4KZSA

Crystal structure of the secreted protein hp1454 from the human pathogen helicobacter pylori
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
254
structure length
242
Chain Sequence
b'QKGYLYGSGSATSKEASKQKALADLVASISVVVNSQIHIQKSRINLKTDDLELNNVEIVNQEVQKGIYYTRVRINQNLFLQGLRDKYNALYGQFSTLMPKVCKGVFLQQSKSMGDLLAKAMPIERILKAYSVPVGSLENYEKIYYQNAFKPKVQITFDNNSDAEIKAALISAYARVLTPSDEEKLYQIKNEVFTDSANGITRIRVVVSASDCQGTPVLNRSLEVDEKNKNFAITRLQSLLYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LPP20 lipofamily protein
publication title Crystal structure of the secreted protein HP1454 from the human pathogen Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori r046wa
molecule tags Unknown function
total genus 68
structure length 242
sequence length 254
ec nomenclature
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02169 LPP20 LPP20 lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.28.20 Alpha Beta Roll Endonuclease I-creI Acetamidase/Formamidase-like domains 4kzsA01
3.30.160.710 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4kzsA03
2F4LA 4KZSA
chains in the Genus database with same CATH superfamily
2YZTA 4JI6E 5LL6R 4UN9A 1A1HA 5A6BA 2MKNA 2JWOA 2EOOA 1XMQE 2MDGA 5AKMA 2ODRC 5A0WA 3VYYA 3T1HE 4UT0A 4B3TE 1FJGE 4ZYGA 4UNAA 1P47A 2EM7A 2EOQA 2YTDA 3ECRA 3JU0A 2V88A 4R2CA 4AQXA 1X5WA 2DB2A 2ENCA 2JR1A 2EOEA 5A69A 2HHHE 1LWSA 5IWAE 5E5SA 1M5XA 3L00A 4YITA 1T4OA 2B7VA 2EN7A 4ZYEA 3K6QA 2EMLA 1HNXE 4I8OA 5AK9A 1FKAE 3MXAA 5AC5A 4F2JC 3VHTB 3OORA 4MLQA 1BB8A 1QU6A 5A74A 1A1KA 2VBNA 2EN8A 3BIDA 5KL4A 1T9JA 1ZBTA 2EPZA 1X47A 5A0MA 2CPNA 4LF6E 1A1IA 4B3ME 2F4VE 3UK3C 3R7PA 1BBOA 1YYKA 3KWRA 2MKDA 1EKZA 5T6JA 2EMWA 1BBGA 2EM8A 2LTRA 3C6KA 2CW8A 2EMHA 1PJSA 3IWDA 3HYIA 1EH8A 3KZYA 4JI7E 2XE0A 2LO3A 4JI5E 2EOHA 1KJKA 3HPZA 3C4BA 4NHRA 2FLDA 1XNRE 1QNTA 4MLVA 4JI8E 5A6JA 2YPNA 4DV4E 3E54A 2V8QB 2CTDA 2QOJZ 4EFJA 2GLIA 4R03A 1G2DC 5DNYA 1HNZE 1XMOE 4P7DA 2R76A 4AAGA 3EPHA 2EMKA 5A77A 2EMGA 4KWYA 2A25A 4JI4E 4R2PA 2M9AA 4LOXA 2LTSA 2M4IA 2L2KB 2EM3A 2EM2A 1WXRA 4LF7E 1P8KZ 3EPKA 