4KZSA

Crystal structure of the secreted protein hp1454 from the human pathogen helicobacter pylori
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
254
structure length
242
Chain Sequence
QKGYLYGSGSATSKEASKQKALADLVASISVVVNSQIHIQKSRINLKTDDLELNNVEIVNQEVQKGIYYTRVRINQNLFLQGLRDKYNALYGQFSTLMPKVCKGVFLQQSKSMGDLLAKAMPIERILKAYSVPVGSLENYEKIYYQNAFKPKVQITFDNNSDAEIKAALISAYARVLTPSDEEKLYQIKNEVFTDSANGITRIRVVVSASDCQGTPVLNRSLEVDEKNKNFAITRLQSLLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords LPP20 lipofamily protein
publication title Crystal structure of the secreted protein HP1454 from the human pathogen Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori r046wa
total genus 68
structure length 242
sequence length 254
ec nomenclature
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02169 LPP20 LPP20 lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.28.20 Alpha Beta Roll Endonuclease I-creI Acetamidase/Formamidase-like domains 4kzsA01
3.30.160.710 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4kzsA03
4KZSA 2F4LA
chains in the Genus database with same CATH superfamily
2EMLA 2Q8UA 2VF1A 1I94E 1IQOA 2I13A 4UN9A 1EH8A 2EN1A 2L33A 4DR7E 2VBNA 4R2PA 2FTXB 4YITA 3C6MA 3EQ1A 2HHHE 1UM2A 3BF2A 1RQ0A 1P8KZ 1N36E 2JOXA 1WXRA 2ADRA 2RS7A 2G7HA 5AC5A 4R2RA 4UN8G 2YRMA 1LLMC 4F6MA 2EQ3A 4EFJA 4P78A 4RH8A 4WSPA 2EPPA 4KHPE 5AE2A 4DV6E 3OMLA 4LQ0A 2V88A 3HPZA 1HNWE 4LFAE 1X47A 2EMZA 4BHCA 4MLQA 4B3TE 1ZAAC 1EH7A 3HQ1A 4Z20A 2RSIA 2EL5A 2YTFA 3THNA 2EMXA 4ZYGA 3ADLA 4F9BB 2UXBE 1X6FA 1A1HA 4M30A 4GKJE 2XE0A 2LTRA 2ELYA 4UN9G 3EPKA 4NXME 5A6BD 3QG5C 2WBSA 1HNZE 4GKKE 3JU0A 2H36X 1KYQA 1R7MA 2EPOA 5LMUE 2EJ4A 2UUBE 2EN2A 4WYQB 2LV2A 5T6JA 1EH6A 4IS1C 2RTXA 1DGCA 5TSEA 1PKPA 4WXDA 4DMIA 5LLQA 3EH8A 2UUCE 2VBNB 2CPNA 3JTZA 4P7DA 3MIPA 5A69A 3HTXA 1N3GA 4AQXA 4JI6E 2M9AA 2EPAA 4X62E 4D6OA 1G2FC 2JVAA 1X3CA 1B24A 1TN9A 2EMGA 1U0CA 3KZZA 2AB5A 4DV1E 1XNQE 5AE3A 4TUIA 4DR2E 2JP9A 1UILA 1KJKA 1DI2A 1M5XA 2DGCA 3E54A 5LL6R 1FKAE 4LF5E 2EPKX 2JYAA 2NA2A 3DJWA 4R03A 2JPAA 2EN8A 2N3HA 2EM5A 