4KZSA

Crystal structure of the secreted protein hp1454 from the human pathogen helicobacter pylori
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
254
structure length
242
Chain Sequence
QKGYLYGSGSATSKEASKQKALADLVASISVVVNSQIHIQKSRINLKTDDLELNNVEIVNQEVQKGIYYTRVRINQNLFLQGLRDKYNALYGQFSTLMPKVCKGVFLQQSKSMGDLLAKAMPIERILKAYSVPVGSLENYEKIYYQNAFKPKVQITFDNNSDAEIKAALISAYARVLTPSDEEKLYQIKNEVFTDSANGITRIRVVVSASDCQGTPVLNRSLEVDEKNKNFAITRLQSLLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the secreted protein HP1454 from the human pathogen Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori r046wa
molecule tags Unknown function
molecule keywords LPP20 lipofamily protein
total genus 68
structure length 242
sequence length 254
ec nomenclature
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02169 LPP20 LPP20 lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.28.20 Alpha Beta Roll Endonuclease I-creI Acetamidase/Formamidase-like domains 4kzsA01
3.30.160.710 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4kzsA03
4KZSA 2F4LA
chains in the Genus database with same CATH superfamily
1AH5A 2EMCA 2N3GA 5KL5A 4RHBB 4I8OA 1N33E 3BF2A 1YSAC 3C4BA 2N8XA 3HTXA 2EMXA 3VYXA 1T4OA 4N4RB 2CPNA 2CTDA 1UN6B 1X49A 2EPKX 2EMIA 1WJPA 1X47A 2XE0A 1SR9A 4IS1C 2LTRA 4R2PA 2EOFA 1AAYA 1HNWE 5ADZA 1BB8A 2EPAA 2YSOA 4LF9E 1N3EA 1GZ6A 3DF6A 3IWDA 4D6OA 1PJQA 2B3TB 2JXPA 1N3FA 2VBNA 2NABA 2NA2A 2DGCA 5E5SA 5AK9A 1UHZA 2YTPA 4F54A 1G2DC 2RPCA 1ZBTA 4JI7E 2VBJA 3C4TA 2L33A 1IBKE 5T6JA 1P8KZ 1DGCA 4O24A 2EM9A 4KHPE 2LO3A 3EPLA 2UUCE 2DLKA 2EPPA 4GKKE 1I94E 4DR4E 4LU9A 4L5NC 3F6HA 1Z1BA 2O7MA 5A6KA 3KZYA 2EPLX 2LT7A 5IWAE 2V83A 3HYIA 1A1FA 5CFFE 2LE2A 2VE7C 2EM3A 1UILA 3IWCA 4M0VA 4F9BB 2EN1A 5KL2A 3THNA 2M7QA 3AUZA 2ODRC 4O5GA 1YUIA 4NXME 3J7AG 4AQUA 2YRKA 3OTOE 4JI0E 2LCEA 2EX5A 2JOBA 3EH8A 4JI1E 5AC4A 1YYOA 4DR7E 2V8QB 2MKNA 5LMUE 2F8BA 2WZOA 3M99B 4ZYHA 3L00A 1T38A 1HNXE 2LV2A 2LUQA 1UM2A 1R7MA 2RTXA 1HR0E 5AC5A 1X6FA 1TF3A 4J8ZA 4Z20A 2JP9A 3EPHA 2LVHA 1J5EE 1BP7A 2JVAA 4NHRA 4B3TE 2NUEA 2CW7A 