2UXDE 1T4LB 3AV0A 4OX9E 2GHFA 2FTXB 1U0CA 2VS8A 2DLQA 1PJTA 4X66E 2EM5A 4BMJA 1HR0E 2RPCA 5A78A 2EMAA 4R2EA 3OTOE 2GPIA 4WYQB 4NZVA 4DR3E 1I94E 1AH5A 4TUGA 4AAEA 1R7MA 2K7IA 4BC9A 2EL5A 4JI3E 1TN9A 4BHCA 2O7MA 5A6BD 2N3HA 4LTYA 3ADGA 4YISA 3J7AG 2CW7A 5A6KA 1JK2A 2BB8A 3DJWA 5TSEA 5KL7A 4DV0E 2VBLA 2L8TA 2LRSA 4WSPA 3F6HA 2L6MA 4Q28A 2L3CA 3EPJA 1B24A 2EOJA 2EPNA 2VBJB 2CSHA 4FK5C 3J80C 2V86A 4WFTA 2EP3A 3T1YE 1WHQA 3VK6A 2YTEA 4F6MA 3BBGA 4DV2E 1YSAC 2EOMA 5AKFA 2YT4A 3EH8A 2I3QA 3HQ1A 5LMNE 5E67A 5AE2A 2YTOA 4F54A 2LJHA 2I13A 1B69A 2EOXA 4GKJE 2LMZA 4UNCA 2UUCE 4AADA 4NXNE 3C6MA 4DR2E 2ZM6E 3KO2A 4KHPE 2FGGA 1LWTA 2YRMA 1T9IA 2RTXA 1EH6A 2JOBA 5FLXC 1IBME 2ELYA 1DQ3A 2HJJA 3QG5C 4IJDA 5KL3A 4M0VA 1YFHA 1PDAA 2DGCA 4LF9E 3MSWA 4BCAA 2KONA 1UBDC 5A2QC 2KHXA 4OOGC 3J81C 4JV5E 2EPCA 2EQ1A 2E72A 3AUZA 5BR8E 1G9YA 4F6NA 2UXCE 2BBGA 4HTGA 4R2AA 3QQYA 4WXDA 4IS1C 2LVHA 2EZ6A 2L2MA 2EJ4A 2EMBA 2JYAA 4X8WA 2N8XA 4GZNC 1XNQE 2H36X 1UM2A 1NCSA 2DCHX 4LFCE 4AABA 2E1MA 2ELZA 1RC7A 2EMXA 3HYJA 1STUA 2M1SA 1IQOA 2EPMX 2RS6A 1DGCA 2YTIA 3C4TA 4DV7E 1BP7A 5KL2A 1JVAA 2EPOA 2EPXA 1PJQA 1WJPA 1KYQA 4K0KE 3MX9A 2YTQA 2YWQA 1LLMC 4UN8G 2LBSB 4B3SE 3M99B 4YY3E 2NABA 2EE8A 4R2QA 3RMPA 2JY9A 2VQFE 3HXLA 3EPLA 4AAFA 3IWCA 1DI2A 2EN3A 2VBOB 2D9HA 2G7HA 1N34E 4M30A 4DR6E 3JAMC 4DR5E 1IQSA 4WXCA 1YPNA 3H09A 2EMZA 5AE3A 2VS7A 3DF6A 3IWBA 1TF3A 2UUAE 1YUIA 1T4NA 2LCEA 1F2IG 2NUFA 2YTGA 1L4SA 2DMIA 2EN6A 1PKPA 4YHHE 2ENHA 5CFFE 2DLKA 2EOZA 2LUQA 4R2DA 3OOLA 3KZZA 3JTZA 2RQLA 3FD2A 1JK1A 4AQUA 5LLQA 2HGHA 1T39A 1A1JA 2RSIA 4X62E 2RSMA 4NXME 2YU5A 4HEIA 4DV6E 3VYXA 3ADIA 3MHSC 2V83A 4DKKA 2MDRA 4BBYA 2EPKX 2YSPA 3MXBA 4BHBA 2VE7C 1A1GA 1X49A 2YU8A 4DR1E 1MEYC 3MHHC 4DV5E 3C0XA 4O4KA 4P78A 4RH8A 5IT9C 1IBKE 2VBNB 2YTPA 2L33A 4F9BB 5A6AA 4DUYE 4Z1ZA 2DRPA 2WCC3 4GKKE 5A0MB 2LUPB 3HPSA 2EOFA 4LF4E 2DMYA 2Q8UA 3P1XA 2NUEA 2YTFA 1T38A 2EX5A 4YHXA 2UUBE 4JYAE 2K4VA 2NUGA 4TUIA 1ZBQA 4LU9A 2LJUA 2LE2A 1AAYA 2ADRA 2MC5A 2XE0B 2J7JA 1YZ9A 2EM9A 1G9ZA 5AASA 2I3PA 1N36E 3ADJA 1RMDA 2PRTA 4M2ZA 4UN8A 1MGTA 2F4LA 1YYOA 1VDEA 