4BU6A

Crystal structure of human tankyrase 2 in complex with 2-(4- aminophenyl)-3,4-dihydroquinazolin-4-one
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
molecule keywords TANKYRASE-2
molecule tags Transferase
source organism Homo sapiens
total genus 69
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bu6A00
4GV7A 5LXPA 4AVUA 4TVJA 4BUEA 4PNSA 3SMJA 4J3MA 3C49A 5LX6A 5C5RA 4HMHA 5AL5A 4AVWA 2RCWA 4I9IA 3HKVA 3BLJA 3FHBA 4N4VA 4R6EA 4L7NA 4UI6A 5AL3A 4L0VA 5ADTA 3P0QA 4PMLA 3W51A 4HLKA 4HLFA 4UVZA 4KZUA 4BJCA 4KRSA 4ZZYA 4PAXA 4PNMA 4BU6A 3GJWA 4OPXC 4UVVA 4N3RA 5ECEA 4TKGA 4BUFA 4OA7A 2RF5A 5ADQA 4RV6A 4HKKA 5AL2A 4TJYA 4BUSA 3KR7A 5EBTA 4UI4A 5LYHA 4LI6A 4K4EA 4L10A 4BUUA 3UH2A 3GEYA 4L7PA 4BUIA 4L0IA 4TK0A 1WOKA 3KJDA 4BUXA 4GV0A 4HHYA 4J21A 4L7UA 4UVXA 4W5IA 3U9YA 4BUVA 4UVWA 4TJWA 4L0SA 4OQAC 3UH4A 4MSKA 4L09A 4UVUA 1EFYA 4HYFA 4KZLA 4L6ZA 4UI7A 4UUHA 4PJVA 4TK5A 4BFPA 4PNNA 4BUAA 4TORA 1A26A 3L3MA 4PNRA 4F0EA 4L6SA 4TOSA 3SE2A 2PAWA 3UDDA 4BUYA 4M7BA 5C5QA 4HKNA 4UW1A 4UI8A 1PAXA 4DVIA 4L7OA 4OQBC 4BU9A 3GOYA 4L7RA 4L33A 4UVYA 5AL4A 4L70A 4TKFA 5FPGA 5C5PA 4BS4A 4UI3A 4F1QA 2RD6A 4BU7A 4UVOA 3MHKA 5A00A 4BJ9A 4L2KA 3SMIA 3KCZA 4N4TA 4UX4A 4UVPA 4HLGA 4BJBA 4PNLA 5ADSA 3KR8A 5AKWA 4UHGA 4PJTA 4L0BA 4GV2A 4MT9A 5ADRA 4GV4A 4K4FA 3CE0A 4L0TA 3P0PA 3C4HA 1GS0A 4R5WA 3L3LA 4HLHA 4TKIA 4MSGA 4UXBA 5AKUA 1UK1A 4BUWA 4ZZZA 4LI8A 4UFUA 4BUDA 3GN7A 2PQFA 4HLMA 4PY4A 4BUTA 2X5YA 4BU3A 4F1LA 4UVSA 4UFYA 3MHJA 4HL5A 4KZQA 3PAXA 4PNQA 4J22A 4W6EA 3UA9A 4UI5A 5FPFA 5DCZA 4L32A 4XHUA 4L2GA 4LI7A 4BU5A 4X52A 1UK0A 4UVNA 4UVTA 5ETYA 4IUEA 3U9HA 4UVLA 4J3LA 4L7LA 3P0NA 4J1ZA 5AL1A 4U6AA 4HHZA 4W5SA 4L34A 4UNDA 4L31A 5AEHA 2PAXA 4HKIA 4ZZXA 4DQYC 4PNTA 4BU8A 4L2FA 4TJUA
chains in the Genus database with same CATH superfamily