2E1MA 1EH7A 2EL6A 2VS7A 3FIGA 5AKFA 4DMIA 1L4SA 2VBNB 5TSEA 2BB8A 2ODRD 2VBLA 1RQ0A 1A1JA 1GQEA 2DMIA 3ADGA 2PRTA 2H36X 2MDGA 1N3GA 5IXMB 1YZ9A 3UVFA 1IMUA 4X64E 1IQOA 2LBSB 1DI2A 1QU6A 2L6MA 1AF5A 2QOJZ 1NEIA 1IQSA 4F2JC 2EWLA 2B7VA 1QNTA 1FJGE 3BIDA 4YITA 2L3CA 4O43A 4MLVA 4YHXA 4R03A 2EMWA 2YTJA 4UN7A 4BHBA 3MSWA 5A77A 4GZNC 4JI2E 1G9ZA 1X6HA 4Q35B 1X3CA 1ZBQA 3JU0A 2YRHA 5KL7A 2YTFA 3UK3C 1A1IA 4OOGC 1LWSA 1F2IG 4IJDA 2M4IA 4DUZE 1HNZE 2XE0B 4JI4E 3KO2A 2EORA 3MXAA 1WHQA 1DFAA 2YTIA 4BC9A 2EQ3A 4B3ME 1ZU1A 2EOQA 4WSGA 5AE3A 4AADA 5IV8B 1XNQE 2GHFA 1T39A 5AE1A 2K7IA 4X65E 4LF5E 2VBOA 2EMKA 1UBDC 2IHR1 2ELZA 5AE2A 1LLMC 5A0WA 5A6BA 4TUGA 2VQFE 2GLIA 1T9JA 4JI5E 2FLDA 2KHXA 3KWRA 2VS8A 3EQ1A 4LTYA 4X66E 4BS9A 4ZYEA 2L92A 4UT0A 2V89A 2EOMA 2LMZA 2UUBE 4DR6E 3OMLA 3J80C 1IBME 3TQMA 2VBLB 1X48A 4NZVA 2YTDA 3MXBA 1EH8A 2I3QA 4DV6E 2EOZA 2EM0A 2EPNA 4WX9A 2D9HA 2I13A 2RS6A 5LLQA 2EPRA 5A6JA 2E72A 5AASA 1G2FC 1O0WA 2V85A 2CSHA 1YYWA 4BMJA 2DCHX 4F6MA 1T9IA 2UUAE 1JK2A 4Q28A 1T4NA 2RS7A 1N32E 3ADJA 2HHHE 3C0XA 2NUGA 5A0MB 1T4LB 2EJ4A 2LJUA 4JV5E 4UN8G 4JI8E 1U0DA 2ADRA 2EOIA 2YZTA 3KZZA 3P1XA 2WBUA 2DIXA 1PJTA 3DJWA 4EFJA 1PKPA 2EMLA 2YSPA 2FGGA 2HC5A 2V88A 3ECRA 5A69A 2VQEE 4DV4E 5LMNE 1MEYC 2MKDA 4Z1XA 4AABA 4LQ0A 4KZSA 2EOJA 2I9IA 4R2QA 4ZYDA 4R2AA 3T1YE 2YU8A 4DKKA 2EM5A 4M30A 4LOXA 1IBLE 2EN4A 4JI3E 2UXCE 2UXDE 2J7JA 2WCC3 3EPKA 2EN7A 1YYKA 2E5LE 2EMZA 2LJHA 2EMBA 3J81C 4TUIA 2L2NA 4R2EA 1KJKA 2EP3A 2HGHA 3K6QA 4P78A 1NCSA 2EN8A 3C6MA 4R8OA 4AAEA 2NUFA 1KYQA 3LLHA 4X8WA 4LF6E 4HEIA 2F4VE 2LUPB 4DUYE 4FK5C 4R2SA 2EM7A 2JYAA 1A1LA 3BGHA 2EOHA 2UXBE 1G9YA 2Q8UA 5F3WA 4ZYGA 2UU9E 4B3RE 4DV5E 1ZAAC 1B24A 5AKMA 2YPNA 4HTGA 2ENAA 1GTKA 4BHCA 2EM4A 2L3JA 4DR5E 2EL4A 2YTNA 4BCAA 4UNBA 2KOUA 1LWTA 2EMHA 1VDEA 1XMQE 2DRPA 4Z1ZA 3C0WA 2JPAA 2YTGA 2LRSA 2G7HA 2VBOB 2DB2A 4YISA 4AAGA 1WHNA 4F9CB 4NXNE 3IWBA 4DV7E 3ADIA 4WPYA 1PDAA 3HXLA 2EN2A 4UN9G 4LFAE 4LF8E 2EMFA 2EL5A 2MC5A 3OOLA 2EN6A 2VRDA 5KL6A 3OORA 2YTOA 2EM6A 2JY9A 1J26A 2DMYA 2EPMX 4R2RA 2RQLA 4UNAA 3VYYA 3AV0A 3R7PA 2EPOA 2BBGA 