5ADZA 4Z20A 2N3GA 1GTKA 3TQMA 2LT7A 2L92A 1J5EE 4UN7A 3LLHA 1GZ6A 4ZYDA 5IV8B 2ODRD 2FV4B 1A1FA 2YTNA 4WPYA 2E5LE 2EPAA 4LF8E 4M9VC 1X6FA 2B3TB 2VBJA 2EOSA 1IMUA 2DIXA 5AE1A 2EN2A 4UN9G 1N3GA 1YYWA 4DR4E 1N33E 1N3FA 4AQYE 1Z1BA 2WBTA 2F8BA 4JI1E 3J7Yp 4DR7E 4ZYHA 1TF6A 3THNA 2I9IA 3MISA 4BC7A 5E63A 5F3WA 4B3RE 2EL6A 2JP9A 1X48A 1A1LA 1YUJA 2EPLX 3MIPA 2YSOA 2HC5A 2EN4A 4UN7G 5KL6A 2EPUA 4D6NA 5LMUE 4X9JA 1NEIA 1EF0A 1SR9A 3HTXA 1X3CA 1WRJA 4N4RB 4D6OA 2LV2A 1ZR9A 2VBLB 2EMFA 2CT1A 2JPAA 3MXBB 1UN6B 2WBUA 4UNBA 1AF5A 4GEQB 2JVAA 2IHR1 1X6EA 4Q35B 4JI0E 2EMCA 2WZOA 1UHZA 5AKNA 4O24A 4L5NC 2V87A 4L8NA 2EM4A 4LQ0A 1O0WA 2EL4A 2V89A 4O43A 4JI2E 4R8OA 4Z1XA 1MOWA 2V85A 2VF1A 4RHBB 2EQ0A 3C0WA 3LMLA 3F6GA 2B9DA 4X64E 2EM0A 2M7QA 5A72A 2EN1A 3THOB 4LF5E 2VQEE 2EPPA 2YTJA 2B7TA 5IXMB 1EH7A 4R2RA 4DUZE 5KL5A 3BGHA 2EM6A 4O5GA 1RQ0A 1ZU1A 4DMIA 2L3JA 2EORA 4F9CB 1ZAAC 3ADLA 1X6HA 2NA2A 2YRHA 5AC4A 4WSGA 4BS9A 2AB5A 2ENAA 2KOUA 4LFBE 2UXBE 2YRKA 2DSYA 2L2NA 4DV3E 3BF2A 1GQEA 2EMIA 2JOXA 5E5OA 3UVFA 2VBOA 1HNWE 1SFEA 1UILA 2RS7A 3FIGA 2VRDA 1U0DA 2EOYA 2JXPA 4X65E 1N32E 2R1FA 2EWLA 4DV1E 4KZSA 1G2FC 1WHNA 2EMYA 4J8ZA 1DFAA 3ZOQB 3EQ1A 2WBSA 4LFAE 2UU9E 4R2SA 4WX9A 3OMLA 4F9AB 2EQ3A 2EPRA 1J26A 1IBLE 1N3EA 2EOIA 2MC6A
chains in the Genus database with same CATH topology
2YZTA 1HR0E 3OTOE 2FV4B 3RMPA 4JI6E 2JY9A 4WYQB 5LL6R 4WPYA 2VQFE 3HXLA 4DR3E 1I94E 2E5LE 3IWCA 4TUGA 4LF8E 1DI2A 4BC9A 2B3TB 2JWOA 1XMQE 4JI3E 1N33E 2G7HA 2DIXA 1N34E 4M30A 5AE1A 4DR4E 1YYWA 4DR6E 2ODRC 2N3HA 4LTYA 3ADGA 3JAMC 3VYYA 4AQYE 3T1HE 4B3TE 1FJGE 3J7AG 4DR5E 2F8BA 4JI1E 3DJWA 3J7Yp 3H09A 3JU0A 5AE3A 4DR7E 2V88A 2DB2A 3DF6A 3IWBA 2UUAE 2JR1A 2HHHE 4DV0E 5IWAE 4BC7A 5F3WA 1T4NA 2NUFA 1T4OA 2B7VA 4B3RE 2L8TA 3K6QA 2LRSA 4WSPA 3F6HA 2L6MA 4Q28A 1PKPA 4YHHE 2L3CA 1X48A 5CFFE 1HNXE 4I8OA 2LUQA 1FKAE 3JTZA 3J80C 2V86A 4WFTA 3T1YE 1WHQA 3VK6A 1QU6A 5LMUE 4DV2E 4X62E 2RSMA 1ZBTA 5LMNE 1SR9A 2YT4A 4NXME 3HQ1A 3HTXA 4DV6E 3VYXA 1X47A 5AE2A 4F54A 2LJHA 4GKJE 2CPNA 4LF6E 4B3ME 3ADIA 2LMZA 2F4VE 2UUCE 4NXNE 4DR2E 2V83A 4DKKA 