4GV7A 5LXPA 4AVUA 4TVJA 4BUEA 2QEYA 4PNSA 3MOEA 4WIEA 4WPVA 3SMJA 1AQ2A 4J3MA 3C49A 5FH4A 5C5RA 5LX6A 4HMHA 5AL5A 4AVWA 2GMVA 2RCWA 4I9IA 3HKVA 3BLJA 3FHBA 4N4VA 4R6EA 4L7NA 4UI6A 5AL3A 4L0VA 5ADTA 3P0QA 4PMLA 3W51A 4HLKA 4HLFA 4UVZA 4KZUA 4BJCA 4KRSA 1KHGA 3DT7A 4PAXA 4PNMA 4BU6A 3GJWA 4ZZYA 4OPXC 1K3CA 4UVVA 4WPTA 4N3RA 4GMMA 4TKGA 5ECEA 4OA7A 2RF5A 4BUFA 5ADQA 4RV6A 4HKKA 5AL2A 4TJYA 4BUSA 2PY7X 3KR7A 1KHFA 5EBTA 4UI4A 5LYHA 4LI6A 1KHBA 4K4EA 4L10A 4WOUA 1YGGA 3DTBA 3UH2A 3GEYA 4L7PA 4BUUA 4BUIA 4L0IA 4TK0A 1WOKA 1YVYA 3KJDA 3MOFA 4GV0A 4HHYA 4J21A 1YTMA 4L7UA 3DT4A 4BUXA 4UVXA 4W5IA 3U9YA 4BUVA 4UVWA 4TJWA 4L0SA 4OQAC 3UH4A 4MSKA 4L09A 4UVUA 1EFYA 4HYFA 4KZLA 4L6ZA 4R43A 4UI7A 4PJVA 4TK5A 4UUHA 4PNNA 4WIUA 4TORA 4BUAA 5FH3A 2RKAA 4BFPA 2PXZX 1A26A 3L3MA 4PNRA 4F0EA 4L6SA 4TOSA 4OX2A 2PAWA 3SE2A 3UDDA 4BUYA 4M7BA 2OLQA 5C5QA 4HKNA 2QF2A 4UW1A 4UI8A 1PAXA 4GNPA 4WL8A 4DVIA 4L7OA 4OQBC 4BU9A 3GOYA 2PC9A 1YLHA 4L33A 4L7RA 4UVYA 5AL4A 4L70A 4TKFA 4YW8A 5FPGA 5C5PA 4BS4A 4UI3A 4F1QA 2OLRA 5FH0A 4GMUA 2RD6A 4BU7A 4UVOA 3MHKA 2QZYA 5A00A 4BJ9A 4L2KA 4GMWA 1OENA 3SMIA 3KCZA 4N4TA 4UX4A 4UVPA 4HLGA 4BJBA 1J3BA 4PNLA 3DT2A 4L2FA 2QEWA 4YW9A 2RKDA 3KR8A 5AKWA 5ADSA 2ZCIA 4UHGA 4PJTA 2RK8A 4L0BA 4GV2A 4MT9A 5ADRA 4GV4A 4K4FA 1M51A 3CE0A 4L0TA 4RCGA 1XKVA 3C4HA 1GS0A 3P0PA 3L3LA 4HLHA 4R5WA 4MSGA 4TKIA 4UXBA 1UK1A 5AKUA 4YWBA 4BUWA 2FAHA 4ZZZA 1AYLA 4LI8A 4UFUA 4BUDA 3GN7A 2PQFA 2RKEA 4HLMA 4PY4A 4BUTA 2X5YA 4BU3A 2RK7A 4F1LA 4UVSA 5I67A 4UFYA 3MHJA 4HL5A 4KZQA 3PAXA 4GNMA 4PNQA 3MOHA 5FH1A 4J22A 5FH5A 4W6EA 1OS1A 4WPUA 3UA9A 4UI5A 1KHEA 1NHXA 5DCZA 4L32A 4YWDA 5FPFA 4XHUA 4GNQA 5FH2A 4L2GA 4LI7A 4GMZA 4BU5A 4X52A 1UK0A 4UVNA 4GNLA 4UVTA 4IUEA 5ETYA 3U9HA 1K3DA 4UVLA 1II2A 2QF1A 4J3LA 4L7LA 3P0NA 4J1ZA 5AL1A 4U6AA 4HHZA 4W5SA 4L34A 4UNDA 2FAFA 4L31A 2PAXA 4HKIA 4ZZXA 5AEHA 4DQYC 4PNTA 4BU8A 4GNOA 4TJUA
chains in the Genus database with same CATH topology