1U0CA 1WXRA 3HPZA 1YPNA 4DV1E 2JR1A 1TN9A 5E5OA 4DR2E 5E67A 3QG5C 3THOB 3ZOQB 2L8TA 5A78A 1EH6A 1RC7A 2ZM6E 2FV4B 1PJSA 4GKJE 5A74A 4LF7E 2I3PA 1N36E 2L2KB 5A0MA 5BR8E 2GPIA 5A6BD 3MXBB 1N34E 4LFCE 2AB5A 2ELYA 2YU5A 3MHHC 4BBYA 2B7TA 2DSYA 1EF0A 1RMDA 2R1FA 3E54A 2EMYA 2EMGA 4GEQB 5A2QC 1BBGA 1MGTA 2M1SA 1P47A 3H09A 4DV3E 2EOEA 4WSPA 1EKZA 2KONA 4UN8A 2K4VA 1SFEA 1B69A 3BBGA 4F9AB 3MISA 2MC6A 4P7DA 2CT1A 2EPZA 1X6EA 2CW8A 3ADLA 4UN9A 2FTXB 4WFTA 4AAFA 3HQ1A 2EOSA 2EZ6A 2M9AA 3JAMC 3JTZA 2EN3A 4M9VC 4D6NA 4DV0E 3F6GA 1XMOE 5A72A 3VK6A 5A6AA 4YHHE 4UNCA 3C6KA 1XNRE 4RH8A 2HJJA 3QQYA 1A1HA 1WRJA 3MX9A 1A1GA 2VF1A 3EPJA 1M5XA 1DQ3A 4DR3E 1MOWA 3MHSC 2EPUA 3VHTB 2EM2A 1A1KA 1FKAE 2ENHA 5E63A 2MDRA 2EE8A 4AQXA 2WBSA 2YTQA 4O4KA 2V86A 3LMLA 4AQYE 2N3HA 2EMAA 4L8NA 2R76A 2RSIA 2WBTA 3HPSA 2EPXA 4LFBE 5LL6R 4BC7A 2YRMA 2EPCA 2B9DA 1YFHA 4M2ZA 2EOXA 2EQ1A 2YT4A 4OX9E 4YY3E 5KL3A 1YUJA 5IT9C 3RMPA 4F6NA 4X62E 2V87A 1JK1A 2RSMA 4WXCA 4DV2E 3J7Yp 4R2DA 3MIPA 1STUA 2VBJB 2YWQA 5FLXC 4LF4E 4JI6E 2F4LA 3HYJA 4WYQB 2EM8A 2DLQA 2ENCA 5DNYA 2JOXA 5AKNA 4B3SE 1TF6A 4R2CA 2EQ0A 4DR1E 1X5WA 5KL4A 4WXDA 4JYAE 2JWOA 2A25A 4MLQA 1JVAA 2YTEA 4UN7G 3FD2A 2EOOA 2L2MA 4K0KE 4X9JA 2EOYA 2LTSA 4KWYA 3T1HE 1ZR9A 1BBOA
chains in the Genus database with same CATH topology
2ODRD 1PKPA 5BR8E 2FGGA 1N34E 1RQ0A 2V88A 4LFCE 2N3GA 1GQEA 4BBYA 3ADGA 2B7TA 2DSYA 4I8OA 2VQEE 2H36X 1N33E 4DV4E 5LMNE 4GEQB 5A2QC 3C4BA 1YZ9A 3HTXA 2M1SA 3VYXA 1T4OA 3H09A 4DV3E 4KZSA 4X64E 4WSPA 2LBSB 2CPNA 1EKZA 1QU6A 1DI2A 2L6MA 1X49A 2KONA 1X47A 2K4VA 1SR9A 3T1YE 2LTRA 2EWLA 2B7VA 4DKKA 1FJGE 1HNWE 5ADZA 4F9AB 2L3CA 4LF9E 4M30A 1GZ6A 3DF6A 2MC6A 1IBLE 3IWDA 4R03A 4P7DA 4JI3E 2B3TB 2UXCE 2UXDE 3ADLA 2NA2A 2FTXB 1YYKA 2E5LE 3MSWA 1UHZA 4WFTA 2LJHA 3J81C 4F54A 4JI2E 3HQ1A 4TUIA 2L2NA 2EZ6A 1ZBTA 3JAMC 3JTZA 1ZBQA 3JU0A 4JI7E 4LFBE 3C4TA 2L33A 3K6QA 4P78A 5T6JA 4OOGC 1IBKE 4DV0E 3F6GA 4R8OA 2NUFA 1XMOE 3VK6A 3LLHA 2M4IA 4X8WA 4YHHE 4DUZE 1HNZE 2UUCE 4LF6E 1XNRE 2F4VE 4KHPE 4JI4E 4GKKE 1I94E 2LUPB 4DR4E 4LU9A 4DUYE 4L5NC 2UXBE 1WHQA 4BC9A 