2MDRA 2ZM6E 4BBYA 4GEQB 2JVAA 2IHR1 1YYKA 4JI0E 4KHPE 2FGGA 2WZOA 3KWRA 1EKZA 1UHZA 2VE7C 4L5NC 5T6JA 2V87A 2RTXA 1X49A 4L8NA 2JOBA 5FLXC 1O0WA 1IBME 4DR1E 1DQ3A 2LTRA 2V89A 3IWDA 4DV5E 4JI7E 4P78A 4R8OA 4JI5E 4JI2E 5IT9C 1IBKE 3HPZA 2L33A 2V85A 2VF1A 3C4BA 3LMLA 3F6GA 4F9BB 2B9DA 4M0VA 4X64E 4DUYE 4LF9E 1XNRE 2M7QA 4JI8E 4GKKE 4LF5E 2VQEE 3MSWA 4BCAA 4DV4E 2KONA 2B7TA 2LUPB 2V8QB 3HPSA 5A2QC 4LF4E 2KHXA 4OOGC 3J81C 2DMYA 4DUZE 4JV5E 3P1XA 2NUEA 1RQ0A 4R03A 4DMIA 5DNYA 2L3JA 1HNZE 3ADLA 3AUZA 5BR8E 2UUBE 2UXCE 1XMOE 4P7DA 2NA2A 2K4VA 4JYAE 2NUGA 4TUIA 1ZBQA 4LU9A 2LE2A 4BS9A 2KOUA 2EZ6A 4LFBE 2MC5A 2UXBE 2DSYA 2L2NA 2L2MA 4X8WA 4DV3E 1GQEA 4JI4E 1XNQE 1YZ9A 5AASA 2H36X 2JOXA 4LFCE 2LTSA 2E1MA 1RC7A 1HNWE 1UILA 1STUA 2M1SA 2M4IA 2RS7A 2RS6A 3ADJA 3FIGA 2L2KB 1N36E 3C4TA 4DV7E 4M2ZA 4X65E 1N32E 4K0KE 2EWLA 1WXRA 4DV1E 4KZSA 4LF7E 2F4LA 1WHNA 4BMJA 4J8ZA 3ZOQB 1YYOA 5ADZA 4LFAE 1T4LB 2UU9E 2UXDE 2N3GA 3AV0A 4OX9E 2FTXB 3OMLA 4F9AB 2LBSB 4B3SE 2L92A 4YY3E 1J5EE 1J26A 3LLHA 1IBLE 1GZ6A 4X66E 4F9CB 2MC6A 2ODRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4L A;  4KZS A; 
#chains in the Genus database with same CATH topology
 2YZT A;  4JI6 E;  5LL6 R;  4UN9 A;  1A1H A;  5A6B A;  2MKN A;  2JWO A;  2EOO A;  1XMQ E;  2MDG A;  5AKM A;  2ODR C;  5A0W A;  3VYY A;  3T1H E;  4UT0 A;  4B3T E;  1FJG E;  4ZYG A;  4UNA A;  1P47 A;  2EM7 A;  2EOQ A;  2YTD A;  3ECR A;  3JU0 A;  2V88 A;  4R2C A;  4AQX A;  1X5W A;  2DB2 A;  2ENC A;  2JR1 A;  2EOE A;  5A69 A;  2HHH E;  1LWS A;  5IWA E;  5E5S A;  1M5X A;  3L00 A;  4YIT A;  1T4O A;  2B7V A;  2EN7 A;  4ZYE A;  3K6Q A;  2EML A;  1HNX E;  4I8O A;  5AK9 A;  1FKA E;  3MXA A;  5AC5 A;  4F2J C;  3VHT B;  3OOR A;  4MLQ A;  1BB8 A;  1QU6 A;  5A74 A;  1A1K A;  2VBN A;  2EN8 A;  3BID A;  5KL4 A;  1T9J A;  1ZBT A;  2EPZ A;  1X47 A;  5A0M A;  2CPN A;  4LF6 E;  1A1I A;  4B3M E;  2F4V E;  3UK3 C;  3R7P A;  1BBO A;  1YYK A;  3KWR A;  2MKD A;  1EKZ A;  5T6J A;  2EMW A;  1BBG A;  2EM8 A;  2LTR A;  3C6K A;  2CW8 A;  2EMH A;  1PJS A;  3IWD A;  3HYI A;  1EH8 A;  3KZY