4GV7A 5LXPA 4AVUA 4TVJA 4BUEA 2QEYA 4PNSA 3MOEA 4WIEA 4WPVA 3SMJA 1AQ2A 4J3MA 3C49A 5FH4A 5C5RA 5LX6A 4HMHA 5AL5A 4AVWA 2GMVA 2RCWA 4I9IA 3HKVA 3BLJA 3FHBA 4N4VA 4R6EA 4L7NA 4UI6A 5AL3A 4L0VA 5ADTA 3P0QA 4PMLA 3W51A 4HLKA 4HLFA 4UVZA 4KZUA 4BJCA 4KRSA 1KHGA 3DT7A 4PAXA 4PNMA 4BU6A 3GJWA 4ZZYA 4OPXC 1K3CA 4UVVA 4WPTA 4N3RA 4GMMA 4TKGA 5ECEA 4OA7A 2RF5A 4BUFA 5ADQA 4RV6A 4HKKA 5AL2A 4TJYA 4BUSA 2PY7X 3KR7A 1KHFA 5EBTA 4UI4A 5LYHA 4LI6A 1KHBA 4K4EA 4L10A 4WOUA 1YGGA 3DTBA 3UH2A 3GEYA 4L7PA 4BUUA 4BUIA 4L0IA 4TK0A 1WOKA 1YVYA 3KJDA 3MOFA 4GV0A 4HHYA 4J21A 1YTMA 4L7UA 3DT4A 4BUXA 4UVXA 4W5IA 3U9YA 4BUVA 4UVWA 4TJWA 4L0SA 4OQAC 3UH4A 4MSKA 4L09A 4UVUA 1EFYA 4HYFA 4KZLA 4L6ZA 4R43A 4UI7A 4PJVA 4TK5A 4UUHA 4PNNA 4WIUA 4TORA 4BUAA 5FH3A 2RKAA 4BFPA 2PXZX 1A26A 3L3MA 4PNRA 4F0EA 4L6SA 4TOSA 4OX2A 2PAWA 3SE2A 3UDDA 4BUYA 4M7BA 2OLQA 5C5QA 4HKNA 2QF2A 4UW1A 4UI8A 1PAXA 4GNPA 4WL8A 4DVIA 4L7OA 4OQBC 4BU9A 3GOYA 2PC9A 1YLHA 4L33A 4L7RA 4UVYA 5AL4A 4L70A 4TKFA 4YW8A 5FPGA 5C5PA 4BS4A 4UI3A 4F1QA 2OLRA 5FH0A 4GMUA 2RD6A 4BU7A 4UVOA 3MHKA 2QZYA 5A00A 4BJ9A 4L2KA 4GMWA 1OENA 3SMIA 3KCZA 4N4TA 4UX4A 4UVPA 4HLGA 4BJBA 1J3BA 4PNLA 3DT2A 4L2FA 2QEWA 4YW9A 2RKDA 3KR8A 5AKWA 5ADSA 2ZCIA 4UHGA 4PJTA 2RK8A 4L0BA 4GV2A 4MT9A 5ADRA 4GV4A 4K4FA 1M51A 3CE0A 4L0TA 4RCGA 1XKVA 3C4HA 1GS0A 3P0PA 3L3LA 4HLHA 4R5WA 4MSGA 4TKIA 4UXBA 1UK1A 5AKUA 4YWBA 4BUWA 2FAHA 4ZZZA 1AYLA 4LI8A 4UFUA 4BUDA 3GN7A 2PQFA 2RKEA 4HLMA 4PY4A 4BUTA 2X5YA 4BU3A 2RK7A 4F1LA 4UVSA 5I67A 4UFYA 3MHJA 4HL5A 4KZQA 3PAXA 4GNMA 4PNQA 3MOHA 5FH1A 4J22A 5FH5A 4W6EA 1OS1A 4WPUA 3UA9A 4UI5A 1KHEA 1NHXA 5DCZA 4L32A 4YWDA 5FPFA 4XHUA 4GNQA 5FH2A 4L2GA 4LI7A 4GMZA 4BU5A 4X52A 1UK0A 4UVNA 4GNLA 4UVTA 4IUEA 5ETYA 3U9HA 1K3DA 4UVLA 1II2A 2QF1A 4J3LA 4L7LA 3P0NA 4J1ZA 5AL1A 4U6AA 4HHZA 4W5SA 4L34A 4UNDA 2FAFA 4L31A 2PAXA 4HKIA 4ZZXA 5AEHA 4DQYC 4PNTA 4BU8A 4GNOA 4TJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GV7 A;  5LXP A;  4AVU A;  4TVJ A;  4BUE A;  4PNS A;  3SMJ A;  4J3M A;  3C49 A;  5LX6 A;  5C5R A;  4HMH A;  5AL5 A;  4AVW A;  2RCW A;  4I9I A;  3HKV A;  