4KZSA

Crystal structure of the secreted protein hp1454 from the human pathogen helicobacter pylori
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
254
structure length
242
Chain Sequence
QKGYLYGSGSATSKEASKQKALADLVASISVVVNSQIHIQKSRINLKTDDLELNNVEIVNQEVQKGIYYTRVRINQNLFLQGLRDKYNALYGQFSTLMPKVCKGVFLQQSKSMGDLLAKAMPIERILKAYSVPVGSLENYEKIYYQNAFKPKVQITFDNNSDAEIKAALISAYARVLTPSDEEKLYQIKNEVFTDSANGITRIRVVVSASDCQGTPVLNRSLEVDEKNKNFAITRLQSLLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the secreted protein HP1454 from the human pathogen Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori r046wa
molecule tags Unknown function
molecule keywords LPP20 lipofamily protein
total genus 68
structure length 242
sequence length 254
ec nomenclature
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02169 LPP20 LPP20 lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.28.20 Alpha Beta Roll Endonuclease I-creI Acetamidase/Formamidase-like domains 4kzsA01
3.30.160.710 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4kzsA03
4KZSA 2F4LA
chains in the Genus database with same CATH superfamily
4R2QA 3C6MA 5FLXC 1UM2A 4X66E 2EM4A 2EMAA 2NABA 5TSEA 2L3JA 3T1HE 4DV1E 1G2FC 4JYAE 4K0KE 3EPJA 2JWOA 2NA2A 2LUPB 2MDRA 5E5SA 2EPKX 2I9IA 3HYJA 3FIGA 2DB2A 2EM9A 2LTSA 4LQ0A 4P78A 2I3QA 2EPPA 4R8OA 3BIDA 4OOGC 1YFHA 2EPRA 2BB8A 1N36E 2J7JA 2LJUA 2EQ3A 4DV6E 2EN7A 4TUIA 4Q35B 3UK3C 1IQSA 4JI4E 2YRMA 2VBNA 4MLVA 2GLIA 4IJDA 3P1XA 3C4BA 2LCEA 2RQLA 4AABA 2YPNA 2R1FA 3T1YE 1JVAA 5A0WA 3ADJA 3BGHA 3IWDA 2EMGA 2JVAA 3C4TA 3OTOE 2FGGA 2UXBE 4F54A 2YT4A 2ENHA 4AQYE 3KWRA 3EPHA 2VBOA 2MKNA 1B69A 1T39A 2EOJA 1NCSA 5T6JA 4BS9A 1A1LA 2BBGA 5A6KA 4BC7A 4AAEA 4N4RB 1X3CA 1F2IG 1UHZA 5IWAE 4UT0A 3LLHA 5KL7A 4DMIA 2M7QA 1JK1A 1EKZA 4LF8E 4UN9A 2V83A 2EM3A 3C6KA 3HXLA 2E72A 4FK5C 1ZU1A 4P7DA 2VBLB 4DR1E 2YU8A 1JK2A 4NHRA 2JOXA 3HTXA 3MHHC 2DLKA 4YISA 2LO3A 2WZOA 4JI7E 2VBNB 2GHFA 1UN6B 1ZBTA 4AAFA 4DR2E 2F4VE 4HTGA 1A1IA 2YZTA 4DV0E 1B24A 4BC9A 2UUBE 4KHPE 2DRPA 4BHBA 3ADLA 1DFAA 3VYYA 4R2DA 2EL4A 4NXNE 4DR5E 