5F3WA 2VF1A 3F6HA 4DR3E 2UU9E 1DQ3A 4B3RE 4DV5E 4B3ME 1FKAE 5IWAE 5AE3A 2V83A 2MDRA 1XNQE 5CFFE 2LE2A 2VE7C 2L3JA 4DR5E 1UILA 4BCAA 5AE1A 3IWCA 2KOUA 2V86A 3LMLA 4AQYE 2N3HA 4M0VA 4X65E 4F9BB 1XMQE 4L8NA 4LF5E 2IHR1 5AE2A 3HPSA 2M7QA 4TUGA 5LL6R 2LRSA 3AUZA 4BC7A 2G7HA 2ODRC 2VQFE 4JI5E 2B9DA 2DB2A 4M2ZA 2KHXA 1WHNA 4F9CB 4NXME 4NXNE 3J7AG 3IWBA 3OTOE 4DV7E 4JI0E 3ADIA 2YT4A 3KWRA 4OX9E 4YY3E 2JOBA 4LTYA 4WPYA 4BS9A 4X66E 3RMPA 5IT9C 2L92A 4X62E 2V87A 3HXLA 4JI1E 2RSMA 2V89A 4DV2E 1YYOA 3J7Yp 2LMZA 2UUBE 4DR6E 4LFAE 1STUA 3OMLA 3J80C 4LF8E 1IBME 4DR7E 2V8QB 1X48A 2MC5A 5LMUE 4DV6E 5FLXC 4LF4E 2F8BA 4JI6E 2WZOA 2JY9A 1HNXE 2LUQA 2DMYA 2F4LA 1J26A 2RTXA 1HR0E 2RS6A 4WYQB 3VYYA 3AV0A 5DNYA 2JOXA 1WXRA 5AASA 4B3SE 4J8ZA 3HPZA 4DV1E 2JR1A 4DR1E 1O0WA 2V85A 4DR2E 1J5EE 1YYWA 4JYAE 3ZOQB 2JWOA 4BMJA 2JVAA 2L8TA 4B3TE 2NUEA 2UUAE 2E1MA 3FIGA 4Q28A 1T4NA 1RC7A 2ZM6E 2FV4B 2L2MA 2RS7A 1N32E 4K0KE 4GKJE 3ADJA 2HHHE 2NUGA 4LF7E 1T4LB 4DMIA 4JV5E 2LTSA 4JI8E 3T1HE 2YZTA 3P1XA 2DIXA 3DJWA 1N36E 2L2KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZS A;  2F4L A; 
#chains in the Genus database with same CATH topology
 1AH5 A;  2EMC A;  2N3G A;  5KL5 A;  4RHB B;  4I8O A;  1N33 E;  3BF2 A;  1YSA C;  3C4B A;  2N8X A;  3HTX A;  2EMX A;  3VYX A;  1T4O A;  4N4R B;  2CPN A;  2CTD A;  1UN6 B;  1X49 A;  2EPK X;  2EMI A;  1WJP A;  1X47 A;  2XE0 A;  1SR9 A;  4IS1 C;  2LTR A;  4R2P A;  2EOF A;  1AAY A;  1HNW E;  5ADZ A;  1BB8 A;  2EPA A;  2YSO A;  4LF9 E;  1N3E A;  1GZ6 A;  3DF6 A;  3IWD A;  4D6O A;  1PJQ A;  2B3T B;  2JXP A;  1N3F A;  2VBN A;  2NAB A;  2NA2 A;  2DGC A;  5E5S A;  5AK9 A;  1UHZ A;  2YTP A;  4F54 A;  1G2D C;  2RPC A;  1ZBT A;  4JI7 E;  2VBJ A;  3C4T A;  2L33 A;  1IBK E;  5T6J A;  1P8K Z;  1DGC A;  4O24 A;  2EM9 A;  4KHP E;  2LO3 A;  3EPL A;  2UUC E;  2DLK A;  2EPP A;  4GKK E;  1I94 E;  4DR4 E;  4LU9 A;  4L5N C;  3F6H A;  1Z1B A;  2O7M A;  5A6K A;  3KZY A;  2EPL X;  2LT7 A;  5IWA E;  2V83 A;  3HYI A;  1A1F A;  5CFF E;  2LE2 A;  2VE7 C;  2EM3 A;  1UIL A;  3IWC A;  4M0V A;  4F9B B;  