C;  4I8O A;  1MGT A;  2EPU A;  2EOZ A;  4JI8 E;  1WHQ A;  2LV2 A;  2EMY A;  3LLH A;  4WXC A;  2JY9 A;  3ZOQ B;  4GKJ E;  4F54 A;  2L3C A;  3AV0 A;  2WBU A;  4O4K A;  2D9H A;  2EM5 A;  1M5X A;  3MXA A;  2EMG A;  5IT9 C;  2UXC E;  2EL4 A;  2EML A;  4R2C A;  3VK6 A;  2VBN B;  1JVA A;  3HYJ A;  2EOI A;  4DR4 E;  2EPO A;  3IWB A;  2EPX A;  1HNZ E;  4AQU A;  3HPZ A;  3OOL A;  2EN3 A;  4X64 E;  4AAB A;  4DV4 E;  2V85 A;  2NA2 A;  5F3W A;  4RH8 A;  1GQE A;  2YTQ A;  4L5N C;  4DV5 E;  1X47 A;  2HC5 A;  4DR5 E;  3T1Y E;  4UN9 G;  2ODR C;  4LF6 E;  3MSW A;  1PJS A;  2YSO A;  1RMD A;  1KYQ A;  4UN7 G;  2JXP A;  4LFA E;  1IBK E;  5IXM B;  5AE2 A;  5KL3 A;  2EOF A;  4F9B B;  1HR0 E;  2YTJ A;  2YTO A;  4JI4 E;  3BF2 A;  2EM4 A;  5BR8 E;  2MDG A;  1WJP A;  2LUQ A;  4N4R B;  2UXB E;  4R8O A;  5A6B A;  2EN7 A;  1N33 E;  1X5W A;  3IWD A;  2VBN A;  1YPN A;  4R2S A;  5E67 A;  2YWQ A;  4D6O A;  2UUC E;  4LF7 E;  5E5S A;  2B7T A;  1T39 A;  1T38 A;  2EOY A;  4M0V A;  5IWA E;  4UN9 A;  3EPH A;  5KL6 A;  1EKZ A;  1BBO A;  4NHR A;  2EP3 A;  5KL4 A;  4DR2 E;  1N36 E;  4UN7 A;  1SR9 A;  3BGH A;  1X6H A;  1UN6 B;  4Q35 B;  1N3E A;  2E5L E;  2N8X A;  4DV2 E;  4F9C B;  4KWY A;  2NAB A;  1TF3 A;  2CW7 A;  4Z1Z A;  2EL6 A;  1RQ0 A;  2V89 A;  4P78 A;  5A2Q C;  4YY3 E;  2DMY A;  1JK2 A;  1J26 A;  1XNQ E;  1X3C A;  2DLQ A;  1X49 A;  5A72 A;  5A0W A;  1ZAA C;  4LQ0 A;  1Z1B A;  3UK3 C;  4DR3 E;  2EOJ A;  4F6N A;  1AF5 A;  2EN1 A;  5AC5 A;  1G9Z A;  2CSH A;  4AAG A;  3THN A;  2EX5 A;  2EOO A;  2V83 A;  1X6E A;  5TSE A;  1P8K Z;  2M7Q A;  1XMQ E;  1ZBT A;  4DMI A;  1YYO A;  1SFE A;  2VE7 C;  1YYK A;  2DMI A;  2FV4 B;  3J81 C;  2EPL X;  4EFJ A;  2YTP A;  2EMI A;  3QQY A;  2EM3 A;  2EWL A;  2LBS B;  2F4L A;  2JYA A;  5LL6 R;  1LWS A;  2MKN A;  3FIG A;  4DR7 E;  2G7H A;  3H09 A;  5LMU E;  1G2F C;  4Z1X A;  3L00 A;  5E63 A;  3KWR A;  4JI7 E;  4JI2 E;  2CW8 A;  2F4V E;  2V8Q B;  4L8N A;  1FKA E;  2JVA A;  4X65 E;  4R2Q A;  1PJT A;  2R1F A;  1B24 A;  3C4T A;  4NZV A;  4AAE A;  2FGG A;  4X66 E;  3IWC A;  1WXR A;  2ELY