A;  4JI7 E;  2XE0 A;  2LO3 A;  4JI5 E;  2EOH A;  1KJK A;  3HPZ A;  3C4B A;  4NHR A;  2FLD A;  1XNR E;  1QNT A;  4MLV A;  4JI8 E;  5A6J A;  2YPN A;  4DV4 E;  3E54 A;  2V8Q B;  2CTD A;  2QOJ Z;  4EFJ A;  2GLI A;  4R03 A;  1G2D C;  5DNY A;  1HNZ E;  1XMO E;  4P7D A;  2R76 A;  4AAG A;  3EPH A;  2EMK A;  5A77 A;  2EMG A;  4KWY A;  2A25 A;  4JI4 E;  4R2P A;  2M9A A;  4LOX A;  2LTS A;  2M4I A;  2L2K B;  2EM3 A;  2EM2 A;  1WXR A;  4LF7 E;  1P8K Z;  3EPK A;  2UXD E;  1T4L B;  3AV0 A;  4OX9 E;  2GHF A;  2FTX B;  1U0C A;  2VS8 A;  2DLQ A;  1PJT A;  4X66 E;  2EM5 A;  4BMJ A;  1HR0 E;  2RPC A;  5A78 A;  2EMA A;  4R2E A;  3OTO E;  2GPI A;  4WYQ B;  4NZV A;  4DR3 E;  1I94 E;  1AH5 A;  4TUG A;  4AAE A;  1R7M A;  2K7I A;  4BC9 A;  2EL5 A;  4JI3 E;  1TN9 A;  4BHC A;  2O7M A;  5A6B D;  2N3H A;  4LTY A;  3ADG A;  4YIS A;  3J7A G;  2CW7 A;  5A6K A;  1JK2 A;  2BB8 A;  3DJW A;  5TSE A;  5KL7 A;  4DV0 E;  2VBL A;  2L8T A;  2LRS A;  4WSP A;  3F6H A;  2L6M A;  4Q28 A;  2L3C A;  3EPJ A;  1B24 A;  2EOJ A;  2EPN A;  2VBJ B;  2CSH A;  4FK5 C;  3J80 C;  2V86 A;  4WFT A;  2EP3 A;  3T1Y E;  1WHQ A;  3VK6 A;  2YTE A;  4F6M A;  3BBG A;  4DV2 E;  1YSA C;  2EOM A;  5AKF A;  2YT4 A;  3EH8 A;  2I3Q A;  3HQ1 A;  5LMN E;  5E67 A;  5AE2 A;  2YTO A;  4F54 A;  2LJH A;  2I13 A;  1B69 A;  2EOX A;  4GKJ E;  2LMZ A;  4UNC A;  2UUC E;  4AAD A;  4NXN E;  3C6M A;  4DR2 E;  2ZM6 E;  3KO2 A;  4KHP E;  2FGG A;  1LWT A;  2YRM A;  1T9I A;  2RTX A;  1EH6 A;  2JOB A;  5FLX C;  1IBM E;  2ELY A;  1DQ3 A;  2HJJ A;  3QG5 C;  4IJD A;  5KL3 A;  4M0V A;  1YFH A;  1PDA A;  2DGC A;  4LF9 E;  3MSW A;  4BCA A;  2KON A;  1UBD C;  5A2Q C;  2KHX A;  4OOG C;  3J81 C;  4JV5 E;  2EPC A;  2EQ1 A;  2E72 A;  3AUZ A;  5BR8 E;  1G9Y A;  4F6N A;  2UXC E;  2BBG A;  4HTG A;  4R2A A;  3QQY A;  4WXD A;  4IS1 C;  2LVH A;  2EZ6 A;  2L2M A;  2EJ4 A;  2EMB A;  2JYA A;  4X8W A;  2N8X A;  4GZN C;  1XNQ E;  2H36 X;  1UM2 A;  1NCS A;  2DCH X;  4LFC E;  4AAB A;  2E1M A;  2ELZ A;  1RC7 A;  2EMX A;  3HYJ A;  1STU A;  2M1S A;  1IQO A;  2EPM X;  2RS6 A;  1DGC A;  2YTI A;  