2EN1 A;  5KL2 A;  3THN A;  2M7Q A;  3AUZ A;  2ODR C;  4O5G A;  1YUI A;  4NXM E;  3J7A G;  4AQU A;  2YRK A;  3OTO E;  4JI0 E;  2LCE A;  2EX5 A;  2JOB A;  3EH8 A;  4JI1 E;  5AC4 A;  1YYO A;  4DR7 E;  2V8Q B;  2MKN A;  5LMU E;  2F8B A;  2WZO A;  3M99 B;  4ZYH A;  3L00 A;  1T38 A;  1HNX E;  2LV2 A;  2LUQ A;  1UM2 A;  1R7M A;  2RTX A;  1HR0 E;  5AC5 A;  1X6F A;  1TF3 A;  4J8Z A;  4Z20 A;  2JP9 A;  3EPH A;  2LVH A;  1J5E E;  1BP7 A;  2JVA A;  4NHR A;  4B3T E;  2NUE A;  2CW7 A;  2E1M A;  1EH7 A;  2EL6 A;  2VS7 A;  3FIG A;  5AKF A;  4DMI A;  1L4S A;  2VBN B;  5TSE A;  2BB8 A;  2ODR D;  2VBL A;  1RQ0 A;  1A1J A;  1GQE A;  2DMI A;  3ADG A;  2PRT A;  2H36 X;  2MDG A;  1N3G A;  5IXM B;  1YZ9 A;  3UVF A;  1IMU A;  4X64 E;  1IQO A;  2LBS B;  1DI2 A;  1QU6 A;  2L6M A;  1AF5 A;  2QOJ Z;  1NEI A;  1IQS A;  4F2J C;  2EWL A;  2B7V A;  1QNT A;  1FJG E;  3BID A;  4YIT A;  2L3C A;  4O43 A;  4MLV A;  4YHX A;  4R03 A;  2EMW A;  2YTJ A;  4UN7 A;  4BHB A;  3MSW A;  5A77 A;  4GZN C;  4JI2 E;  1G9Z A;  1X6H A;  4Q35 B;  1X3C A;  1ZBQ A;  3JU0 A;  2YRH A;  5KL7 A;  2YTF A;  3UK3 C;  1A1I A;  4OOG C;  1LWS A;  1F2I G;  4IJD A;  2M4I A;  4DUZ E;  1HNZ E;  2XE0 B;  4JI4 E;  3KO2 A;  2EOR A;  3MXA A;  1WHQ A;  1DFA A;  2YTI A;  4BC9 A;  2EQ3 A;  4B3M E;  1ZU1 A;  2EOQ A;  4WSG A;  5AE3 A;  4AAD A;  5IV8 B;  1XNQ E;  2GHF A;  1T39 A;  5AE1 A;  2K7I A;  4X65 E;  4LF5 E;  2VBO A;  2EMK A;  1UBD C;  2IHR 1;  2ELZ A;  5AE2 A;  1LLM C;  5A0W A;  5A6B A;  4TUG A;  2VQF E;  2GLI A;  1T9J A;  4JI5 E;  2FLD A;  2KHX A;  3KWR A;  2VS8 A;  3EQ1 A;  4LTY A;  4X66 E;  4BS9 A;  4ZYE A;  2L92 A;  4UT0 A;  2V89 A;  2EOM A;  2LMZ A;  2UUB E;  4DR6 E;  3OML A;  3J80 C;  1IBM E;  3TQM A;  2VBL B;  1X48 A;  4NZV A;  2YTD A;  3MXB A;  1EH8 A;  2I3Q A;  4DV6 E;  2EOZ A;  2EM0 A;  2EPN A;  4WX9 A;  2D9H A;  2I13 A;  2RS6 A;  5LLQ A;  2EPR A;  5A6J A;  2E72 A;  5AAS A;  1G2F C;  1O0W A;  2V85 A;  2CSH A;  1YYW A;  4BMJ A;  2DCH X;  4F6M A;  1T9I A;  2UUA E;  1JK2 A;  4Q28 A;  1T4N A;  2RS7 A;  1N32 E;  3ADJ A;  2HHH E;  3C0X A;  