4N4RB 3C4BA 3QQYA 2UXDE 4BBYA 4GZNC 1T39A 2VBJA 2L6MA 4WXCA 4HTGA 3EPLA 4J8ZA 4M2ZA 4F9CB 5A72A 5AKNA 4TUGA 3BBGA 4DR6E 1WJPA 2RPCA 1UBDC 2J7JA 4AABA 5FLXC 4O5GA 2XE0B 2D9HA 2LO3A 2VS7A 2FV4B 1P47A 3AUZA 3C0XA 4JI8E 2HJJA 4R2QA 2KHXA 1IQSA 4KWYA 5AKFA 2LJUA 2EOYA 1ZR9A 2JY9A 4LF4E 2F4LA 2CSHA 2V83A 1RMDA 4ZYEA 5A6JA 2NABA 2E1MA 2N3GA 2EE8A 4UNAA 3FD2A 2EM9A 4DV7E 2YTGA 4LF7E 1PJSA 5A6BA 4DV2E 1LWTA 1T4LB 1IBKE 2BB8A 5E67A 4DKKA 1TF6A 2EOFA 2L92A 3MISA 4WX9A 2WCC3 1J26A 1IBME 2YTIA 4Z1ZA 1U0DA 2V86A 2L2KB 2ODRC 3J7Yp 2JWOA 4UN7A 2EMWA 2LVHA 2DRPA 2EN6A 2VQFE 3RMPA 4K0KE 4YHXA 1IBLE 2EOIA 4DUZE 4X65E 5AE1A 4Q28A 2B9DA 1MEYC 1VDEA 3VYYA 2L3CA 3HXLA 4F6NA 2EWLA 1STUA 1PDAA 1A1FA 3DF6A 1EF0A 2UU9E 2EOXA 1BBOA 5E63A 4JI4E 4JI7E 2EOEA 2R1FA 2WBUA 3EPJA 4JI0E 2VBJB 2EM6A 3P1XA 4AAFA 1F2IG 2EPRA 2KOUA 4LOXA 2YRHA 4DR4E 2LTSA 1T4OA 2WBTA 2EN4A 2F8BA 3C6KA 4O43A 2EZ6A 2EOHA 1GTKA 2EOMA 4NHRA 3IWCA 5A2QC 4JYAE 2K4VA 4ZYHA 4Q35B 2EPMX 4KZSA 2JXPA 1JK2A 4B3ME 1X48A 1EKZA 1DFAA 3BGHA 1X6HA 2ODRD 3MX9A 2YTQA 4UN7G 1A1JA 2M7QA 2HGHA 2F4VE 4F2JC 2LE2A 1X49A 3MHSC 4ZYDA 2EOSA 3ADJA 2RQLA 3F6GA 3UK3C 1YZ9A 1N33E 1A1LA 1YUJA 2EM7A 2M1SA 5A0WA 2VS8A 2L8TA 3J7AG 1L4SA 2EPZA 2YTOA 3AV0A 2HC5A 3H09A 5IXMB 4R2CA 4JI5E 5KL5A 2MDRA 1G2DC 2JR1A 4X8WA 4BS9A 3FIGA 3EPHA 2EPCA 1LWSA 1GQEA 2YU5A 4YHHE 1QNTA 2EMKA 1NEIA 2EMYA 4R2AA 2YRKA 4DR5E 2EQ0A 4JI3E 2I3QA 2LCEA 3T1HE 3J80C 1WHQA 4X9JA 2EM2A 2NUEA 1JK1A 2YTDA 2NUGA 2GPIA 4DV4E 3MXBA 5DNYA 2YTJA 2MC6A 4BCAA 2EM3A 1YFHA 3IWDA 5CFFE 4JI1E 2V8QB 2EP3A 3IWBA 5AK9A 2EMCA 2V89A 1A1IA 2DIXA 2LUPB 2YTNA 1N32E 4RHBB 2PRTA 3OTOE 2YSPA 1MGTA 5A74A 4DV3E 2EN7A 3ADGA 5KL4A 5KL6A 2CW8A 3KWRA 2YTEA 4OOGC 2VBOA 2EMHA 1A1GA 1TF3A 2EM0A 1UHZA 5ADZA 1YYOA 2EM4A 2L2NA 2CTDA 4O4KA 2MKDA 1Z1BA 4AQUA 2DB2A 1QU6A 3HPSA 2B3TB 2VRDA 4DV0E 1YYWA 4LU9A 2EL6A 1XMQE 1XNRE 4LF9E 2EMAA 3OOLA 1N3EA 3K6QA 2YSOA 3LMLA 4B3RE 4Z1XA 1HR0E 2V85A 3ADIA 2ENAA 2DLKA 3C4TA 5IWAE 3VK6A 2B7TA 2ELZA 4HEIA 5F3WA 2L3JA 4I8OA 2EPUA 1NCSA 3LLHA 4WPYA 2YWQA 3ZOQB 4DUYE 2VE7C 4O24A 5AASA 4D6NA 5A0MA 