4KZSA

Crystal structure of the secreted protein hp1454 from the human pathogen helicobacter pylori
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
254
structure length
242
Chain Sequence
QKGYLYGSGSATSKEASKQKALADLVASISVVVNSQIHIQKSRINLKTDDLELNNVEIVNQEVQKGIYYTRVRINQNLFLQGLRDKYNALYGQFSTLMPKVCKGVFLQQSKSMGDLLAKAMPIERILKAYSVPVGSLENYEKIYYQNAFKPKVQITFDNNSDAEIKAALISAYARVLTPSDEEKLYQIKNEVFTDSANGITRIRVVVSASDCQGTPVLNRSLEVDEKNKNFAITRLQSLLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LPP20 lipofamily protein
publication title Crystal structure of the secreted protein HP1454 from the human pathogen Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori r046wa
molecule tags Unknown function
total genus 68
structure length 242
sequence length 254
ec nomenclature
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02169 LPP20 LPP20 lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.28.20 Alpha Beta Roll Endonuclease I-creI Acetamidase/Formamidase-like domains 4kzsA01
3.30.160.710 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4kzsA03
2F4LA 4KZSA
chains in the Genus database with same CATH superfamily
5A0MB 3C4BA 3JAMC 5IWAE 1TF3A 2EPMX 2RS6A 4JYAE 5IV8B 1N32E 2EN6A 2WBTA 2ADRA 2EOJA 4N4RB 2DSYA 4R2QA 2FTXB 1IMUA 4DKKA 2YSPA 1X49A 3KZZA 3ADIA 1IBLE 4GEQB 4OOGC 2VE7C 3H09A 1EH6A 4AQXA 4BHCA 1YFHA 5KL4A 4EFJA 1O0WA 2UUCE 1HNZE 1N34E 5KL7A 4B3RE 2EPZA 1ZAAC 4ZYDA 4LFAE 2DLKA 4DR1E 1YSAC 1STUA 4R2CA 2V83A 2V85A 4M0VA 1G9YA 5DNYA 2ENAA 5A6JA 1GQEA 2B9DA 1ZBTA 2V86A 3BBGA 4JI8E 4YHHE 2ODRD 2ZM6E 4DR2E 2NUGA 2YTNA 1DFAA 1EH7A 4WYQB 5E63A 5A0MA 3C0XA 2EN7A 2EOHA 2M4IA 4UNCA 4R8OA 3EQ1A 4ZYHA 1NEIA 2EMBA 2N3GA 2LT7A 5A77A 4RH8A 2E5LE 4J8ZA 1LLMC 2EPCA 3FD2A 2LJUA 2EMAA 5TSEA 2RSIA 2LUQA 4L8NA 3F6GA 4JI6E 4WX9A 3QQYA 4GKKE 2EOFA 1J26A 3R7PA 2L6MA 2EOIA 1FJGE 4F54A 4LOXA 4KZSA 1QU6A 3OTOE 2YRHA 1XMQE 2LV2A 5KL5A 1A1KA 2L2MA 1WHQA 2EM2A 2EOMA 5A69A 1Z1BA 4NXME 2O7MA 1SFEA 1BBOA 2VBOB 3BF2A 2ODRC 5LL6R 1IBKE 2EPXA 1X5WA 2UXBE 4JI0E 1IQSA 4TUIA 3JTZA 3VHTB 5A6AA 4R2PA 4B3TE 1G2FC 2CW8A 