2VQFE 3JTZA 1X6FA 1L4SA 1MGTA 2EMBA 3QG5C 5E63A 2YWQA 3AV0A 2CPNA 3THNA 2EM2A 2NUGA 1A1FA 2EL5A 4DUZE 2V85A 2ODRC 5KL5A 2EPAA 1WJPA 2YRKA 2ELZA 5A74A 2R76A 2F8BA 4JI0E 2EOZA 2CW8A 4JI1E 3LMLA 3MIPA 3R7PA 1TF3A 4Z1ZA 5ADZA 5E67A 4LF5E 2B7TA 4WXCA 1R7MA 4GZNC 4LF7E 2B7VA 1T4NA 2O7MA 2EMYA 2G7HA 2RPCA 2VBJB 1XNQE 5A72A 4X62E 3JU0A 4F2JC 4YITA 4UNAA 5A6AA 4OX9E 2EMWA 3EPLA 1MOWA 2VF1A 2EN1A 3EPKA 4O43A 1YUIA 4YHXA 4JI6E 2RSMA 2VBOB 2E1MA 5AKFA 1EH6A 4DR3E 5A2QC 4B3SE 3UVFA 4AADA 2YSPA 4DV2E 4GKJE 5LL6R 1A1KA 1YZ9A 5F3WA 2EOOA 1YPNA 2LT7A 2EOFA 5AC4A 2YU5A 4L8NA 1XMOE 2EPZA 2EOSA 2HHHE 4AAGA 1RMDA 1DQ3A 4WPYA 1HNZE 2DCHX 1LLMC 2YTQA 2N3HA 3ZOQB 2DSYA 1BBGA 2N8XA 4JI2E 2EZ6A 2YSOA 2EM8A 4UNBA 3AUZA 4UN8A 1BBOA 3QQYA 5LMUE 3OMLA 4ZYGA 5AK9A 2EOIA 4BHCA 4F9CB 2RTXA 1PJTA 4DUYE 1G2DC 2E5LE 3KZYA 2MDGA 5KL4A 2L2NA 2LVHA 3DF6A 1N33E 3HQ1A 1AF5A 2UUAE 2VBJA 4HEIA 5KL2A 1T38A 1TN9A 3J81C 4Q28A 2VBLA 2MC5A 2YTPA 2EN6A 2HC5A 1YYWA 1T9JA 4ZYEA 4LFCE 2VE7C 1GQEA 1PKPA 5IV8B 4DR4E 2V8QB 5AC5A 2RS7A 3F6GA 3RMPA 4F6NA 1HNXE 2LV2A 4LTYA 2YTNA 3MXBB 3EH8A 3EQ1A 4BCAA 2V89A 2EE8A 1AH5A 1X6HA 5IT9C 1HNWE 2JXPA 2CTDA 2EM6A 4IS1C 2EORA 2DMIA 3THOB 1YYKA 4D6OA 1PJQA 3J80C 3BBGA 2RS6A 2EPMX 3IWCA 2EMCA 4M9VC 3JAMC 4DKKA 4YHHE 2VRDA 1O0WA 2VQEE 2JP9A 1U0CA 2EPXA 2EM5A 4Z1XA 2H36X 2EQ1A 4F6MA 5E5OA 1WHNA 2M9AA 1NEIA 2YTIA 3OOLA 1U0DA 2WCC3 4B3TE 2EMXA 1BB8A 1T4LB 2LRSA 4WSGA 1MEYC 3IWBA 4M30A 2DLQA 4DR7E 1ZR9A 1M5XA 1QU6A 2EPOA 4DR6E 5A6JA 2Q8UA 4JI8E 2RSIA 1EH7A 5CFFE 1IBKE 1RC7A 2JY9A 4WSPA 4X65E 1PJSA 2EN4A 2ELYA 1A1HA 2UXCE 2I3PA 2CSHA 2EL6A 3C0WA 4R2RA 1IBME 1KJKA 2EMLA 4DV7E 4M2ZA 2HGHA 1DI2A 1AAYA 3MX9A 2K4VA 2LJHA 4KWYA 1FJGE 1ZAAC 3C0XA 4JV5E 1J26A 2D9HA 2MKDA 2WBTA 1YYOA 3MHSC 2EMZA 4LFAE 1TF6A 4DV3E 3E54A 5A0MB 3MXAA 2EOMA 2EP3A 2L2KB 5A78A 1X6EA 4WFTA 5A69A 1N3FA 2N3GA 4WXDA 4X9JA 4I8OA 4GKKE 2MC6A 1EF0A 1X49A 2CT1A 2JYAA 2EM7A 1X47A 3ADGA 4JI5E 4DV5E 2UU9E 3J7AG 1LWSA 1N3EA 3K6QA 4WYQB 3MISA 4UN7A 2KONA 2XE0A 5LMNE 3KZZA 5A6BD 2EQ0A 3ECRA 2EN3A 4UN9G 2ENAA 5KL6A 2CW7A 1WHQA 1IMUA 2L92A 2XE0B 