A;  5A77 A;  2MC5 A;  2WBS A;  4NXM E;  2YRK A;  3JAM C;  2EM7 A;  1T4N A;  1IMU A;  3RMP A;  4WPY A;  2VS8 A;  1ZR9 A;  1LLM C;  5A6J A;  3MXB A;  3ADL A;  2M4I A;  2VBO B;  2M9A A;  4WXD A;  2B3T B;  1A1K A;  2KOU A;  2H36 X;  2RPC A;  3C4B A;  4BC7 A;  2VRD A;  1A1H A;  4B3M E;  1TN9 A;  2RS7 A;  2ODR D;  1PJQ A;  1A1F A;  2EM8 A;  4J8Z A;  1MOW A;  3AUZ A;  2L6M A;  4HEI A;  2EM6 A;  4JV5 E;  2LJH A;  2ADR A;  3VYX A;  2VF1 A;  2JPA A;  2I9I A;  2WBT A;  4F6M A;  4RHB B;  1N3F A;  2RS6 A;  3QG5 C;  1BB8 A;  4NXN E;  1ZU1 A;  2YTG A;  3EPK A;  1A1I A;  2EQ3 A;  4WFT A;  2CPN A;  5A6B D;  1DQ3 A;  4JI6 E;  2BBG A;  2EOE A;  4DV7 E;  4B3R E;  4O24 A;  2YU5 A;  4OOG C;  1DFA A;  1YYW A;  3EQ1 A;  2B7V A;  1WHN A;  2VBO A;  2LTR A;  2ENA A;  3R7P A;  2QOJ Z;  4AQX A;  2YTF A;  4LFC E;  2EMZ A;  4OX9 E;  2LCE A;  4JI0 E;  4JYA E;  2YU8 A;  4BBY A;  2EMK A;  4O5G A;  2L2N A;  4DUZ E;  1NEI A;  1XMO E;  3MIS A;  2LRS A;  2NUF A;  4Q28 A;  2CTD A;  5A74 A;  2EJ4 A;  2JWO A;  2YSP A;  1RC7 A;  3ECR A;  4HTG A;  4BC9 A;  4KZS A;  4YHX A;  4R2E A;  2VBL B;  5DNY A;  3J7Y p;  2Q8U A;  4WYQ B;  3F6H A;  1L4S A;  2RQL A;  2I3Q A;  2EPR A;  2WCC 3;  3K6Q A;  1NCS A;  4KHP E;  4X62 E;  1O0W A;  2VQE E;  2EMA A;  3HQ1 A;  2XE0 B;  4P7D A;  2GLI A;  2YRH A;  4UT0 A;  2EM2 A; 
#chains in the Genus database with same CATH homology
 3OTO E;  1HNW E;  4DV4 E;  1T4O A;  2V85 A;  2UXD E;  2NA2 A;  3C4T A;  2F8B A;  5F3W A;  2FGG A;  4X66 E;  3IWC A;  2L33 A;  1GQE A;  1WXR A;  4L5N C;  4DV5 E;  1X47 A;  4DV0 E;  2E1M A;  4DR1 E;  2L2M A;  3T1Y E;  4DR5 E;  1X48 A;  2MC5 A;  4NXM E;  2ODR C;  3JAM C;  3MSW A;  2ZM6 E;  4LF6 E;  3ADG A;  4LF5 E;  4WSP A;  4LFA E;  1T4N A;  2V87 A;  2UU9 E;  1IBK E;  3RMP A;  4WPY A;  5AE2 A;  1IBL E;  2V88 A;  4F9B B;  5CFF E;  3F6G A;  1HR0 E;  4K0K E;  3ADL A;  2WZO A;  2M4I A;  4YHH E;  2B3T B;  2KOU A;  2H36 X;  2DIX A;  3DF6 A;  4BC7 A;  5BR8 E;  4JI4 E;  2V86 A;  1QU6 A;  4JI3 E;  2LUQ A;  4B3M E;  2UXB E;  2DSY A;  4R8O A;  5LMN E;  2RS7 A;  1GZ6 A;  2ODR