3BIDA 1O0WA 2RSMA 3OORA 2LBSB 3MXBB 2EPXA 5LMNE 1B69A 3ECRA 4L5NC 2VBLA 1T4NA 3HYJA 5A78A 2EPNA 1SR9A 5AKMA 2L2MA 2A25A 4DV5E 2ENHA 2LT7A 3JAMC 4UT0A 4BMJA 5KL2A 2R76A 1T38A 2QOJZ 1GZ6A 3KZYA 2VQEE 3J81C 2CT1A 1X5WA 4UNBA 3VHTB 3VYXA 3THOB 4AAEA 1N34E 2VBOB 3MXAA 5E5OA 2EPLX 2FGGA 3F6HA 2KONA 2EMFA 4BC7A 4NXNE 2ZM6E 2EM8A 2EOOA 2I3PA 5KL7A 4UNCA 5AC4A 4R8OA 2LMZA 4MLVA 1JVAA 1PJQA 2I9IA 2K7IA 2DSYA 2GHFA 1RC7A 4LFCE 1J5EE 1YYKA 3T1YE 2EOJA 2WZOA 3L00A 2CW7A 1BBGA 1X6EA 2IHR1 2MDGA 2B7VA 3KO2A 4IJDA 2YU8A 2EOZA 4FK5C 4WSGA 4R2DA 4B3SE 5IV8B 2DMIA 2UXCE 1HNXE 3M99B 4LTYA 1IMUA 4NZVA 2LRSA 1ZBTA 2V87A 1ZU1A 4X66E 1AAYA 2NUFA 2O7MA 4X64E 1ZBQA 5A0MB 2E72A 2EMBA 1XMOE 2UUAE 2EL4A 2EOQA 2EX5A 2EMIA 2VBLB 2BBGA 2JOBA 2M4IA 4R2EA 3HYIA 2LJHA 4M9VC 1AH5A 1N3FA 1MOWA 1WHNA 4DR1E 1DQ3A 1SFEA 5KL3A 4OX9E 1AF5A 4L8NA 2GLIA 2DMYA 1A1KA 4M0VA 2RS6A 3TQMA 5A77A 4GEQB 2YPNA 4WFTA 1YSAC 2YZTA 2EORA 4AADA 1PJTA 2DLQA 4UN8A 2YTPA 4YISA 1G9YA 2EQ1A 2MKNA 4LF8E 1BP7A 1WRJA 2YT4A 4YY3E 4JI2E 1T9JA 2EN3A 5A6AA 3C0WA 2E5LE 4F54A 1UN6B 4LF6E 5BR8E 4F9AB 5IT9C 1T9IA 4LFBE 2MC5A 3UVFA 4BHBA 5E5SA 4JV5E 1G9ZA 2LUQA 4AAGA 2N8XA 1YPNA 2FLDA 1YUIA 1FJGE 5A6KA 2ENCA 3R7PA 4R2SA 1BB8A 4DR3E 3MSWA 2DCHX 4AQYE 4BC9A 3MHHC
chains in the Genus database with same CATH topology
3J7AG 2VF1A 2L6MA 1I94E 3JAMC 4BMJA 4M2ZA 4J8ZA 3AV0A 4F9CB 3H09A 2L33A 4TUGA 4DR7E 1GZ6A 2VQEE 4JI5E 3J81C 2MDRA 4DR6E 2FTXB 2JR1A 2HHHE 4X8WA 5FLXC 4BS9A 3FIGA 3VYXA 1GQEA 1RQ0A 1N34E 2FV4B 2FGGA 3F6HA 4BC7A 2JOXA 1N36E 2KONA 1WXRA 4NXNE 2RS7A 3AUZA 4YHHE 2ZM6E 2G7HA 4JI8E 4DR5E 4JI3E 2KHXA 3T1HE 3J80C 1WHQA 2JY9A 4P78A 2F4LA 2V83A 4R8OA 4LF4E 2NUEA 2LMZA 2NUGA 4WSPA 4DV4E 2E1MA 2N3GA 5AE2A 5DNYA 2DSYA 2MC6A 3OMLA 4BCAA 4DV6E 1RC7A 4LFCE 4KHPE 2V88A 3HPZA 1J5EE 1YYKA 3T1YE 1X47A 4LFAE 1HNWE 3IWDA 5CFFE 4JI1E 2WZOA 4B3TE 2V8QB 4DV7E 3IWBA 3HQ1A 4LF7E 2V89A 2IHR1 2DIXA 2B7VA 4DV2E 2LUPB 1T4LB 1IBKE 1N32E 4DKKA 3ADLA 2L92A 4F9BB 3OTOE 4B3SE 1J26A 2UXBE 1IBME 4DV3E 2V86A 2L2KB 2ODRC 3J7Yp 2JWOA 1HNXE 4M30A 2UXCE 4LTYA 3ADGA 4GKJE 2LRSA 2LTRA 