3BLJ A;  3FHB A;  4N4V A;  4R6E A;  4L7N A;  4UI6 A;  5AL3 A;  4L0V A;  5ADT A;  3P0Q A;  4PML A;  3W51 A;  4HLK A;  4HLF A;  4UVZ A;  4KZU A;  4BJC A;  4KRS A;  4ZZY A;  4PAX A;  4PNM A;  4BU6 A;  3GJW A;  4OPX C;  4UVV A;  4N3R A;  5ECE A;  4TKG A;  4BUF A;  4OA7 A;  2RF5 A;  5ADQ A;  4RV6 A;  4HKK A;  5AL2 A;  4TJY A;  4BUS A;  3KR7 A;  5EBT A;  4UI4 A;  5LYH A;  4LI6 A;  4K4E A;  4L10 A;  4BUU A;  3UH2 A;  3GEY A;  4L7P A;  4BUI A;  4L0I A;  4TK0 A;  1WOK A;  3KJD A;  4BUX A;  4GV0 A;  4HHY A;  4J21 A;  4L7U A;  4UVX A;  4W5I A;  3U9Y A;  4BUV A;  4UVW A;  4TJW A;  4L0S A;  4OQA C;  3UH4 A;  4MSK A;  4L09 A;  4UVU A;  1EFY A;  4HYF A;  4KZL A;  4L6Z A;  4UI7 A;  4UUH A;  4PJV A;  4TK5 A;  4BFP A;  4PNN A;  4BUA A;  4TOR A;  1A26 A;  3L3M A;  4PNR A;  4F0E A;  4L6S A;  4TOS A;  3SE2 A;  2PAW A;  3UDD A;  4BUY A;  4M7B A;  5C5Q A;  4HKN A;  4UW1 A;  4UI8 A;  1PAX A;  4DVI A;  4L7O A;  4OQB C;  4BU9 A;  3GOY A;  4L7R A;  4L33 A;  4UVY A;  5AL4 A;  4L70 A;  4TKF A;  5FPG A;  5C5P A;  4BS4 A;  4UI3 A;  4F1Q A;  2RD6 A;  4BU7 A;  4UVO A;  3MHK A;  5A00 A;  4BJ9 A;  4L2K A;  3SMI A;  3KCZ A;  4N4T A;  4UX4 A;  4UVP A;  4HLG A;  4BJB A;  4PNL A;  5ADS A;  3KR8 A;  5AKW A;  4UHG A;  4PJT A;  4L0B A;  4GV2 A;  4MT9 A;  5ADR A;  4GV4 A;  4K4F A;  3CE0 A;  4L0T A;  3P0P A;  3C4H A;  1GS0 A;  4R5W A;  3L3L A;  4HLH A;  4TKI A;  4MSG A;  4UXB A;  5AKU A;  1UK1 A;  4BUW A;  4ZZZ A;  4LI8 A;  4UFU A;  4BUD A;  3GN7 A;  2PQF A;  4HLM A;  4PY4 A;  4BUT A;  2X5Y A;  4BU3 A;  4F1L A;  4UVS A;  4UFY A;  3MHJ A;  4HL5 A;  4KZQ A;  3PAX A;  4PNQ A;  4J22 A;  4W6E A;  3UA9 A;  4UI5 A;  5FPF A;  5DCZ A;  4L32 A;  4XHU A;  4L2G A;  4LI7 A;  4BU5 A;  4X52 A;  1UK0 A;  4UVN A;  4UVT A;  5ETY A;  4IUE A;  3U9H A;  4UVL A;  4J3L A;  4L7L A;  3P0N A;  4J1Z A;  5AL1 A;  4U6A A;  4HHZ A;  4W5S A;  4L34 A;  4UND A;  4L31 A;  5AEH A;  2PAX A;  4HKI A;  4ZZX A;  4DQY C;  4PNT A;  4BU8 A;  4L2F A;  4TJU A; 
