The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
31
|
sequence length |
108
|
structure length |
102
|
Chain Sequence |
SAEASAADYLERQGYRILARRFKTRCGEIDLVAQRDALVAFVEVKARAYAVTPRQQSRIVAAAEAWLSRHPEHAMSELRFDAILIAPNTAPRHLPGAFDATP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
X-ray crystal structure of protein RPA0323 of unknown function from Rhodopseudomonas palustris.
rcsb |
| molecule keywords |
UPF0102 protein RPA0323
|
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Rhodopseudomonas palustris
|
| total genus |
31
|
| structure length |
102
|
| sequence length |
108
|
| ec nomenclature | |
| pdb deposition date | 2009-01-02 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02021 | UPF0102 | Uncharacterised protein family UPF0102 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Trna Endonuclease; Chain: A, domain 1 | Trna Endonuclease; Chain: A, domain 1 |
#chains in the Genus database with same CATH superfamily 3AJV A; 3IEY A; 4QBN A; 4QBL A; 1OB9 A; 1IPI A; 1RZN A; 1RLV A; 1Y88 A; 1XMX A; 2GJW A; 2FCO A; 1HH1 A; 1GEF A; 2WJ0 A; 1R11 A; 1ZP7 A; 2INB A; 1A79 A; 4QBO A; 2WCW A; 2OST A; 2CV8 A; 1F1Z A; 3DNX A; 2ZYZ B; 5FDK A; 2WIW A; 2OKF A; 3P1Z B; 3AJV B; 1R0V A; 2EO0 A; 3P1Y A; 2GW6 A; 1OB8 A; 1T0F A; 4TKD A; 2ZYZ A; 3FOV A; 2WIZ A; 4TKK A; 3P1Z A; 1Y1O A; 2WCZ A; 2VLD A; #chains in the Genus database with same CATH topology 3AJV A; 3IEY A; 4QBN A; 4G6V A; 1OB9 A; 4QBL A; 1IPI A; 1RZN A; 1RLV A; 1UWV A; 2IXS A; 4ZQU A; 2FKC A; 2FKH B; 1Y88 A; 2CZR A; 1XMX A; 3IF0 X; 4DAP A; 2FCO A; 1HH1 A; 1GEF A; 2WJ0 A; 2FL3 A; 1R11 A; 1ZP7 A; 2GJW A; 1YNM A; 2INB A; 2Z0R A; 1A79 A; 3BT7 A; 4QBO A; 2W8M A; 2WCW A; 2BH2 A; 4G6U A; 2OST A; 2CV8 A; 2DBS A; 1F1Z A; 3DNX A; 2ZYZ B; 5FDK A; 2WIW A; 2OKF A; 3P1Z B; 2JJQ A; 3AJV B; 3IEY B; 2VS1 A; 1R0V A; 4E6Z A; 4DAV A; 2FLC A; 2EO0 A; 3P1Y A; 2GW6 A; 1OB8 A; 1T0F A; 4TKD A; 4EV1 A; 2ZYZ A; 3FOV A; 2WIZ A; 4LQE A; 4TKK A; 4DA2 A; 3P1Z A; 1Y1O A; 2WCZ A; 2VLD A; #chains in the Genus database with same CATH homology 3AJV A; 3IEY A; 4QBN A; 4G6V A; 1OB9 A; 4QBL A; 1IPI A; 1RZN A; 1RLV A; 1UWV A; 2IXS A; 4ZQU A; 2FKC A; 2FKH B; 1Y88 A; 2CZR A; 1XMX A; 3IF0 X; 4DAP A; 2FCO A; 1HH1 A; 1GEF A; 2WJ0 A; 2FL3 A; 1R11 A; 1ZP7 A; 2GJW A; 1YNM A; 2INB A; 2Z0R A; 1A79 A; 3BT7 A; 4QBO A; 2W8M A; 2WCW A; 2BH2 A; 4G6U A; 2OST A; 2CV8 A; 2DBS A; 1F1Z A; 3DNX A; 2ZYZ B; 5FDK A; 2WIW A; 2OKF A; 3P1Z B; 2JJQ A; 3AJV B; 3IEY B; 2VS1 A; 1R0V A; 4E6Z A; 4DAV A; 2FLC A; 2EO0 A; 3P1Y A; 2GW6 A; 1OB8 A; 1T0F A; 4TKD A; 4EV1 A; 2ZYZ A; 3FOV A; 2WIZ A; 4LQE A; 4TKK A; 4DA2 A; 3P1Z A; 1Y1O A; 2WCZ A; 2VLD A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...