2VQFE 3RMPA 4K0KE 3KWRA 1IBLE 1ZBTA 2V87A 4OOGC 4DUZE 4NXME 4X65E 5AE1A 4X66E 2NUFA 4GKKE 4Q28A 2B9DA 4X64E 1HNZE 1ZBQA 1UHZA 3JU0A 5ADZA 3VYYA 1YYOA 2L3CA 3HXLA 2H36X 2L2NA 1XMOE 2UUAE 2EWLA 1STUA 5LMUE 2JOBA 2UUBE 2M4IA 4WYQB 3DF6A 2DB2A 1QU6A 2LJHA 2UU9E 3HPSA 1WHNA 2B3TB 5T6JA 4DV0E 4JI4E 1XNQE 2RTXA 4LU9A 4DR1E 1XMQE 1DQ3A 4JI7E 1XNRE 4BBYA 1YYWA 4OX9E 4LF9E 4JI0E 1PKPA 4L8NA 4DMIA 3P1XA 2DMYA 3K6QA 2UUCE 4M0VA 2KOUA 2RS6A 3LMLA 4GEQB 2CPNA 3JTZA 4P7DA 4WFTA 2LTSA 4B3RE 4DR4E 1T4OA 2EZ6A 2F8BA 2YZTA 2V85A 1HR0E 3HTXA 3ADIA 3C4TA 4JI6E 5IWAE 3VK6A 4X62E 2B7TA 3IWCA 2JVAA 5A2QC 4LF8E 2YT4A 4JYAE 4YY3E 5F3WA 2L3JA 2K4VA 4JI2E 4I8OA 4DV1E 4KZSA 5AE3A 4TUIA 4DR2E 3LLHA 4WPYA 4F54A 2E5LE 1UILA 4B3ME 1X48A 1EKZA 4LF6E 5BR8E 3ZOQB 4DUYE 2VE7C 1DI2A 2ODRD 4F9AB 5AASA 5IT9C 5LL6R 2M7QA 1O0WA 2RSMA 1FKAE 4LF5E 2F4VE 2LBSB 4LFBE 2MC5A 2LE2A 5LMNE 2NA2A 1X49A 3DJWA 4L5NC 4R03A 4JV5E 1T4NA 2LUQA 3ADJA 1FJGE 3F6GA 1YZ9A 1N33E 1SR9A 2N3HA 2L2MA 3C4BA 2M1SA 4DR3E 3MSWA 2UXDE 4DV5E 4AQYE 4BC9A 2L8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZS A;  2F4L A; 
#chains in the Genus database with same CATH topology
 2EML A;  2Q8U A;  2VF1 A;  1I94 E;  1IQO A;  2I13 A;  4UN9 A;  1EH8 A;  2EN1 A;  2L33 A;  4DR7 E;  2VBN A;  4R2P A;  2FTX B;  4YIT A;  3C6M A;  3EQ1 A;  2HHH E;  1UM2 A;  3BF2 A;  1RQ0 A;  1P8K Z;  1N36 E;  2JOX A;  1WXR A;  2ADR A;  2RS7 A;  2G7H A;  5AC5 A;  4R2R A;  4UN8 G;  2YRM A;  1LLM C;  4F6M A;  2EQ3 A;  4EFJ A;  4P78 A;  4RH8 A;  4WSP A;  2EPP A;  4KHP E;  5AE2 A;  4DV6 E;  3OML A;  4LQ0 A;  2V88 A;  3HPZ A;  1HNW E;  4LFA E;  1X47 A;  2EMZ A;  4BHC A;  4MLQ A;  4B3T E;  1ZAA C;  1EH7 A;  3HQ1 A;  4Z20 A;  2RSI A;  2EL5 A;  2YTF A;  3THN A;  2EMX A;  4ZYG A;  3ADL A;  4F9B B;  2UXB E;  1X6F A;  1A1H A;  4M30 A;  4GKJ E;  2XE0 A;  2LTR A;  2ELY A;  4UN9 G;  3EPK A;  4NXM E;  5A6B D;  3QG5 C;  2WBS A;  1HNZ E;  4GKK E;  3JU0 A;  2H36 X;  1KYQ A;  1R7M A;  2EPO A;  5LMU E;  2EJ4 A;  2UUB E;  2EN2 A;  4WYQ B;  2LV2 A;  5T6J A;  1EH6 A;  4IS1 C;  2RTX A;  1DGC A;  5TSE