3MSWA 4BMJA 2HJJA 3HPSA 5AE3A 2EPCA 4F9BB 4AQUA 1GZ6A 5AE1A 1UILA 5DNYA 4RHBB 2A25A 2M4IA 2QOJZ 3FD2A 2YTJA 2B9DA 3VK6A 2FTXB 2PRTA 2ADRA 4D6NA 2JOBA 4NXME 2YTDA 4R2CA 4TUGA 2ENCA 4Z20A 2EMIA 1A1GA 2UUCE 2L8TA 2L6MA 2YRHA 2UXDE 4EFJA 3HYIA 2LTRA 3M99B 4L5NC 4DV4E 1P47A 2YTFA 5BR8E 3TQMA 1J5EE 4F9AB 2B3TB 3DJWA 4BBYA 1EH8A 1ZBQA 2EOQA 2YTOA 3VHTB 4R2PA 1G9ZA 2GPIA 3VYXA 4M0VA 4O5GA 2YTEA 1I94E 1T9IA 1G9YA 2DMYA 2EOYA 1RQ0A 4ZYHA 4X64E 4O24A 4LF9E 2JR1A 1P8KZ 5KL3A 1GTKA 4WX9A 2EMHA 2V86A 2EOEA 1FKAE 4KZSA 2EM0A 4R2AA 2EPUA 1YSAC 4B3RE 4R2EA 5AASA 3BF2A 2WBUA 2ODRD 2EJ4A 2WBSA 4LFBE 1STUA 2NUEA 2LMZA 2NUFA 4X8WA 2DIXA 2KOUA 4LU9A 4R03A 1IBLE 2KHXA 2EN2A 4B3ME 2LUQA 1KYQA 4GEQB 4RH8A 4LOXA 2VS7A 3KO2A 5AKMA 2L2MA 1XMQE 2K7IA 2F4LA 2EOXA 2EPNA 2EX5A 1N32E 2EWLA 1LWTA 4ZYDA 4JI3E 1A1JA 3J7Yp 2LE2A 5AKNA 1PDAA 1T4OA 3MXBA 2V87A 1WXRA 4UN8G 4UN7G 2I13A 4NZVA 1Z1BA 1BP7A 1N34E 2DGCA 4R2SA 5A0MA 3L00A 1X5WA 2AB5A 2FLDA 2EN8A 1UBDC 5A6BA 2L3CA 2L33A 5LLQA 1IQOA 3ADIA 4AQXA 1QNTA 1WRJA 4O4KA 2IHR1 5A77A 4LF4E 1SR9A 4YY3E 2EMKA 3H09A 4J8ZA 1SFEA 5AE2A 3HPZA 1DGCA 2ZM6E 2LBSB 1XNRE 2EOHA 2FV4B 4UNCA 2JPAA 1N3GA 2EPLX 2YTGA 1HR0E 4MLQA 2V88A 2VS8A 4LF6E 1X48A 2EMFA 3F6HA 5IXMB 1VDEA 2M1SA 1YUJA 3OORA
chains in the Genus database with same CATH topology
2JOBA 4JI0E 2F8BA 4NXME 3J80C 5FLXC 4TUGA 4X66E 2RS6A 3IWCA 3LMLA 4JI1E 2UUCE 2L8TA 2L6MA 3JAMC 4DKKA 2L3JA 4YHHE 4DV1E 3T1HE 4JYAE 5ADZA 4K0KE 2LTRA 1O0WA 4L5NC 2VQEE 2B7TA 4DV4E 4LF5E 2JWOA 5BR8E 4LF7E 2B7VA 1T4NA 2NA2A 1J5EE 4F9AB 2H36X 2G7HA 2MDRA 2LUPB 2B3TB 3DJWA 4BBYA 1WHNA 1XNQE 3FIGA 2DB2A 1ZBQA 2LTSA 4B3TE 4X62E 3JU0A 1T4LB 4P78A 4R8OA 2LRSA 3IWBA 4M30A 4OX9E 3VYXA 4OOGC 4DR7E 2VF1A 1I94E 2DMYA 1N36E 4DV6E 1RQ0A 4X64E 4TUIA 4JI4E 4LF9E 1QU6A 2JR1A 4JI6E 4DR6E 2RSMA 2E1MA 4JI8E 2V86A 3P1XA 1FKAE 4KZSA 3C4BA 4B3RE 5CFFE 1IBKE 4DR3E 5A2QC 1RC7A 4B3SE 2UXDE 5AASA 4DV2E 4GKJE 2JY9A 2ODRD 4WSPA 5LL6R 4X65E 3T1YE 1STUA 1YZ9A 5F3WA 2NUEA 4LFBE 2UXCE 2LMZA 2NUFA 3ADJA 4L8NA 4X8WA 1XMOE 3IWDA 2DIXA 2KOUA 4LU9A 2JVAA 4R03A 1IBLE 3C4TA 2KHXA 