2NUG A;  5A0M B;  1T4L B;  2EJ4 A;  2LJU A;  4JV5 E;  4UN8 G;  4JI8 E;  1U0D A;  2ADR A;  2EOI A;  2YZT A;  3KZZ A;  3P1X A;  2WBU A;  2DIX A;  1PJT A;  3DJW A;  4EFJ A;  1PKP A;  2EML A;  2YSP A;  2FGG A;  2HC5 A;  2V88 A;  3ECR A;  5A69 A;  2VQE E;  4DV4 E;  5LMN E;  1MEY C;  2MKD A;  4Z1X A;  4AAB A;  4LQ0 A;  4KZS A;  2EOJ A;  2I9I A;  4R2Q A;  4ZYD A;  4R2A A;  3T1Y E;  2YU8 A;  4DKK A;  2EM5 A;  4M30 A;  4LOX A;  1IBL E;  2EN4 A;  4JI3 E;  2UXC E;  2UXD E;  2J7J A;  2WCC 3;  3EPK A;  2EN7 A;  1YYK A;  2E5L E;  2EMZ A;  2LJH A;  2EMB A;  3J81 C;  4TUI A;  2L2N A;  4R2E A;  1KJK A;  2EP3 A;  2HGH A;  3K6Q A;  4P78 A;  1NCS A;  2EN8 A;  3C6M A;  4R8O A;  4AAE A;  2NUF A;  1KYQ A;  3LLH A;  4X8W A;  4LF6 E;  4HEI A;  2F4V E;  2LUP B;  4DUY E;  4FK5 C;  4R2S A;  2EM7 A;  2JYA A;  1A1L A;  3BGH A;  2EOH A;  2UXB E;  1G9Y A;  2Q8U A;  5F3W A;  4ZYG A;  2UU9 E;  4B3R E;  4DV5 E;  1ZAA C;  1B24 A;  5AKM A;  2YPN A;  4HTG A;  2ENA A;  1GTK A;  4BHC A;  2EM4 A;  2L3J A;  4DR5 E;  2EL4 A;  2YTN A;  4BCA A;  4UNB A;  2KOU A;  1LWT A;  2EMH A;  1VDE A;  1XMQ E;  2DRP A;  4Z1Z A;  3C0W A;  2JPA A;  2YTG A;  2LRS A;  2G7H A;  2VBO B;  2DB2 A;  4YIS A;  4AAG A;  1WHN A;  4F9C B;  4NXN E;  3IWB A;  4DV7 E;  3ADI A;  4WPY A;  1PDA A;  3HXL A;  2EN2 A;  4UN9 G;  4LFA E;  4LF8 E;  2EMF A;  2EL5 A;  2MC5 A;  3OOL A;  2EN6 A;  2VRD A;  5KL6 A;  3OOR A;  2YTO A;  2EM6 A;  2JY9 A;  1J26 A;  2DMY A;  2EPM X;  4R2R A;  2RQL A;  4UNA A;  3VYY A;  3AV0 A;  3R7P A;  2EPO A;  2BBG A;  1U0C A;  1WXR A;  3HPZ A;  1YPN A;  4DV1 E;  2JR1 A;  1TN9 A;  5E5O A;  4DR2 E;  5E67 A;  3QG5 C;  3THO B;  3ZOQ B;  2L8T A;  5A78 A;  1EH6 A;  1RC7 A;  2ZM6 E;  2FV4 B;  1PJS A;  4GKJ E;  5A74 A;  4LF7 E;  2I3P A;  1N36 E;  2L2K B;  5A0M A;  5BR8 E;  2GPI A;  5A6B D;  3MXB B;  1N34 E;  4LFC E;  2AB5 A;  2ELY A;  2YU5 A;  3MHH C;  4BBY A;  2B7T A;  2DSY A;  1EF0 A;  1RMD A;  2R1F A;  3E54 A;  2EMY A;  2EMG A;  4GEQ B;  5A2Q C;  1BBG A;  1MGT A;  2M1S A;  1P47 A;  3H09 A;  4DV3 E;  2EOE A;  4WSP A;  1EKZ A;  2KON A;  4UN8 