3C4T A;  4DV7 E;  1BP7 A;  5KL2 A;  1JVA A;  2EPO A;  2EPX A;  1PJQ A;  1WJP A;  1KYQ A;  4K0K E;  3MX9 A;  2YTQ A;  2YWQ A;  1LLM C;  4UN8 G;  2LBS B;  4B3S E;  3M99 B;  4YY3 E;  2NAB A;  2EE8 A;  4R2Q A;  3RMP A;  2JY9 A;  2VQF E;  3HXL A;  3EPL A;  4AAF A;  3IWC A;  1DI2 A;  2EN3 A;  2VBO B;  2D9H A;  2G7H A;  1N34 E;  4M30 A;  4DR6 E;  3JAM C;  4DR5 E;  1IQS A;  4WXC A;  1YPN A;  3H09 A;  2EMZ A;  5AE3 A;  2VS7 A;  3DF6 A;  3IWB A;  1TF3 A;  2UUA E;  1YUI A;  1T4N A;  2LCE A;  1F2I G;  2NUF A;  2YTG A;  1L4S A;  2DMI A;  2EN6 A;  1PKP A;  4YHH E;  2ENH A;  5CFF E;  2DLK A;  2EOZ A;  2LUQ A;  4R2D A;  3OOL A;  3KZZ A;  3JTZ A;  2RQL A;  3FD2 A;  1JK1 A;  4AQU A;  5LLQ A;  2HGH A;  1T39 A;  1A1J A;  2RSI A;  4X62 E;  2RSM A;  4NXM E;  2YU5 A;  4HEI A;  4DV6 E;  3VYX A;  3ADI A;  3MHS C;  2V83 A;  4DKK A;  2MDR A;  4BBY A;  2EPK X;  2YSP A;  3MXB A;  4BHB A;  2VE7 C;  1A1G A;  1X49 A;  2YU8 A;  4DR1 E;  1MEY C;  3MHH C;  4DV5 E;  3C0X A;  4O4K A;  4P78 A;  4RH8 A;  5IT9 C;  1IBK E;  2VBN B;  2YTP A;  2L33 A;  4F9B B;  5A6A A;  4DUY E;  4Z1Z A;  2DRP A;  2WCC 3;  4GKK E;  5A0M B;  2LUP B;  3HPS A;  2EOF A;  4LF4 E;  2DMY A;  2Q8U A;  3P1X A;  2NUE A;  2YTF A;  1T38 A;  2EX5 A;  4YHX A;  2UUB E;  4JYA E;  2K4V A;  2NUG A;  4TUI A;  1ZBQ A;  4LU9 A;  2LJU A;  2LE2 A;  1AAY A;  2ADR A;  2MC5 A;  2XE0 B;  2J7J A;  1YZ9 A;  2EM9 A;  1G9Z A;  5AAS A;  2I3P A;  1N36 E;  3ADJ A;  1RMD A;  2PRT A;  4M2Z A;  4UN8 A;  1MGT A;  2F4L A;  1YYO A;  1VDE A;  5ADZ A;  4Z20 A;  2N3G A;  1GTK A;  3TQM A;  2LT7 A;  2L92 A;  1J5E E;  4UN7 A;  3LLH A;  1GZ6 A;  4ZYD A;  5IV8 B;  2ODR D;  2FV4 B;  1A1F A;  2YTN A;  4WPY A;  2E5L E;  2EPA A;  4LF8 E;  4M9V C;  1X6F A;  2B3T B;  2VBJ A;  2EOS A;  1IMU A;  2DIX A;  5AE1 A;  2EN2 A;  4UN9 G;  1N3G A;  1YYW A;  4DR4 E;  1N33 E;  1N3F A;  4AQY E;  1Z1B A;  2WBT A;  2F8B A;  4JI1 E;  3J7Y p;  4DR7 E;  4ZYH A;  1TF6 A;  3THN A;  2I9I A;  3MIS A;  4BC7 A;  5E63 A;  5F3W A;  4B3R E;  2EL6 A;  2JP9 A;  1X48 A;  1A1L A;  1YUJ A;  2EPL X;  3MIP A;  2YSO A;  2HC5 