2RPCA 4I8OA 2PRTA 4LF4E 2G7HA 4Q28A 2XE0B 4LTYA 1AH5A 4X9JA 2KONA 3ADGA 3C4TA 4LU9A 3AUZA 1TF6A 4BC9A 1WJPA 2L92A 2AB5A 2LTRA 1N36E 2MC5A 3DF6A 4BHBA 2N3HA 2EN8A 1PKPA 2YTIA 1GTKA 4JV5E 3JU0A 5KL6A 2QOJZ 5CFFE 2E1MA 2M9AA 4IS1C 2EM7A 1R7MA 1HNXE 1G2DC 1UM2A 1F2IG 2EZ6A 3C6MA 1B24A 4DV7E 2LMZA 3IWCA 3UK3C 3K6QA 2EM5A 1YYOA 2B7TA 2EMXA 2CTDA 4YISA 4KHPE 4UN8A 2VBOA 2DLQA 5KL3A 4AQUA 2YU5A 1I94E 3VYYA 4DV0E 2R76A 1JVAA 5AASA 2LJHA 2EMKA 4KWYA 2DRPA 2EM9A 2ENHA 2YT4A 2FGGA 4OX9E 1XNRE 2YTQA 3MHHC 4X62E 2JXPA 2MC6A 3KO2A 2EMYA 2ELZA 4YITA 2EMIA 2XE0A 5A6BA 4DV6E 2BBGA 1N3EA 2KOUA 2I13A 2H36X 1KJKA 4F9BB 1XMOE 2EL5A 2JYAA 4LFCE 2I3PA 2BB8A 4X65E 2CPNA 1WXRA 1VDEA 2F4VE 1T4LB 1YYWA 3P1XA 2UXDE 1T39A 1P47A 4B3ME 5F3WA 5AKFA 4UNBA 3J80C 1YPNA 2IHR1 4MLVA 2EOSA 2EMGA 2YPNA 4JI2E 5LMUE 4D6OA 3ECRA 1B69A 3RMPA 1UILA 5AC4A 2EN4A 2UU9E 5E67A 1ZU1A 1IQOA 4Z1XA 4Z1ZA 1N3FA 5AE1A 2D9HA 5A74A 4B3SE 3AV0A 2VBLB 1X48A 2L8TA 1UBDC 4AAEA 2EOQA 2M1SA 4DV5E 2EL6A 1PJQA 2B3TB 2LUPB 2YRKA 5A0WA 2L2KB 1FKAE 1MGTA 2EPPA 4M2ZA 1YZ9A 2VS7A 3T1YE 1AF5A 3HPZA 2EPKX 1KYQA 2EPLX 2JOBA 3J7AG 1EF0A 2I3QA 4LF7E 4P78A 3EPKA 2EOZA 1EH8A 1P8KZ 2K7IA 4M9VC 2LO3A 4O43A 3C0WA 2EOXA 4O24A 1BBGA 4DUYE 2EN3A 1T9JA 1A1FA 2EPUA 3VK6A 2YWQA 4X8WA 3ZOQB 3BGHA 4DV3E 4DMIA 3FIGA 2YZTA 5E5SA 4R2DA 2JOXA 4BC7A 1AAYA 2JY9A 5ADZA 4UN8G 1A1IA 4LQ0A 2ENCA 1PDAA 2KHXA 4DUZE 2ELYA 1NCSA 3MXBB 2K4VA 4UNAA 5KL2A 2FV4B 2L33A 4DR5E 2VF1A 1JK1A 4WXCA 1XNQE 1X6HA 2EX5A 2VS8A 1WHNA 2EJ4A 2VBLA 2EPNA 4JI3E 4LFBE 2EP3A 2JR1A 4RHBB 1X47A 4F2JC 1A1JA 2MDRA 2YU8A 3THNA 2JP9A 2DCHX 2CW7A 2JVAA 2EM3A 4DV2E 1J5EE 3EPLA 3LMLA 3TQMA 1TN9A 2L2NA 2EMLA 2EQ0A 1PJTA 3E54A 4YY3E 2WCC3 4R03A 2MKNA 2RTXA 1ZBQA 3EPHA 2DGCA 3MX9A 2LE2A 1M5XA 1RMDA 5LLQA 2NUFA 1UN6B 1LWSA 4R2EA 2NABA 2F8BA 1X6FA 1RQ0A 2VBNB 5A72A 2RS7A 3MIPA 2EE8A 2EORA 2YTPA 4HEIA 4D6NA 2LBSB 4JI7E 5IT9C 3MXBA 5E5OA 2CT1A 3LLHA 3HQ1A 1T9IA 2EM4A 1N33E 2EPAA 5AKNA 2Q8UA 4JI4E 1T4OA 5T6JA 4ZYGA 4LF5E 2EOOA 1IBME 4K0KE 2NUEA 4O4KA 4R2SA 2VQEE 4UN7A 1SR9A 2VQFE 4HTGA 3M99B 5BR8E 5IXMB 5A2QC 3F6HA 