4DV7E 1IBME 4B3ME 2LUQA 3OTOE 2HHHE 2FGGA 4M2ZA 4GEQB 2YT4A 1DQ3A 4WPYA 4F54A 1HNZE 2UXBE 2L2MA 1XMQE 4AQYE 3KWRA 1DI2A 2N3HA 2K4VA 2LJHA 3ZOQB 5T6JA 1FJGE 4BS9A 2F4LA 2DSYA 1N32E 2EWLA 4JV5E 4BC7A 4JI3E 1J26A 3J7Yp 2LE2A 4JI2E 1YYOA 2EZ6A 4LFAE 1UHZA 5IWAE 1T4OA 3AUZA 4DV3E 3LLHA 4DMIA 5LMUE 2M7QA 1EKZA 4LF8E 3OMLA 2V83A 2L2KB 2V87A 4WFTA 1WXRA 3HXLA 4F9CB 2N3GA 2RTXA 4DUYE 2E5LE 4P7DA 1N34E 4DR1E 4I8OA 2L2NA 4GKKE 2MC6A 1X49A 3DF6A 1N33E 2JOXA 3HTXA 3HQ1A 1X47A 3ADGA 2WZOA 2UUAE 4JI5E 2L3CA 4JI7E 4DV5E 2L33A 2UU9E 3J7AG 1ZBTA 3J81C 4Q28A 3K6QA 4WYQB 4DR2E 2MC5A 3ADIA 2F4VE 2IHR1 2KONA 5LMNE 1YYWA 2YZTA 4DV0E 4BC9A 2UUBE 4LF4E 1SR9A 4YY3E 4KHPE 4LFCE 3ADLA 1WHQA 3VYYA 3H09A 2VE7C 4NXNE 4J8ZA 2L92A 4DR5E 1PKPA 1GQEA 3MSWA 5AE2A 4BMJA 3JTZA 2VQFE 4DR4E 2V8QB 3HPZA 2ZM6E 2RS7A 3F6GA 3RMPA 2LBSB 1HNXE 1XNRE 4LTYA 2FV4B 3HPSA 5AE3A 4BCAA 4F9BB 3AV0A 2V89A 5IT9C 1GZ6A 2CPNA 1UILA 5AE1A 1HR0E 5DNYA 2V88A 2NUGA 1HNWE 4DUZE 2M4IA 2V85A 2ODRC 4LF6E 1X48A 2B9DA 3F6HA 3VK6A 2FTXB 4M0VA 2M1SA 1YYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZS A;  2F4L A; 
#chains in the Genus database with same CATH topology
 4R2Q A;  3C6M A;  5FLX C;  1UM2 A;  4X66 E;  2EM4 A;  2EMA A;  2NAB A;  5TSE A;  2L3J A;  3T1H E;  4DV1 E;  1G2F C;  4JYA E;  4K0K E;  3EPJ A;  2JWO A;  2NA2 A;  2LUP B;  2MDR A;  5E5S A;  2EPK X;  2I9I A;  3HYJ A;  3FIG A;  2DB2 A;  2EM9 A;  2LTS A;  4LQ0 A;  4P78 A;  2I3Q A;  2EPP A;  4R8O A;  3BID A;  4OOG C;  1YFH A;  2EPR A;  2BB8 A;  1N36 E;  2J7J A;  2LJU A;  2EQ3 A;  4DV6 E;  2EN7 A;  4TUI A;  4Q35 B;  3UK3 C;  1IQS A;  4JI4 E;  2YRM A;  2VBN A;  4MLV A;  2GLI A;  4IJD A;  3P1X A;  3C4B A;  2LCE A;  2RQL A;  4AAB A;  2YPN A;  2R1F A;  3T1Y E;  1JVA A;  5A0W A;  3ADJ A;  3BGH A;  3IWD A;  2EMG A;  2JVA A;  3C4T A;  3OTO E;  2FGG A;  2UXB E;  4F54 A;  2YT4 A;  2ENH A;  4AQY E;  3KWR A;  3EPH A;  2VBO A;  2MKN A;  1B69 A;  1T39 A;  2EOJ A;  1NCS A;  5T6J A;  4BS9 A;  1A1L A;  2BBG A;  5A6K A;  4BC7 A;  4AAE A;  4N4R B;  1X3C A;  1F2I G;  1UHZ A;  5IWA E;  4UT0 A;  