A;  1PKP A;  4WXD A;  4DMI A;  5LLQ A;  3EH8 A;  2UUC E;  2VBN B;  2CPN A;  3JTZ A;  4P7D A;  3MIP A;  5A69 A;  3HTX A;  1N3G A;  4AQX A;  4JI6 E;  2M9A A;  2EPA A;  4X62 E;  4D6O A;  1G2F C;  2JVA A;  1X3C A;  1B24 A;  1TN9 A;  2EMG A;  1U0C A;  3KZZ A;  2AB5 A;  4DV1 E;  1XNQ E;  5AE3 A;  4TUI A;  4DR2 E;  2JP9 A;  1UIL A;  1KJK A;  1DI2 A;  1M5X A;  2DGC A;  3E54 A;  5LL6 R;  1FKA E;  4LF5 E;  2EPK X;  2JYA A;  2NA2 A;  3DJW A;  4R03 A;  2JPA A;  2EN8 A;  2N3H A;  2EM5 A;  4N4R B;  3C4B A;  3QQY A;  2UXD E;  4BBY A;  4GZN C;  1T39 A;  2VBJ A;  2L6M A;  4WXC A;  4HTG A;  3EPL A;  4J8Z A;  4M2Z A;  4F9C B;  5A72 A;  5AKN A;  4TUG A;  3BBG A;  4DR6 E;  1WJP A;  2RPC A;  1UBD C;  2J7J A;  4AAB A;  5FLX C;  4O5G A;  2XE0 B;  2D9H A;  2LO3 A;  2VS7 A;  2FV4 B;  1P47 A;  3AUZ A;  3C0X A;  4JI8 E;  2HJJ A;  4R2Q A;  2KHX A;  1IQS A;  4KWY A;  5AKF A;  2LJU A;  2EOY A;  1ZR9 A;  2JY9 A;  4LF4 E;  2F4L A;  2CSH A;  2V83 A;  1RMD A;  4ZYE A;  5A6J A;  2NAB A;  2E1M A;  2N3G A;  2EE8 A;  4UNA A;  3FD2 A;  2EM9 A;  4DV7 E;  2YTG A;  4LF7 E;  1PJS A;  5A6B A;  4DV2 E;  1LWT A;  1T4L B;  1IBK E;  2BB8 A;  5E67 A;  4DKK A;  1TF6 A;  2EOF A;  2L92 A;  3MIS A;  4WX9 A;  2WCC 3;  1J26 A;  1IBM E;  2YTI A;  4Z1Z A;  1U0D A;  2V86 A;  2L2K B;  2ODR C;  3J7Y p;  2JWO A;  4UN7 A;  2EMW A;  2LVH A;  2DRP A;  2EN6 A;  2VQF E;  3RMP A;  4K0K E;  4YHX A;  1IBL E;  2EOI A;  4DUZ E;  4X65 E;  5AE1 A;  4Q28 A;  2B9D A;  1MEY C;  1VDE A;  3VYY A;  2L3C A;  3HXL A;  4F6N A;  2EWL A;  1STU A;  1PDA A;  1A1F A;  3DF6 A;  1EF0 A;  2UU9 E;  2EOX A;  1BBO A;  5E63 A;  4JI4 E;  4JI7 E;  2EOE A;  2R1F A;  2WBU A;  3EPJ A;  4JI0 E;  2VBJ B;  2EM6 A;  3P1X A;  4AAF A;  1F2I G;  2EPR A;  2KOU A;  4LOX A;  2YRH A;  4DR4 E;  2LTS A;  1T4O A;  2WBT A;  2EN4 A;  2F8B A;  3C6K A;  4O43 A;  2EZ6 A;  2EOH A;  1GTK A;  2EOM A;  4NHR A;  3IWC A;  5A2Q C;  4JYA E;  2K4V A;  4ZYH A;  4Q35 B;  2EPM X;  4KZS A;  2JXP A;  1JK2 A;  4B3M E;  1X48 A;  1EKZ A;  1DFA A;  3BGH A;  1X6H A;  2ODR D;  3MX9 A;  2YTQ A;  4UN7 G;  1A1J