4WPYA 1DQ3A 3KWRA 2FLDA 1X3CA 2HGHA 5A6BD 2UUAE 4YHXA 4UT0A 3L00A 4GKJE 4AADA 2EWLA 2I9IA 2V8QB 2YSOA 4R2AA 4L5NC 2V88A 1LWTA 1BB8A 2L3CA 3VYXA 1T4NA 4TUGA 3IWBA 4AABA 5AC5A 2VBJB 4WXDA 1N3GA 4DV1E 2NA2A 2E72A 1G9ZA 2EPOA 1HR0E 1U0DA 2V87A 2HC5A 1ZR9A 3HYJA 2EMHA 4Q35B 2L3JA 1U0CA 4AAFA 4M30A 2VBNA 2WZOA 2EN2A 3MSWA 2EPRA 4R2RA 5A6KA 1YUIA 2JWOA 2YTFA 5AK9A 2LRSA 2YTDA 3EPJA 1MOWA 4LF6E 3MXAA 3HTXA 2DMIA 4NHRA 4GZNC 3T1HE 3OMLA 1A1HA 2YTOA 4F9CB 1JK2A 4NXNE 2LVHA 3THOB 2YTEA 4X64E 3IWDA 3OOLA 2DIXA 2EM6A 2N8XA 2B7VA 1A1LA 1GZ6A 2GLIA 2V89A 3C6KA 3UVFA 4DR7E 4DR3E 5A78A 4BMJA 2EMFA 2LCEA 3QG5C 2EMWA 4P7DA 2M7QA 2DB2A 5AKMA 4F9AB 2VBJA 1RC7A 3ADLA 3HXLA 2EOEA 4ZYEA 3KZYA 2EOYA 3MISA 2WBUA 2EL4A 2UUBE 2LTSA 4FK5C 4DR4E 4IJDA 4JI1E 2EQ3A 1MEYC 2YRMA 4UN9G 3MHSC 4DR6E 4BBYA 1WRJA 2RQLA 2VRDA 4Z20A 2RSMA 3ADJA 4F6NA 1EKZA 4MLQA 5AE2A 1UHZA 3BIDA 2MKDA 4O5GA 4LF8E 2F4LA 1T38A 2A25A 4WSPA 4UN7G 4NZVA 4F6MA 1HNWE 2EMZA 2HJJA 2R1FA 3DJWA 2EMCA 2EN1A 2YTGA 4AQYE 2DMYA 3J7Yp 2EQ1A 2UXCE 1L4SA 1DGCA 4WFTA 2CSHA 1PJSA 2GPIA 2J7JA 2MDGA 1A1GA 3OORA 3HYIA 4DV4E 4JI5E 3EH8A 2EM8A 1YYKA 5LMNE 1QNTA 2HHHE 5AE3A 2JPAA 4WSGA 2GHFA 3HPSA 1BP7A 1X6EA 5FLXC 4BS9A 4AAGA 1YUJA 2EM0A 4UN9A 2YTJA 4LF9E 2WBSA 3J81C 1DI2A 4BCAA 4X66E
chains in the Genus database with same CATH topology
4DV1E 4JV5E 2NA2A 3C4BA 3JAMC 3JU0A 5IWAE 5CFFE 1HR0E 2E1MA 2V87A 3VK6A 2RS6A 4X8WA 3ZOQB 4DV3E 4JYAE 4DMIA 3FIGA 2YZTA 1N32E 2JOXA 4BC7A 2DSYA 2L3JA 1HNXE 2FTXB 2JY9A 4M30A 4DKKA 5ADZA 2WZOA 3MSWA 1X49A 3ADIA 2JWOA 2EZ6A 2LRSA 1IBLE 4DV7E 4GEQB 4OOGC 2LMZA 2VE7C 2KHXA 3IWCA 3K6QA 4DUZE 3H09A 2K4VA 4LF6E 3HTXA 1YYOA 2B7TA 2FV4B 2L33A 3OMLA 3T1HE 1O0WA 4DR5E 2VF1A 2UUCE 4KHPE 1XNQE 1HNZE 1N34E 1YZ9A 4DUYE 4F9CB 1WHNA 4NXNE 4B3RE 1I94E 4JI3E 4LFBE 3VYYA 4DV0E 4LFAE 2JR1A 1X47A 5AASA 2LJHA 4DR1E 1XNRE 2YT4A 1STUA 2FGGA 4X64E 4OX9E 2MDRA 4X62E 2V83A 2V85A 4M0VA 2MC6A 3IWDA 2JVAA 5DNYA 2DIXA 4DV2E 1GQEA 2B9DA 4DV6E 1J5EE 3LMLA 1ZBTA 2B7VA 2V86A 1GZ6A 2L2NA 2V89A 4JI8E 4YHHE 2ODRD 2KOUA 2ZM6E 4DR7E 4DR2E 4DR3E 4YY3E 4BMJA 4R03A 2NUGA 