3LLH A;  5KL7 A;  4DMI A;  2M7Q A;  1JK1 A;  1EKZ A;  4LF8 E;  4UN9 A;  2V83 A;  2EM3 A;  3C6K A;  3HXL A;  2E72 A;  4FK5 C;  1ZU1 A;  4P7D A;  2VBL B;  4DR1 E;  2YU8 A;  1JK2 A;  4NHR A;  2JOX A;  3HTX A;  3MHH C;  2DLK A;  4YIS A;  2LO3 A;  2WZO A;  4JI7 E;  2VBN B;  2GHF A;  1UN6 B;  1ZBT A;  4AAF A;  4DR2 E;  2F4V E;  4HTG A;  1A1I A;  2YZT A;  4DV0 E;  1B24 A;  4BC9 A;  2UUB E;  4KHP E;  2DRP A;  4BHB A;  3ADL A;  1DFA A;  3VYY A;  4R2D A;  2EL4 A;  4NXN E;  4DR5 E;  2VQF E;  3JTZ A;  1X6F A;  1L4S A;  1MGT A;  2EMB A;  3QG5 C;  5E63 A;  2YWQ A;  3AV0 A;  2CPN A;  3THN A;  2EM2 A;  2NUG A;  1A1F A;  2EL5 A;  4DUZ E;  2V85 A;  2ODR C;  5KL5 A;  2EPA A;  1WJP A;  2YRK A;  2ELZ A;  5A74 A;  2R76 A;  2F8B A;  4JI0 E;  2EOZ A;  2CW8 A;  4JI1 E;  3LML A;  3MIP A;  3R7P A;  1TF3 A;  4Z1Z A;  5ADZ A;  5E67 A;  4LF5 E;  2B7T A;  4WXC A;  1R7M A;  4GZN C;  4LF7 E;  2B7V A;  1T4N A;  2O7M A;  2EMY A;  2G7H A;  2RPC A;  2VBJ B;  1XNQ E;  5A72 A;  4X62 E;  3JU0 A;  4F2J C;  4YIT A;  4UNA A;  5A6A A;  4OX9 E;  2EMW A;  3EPL A;  1MOW A;  2VF1 A;  2EN1 A;  3EPK A;  4O43 A;  1YUI A;  4YHX A;  4JI6 E;  2RSM A;  2VBO B;  2E1M A;  5AKF A;  1EH6 A;  4DR3 E;  5A2Q C;  4B3S E;  3UVF A;  4AAD A;  2YSP A;  4DV2 E;  4GKJ E;  5LL6 R;  1A1K A;  1YZ9 A;  5F3W A;  2EOO A;  1YPN A;  2LT7 A;  2EOF A;  5AC4 A;  2YU5 A;  4L8N A;  1XMO E;  2EPZ A;  2EOS A;  2HHH E;  4AAG A;  1RMD A;  1DQ3 A;  4WPY A;  1HNZ E;  2DCH X;  1LLM C;  2YTQ A;  2N3H A;  3ZOQ B;  2DSY A;  1BBG A;  2N8X A;  4JI2 E;  2EZ6 A;  2YSO A;  2EM8 A;  4UNB A;  3AUZ A;  4UN8 A;  1BBO A;  3QQY A;  5LMU E;  3OML A;  4ZYG A;  5AK9 A;  2EOI A;  4BHC A;  4F9C B;  2RTX A;  1PJT A;  4DUY E;  1G2D C;  2E5L E;  3KZY A;  2MDG A;  5KL4 A;  2L2N A;  2LVH A;  3DF6 A;  1N33 E;  3HQ1 A;  1AF5 A;  2UUA E;  2VBJ A;  4HEI A;  5KL2 A;  1T38 A;  1TN9 A;  3J81 C;  4Q28 A;  2VBL A;  2MC5 A;  2YTP A;  2EN6 A;  2HC5 A;  1YYW A;  1T9J A;  4ZYE A;  4LFC E;  2VE7 C;  1GQE A;  1PKP A;  5IV8 B;  4DR4 E;  2V8Q B;  5AC5 A;  2RS7 A;  3F6G A;  3RMP A;  4F6N A;  1HNX E;  