D;  2JOX A;  1N33 E;  3IWD A;  4J8Z A;  2DB2 A;  2L8T A;  1T4L B;  2JR1 A;  3AUZ A;  1J5E E;  2YZT A;  2M1S A;  2UUC E;  1I94 E;  2L6M A;  4LF7 E;  2RSM A;  4R03 A;  1YZ9 A;  2B7T A;  2NUG A;  1DI2 A;  3JTZ A;  1N34 E;  4M0V A;  4JV5 E;  5IWA E;  1EKZ A;  2LJH A;  1N36 E;  4DR2 E;  2B9D A;  3ADJ A;  3VYX A;  2VF1 A;  2LTS A;  1SR9 A;  2IHR 1;  3HXL A;  2RS6 A;  4DKK A;  3J7A G;  2LMZ A;  4JI1 E;  4NXN E;  2E5L E;  5FLX C;  4M2Z A;  4DV2 E;  4F9C B;  3P1X A;  4TUG A;  2RTX A;  2VQF E;  2HHH E;  1UIL A;  2L92 A;  4WFT A;  2CPN A;  5AE1 A;  3VYY A;  1RQ0 A;  1DQ3 A;  2V89 A;  4P78 A;  5A2Q C;  4X64 E;  2JOB A;  2DMY A;  4YY3 E;  5AE3 A;  4JI6 E;  4DV7 E;  4B3R E;  1J26 A;  2KON A;  4OOG C;  1YYW A;  1XNQ E;  2B7V A;  1WHN A;  2YT4 A;  4B3S E;  1X49 A;  2LTR A;  5ADZ A;  4DUY E;  3ADI A;  1FJG E;  4GEQ B;  4LFC E;  2KHX A;  3HTX A;  4F9A B;  4AQY E;  4JI0 E;  4OX9 E;  4JYA E;  4BBY A;  4DR3 E;  2N3G A;  4LF8 E;  4JI5 E;  2L2N A;  4M30 A;  4DUZ E;  1XMO E;  2NUF A;  2LRS A;  4LTY A;  2L3J A;  3DJW A;  2MDR A;  1N32 E;  4Q28 A;  4LF4 E;  4GKK E;  1HNX E;  2V83 A;  4LU9 A;  2LUP B;  5T6J A;  4DV1 E;  2M7Q A;  4B3T E;  1XMQ E;  1ZBT A;  4DMI A;  1YYO A;  2N3H A;  1IBM E;  2EZ6 A;  2VE7 C;  2JWO A;  1ZBQ A;  1RC7 A;  2UUB E;  2FV4 B;  1YYK A;  3J81 C;  4LFB E;  2MC6 A;  1PKP A;  4KZS A;  4BC9 A;  4TUI A;  3J80 C;  4I8O A;  2NUE A;  2K4V A;  3JU0 A;  4JI8 E;  5DNY A;  1WHQ A;  2EWL A;  3LLH A;  3OML A;  3J7Y p;  2LBS B;  4WYQ B;  1XNR E;  2F4L A;  2JY9 A;  3F6H A;  3ZOQ B;  2LE2 A;  4F54 A;  2L3C A;  3AV0 A;  4GKJ E;  5LL6 R;  2L2K B;  3FIG A;  4DR6 E;  4DR7 E;  3HPS A;  3K6Q A;  4BCA A;  2G7H A;  3H09 A;  4BMJ A;  5LMU E;  5IT9 C;  4LF9 E;  4KHP E;  5AAS A;  2UXC E;  3KWR A;  4JI7 E;  3VK6 A;  4JI2 E;  2F4V E;  4X8W A;  2V8Q B;  4X62 E;  1STU A;  1UHZ A;  1O0W A;  4DV3 E;  4DV6 E;  2UUA E;  4BS9 A;  2VQE E;  2FTX B;  3T1H E;  4DR4 E;  3LML A;  3IWB A;  1HNZ E;  4L8N A;  3HQ1 A;  3HPZ A;  1FKA E;  2JVA A;  4P7D A;  4X65 E;  3C4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...