A;  2EN4 A;  4UN7 G;  5KL6 A;  2EPU A;  4D6N A;  5LMU E;  4X9J A;  1NEI A;  1EF0 A;  1SR9 A;  3HTX A;  1X3C A;  1WRJ A;  4N4R B;  4D6O A;  2LV2 A;  1ZR9 A;  2VBL B;  2EMF A;  2CT1 A;  2JPA A;  3MXB B;  1UN6 B;  2WBU A;  4UNB A;  1AF5 A;  4GEQ B;  2JVA A;  2IHR 1;  1X6E A;  4Q35 B;  4JI0 E;  2EMC A;  2WZO A;  1UHZ A;  5AKN A;  4O24 A;  4L5N C;  2V87 A;  4L8N A;  2EM4 A;  4LQ0 A;  1O0W A;  2EL4 A;  2V89 A;  4O43 A;  4JI2 E;  4R8O A;  4Z1X A;  1MOW A;  2V85 A;  2VF1 A;  4RHB B;  2EQ0 A;  3C0W A;  3LML A;  3F6G A;  2B9D A;  4X64 E;  2EM0 A;  2M7Q A;  5A72 A;  2EN1 A;  3THO B;  4LF5 E;  2VQE E;  2EPP A;  2YTJ A;  2B7T A;  5IXM B;  1EH7 A;  4R2R A;  4DUZ E;  5KL5 A;  3BGH A;  2EM6 A;  4O5G A;  1RQ0 A;  1ZU1 A;  4DMI A;  2L3J A;  2EOR A;  4F9C B;  1ZAA C;  3ADL A;  1X6H A;  2NA2 A;  2YRH A;  5AC4 A;  4WSG A;  4BS9 A;  2AB5 A;  2ENA A;  2KOU A;  4LFB E;  2UXB E;  2YRK A;  2DSY A;  2L2N A;  4DV3 E;  3BF2 A;  1GQE A;  2EMI A;  2JOX A;  5E5O A;  3UVF A;  2VBO A;  1HNW E;  1SFE A;  1UIL A;  2RS7 A;  3FIG A;  2VRD A;  1U0D A;  2EOY A;  2JXP A;  4X65 E;  1N32 E;  2R1F A;  2EWL A;  4DV1 E;  4KZS A;  1G2F C;  1WHN A;  2EMY A;  4J8Z A;  1DFA A;  3ZOQ B;  3EQ1 A;  2WBS A;  4LFA E;  2UU9 E;  4R2S A;  4WX9 A;  3OML A;  4F9A B;  2EQ3 A;  2EPR A;  1J26 A;  1IBL E;  1N3E A;  2EOI A;  2MC6 A; 
#chains in the Genus database with same CATH homology
 2YZT A;  1HR0 E;  3OTO E;  2FV4 B;  3RMP A;  4JI6 E;  2JY9 A;  4WYQ B;  5LL6 R;  4WPY A;  2VQF E;  3HXL A;  4DR3 E;  1I94 E;  2E5L E;  3IWC A;  4TUG A;  4LF8 E;  1DI2 A;  4BC9 A;  2B3T B;  2JWO A;  1XMQ E;  4JI3 E;  1N33 E;  2G7H A;  2DIX A;  1N34 E;  4M30 A;  5AE1 A;  4DR4 E;  1YYW A;  4DR6 E;  2ODR C;  2N3H A;  4LTY A;  3ADG A;  3JAM C;  3VYY A;  4AQY E;  3T1H E;  4B3T E;  1FJG E;  3J7A G;  4DR5 E;  2F8B A;  4JI1 E;  3DJW A;  3J7Y p;  3H09 A;  3JU0 A;  5AE3 A;  4DR7 E;  2V88 A;  2DB2 A;  3DF6 A;  3IWB A;  2UUA E;  2JR1 A;  2HHH E;  4DV0 E;  5IWA E;  4BC7 A;  5F3W A;  1T4N A;  2NUF A;  1T4O A;  2B7V A;  4B3R E;  2L8T A;  3K6Q A;  2LRS A;  4WSP A;  3F6H A;  