#chains in the Genus database with same CATH topology
 4GV7 A;  5LXP A;  4AVU A;  4TVJ A;  4BUE A;  2QEY A;  4PNS A;  3MOE A;  4WIE A;  4WPV A;  3SMJ A;  1AQ2 A;  4J3M A;  3C49 A;  5FH4 A;  5C5R A;  5LX6 A;  4HMH A;  5AL5 A;  4AVW A;  2GMV A;  2RCW A;  4I9I A;  3HKV A;  3BLJ A;  3FHB A;  4N4V A;  4R6E A;  4L7N A;  4UI6 A;  5AL3 A;  4L0V A;  5ADT A;  3P0Q A;  4PML A;  3W51 A;  4HLK A;  4HLF A;  4UVZ A;  4KZU A;  4BJC A;  4KRS A;  1KHG A;  3DT7 A;  4PAX A;  4PNM A;  4BU6 A;  3GJW A;  4ZZY A;  4OPX C;  1K3C A;  4UVV A;  4WPT A;  4N3R A;  4GMM A;  4TKG A;  5ECE A;  4OA7 A;  2RF5 A;  4BUF A;  5ADQ A;  4RV6 A;  4HKK A;  5AL2 A;  4TJY A;  4BUS A;  2PY7 X;  3KR7 A;  1KHF A;  5EBT A;  4UI4 A;  5LYH A;  4LI6 A;  1KHB A;  4K4E A;  4L10 A;  4WOU A;  1YGG A;  3DTB A;  3UH2 A;  3GEY A;  4L7P A;  4BUU A;  4BUI A;  4L0I A;  4TK0 A;  1WOK A;  1YVY A;  3KJD A;  3MOF A;  4GV0 A;  4HHY A;  4J21 A;  1YTM A;  4L7U A;  3DT4 A;  4BUX A;  4UVX A;  4W5I A;  3U9Y A;  4BUV A;  4UVW A;  4TJW A;  4L0S A;  4OQA C;  3UH4 A;  4MSK A;  4L09 A;  4UVU A;  1EFY A;  4HYF A;  4KZL A;  4L6Z A;  4R43 A;  4UI7 A;  4PJV A;  4TK5 A;  4UUH A;  4PNN A;  4WIU A;  4TOR A;  4BUA A;  5FH3 A;  2RKA A;  4BFP A;  2PXZ X;  1A26 A;  3L3M A;  4PNR A;  4F0E A;  4L6S A;  4TOS A;  4OX2 A;  2PAW A;  3SE2 A;  3UDD A;  4BUY A;  4M7B A;  2OLQ A;  5C5Q A;  4HKN A;  2QF2 A;  4UW1 A;  4UI8 A;  1PAX A;  4GNP A;  4WL8 A;  4DVI A;  4L7O A;  4OQB C;  4BU9 A;  3GOY A;  2PC9 A;  1YLH A;  4L33 A;  4L7R A;  4UVY A;  5AL4 A;  4L70 A;  4TKF A;  4YW8 A;  5FPG A;  5C5P A;  4BS4 A;  4UI3 A;  4F1Q A;  2OLR A;  5FH0 A;  4GMU A;  2RD6 A;  4BU7 A;  4UVO A;  3MHK A;  2QZY A;  5A00 A;  4BJ9 A;  4L2K A;  4GMW A;  1OEN A;  3SMI A;  3KCZ A;  4N4T A;  4UX4 A;  4UVP A;  4HLG A;  4BJB A;  1J3B A;  4PNL A;  3DT2 A;  4L2F A;  2QEW A;  4YW9 A;  2RKD A;  3KR8 A;  5AKW A;  5ADS A;  2ZCI A;  4UHG A;  4PJT A;  2RK8 A;  4L0B