A;  2M7Q A;  2HGH A;  2F4V E;  4F2J C;  2LE2 A;  1X49 A;  3MHS C;  4ZYD A;  2EOS A;  3ADJ A;  2RQL A;  3F6G A;  3UK3 C;  1YZ9 A;  1N33 E;  1A1L A;  1YUJ A;  2EM7 A;  2M1S A;  5A0W A;  2VS8 A;  2L8T A;  3J7A G;  1L4S A;  2EPZ A;  2YTO A;  3AV0 A;  2HC5 A;  3H09 A;  5IXM B;  4R2C A;  4JI5 E;  5KL5 A;  2MDR A;  1G2D C;  2JR1 A;  4X8W A;  4BS9 A;  3FIG A;  3EPH A;  2EPC A;  1LWS A;  1GQE A;  2YU5 A;  4YHH E;  1QNT A;  2EMK A;  1NEI A;  2EMY A;  4R2A A;  2YRK A;  4DR5 E;  2EQ0 A;  4JI3 E;  2I3Q A;  2LCE A;  3T1H E;  3J80 C;  1WHQ A;  4X9J A;  2EM2 A;  2NUE A;  1JK1 A;  2YTD A;  2NUG A;  2GPI A;  4DV4 E;  3MXB A;  5DNY A;  2YTJ A;  2MC6 A;  4BCA A;  2EM3 A;  1YFH A;  3IWD A;  5CFF E;  4JI1 E;  2V8Q B;  2EP3 A;  3IWB A;  5AK9 A;  2EMC A;  2V89 A;  1A1I A;  2DIX A;  2LUP B;  2YTN A;  1N32 E;  4RHB B;  2PRT A;  3OTO E;  2YSP A;  1MGT A;  5A74 A;  4DV3 E;  2EN7 A;  3ADG A;  5KL4 A;  5KL6 A;  2CW8 A;  3KWR A;  2YTE A;  4OOG C;  2VBO A;  2EMH A;  1A1G A;  1TF3 A;  2EM0 A;  1UHZ A;  5ADZ A;  1YYO A;  2EM4 A;  2L2N A;  2CTD A;  4O4K A;  2MKD A;  1Z1B A;  4AQU A;  2DB2 A;  1QU6 A;  3HPS A;  2B3T B;  2VRD A;  4DV0 E;  1YYW A;  4LU9 A;  2EL6 A;  1XMQ E;  1XNR E;  4LF9 E;  2EMA A;  3OOL A;  1N3E A;  3K6Q A;  2YSO A;  3LML A;  4B3R E;  4Z1X A;  1HR0 E;  2V85 A;  3ADI A;  2ENA A;  2DLK A;  3C4T A;  5IWA E;  3VK6 A;  2B7T A;  2ELZ A;  4HEI A;  5F3W A;  2L3J A;  4I8O A;  2EPU A;  1NCS A;  3LLH A;  4WPY A;  2YWQ A;  3ZOQ B;  4DUY E;  2VE7 C;  4O24 A;  5AAS A;  4D6N A;  5A0M A;  3BID A;  1O0W A;  2RSM A;  3OOR A;  2LBS B;  3MXB B;  2EPX A;  5LMN E;  1B69 A;  3ECR A;  4L5N C;  2VBL A;  1T4N A;  3HYJ A;  5A78 A;  2EPN A;  1SR9 A;  5AKM A;  2L2M A;  2A25 A;  4DV5 E;  2ENH A;  2LT7 A;  3JAM C;  4UT0 A;  4BMJ A;  5KL2 A;  2R76 A;  1T38 A;  2QOJ Z;  1GZ6 A;  3KZY A;  2VQE E;  3J81 C;  2CT1 A;  1X5W A;  4UNB A;  3VHT B;  3VYX A;  3THO B;  4AAE A;  1N34 E;  2VBO B;  3MXA A;  5E5O A;  2EPL X;  2FGG A;  3F6H A;  2KON A;  2EMF A;  4BC7 A;  4NXN E;  2ZM6 E;  2EM8 A;  2EOO A;  2I3P A;  5KL7 A;  4UNC A;  5AC4 