2L6M A;  4Q28 A;  1PKP A;  4YHH E;  2L3C A;  1X48 A;  5CFF E;  1HNX E;  4I8O A;  2LUQ A;  1FKA E;  3JTZ A;  3J80 C;  2V86 A;  4WFT A;  3T1Y E;  1WHQ A;  3VK6 A;  1QU6 A;  5LMU E;  4DV2 E;  4X62 E;  2RSM A;  1ZBT A;  5LMN E;  1SR9 A;  2YT4 A;  4NXM E;  3HQ1 A;  3HTX A;  4DV6 E;  3VYX A;  1X47 A;  5AE2 A;  4F54 A;  2LJH A;  4GKJ E;  2CPN A;  4LF6 E;  4B3M E;  3ADI A;  2LMZ A;  2F4V E;  2UUC E;  4NXN E;  4DR2 E;  2V83 A;  4DKK A;  2MDR A;  2ZM6 E;  4BBY A;  4GEQ B;  2JVA A;  2IHR 1;  1YYK A;  4JI0 E;  4KHP E;  2FGG A;  2WZO A;  3KWR A;  1EKZ A;  1UHZ A;  2VE7 C;  4L5N C;  5T6J A;  2V87 A;  2RTX A;  1X49 A;  4L8N A;  2JOB A;  5FLX C;  1O0W A;  1IBM E;  4DR1 E;  1DQ3 A;  2LTR A;  2V89 A;  3IWD A;  4DV5 E;  4JI7 E;  4P78 A;  4R8O A;  4JI5 E;  4JI2 E;  5IT9 C;  1IBK E;  3HPZ A;  2L33 A;  2V85 A;  2VF1 A;  3C4B A;  3LML A;  3F6G A;  4F9B B;  2B9D A;  4M0V A;  4X64 E;  4DUY E;  4LF9 E;  1XNR E;  2M7Q A;  4JI8 E;  4GKK E;  4LF5 E;  2VQE E;  3MSW A;  4BCA A;  4DV4 E;  2KON A;  2B7T A;  2LUP B;  2V8Q B;  3HPS A;  5A2Q C;  4LF4 E;  2KHX A;  4OOG C;  3J81 C;  2DMY A;  4DUZ E;  4JV5 E;  3P1X A;  2NUE A;  1RQ0 A;  4R03 A;  4DMI A;  5DNY A;  2L3J A;  1HNZ E;  3ADL A;  3AUZ A;  5BR8 E;  2UUB E;  2UXC E;  1XMO E;  4P7D A;  2NA2 A;  2K4V A;  4JYA E;  2NUG A;  4TUI A;  1ZBQ A;  4LU9 A;  2LE2 A;  4BS9 A;  2KOU A;  2EZ6 A;  4LFB E;  2MC5 A;  2UXB E;  2DSY A;  2L2N A;  2L2M A;  4X8W A;  4DV3 E;  1GQE A;  4JI4 E;  1XNQ E;  1YZ9 A;  5AAS A;  2H36 X;  2JOX A;  4LFC E;  2LTS A;  2E1M A;  1RC7 A;  1HNW E;  1UIL A;  1STU A;  2M1S A;  2M4I A;  2RS7 A;  2RS6 A;  3ADJ A;  3FIG A;  2L2K B;  1N36 E;  3C4T A;  4DV7 E;  4M2Z A;  4X65 E;  1N32 E;  4K0K E;  2EWL A;  1WXR A;  4DV1 E;  4KZS A;  4LF7 E;  2F4L A;  1WHN A;  4BMJ A;  4J8Z A;  3ZOQ B;  1YYO A;  5ADZ A;  4LFA E;  1T4L B;  2UU9 E;  2UXD E;  2N3G A;  3AV0 A;  4OX9 E;  2FTX B;  3OML A;  4F9A B;  2LBS B;  4B3S E;  2L92 A;  4YY3 E;  1J5E E;  1J26 A;  3LLH A;  1IBL E;  1GZ6 A;  4X66 E;  4F9C B;  2MC6 A;  2ODR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...