2H36X 4F9AB 2RTXA 2M7QA 1ZBQA 4P7DA 2DB2A 4F9BB 4WYQB 1RC7A 3ADLA 3HXLA 2M4IA 1XMOE 4LFCE 4R8OA 2UUBE 2LTSA 4X65E 4DR4E 2CPNA 4JI1E 1WXRA 2LE2A 2F4VE 1T4LB 1YYWA 4DR6E 2N3GA 3P1XA 4BBYA 2NUFA 2UXDE 2E5LE 4J8ZA 4B3ME 5F3WA 3J80C 2IHR1 2LUQA 2F8BA 2RSMA 1RQ0A 3ADJA 3F6GA 4L8NA 5AE2A 1UHZA 1EKZA 4JI6E 2RS7A 4JI2E 5LMUE 4GKKE 1J26A 4LF8E 2F4LA 2L6MA 1FJGE 2LBSB 4JI7E 4F54A 5IT9C 3RMPA 4WSPA 1UILA 1DI2A 1HNWE 4KZSA 1QU6A 3OTOE 1XMQE 3DJWA 3LLHA 2L2MA 3HQ1A 1WHQA 2UU9E 1N33E 4AQYE 2DMYA 4JI4E 4NXME 3J7Yp 5AE1A 1T4OA 5T6JA 2UXCE 2ODRC 4LF5E 5LL6R 4WFTA 1IBME 4B3SE 4K0KE 3AV0A 1X48A 2L8TA 1IBKE 2NUEA 2VQEE 2M1SA 4JI0E 4DV5E 2UXBE 1SR9A 2VQFE 5BR8E 2B3TB 2LUPB 5A2QC 4TUIA 3JTZA 3F6HA 2L2KB 4DV4E 1FKAE 4WPYA 4JI5E 4B3TE 4M2ZA 4LF4E 1DQ3A 3KWRA 4I8OA 1YYKA 5LMNE 2G7HA 3T1YE 4Q28A 3HPZA 5AE3A 2HHHE 3HPSA 4LTYA 2UUAE 3J7AG 2JOBA 2KONA 3ADGA 4GKJE 3C4TA 4LU9A 3AUZA 2EWLA 2V8QB 4BS9A 5FLXC 4LF7E 4L5NC 4P78A 4BC9A 2V88A 2L92A 2LTRA 1N36E 2MC5A 2L3CA 1T4NA 3DF6A 3J81C 4TUGA 3IWBA 4LF9E 3VYXA 2N3HA 1PKPA 4BCAA 4X66E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4L A;  4KZS A; 
#chains in the Genus database with same CATH topology
 5A0M B;  3C4B A;  3JAM C;  5IWA E;  1TF3 A;  2EPM X;  2RS6 A;  4JYA E;  5IV8 B;  1N32 E;  2EN6 A;  2WBT A;  2ADR A;  2EOJ A;  4N4R B;  2DSY A;  4R2Q A;  2FTX B;  1IMU A;  4DKK A;  2YSP A;  1X49 A;  3KZZ A;  3ADI A;  1IBL E;  4GEQ B;  4OOG C;  2VE7 C;  3H09 A;  1EH6 A;  4AQX A;  4BHC A;  1YFH A;  5KL4 A;  4EFJ A;  1O0W A;  2UUC E;  1HNZ E;  1N34 E;  5KL7 A;  4B3R E;  2EPZ A;  1ZAA C;  4ZYD A;  4LFA E;  2DLK A;  4DR1 E;  1YSA C;  1STU A;  4R2C A;  2V83 A;  2V85 A;  4M0V A;  1G9Y A;  5DNY A;  2ENA A;  5A6J A;  1GQE A;  2B9D A;  1ZBT A;  2V86 A;  3BBG A;  4JI8 E;  4YHH E;  2ODR D;  2ZM6 E;  4DR2 E;  2NUG A;  2YTN A;  1DFA A;  1EH7 A;  4WYQ B;  5E63 A;  5A0M A;  3C0X A;  2EN7 A;  2EOH A;  2M4I A;  4UNC A;  4R8O A;  3EQ1 A;  4ZYH A;  1NEI A;  2EMB A;  2N3G A;  2LT7 A;  5A77 A;  4RH8 A;  2E5L E;  4J8Z A;  1LLM C;  2EPC A;  3FD2 A;  2LJU A;  2EMA A;  5TSE A;  2RSI A;  