A;  4GV2 A;  4MT9 A;  5ADR A;  4GV4 A;  4K4F A;  1M51 A;  3CE0 A;  4L0T A;  4RCG A;  1XKV A;  3C4H A;  1GS0 A;  3P0P A;  3L3L A;  4HLH A;  4R5W A;  4MSG A;  4TKI A;  4UXB A;  1UK1 A;  5AKU A;  4YWB A;  4BUW A;  2FAH A;  4ZZZ A;  1AYL A;  4LI8 A;  4UFU A;  4BUD A;  3GN7 A;  2PQF A;  2RKE A;  4HLM A;  4PY4 A;  4BUT A;  2X5Y A;  4BU3 A;  2RK7 A;  4F1L A;  4UVS A;  5I67 A;  4UFY A;  3MHJ A;  4HL5 A;  4KZQ A;  3PAX A;  4GNM A;  4PNQ A;  3MOH A;  5FH1 A;  4J22 A;  5FH5 A;  4W6E A;  1OS1 A;  4WPU A;  3UA9 A;  4UI5 A;  1KHE A;  1NHX A;  5DCZ A;  4L32 A;  4YWD A;  5FPF A;  4XHU A;  4GNQ A;  5FH2 A;  4L2G A;  4LI7 A;  4GMZ A;  4BU5 A;  4X52 A;  1UK0 A;  4UVN A;  4GNL A;  4UVT A;  4IUE A;  5ETY A;  3U9H A;  1K3D A;  4UVL A;  1II2 A;  2QF1 A;  4J3L A;  4L7L A;  3P0N A;  4J1Z A;  5AL1 A;  4U6A A;  4HHZ A;  4W5S A;  4L34 A;  4UND A;  2FAF A;  4L31 A;  2PAX A;  4HKI A;  4ZZX A;  5AEH A;  4DQY C;  4PNT A;  4BU8 A;  4GNO A;  4TJU A; 
#chains in the Genus database with same CATH homology
 4GV7 A;  5LXP A;  4AVU A;  4TVJ A;  4BUE A;  2QEY A;  4PNS A;  3MOE A;  4WIE A;  4WPV A;  3SMJ A;  1AQ2 A;  4J3M A;  3C49 A;  5FH4 A;  5C5R A;  5LX6 A;  4HMH A;  5AL5 A;  4AVW A;  2GMV A;  2RCW A;  4I9I A;  3HKV A;  3BLJ A;  3FHB A;  4N4V A;  4R6E A;  4L7N A;  4UI6 A;  5AL3 A;  4L0V A;  5ADT A;  3P0Q A;  4PML A;  3W51 A;  4HLK A;  4HLF A;  4UVZ A;  4KZU A;  4BJC A;  4KRS A;  1KHG A;  3DT7 A;  4PAX A;  4PNM A;  4BU6 A;  3GJW A;  4ZZY A;  4OPX C;  1K3C A;  4UVV A;  4WPT A;  4N3R A;  4GMM A;  4TKG A;  5ECE A;  4OA7 A;  2RF5 A;  4BUF A;  5ADQ A;  4RV6 A;  4HKK A;  5AL2 A;  4TJY A;  4BUS A;  2PY7 X;  3KR7 A;  1KHF A;  5EBT A;  4UI4 A;  5LYH A;  4LI6 A;  1KHB A;  4K4E A;  4L10 A;  4WOU A;  1YGG A;  3DTB A;  3UH2 A;  3GEY A;  4L7P A;  4BUU A;  4BUI A;  4L0I A;  4TK0 A;  1WOK A;  1YVY A;  3KJD A;  3MOF A;  4GV0 A;  4HHY A;  4J21 A;  1YTM A;  4L7U A;  3DT4 A;  4BUX A;  4UVX A;  4W5I A;  3U9Y A;  