2LV2 A;  4LTY A;  2YTN A;  3MXB B;  3EH8 A;  3EQ1 A;  4BCA A;  2V89 A;  2EE8 A;  1AH5 A;  1X6H A;  5IT9 C;  1HNW E;  2JXP A;  2CTD A;  2EM6 A;  4IS1 C;  2EOR A;  2DMI A;  3THO B;  1YYK A;  4D6O A;  1PJQ A;  3J80 C;  3BBG A;  2RS6 A;  2EPM X;  3IWC A;  2EMC A;  4M9V C;  3JAM C;  4DKK A;  4YHH E;  2VRD A;  1O0W A;  2VQE E;  2JP9 A;  1U0C A;  2EPX A;  2EM5 A;  4Z1X A;  2H36 X;  2EQ1 A;  4F6M A;  5E5O A;  1WHN A;  2M9A A;  1NEI A;  2YTI A;  3OOL A;  1U0D A;  2WCC 3;  4B3T E;  2EMX A;  1BB8 A;  1T4L B;  2LRS A;  4WSG A;  1MEY C;  3IWB A;  4M30 A;  2DLQ A;  4DR7 E;  1ZR9 A;  1M5X A;  1QU6 A;  2EPO A;  4DR6 E;  5A6J A;  2Q8U A;  4JI8 E;  2RSI A;  1EH7 A;  5CFF E;  1IBK E;  1RC7 A;  2JY9 A;  4WSP A;  4X65 E;  1PJS A;  2EN4 A;  2ELY A;  1A1H A;  2UXC E;  2I3P A;  2CSH A;  2EL6 A;  3C0W A;  4R2R A;  1IBM E;  1KJK A;  2EML A;  4DV7 E;  4M2Z A;  2HGH A;  1DI2 A;  1AAY A;  3MX9 A;  2K4V A;  2LJH A;  4KWY A;  1FJG E;  1ZAA C;  3C0X A;  4JV5 E;  1J26 A;  2D9H A;  2MKD A;  2WBT A;  1YYO A;  3MHS C;  2EMZ A;  4LFA E;  1TF6 A;  4DV3 E;  3E54 A;  5A0M B;  3MXA A;  2EOM A;  2EP3 A;  2L2K B;  5A78 A;  1X6E A;  4WFT A;  5A69 A;  1N3F A;  2N3G A;  4WXD A;  4X9J A;  4I8O A;  4GKK E;  2MC6 A;  1EF0 A;  1X49 A;  2CT1 A;  2JYA A;  2EM7 A;  1X47 A;  3ADG A;  4JI5 E;  4DV5 E;  2UU9 E;  3J7A G;  1LWS A;  1N3E A;  3K6Q A;  4WYQ B;  3MIS A;  4UN7 A;  2KON A;  2XE0 A;  5LMN E;  3KZZ A;  5A6B D;  2EQ0 A;  3ECR A;  2EN3 A;  4UN9 G;  2ENA A;  5KL6 A;  2CW7 A;  1WHQ A;  1IMU A;  2L92 A;  2XE0 B;  3MSW A;  4BMJ A;  2HJJ A;  3HPS A;  5AE3 A;  2EPC A;  4F9B B;  4AQU A;  1GZ6 A;  5AE1 A;  1UIL A;  5DNY A;  4RHB B;  2A25 A;  2M4I A;  2QOJ Z;  3FD2 A;  2YTJ A;  2B9D A;  3VK6 A;  2FTX B;  2PRT A;  2ADR A;  4D6N A;  2JOB A;  4NXM E;  2YTD A;  4R2C A;  4TUG A;  2ENC A;  4Z20 A;  2EMI A;  1A1G A;  2UUC E;  2L8T A;  2L6M A;  2YRH A;  2UXD E;  4EFJ A;  3HYI A;  2LTR A;  3M99 B;  4L5N C;  4DV4 E;  1P47 A;  2YTF A;  5BR8 E;  3TQM A;  1J5E E;  4F9A B;  2B3T B;  3DJW A;  4BBY A;  1EH8 A;  1ZBQ A;  2EOQ A;  2YTO A;  3VHT B;  4R2P