2LUQ A;  4L8N A;  3F6G A;  4JI6 E;  4WX9 A;  3QQY A;  4GKK E;  2EOF A;  1J26 A;  3R7P A;  2L6M A;  2EOI A;  1FJG E;  4F54 A;  4LOX A;  4KZS A;  1QU6 A;  3OTO E;  2YRH A;  1XMQ E;  2LV2 A;  5KL5 A;  1A1K A;  2L2M A;  1WHQ A;  2EM2 A;  2EOM A;  5A69 A;  1Z1B A;  4NXM E;  2O7M A;  1SFE A;  1BBO A;  2VBO B;  3BF2 A;  2ODR C;  5LL6 R;  1IBK E;  2EPX A;  1X5W A;  2UXB E;  4JI0 E;  1IQS A;  4TUI A;  3JTZ A;  3VHT B;  5A6A A;  4R2P A;  4B3T E;  1G2F C;  2CW8 A;  2RPC A;  4I8O A;  2PRT A;  4LF4 E;  2G7H A;  4Q28 A;  2XE0 B;  4LTY A;  1AH5 A;  4X9J A;  2KON A;  3ADG A;  3C4T A;  4LU9 A;  3AUZ A;  1TF6 A;  4BC9 A;  1WJP A;  2L92 A;  2AB5 A;  2LTR A;  1N36 E;  2MC5 A;  3DF6 A;  4BHB A;  2N3H A;  2EN8 A;  1PKP A;  2YTI A;  1GTK A;  4JV5 E;  3JU0 A;  5KL6 A;  2QOJ Z;  5CFF E;  2E1M A;  2M9A A;  4IS1 C;  2EM7 A;  1R7M A;  1HNX E;  1G2D C;  1UM2 A;  1F2I G;  2EZ6 A;  3C6M A;  1B24 A;  4DV7 E;  2LMZ A;  3IWC A;  3UK3 C;  3K6Q A;  2EM5 A;  1YYO A;  2B7T A;  2EMX A;  2CTD A;  4YIS A;  4KHP E;  4UN8 A;  2VBO A;  2DLQ A;  5KL3 A;  4AQU A;  2YU5 A;  1I94 E;  3VYY A;  4DV0 E;  2R76 A;  1JVA A;  5AAS A;  2LJH A;  2EMK A;  4KWY A;  2DRP A;  2EM9 A;  2ENH A;  2YT4 A;  2FGG A;  4OX9 E;  1XNR E;  2YTQ A;  3MHH C;  4X62 E;  2JXP A;  2MC6 A;  3KO2 A;  2EMY A;  2ELZ A;  4YIT A;  2EMI A;  2XE0 A;  5A6B A;  4DV6 E;  2BBG A;  1N3E A;  2KOU A;  2I13 A;  2H36 X;  1KJK A;  4F9B B;  1XMO E;  2EL5 A;  2JYA A;  4LFC E;  2I3P A;  2BB8 A;  4X65 E;  2CPN A;  1WXR A;  1VDE A;  2F4V E;  1T4L B;  1YYW A;  3P1X A;  2UXD E;  1T39 A;  1P47 A;  4B3M E;  5F3W A;  5AKF A;  4UNB A;  3J80 C;  1YPN A;  2IHR 1;  4MLV A;  2EOS A;  2EMG A;  2YPN A;  4JI2 E;  5LMU E;  4D6O A;  3ECR A;  1B69 A;  3RMP A;  1UIL A;  5AC4 A;  2EN4 A;  2UU9 E;  5E67 A;  1ZU1 A;  1IQO A;  4Z1X A;  4Z1Z A;  1N3F A;  5AE1 A;  2D9H A;  5A74 A;  4B3S E;  3AV0 A;  2VBL B;  1X48 A;  2L8T A;  1UBD C;  4AAE A;  2EOQ A;  2M1S A;  4DV5 E;  2EL6 A;  1PJQ A;  2B3T B;  2LUP B;  2YRK A;  5A0W A;  2L2K B;  1FKA E;  1MGT A;  2EPP A;  4M2Z A;  1YZ9 A;  2VS7 A;  3T1Y E;  1AF5 