A;  4R8O A;  2LMZ A;  4MLV A;  1JVA A;  1PJQ A;  2I9I A;  2K7I A;  2DSY A;  2GHF A;  1RC7 A;  4LFC E;  1J5E E;  1YYK A;  3T1Y E;  2EOJ A;  2WZO A;  3L00 A;  2CW7 A;  1BBG A;  1X6E A;  2IHR 1;  2MDG A;  2B7V A;  3KO2 A;  4IJD A;  2YU8 A;  2EOZ A;  4FK5 C;  4WSG A;  4R2D A;  4B3S E;  5IV8 B;  2DMI A;  2UXC E;  1HNX E;  3M99 B;  4LTY A;  1IMU A;  4NZV A;  2LRS A;  1ZBT A;  2V87 A;  1ZU1 A;  4X66 E;  1AAY A;  2NUF A;  2O7M A;  4X64 E;  1ZBQ A;  5A0M B;  2E72 A;  2EMB A;  1XMO E;  2UUA E;  2EL4 A;  2EOQ A;  2EX5 A;  2EMI A;  2VBL B;  2BBG A;  2JOB A;  2M4I A;  4R2E A;  3HYI A;  2LJH A;  4M9V C;  1AH5 A;  1N3F A;  1MOW A;  1WHN A;  4DR1 E;  1DQ3 A;  1SFE A;  5KL3 A;  4OX9 E;  1AF5 A;  4L8N A;  2GLI A;  2DMY A;  1A1K A;  4M0V A;  2RS6 A;  3TQM A;  5A77 A;  4GEQ B;  2YPN A;  4WFT A;  1YSA C;  2YZT A;  2EOR A;  4AAD A;  1PJT A;  2DLQ A;  4UN8 A;  2YTP A;  4YIS A;  1G9Y A;  2EQ1 A;  2MKN A;  4LF8 E;  1BP7 A;  1WRJ A;  2YT4 A;  4YY3 E;  4JI2 E;  1T9J A;  2EN3 A;  5A6A A;  3C0W A;  2E5L E;  4F54 A;  1UN6 B;  4LF6 E;  5BR8 E;  4F9A B;  5IT9 C;  1T9I A;  4LFB E;  2MC5 A;  3UVF A;  4BHB A;  5E5S A;  4JV5 E;  1G9Z A;  2LUQ A;  4AAG A;  2N8X A;  1YPN A;  2FLD A;  1YUI A;  1FJG E;  5A6K A;  2ENC A;  3R7P A;  4R2S A;  1BB8 A;  4DR3 E;  3MSW A;  2DCH X;  4AQY E;  4BC9 A;  3MHH C; 
#chains in the Genus database with same CATH homology
 3J7A G;  2VF1 A;  2L6M A;  1I94 E;  3JAM C;  4BMJ A;  4M2Z A;  4J8Z A;  3AV0 A;  4F9C B;  3H09 A;  2L33 A;  4TUG A;  4DR7 E;  1GZ6 A;  2VQE E;  4JI5 E;  3J81 C;  2MDR A;  4DR6 E;  2FTX B;  2JR1 A;  2HHH E;  4X8W A;  5FLX C;  4BS9 A;  3FIG A;  3VYX A;  1GQE A;  1RQ0 A;  1N34 E;  2FV4 B;  2FGG A;  3F6H A;  4BC7 A;  2JOX A;  1N36 E;  2KON A;  1WXR A;  4NXN E;  2RS7 A;  3AUZ A;  4YHH E;  2ZM6 E;  2G7H A;  4JI8 E;  4DR5 E;  4JI3 E;  2KHX A;  3T1H E;  3J80 C;  1WHQ A;  2JY9 A;  4P78 A;  2F4L A;  2V83 A;  4R8O A;  4LF4 E;  2NUE A;  2LMZ A;  2NUG A;  4WSP A;  4DV4 E;  2E1M A;  2N3G A;  5AE2 A;  5DNY A;  2DSY A;  2MC6 A;  3OML A;  4BCA A;  4DV6 E;  1RC7 A;  4LFC E;  4KHP