A;  1G9Z A;  2GPI A;  3VYX A;  4M0V A;  4O5G A;  2YTE A;  1I94 E;  1T9I A;  1G9Y A;  2DMY A;  2EOY A;  1RQ0 A;  4ZYH A;  4X64 E;  4O24 A;  4LF9 E;  2JR1 A;  1P8K Z;  5KL3 A;  1GTK A;  4WX9 A;  2EMH A;  2V86 A;  2EOE A;  1FKA E;  4KZS A;  2EM0 A;  4R2A A;  2EPU A;  1YSA C;  4B3R E;  4R2E A;  5AAS A;  3BF2 A;  2WBU A;  2ODR D;  2EJ4 A;  2WBS A;  4LFB E;  1STU A;  2NUE A;  2LMZ A;  2NUF A;  4X8W A;  2DIX A;  2KOU A;  4LU9 A;  4R03 A;  1IBL E;  2KHX A;  2EN2 A;  4B3M E;  2LUQ A;  1KYQ A;  4GEQ B;  4RH8 A;  4LOX A;  2VS7 A;  3KO2 A;  5AKM A;  2L2M A;  1XMQ E;  2K7I A;  2F4L A;  2EOX A;  2EPN A;  2EX5 A;  1N32 E;  2EWL A;  1LWT A;  4ZYD A;  4JI3 E;  1A1J A;  3J7Y p;  2LE2 A;  5AKN A;  1PDA A;  1T4O A;  3MXB A;  2V87 A;  1WXR A;  4UN8 G;  4UN7 G;  2I13 A;  4NZV A;  1Z1B A;  1BP7 A;  1N34 E;  2DGC A;  4R2S A;  5A0M A;  3L00 A;  1X5W A;  2AB5 A;  2FLD A;  2EN8 A;  1UBD C;  5A6B A;  2L3C A;  2L33 A;  5LLQ A;  1IQO A;  3ADI A;  4AQX A;  1QNT A;  1WRJ A;  4O4K A;  2IHR 1;  5A77 A;  4LF4 E;  1SR9 A;  4YY3 E;  2EMK A;  3H09 A;  4J8Z A;  1SFE A;  5AE2 A;  3HPZ A;  1DGC A;  2ZM6 E;  2LBS B;  1XNR E;  2EOH A;  2FV4 B;  4UNC A;  2JPA A;  1N3G A;  2EPL X;  2YTG A;  1HR0 E;  4MLQ A;  2V88 A;  2VS8 A;  4LF6 E;  1X48 A;  2EMF A;  3F6H A;  5IXM B;  1VDE A;  2M1S A;  1YUJ A;  3OOR A; 
#chains in the Genus database with same CATH homology
 2JOB A;  4JI0 E;  2F8B A;  4NXM E;  3J80 C;  5FLX C;  4TUG A;  4X66 E;  2RS6 A;  3IWC A;  3LML A;  4JI1 E;  2UUC E;  2L8T A;  2L6M A;  3JAM C;  4DKK A;  2L3J A;  4YHH E;  4DV1 E;  3T1H E;  4JYA E;  5ADZ A;  4K0K E;  2LTR A;  1O0W A;  4L5N C;  2VQE E;  2B7T A;  4DV4 E;  4LF5 E;  2JWO A;  5BR8 E;  4LF7 E;  2B7V A;  1T4N A;  2NA2 A;  1J5E E;  4F9A B;  2H36 X;  2G7H A;  2MDR A;  2LUP B;  2B3T B;  3DJW A;  4BBY A;  1WHN A;  1XNQ E;  3FIG A;  2DB2 A;  1ZBQ A;  2LTS A;  4B3T E;  4X62 E;  3JU0 A;  1T4L B;  4P78 A;  4R8O A;  2LRS A;  3IWB A;  4M30 A;  4OX9 E;  3VYX A;  4OOG C;  4DR7 E;  2VF1 A;  1I94 E;  2DMY A;  1N36 E;  4DV6 E;  1RQ0 A;  4X64 E;  4TUI A;  4JI4 E;  4LF9 