A;  3HPZ A;  2EPK X;  1KYQ A;  2EPL X;  2JOB A;  3J7A G;  1EF0 A;  2I3Q A;  4LF7 E;  4P78 A;  3EPK A;  2EOZ A;  1EH8 A;  1P8K Z;  2K7I A;  4M9V C;  2LO3 A;  4O43 A;  3C0W A;  2EOX A;  4O24 A;  1BBG A;  4DUY E;  2EN3 A;  1T9J A;  1A1F A;  2EPU A;  3VK6 A;  2YWQ A;  4X8W A;  3ZOQ B;  3BGH A;  4DV3 E;  4DMI A;  3FIG A;  2YZT A;  5E5S A;  4R2D A;  2JOX A;  4BC7 A;  1AAY A;  2JY9 A;  5ADZ A;  4UN8 G;  1A1I A;  4LQ0 A;  2ENC A;  1PDA A;  2KHX A;  4DUZ E;  2ELY A;  1NCS A;  3MXB B;  2K4V A;  4UNA A;  5KL2 A;  2FV4 B;  2L33 A;  4DR5 E;  2VF1 A;  1JK1 A;  4WXC A;  1XNQ E;  1X6H A;  2EX5 A;  2VS8 A;  1WHN A;  2EJ4 A;  2VBL A;  2EPN A;  4JI3 E;  4LFB E;  2EP3 A;  2JR1 A;  4RHB B;  1X47 A;  4F2J C;  1A1J A;  2MDR A;  2YU8 A;  3THN A;  2JP9 A;  2DCH X;  2CW7 A;  2JVA A;  2EM3 A;  4DV2 E;  1J5E E;  3EPL A;  3LML A;  3TQM A;  1TN9 A;  2L2N A;  2EML A;  2EQ0 A;  1PJT A;  3E54 A;  4YY3 E;  2WCC 3;  4R03 A;  2MKN A;  2RTX A;  1ZBQ A;  3EPH A;  2DGC A;  3MX9 A;  2LE2 A;  1M5X A;  1RMD A;  5LLQ A;  2NUF A;  1UN6 B;  1LWS A;  4R2E A;  2NAB A;  2F8B A;  1X6F A;  1RQ0 A;  2VBN B;  5A72 A;  2RS7 A;  3MIP A;  2EE8 A;  2EOR A;  2YTP A;  4HEI A;  4D6N A;  2LBS B;  4JI7 E;  5IT9 C;  3MXB A;  5E5O A;  2CT1 A;  3LLH A;  3HQ1 A;  1T9I A;  2EM4 A;  1N33 E;  2EPA A;  5AKN A;  2Q8U A;  4JI4 E;  1T4O A;  5T6J A;  4ZYG A;  4LF5 E;  2EOO A;  1IBM E;  4K0K E;  2NUE A;  4O4K A;  4R2S A;  2VQE E;  4UN7 A;  1SR9 A;  2VQF E;  4HTG A;  3M99 B;  5BR8 E;  5IXM B;  5A2Q C;  3F6H A;  4WPY A;  1DQ3 A;  3KWR A;  2FLD A;  1X3C A;  2HGH A;  5A6B D;  2UUA E;  4YHX A;  4UT0 A;  3L00 A;  4GKJ E;  4AAD A;  2EWL A;  2I9I A;  2V8Q B;  2YSO A;  4R2A A;  4L5N C;  2V88 A;  1LWT A;  1BB8 A;  2L3C A;  3VYX A;  1T4N A;  4TUG A;  3IWB A;  4AAB A;  5AC5 A;  2VBJ B;  4WXD A;  1N3G A;  4DV1 E;  2NA2 A;  2E72 A;  1G9Z A;  2EPO A;  1HR0 E;  1U0D A;  2V87 A;  2HC5 A;  1ZR9 A;  3HYJ A;  2EMH A;  4Q35 B;  2L3J A;  1U0C A;  4AAF A;  4M30 A;  2VBN A;  2WZO A;  2EN2 A;  3MSW A;  2EPR A;  4R2R A;  5A6K A;  1YUI A;  2JWO A;  2YTF A;  5AK9 A;  2LRS A;  