A;  2K4V A;  1SFE A;  1B69 A;  3BBG A;  4F9A B;  3MIS A;  2MC6 A;  4P7D A;  2CT1 A;  2EPZ A;  1X6E A;  2CW8 A;  3ADL A;  4UN9 A;  2FTX B;  4WFT A;  4AAF A;  3HQ1 A;  2EOS A;  2EZ6 A;  2M9A A;  3JAM C;  3JTZ A;  2EN3 A;  4M9V C;  4D6N A;  4DV0 E;  3F6G A;  1XMO E;  5A72 A;  3VK6 A;  5A6A A;  4YHH E;  4UNC A;  3C6K A;  1XNR E;  4RH8 A;  2HJJ A;  3QQY A;  1A1H A;  1WRJ A;  3MX9 A;  1A1G A;  2VF1 A;  3EPJ A;  1M5X A;  1DQ3 A;  4DR3 E;  1MOW A;  3MHS C;  2EPU A;  3VHT B;  2EM2 A;  1A1K A;  1FKA E;  2ENH A;  5E63 A;  2MDR A;  2EE8 A;  4AQX A;  2WBS A;  2YTQ A;  4O4K A;  2V86 A;  3LML A;  4AQY E;  2N3H A;  2EMA A;  4L8N A;  2R76 A;  2RSI A;  2WBT A;  3HPS A;  2EPX A;  4LFB E;  5LL6 R;  4BC7 A;  2YRM A;  2EPC A;  2B9D A;  1YFH A;  4M2Z A;  2EOX A;  2EQ1 A;  2YT4 A;  4OX9 E;  4YY3 E;  5KL3 A;  1YUJ A;  5IT9 C;  3RMP A;  4F6N A;  4X62 E;  2V87 A;  1JK1 A;  2RSM A;  4WXC A;  4DV2 E;  3J7Y p;  4R2D A;  3MIP A;  1STU A;  2VBJ B;  2YWQ A;  5FLX C;  4LF4 E;  4JI6 E;  2F4L A;  3HYJ A;  4WYQ B;  2EM8 A;  2DLQ A;  2ENC A;  5DNY A;  2JOX A;  5AKN A;  4B3S E;  1TF6 A;  4R2C A;  2EQ0 A;  4DR1 E;  1X5W A;  5KL4 A;  4WXD A;  4JYA E;  2JWO A;  2A25 A;  4MLQ A;  1JVA A;  2YTE A;  4UN7 G;  3FD2 A;  2EOO A;  2L2M A;  4K0K E;  4X9J A;  2EOY A;  2LTS A;  4KWY A;  3T1H E;  1ZR9 A;  1BBO A; 
#chains in the Genus database with same CATH homology
 2ODR D;  1PKP A;  5BR8 E;  2FGG A;  1N34 E;  1RQ0 A;  2V88 A;  4LFC E;  2N3G A;  1GQE A;  4BBY A;  3ADG A;  2B7T A;  2DSY A;  4I8O A;  2VQE E;  2H36 X;  1N33 E;  4DV4 E;  5LMN E;  4GEQ B;  5A2Q C;  3C4B A;  1YZ9 A;  3HTX A;  2M1S A;  3VYX A;  1T4O A;  3H09 A;  4DV3 E;  4KZS A;  4X64 E;  4WSP A;  2LBS B;  2CPN A;  1EKZ A;  1QU6 A;  1DI2 A;  2L6M A;  1X49 A;  2KON A;  1X47 A;  2K4V A;  1SR9 A;  3T1Y E;  2LTR A;  2EWL A;  2B7V A;  4DKK A;  1FJG E;  1HNW E;  5ADZ A;  4F9A B;  2L3C A;  4LF9 E;  4M30 A;  1GZ6 A;  3DF6 A;  2MC6 A;  1IBL E;  3IWD A;  4R03 A;  4P7D A;  4JI3 E;  2B3T B;  2UXC E;  2UXD E;  3ADL A;  2NA2 A;  2FTX B;  1YYK A;  2E5L E;  3MSW A;  1UHZ A;  4WFT