E;  1QU6 A;  2JR1 A;  4JI6 E;  4DR6 E;  2RSM A;  2E1M A;  4JI8 E;  2V86 A;  3P1X A;  1FKA E;  4KZS A;  3C4B A;  4B3R E;  5CFF E;  1IBK E;  4DR3 E;  5A2Q C;  1RC7 A;  4B3S E;  2UXD E;  5AAS A;  4DV2 E;  4GKJ E;  2JY9 A;  2ODR D;  4WSP A;  5LL6 R;  4X65 E;  3T1Y E;  1STU A;  1YZ9 A;  5F3W A;  2NUE A;  4LFB E;  2UXC E;  2LMZ A;  2NUF A;  3ADJ A;  4L8N A;  4X8W A;  1XMO E;  3IWD A;  2DIX A;  2KOU A;  4LU9 A;  2JVA A;  4R03 A;  1IBL E;  3C4T A;  2KHX A;  4DV7 E;  1IBM E;  4B3M E;  2LUQ A;  3OTO E;  2HHH E;  2FGG A;  4M2Z A;  4GEQ B;  2YT4 A;  1DQ3 A;  4WPY A;  4F54 A;  1HNZ E;  2UXB E;  2L2M A;  1XMQ E;  4AQY E;  3KWR A;  1DI2 A;  2N3H A;  2K4V A;  2LJH A;  3ZOQ B;  5T6J A;  1FJG E;  4BS9 A;  2F4L A;  2DSY A;  1N32 E;  2EWL A;  4JV5 E;  4BC7 A;  4JI3 E;  1J26 A;  3J7Y p;  2LE2 A;  4JI2 E;  1YYO A;  2EZ6 A;  4LFA E;  1UHZ A;  5IWA E;  1T4O A;  3AUZ A;  4DV3 E;  3LLH A;  4DMI A;  5LMU E;  2M7Q A;  1EKZ A;  4LF8 E;  3OML A;  2V83 A;  2L2K B;  2V87 A;  4WFT A;  1WXR A;  3HXL A;  4F9C B;  2N3G A;  2RTX A;  4DUY E;  2E5L E;  4P7D A;  1N34 E;  4DR1 E;  4I8O A;  2L2N A;  4GKK E;  2MC6 A;  1X49 A;  3DF6 A;  1N33 E;  2JOX A;  3HTX A;  3HQ1 A;  1X47 A;  3ADG A;  2WZO A;  2UUA E;  4JI5 E;  2L3C A;  4JI7 E;  4DV5 E;  2L33 A;  2UU9 E;  3J7A G;  1ZBT A;  3J81 C;  4Q28 A;  3K6Q A;  4WYQ B;  4DR2 E;  2MC5 A;  3ADI A;  2F4V E;  2IHR 1;  2KON A;  5LMN E;  1YYW A;  2YZT A;  4DV0 E;  4BC9 A;  2UUB E;  4LF4 E;  1SR9 A;  4YY3 E;  4KHP E;  4LFC E;  3ADL A;  1WHQ A;  3VYY A;  3H09 A;  2VE7 C;  4NXN E;  4J8Z A;  2L92 A;  4DR5 E;  1PKP A;  1GQE A;  3MSW A;  5AE2 A;  4BMJ A;  3JTZ A;  2VQF E;  4DR4 E;  2V8Q B;  3HPZ A;  2ZM6 E;  2RS7 A;  3F6G A;  3RMP A;  2LBS B;  1HNX E;  1XNR E;  4LTY A;  2FV4 B;  3HPS A;  5AE3 A;  4BCA A;  4F9B B;  3AV0 A;  2V89 A;  5IT9 C;  1GZ6 A;  2CPN A;  1UIL A;  5AE1 A;  1HR0 E;  5DNY A;  2V88 A;  2NUG A;  1HNW E;  4DUZ E;  2M4I A;  2V85 A;  2ODR C;  4LF6 E;  1X48 A;  2B9D A;  3F6H A;  3VK6 A;  2FTX B;  4M0V A;  2M1S A;  1YYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...