2YTD A;  3EPJ A;  1MOW A;  4LF6 E;  3MXA A;  3HTX A;  2DMI A;  4NHR A;  4GZN C;  3T1H E;  3OML A;  1A1H A;  2YTO A;  4F9C B;  1JK2 A;  4NXN E;  2LVH A;  3THO B;  2YTE A;  4X64 E;  3IWD A;  3OOL A;  2DIX A;  2EM6 A;  2N8X A;  2B7V A;  1A1L A;  1GZ6 A;  2GLI A;  2V89 A;  3C6K A;  3UVF A;  4DR7 E;  4DR3 E;  5A78 A;  4BMJ A;  2EMF A;  2LCE A;  3QG5 C;  2EMW A;  4P7D A;  2M7Q A;  2DB2 A;  5AKM A;  4F9A B;  2VBJ A;  1RC7 A;  3ADL A;  3HXL A;  2EOE A;  4ZYE A;  3KZY A;  2EOY A;  3MIS A;  2WBU A;  2EL4 A;  2UUB E;  2LTS A;  4FK5 C;  4DR4 E;  4IJD A;  4JI1 E;  2EQ3 A;  1MEY C;  2YRM A;  4UN9 G;  3MHS C;  4DR6 E;  4BBY A;  1WRJ A;  2RQL A;  2VRD A;  4Z20 A;  2RSM A;  3ADJ A;  4F6N A;  1EKZ A;  4MLQ A;  5AE2 A;  1UHZ A;  3BID A;  2MKD A;  4O5G A;  4LF8 E;  2F4L A;  1T38 A;  2A25 A;  4WSP A;  4UN7 G;  4NZV A;  4F6M A;  1HNW E;  2EMZ A;  2HJJ A;  2R1F A;  3DJW A;  2EMC A;  2EN1 A;  2YTG A;  4AQY E;  2DMY A;  3J7Y p;  2EQ1 A;  2UXC E;  1L4S A;  1DGC A;  4WFT A;  2CSH A;  1PJS A;  2GPI A;  2J7J A;  2MDG A;  1A1G A;  3OOR A;  3HYI A;  4DV4 E;  4JI5 E;  3EH8 A;  2EM8 A;  1YYK A;  5LMN E;  1QNT A;  2HHH E;  5AE3 A;  2JPA A;  4WSG A;  2GHF A;  3HPS A;  1BP7 A;  1X6E A;  5FLX C;  4BS9 A;  4AAG A;  1YUJ A;  2EM0 A;  4UN9 A;  2YTJ A;  4LF9 E;  2WBS A;  3J81 C;  1DI2 A;  4BCA A;  4X66 E; 
#chains in the Genus database with same CATH homology
 4DV1 E;  4JV5 E;  2NA2 A;  3C4B A;  3JAM C;  3JU0 A;  5IWA E;  5CFF E;  1HR0 E;  2E1M A;  2V87 A;  3VK6 A;  2RS6 A;  4X8W A;  3ZOQ B;  4DV3 E;  4JYA E;  4DMI A;  3FIG A;  2YZT A;  1N32 E;  2JOX A;  4BC7 A;  2DSY A;  2L3J A;  1HNX E;  2FTX B;  2JY9 A;  4M30 A;  4DKK A;  5ADZ A;  2WZO A;  3MSW A;  1X49 A;  3ADI A;  2JWO A;  2EZ6 A;  2LRS A;  1IBL E;  4DV7 E;  4GEQ B;  4OOG C;  2LMZ A;  2VE7 C;  2KHX A;  3IWC A;  3K6Q A;  4DUZ E;  3H09 A;  2K4V A;  4LF6 E;  3HTX A;  1YYO A;  2B7T A;  2FV4 B;  2L33 A;  3OML A;  3T1H E;  1O0W A;  4DR5 E;  2VF1 A;  2UUC E;  4KHP E;  1XNQ E;  1HNZ E;  1N34 E;  1YZ9 A;  4DUY E;  4F9C B;  1WHN A;  4NXN E;  4B3R E;  1I94 E;  4JI3 E;  