4BUV A;  4UVW A;  4TJW A;  4L0S A;  4OQA C;  3UH4 A;  4MSK A;  4L09 A;  4UVU A;  1EFY A;  4HYF A;  4KZL A;  4L6Z A;  4R43 A;  4UI7 A;  4PJV A;  4TK5 A;  4UUH A;  4PNN A;  4WIU A;  4TOR A;  4BUA A;  5FH3 A;  2RKA A;  4BFP A;  2PXZ X;  1A26 A;  3L3M A;  4PNR A;  4F0E A;  4L6S A;  4TOS A;  4OX2 A;  2PAW A;  3SE2 A;  3UDD A;  4BUY A;  4M7B A;  2OLQ A;  5C5Q A;  4HKN A;  2QF2 A;  4UW1 A;  4UI8 A;  1PAX A;  4GNP A;  4WL8 A;  4DVI A;  4L7O A;  4OQB C;  4BU9 A;  3GOY A;  2PC9 A;  1YLH A;  4L33 A;  4L7R A;  4UVY A;  5AL4 A;  4L70 A;  4TKF A;  4YW8 A;  5FPG A;  5C5P A;  4BS4 A;  4UI3 A;  4F1Q A;  2OLR A;  5FH0 A;  4GMU A;  2RD6 A;  4BU7 A;  4UVO A;  3MHK A;  2QZY A;  5A00 A;  4BJ9 A;  4L2K A;  4GMW A;  1OEN A;  3SMI A;  3KCZ A;  4N4T A;  4UX4 A;  4UVP A;  4HLG A;  4BJB A;  1J3B A;  4PNL A;  3DT2 A;  4L2F A;  2QEW A;  4YW9 A;  2RKD A;  3KR8 A;  5AKW A;  5ADS A;  2ZCI A;  4UHG A;  4PJT A;  2RK8 A;  4L0B A;  4GV2 A;  4MT9 A;  5ADR A;  4GV4 A;  4K4F A;  1M51 A;  3CE0 A;  4L0T A;  4RCG A;  1XKV A;  3C4H A;  1GS0 A;  3P0P A;  3L3L A;  4HLH A;  4R5W A;  4MSG A;  4TKI A;  4UXB A;  1UK1 A;  5AKU A;  4YWB A;  4BUW A;  2FAH A;  4ZZZ A;  1AYL A;  4LI8 A;  4UFU A;  4BUD A;  3GN7 A;  2PQF A;  2RKE A;  4HLM A;  4PY4 A;  4BUT A;  2X5Y A;  4BU3 A;  2RK7 A;  4F1L A;  4UVS A;  5I67 A;  4UFY A;  3MHJ A;  4HL5 A;  4KZQ A;  3PAX A;  4GNM A;  4PNQ A;  3MOH A;  5FH1 A;  4J22 A;  5FH5 A;  4W6E A;  1OS1 A;  4WPU A;  3UA9 A;  4UI5 A;  1KHE A;  1NHX A;  5DCZ A;  4L32 A;  4YWD A;  5FPF A;  4XHU A;  4GNQ A;  5FH2 A;  4L2G A;  4LI7 A;  4GMZ A;  4BU5 A;  4X52 A;  1UK0 A;  4UVN A;  4GNL A;  4UVT A;  4IUE A;  5ETY A;  3U9H A;  1K3D A;  4UVL A;  1II2 A;  2QF1 A;  4J3L A;  4L7L A;  3P0N A;  4J1Z A;  5AL1 A;  4U6A A;  4HHZ A;  4W5S A;  4L34 A;  4UND A;  2FAF A;  4L31 A;  2PAX A;  4HKI A;  4ZZX A;  5AEH A;  4DQY C;  4PNT A;  4BU8 A;  4GNO A;  4TJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...