A;  2LJH A;  3J81 C;  4F54 A;  4JI2 E;  3HQ1 A;  4TUI A;  2L2N A;  2EZ6 A;  1ZBT A;  3JAM C;  3JTZ A;  1ZBQ A;  3JU0 A;  4JI7 E;  4LFB E;  3C4T A;  2L33 A;  3K6Q A;  4P78 A;  5T6J A;  4OOG C;  1IBK E;  4DV0 E;  3F6G A;  4R8O A;  2NUF A;  1XMO E;  3VK6 A;  3LLH A;  2M4I A;  4X8W A;  4YHH E;  4DUZ E;  1HNZ E;  2UUC E;  4LF6 E;  1XNR E;  2F4V E;  4KHP E;  4JI4 E;  4GKK E;  1I94 E;  2LUP B;  4DR4 E;  4LU9 A;  4DUY E;  4L5N C;  2UXB E;  1WHQ A;  4BC9 A;  5F3W A;  2VF1 A;  3F6H A;  4DR3 E;  2UU9 E;  1DQ3 A;  4B3R E;  4DV5 E;  4B3M E;  1FKA E;  5IWA E;  5AE3 A;  2V83 A;  2MDR A;  1XNQ E;  5CFF E;  2LE2 A;  2VE7 C;  2L3J A;  4DR5 E;  1UIL A;  4BCA A;  5AE1 A;  3IWC A;  2KOU A;  2V86 A;  3LML A;  4AQY E;  2N3H A;  4M0V A;  4X65 E;  4F9B B;  1XMQ E;  4L8N A;  4LF5 E;  2IHR 1;  5AE2 A;  3HPS A;  2M7Q A;  4TUG A;  5LL6 R;  2LRS A;  3AUZ A;  4BC7 A;  2G7H A;  2ODR C;  2VQF E;  4JI5 E;  2B9D A;  2DB2 A;  4M2Z A;  2KHX A;  1WHN A;  4F9C B;  4NXM E;  4NXN E;  3J7A G;  3IWB A;  3OTO E;  4DV7 E;  4JI0 E;  3ADI A;  2YT4 A;  3KWR A;  4OX9 E;  4YY3 E;  2JOB A;  4LTY A;  4WPY A;  4BS9 A;  4X66 E;  3RMP A;  5IT9 C;  2L92 A;  4X62 E;  2V87 A;  3HXL A;  4JI1 E;  2RSM A;  2V89 A;  4DV2 E;  1YYO A;  3J7Y p;  2LMZ A;  2UUB E;  4DR6 E;  4LFA E;  1STU A;  3OML A;  3J80 C;  4LF8 E;  1IBM E;  4DR7 E;  2V8Q B;  1X48 A;  2MC5 A;  5LMU E;  4DV6 E;  5FLX C;  4LF4 E;  2F8B A;  4JI6 E;  2WZO A;  2JY9 A;  1HNX E;  2LUQ A;  2DMY A;  2F4L A;  1J26 A;  2RTX A;  1HR0 E;  2RS6 A;  4WYQ B;  3VYY A;  3AV0 A;  5DNY A;  2JOX A;  1WXR A;  5AAS A;  4B3S E;  4J8Z A;  3HPZ A;  4DV1 E;  2JR1 A;  4DR1 E;  1O0W A;  2V85 A;  4DR2 E;  1J5E E;  1YYW A;  4JYA E;  3ZOQ B;  2JWO A;  4BMJ A;  2JVA A;  2L8T A;  4B3T E;  2NUE A;  2UUA E;  2E1M A;  3FIG A;  4Q28 A;  1T4N A;  1RC7 A;  2ZM6 E;  2FV4 B;  2L2M A;  2RS7 A;  1N32 E;  4K0K E;  4GKJ E;  3ADJ A;  2HHH E;  2NUG A;  4LF7 E;  1T4L B;  4DMI A;  4JV5 E;  2LTS A;  4JI8 E;  3T1H E;  2YZT A;  3P1X A;  2DIX A;  3DJW A;  1N36 E;  2L2K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...