4LFB E;  3VYY A;  4DV0 E;  4LFA E;  2JR1 A;  1X47 A;  5AAS A;  2LJH A;  4DR1 E;  1XNR E;  2YT4 A;  1STU A;  2FGG A;  4X64 E;  4OX9 E;  2MDR A;  4X62 E;  2V83 A;  2V85 A;  4M0V A;  2MC6 A;  3IWD A;  2JVA A;  5DNY A;  2DIX A;  4DV2 E;  1GQE A;  2B9D A;  4DV6 E;  1J5E E;  3LML A;  1ZBT A;  2B7V A;  2V86 A;  1GZ6 A;  2L2N A;  2V89 A;  4JI8 E;  4YHH E;  2ODR D;  2KOU A;  2ZM6 E;  4DR7 E;  4DR2 E;  4DR3 E;  4YY3 E;  4BMJ A;  4R03 A;  2NUG A;  2H36 X;  4F9A B;  2RTX A;  2M7Q A;  1ZBQ A;  4P7D A;  2DB2 A;  4F9B B;  4WYQ B;  1RC7 A;  3ADL A;  3HXL A;  2M4I A;  1XMO E;  4LFC E;  4R8O A;  2UUB E;  2LTS A;  4X65 E;  4DR4 E;  2CPN A;  4JI1 E;  1WXR A;  2LE2 A;  2F4V E;  1T4L B;  1YYW A;  4DR6 E;  2N3G A;  3P1X A;  4BBY A;  2NUF A;  2UXD E;  2E5L E;  4J8Z A;  4B3M E;  5F3W A;  3J80 C;  2IHR 1;  2LUQ A;  2F8B A;  2RSM A;  1RQ0 A;  3ADJ A;  3F6G A;  4L8N A;  5AE2 A;  1UHZ A;  1EKZ A;  4JI6 E;  2RS7 A;  4JI2 E;  5LMU E;  4GKK E;  1J26 A;  4LF8 E;  2F4L A;  2L6M A;  1FJG E;  2LBS B;  4JI7 E;  4F54 A;  5IT9 C;  3RMP A;  4WSP A;  1UIL A;  1DI2 A;  1HNW E;  4KZS A;  1QU6 A;  3OTO E;  1XMQ E;  3DJW A;  3LLH A;  2L2M A;  3HQ1 A;  1WHQ A;  2UU9 E;  1N33 E;  4AQY E;  2DMY A;  4JI4 E;  4NXM E;  3J7Y p;  5AE1 A;  1T4O A;  5T6J A;  2UXC E;  2ODR C;  4LF5 E;  5LL6 R;  4WFT A;  1IBM E;  4B3S E;  4K0K E;  3AV0 A;  1X48 A;  2L8T A;  1IBK E;  2NUE A;  2VQE E;  2M1S A;  4JI0 E;  4DV5 E;  2UXB E;  1SR9 A;  2VQF E;  5BR8 E;  2B3T B;  2LUP B;  5A2Q C;  4TUI A;  3JTZ A;  3F6H A;  2L2K B;  4DV4 E;  1FKA E;  4WPY A;  4JI5 E;  4B3T E;  4M2Z A;  4LF4 E;  1DQ3 A;  3KWR A;  4I8O A;  1YYK A;  5LMN E;  2G7H A;  3T1Y E;  4Q28 A;  3HPZ A;  5AE3 A;  2HHH E;  3HPS A;  4LTY A;  2UUA E;  3J7A G;  2JOB A;  2KON A;  3ADG A;  4GKJ E;  3C4T A;  4LU9 A;  3AUZ A;  2EWL A;  2V8Q B;  4BS9 A;  5FLX C;  4LF7 E;  4L5N C;  4P78 A;  4BC9 A;  2V88 A;  2L92 A;  2LTR A;  1N36 E;  2MC5 A;  2L3C A;  1T4N A;  3DF6 A;  3J81 C;  4TUG A;  3IWB A;  4LF9 E;  3VYX A;  2N3H A;  1PKP A;  4BCA A;  4X66 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...