E;  2V88 A;  3HPZ A;  1J5E E;  1YYK A;  3T1Y E;  1X47 A;  4LFA E;  1HNW E;  3IWD A;  5CFF E;  4JI1 E;  2WZO A;  4B3T E;  2V8Q B;  4DV7 E;  3IWB A;  3HQ1 A;  4LF7 E;  2V89 A;  2IHR 1;  2DIX A;  2B7V A;  4DV2 E;  2LUP B;  1T4L B;  1IBK E;  1N32 E;  4DKK A;  3ADL A;  2L92 A;  4F9B B;  3OTO E;  4B3S E;  1J26 A;  2UXB E;  1IBM E;  4DV3 E;  2V86 A;  2L2K B;  2ODR C;  3J7Y p;  2JWO A;  1HNX E;  4M30 A;  2UXC E;  4LTY A;  3ADG A;  4GKJ E;  2LRS A;  2LTR A;  2VQF E;  3RMP A;  4K0K E;  3KWR A;  1IBL E;  1ZBT A;  2V87 A;  4OOG C;  4DUZ E;  4NXM E;  4X65 E;  5AE1 A;  4X66 E;  2NUF A;  4GKK E;  4Q28 A;  2B9D A;  4X64 E;  1HNZ E;  1ZBQ A;  1UHZ A;  3JU0 A;  5ADZ A;  3VYY A;  1YYO A;  2L3C A;  3HXL A;  2H36 X;  2L2N A;  1XMO E;  2UUA E;  2EWL A;  1STU A;  5LMU E;  2JOB A;  2UUB E;  2M4I A;  4WYQ B;  3DF6 A;  2DB2 A;  1QU6 A;  2LJH A;  2UU9 E;  3HPS A;  1WHN A;  2B3T B;  5T6J A;  4DV0 E;  4JI4 E;  1XNQ E;  2RTX A;  4LU9 A;  4DR1 E;  1XMQ E;  1DQ3 A;  4JI7 E;  1XNR E;  4BBY A;  1YYW A;  4OX9 E;  4LF9 E;  4JI0 E;  1PKP A;  4L8N A;  4DMI A;  3P1X A;  2DMY A;  3K6Q A;  2UUC E;  4M0V A;  2KOU A;  2RS6 A;  3LML A;  4GEQ B;  2CPN A;  3JTZ A;  4P7D A;  4WFT A;  2LTS A;  4B3R E;  4DR4 E;  1T4O A;  2EZ6 A;  2F8B A;  2YZT A;  2V85 A;  1HR0 E;  3HTX A;  3ADI A;  3C4T A;  4JI6 E;  5IWA E;  3VK6 A;  4X62 E;  2B7T A;  3IWC A;  2JVA A;  5A2Q C;  4LF8 E;  2YT4 A;  4JYA E;  4YY3 E;  5F3W A;  2L3J A;  2K4V A;  4JI2 E;  4I8O A;  4DV1 E;  4KZS A;  5AE3 A;  4TUI A;  4DR2 E;  3LLH A;  4WPY A;  4F54 A;  2E5L E;  1UIL A;  4B3M E;  1X48 A;  1EKZ A;  4LF6 E;  5BR8 E;  3ZOQ B;  4DUY E;  2VE7 C;  1DI2 A;  2ODR D;  4F9A B;  5AAS A;  5IT9 C;  5LL6 R;  2M7Q A;  1O0W A;  2RSM A;  1FKA E;  4LF5 E;  2F4V E;  2LBS B;  4LFB E;  2MC5 A;  2LE2 A;  5LMN E;  2NA2 A;  1X49 A;  3DJW A;  4L5N C;  4R03 A;  4JV5 E;  1T4N A;  2LUQ A;  3ADJ A;  1FJG E;  3F6G A;  1YZ9 A;  1N33 E;  1SR9 A;  2N3H A;  2L2M A;  3C4B A;  2M1S A;  4DR3 E;  3MSW A;  2UXD E;  4DV5 E;  4AQY E;  4BC9 A;  2L8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...