4PMLA

Crystal structure of human tankyrase 2 in complex with 3-amino-benzamide.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
199
structure length
198
Chain Sequence
KEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into the binding of PARP inhibitors to the catalytic domain of human tankyrase-2.
pubmed doi rcsb
molecule keywords Tankyrase-2
molecule tags Transferase
source organism Homo sapiens
total genus 66
structure length 198
sequence length 199
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4pmlA00
4PAXA 4BFPA 4UNDA 4X52A 4UVXA 5AL1A 4ZZYA 4BU8A 4KZLA 3P0PA 4UI8A 4LI6A 4N4TA 4PNLA 4L6ZA 3BLJA 4RV6A 4KRSA 4GV4A 5ETYA 3GJWA 4L0BA 4W5SA 5AL5A 3GEYA 4ZZXA 4BU3A 4PJTA 4W6EA 5FPFA 5AL2A 4BUVA 4L32A 4L7LA 4UVTA 4L0SA 4BJBA 4UVOA 3SE2A 4HMHA 4MT9A 4PNTA 4L09A 4IUEA 4J3MA 4F1LA 1PAXA 5AKUA 4UI3A 4HL5A 4M7BA 1UK1A 4L0TA 2PQFA 4L2GA 5LX6A 4BS4A 2X5YA 2PAWA 4N3RA 5AL3A 3SMIA 3UH2A 4L7OA 5A00A 4BUEA 3UH4A 4BUSA 4BU5A 4K4FA 4BUWA 4DVIA 4OPXC 4OQBC 3KR7A 3C49A 3P0NA 4L6SA 5ADSA 3HKVA 3PAXA 4LI7A 4L0IA 4BJCA 3U9HA 4J1ZA 4TKIA 4LI8A 4AVUA 4UVLA 4PNRA 4HLGA 4U6AA 4UHGA 5ECEA 4N4VA 3UA9A 5AEHA 4PNSA 4L7UA 4PNNA 4HLKA 4UI7A 4UVZA 5EBTA 4L0VA 5LXPA 4BUYA 4PMLA 5AKWA 3L3MA 3GOYA 4BUIA 4F0EA 1A26A 4UUHA 4TORA 4UXBA 2PAXA 4L10A 4MSKA 4TVJA 4L7RA 4BU6A 3CE0A 4HKNA 4BUAA 4DQYC 1EFYA 4OA7A 5AL4A 4HYFA 4UI5A 3FHBA 3MHKA 4UVYA 3W51A 4BU9A 4TK5A 3KCZA 4J3LA 4L33A 4HLMA 4UX4A 4L7NA 4KZUA 4UVPA 4TKFA 4GV2A 5DCZA 4R5WA 4TJYA 4MSGA 4UVNA 4UW1A 4J22A 3KR8A 4PNMA 3U9YA 5C5PA 4L70A 4UVUA 4UVSA 4XHUA 5LYHA 3C4HA 2RD6A 3GN7A 4BJ9A 4TKGA 4TOSA 1UK0A 3SMJA 5ADRA 4L2FA 4PNQA 4AVWA 4L31A 4TJUA 1WOKA 4J21A 4TK0A 4K4EA 4GV0A 4PJVA 4W5IA 4BUUA 4GV7A 4PY4A 3KJDA 4L34A 4R6EA 5ADQA 5C5QA 2RF5A 4BU7A 4HKIA 4HHYA 5FPGA 4UFYA 4BUFA 4BUDA 1GS0A 3L3LA 2RCWA 4HKKA 3UDDA 4BUTA 4UVWA 4HHZA 4L2KA 4F1QA 4HLFA 4ZZZA 4KZQA 4UFUA 5C5RA 4I9IA 4HLHA 4UI6A 4OQAC 3MHJA 4BUXA 4UVVA 4UI4A 4TJWA 5ADTA 3P0QA 4L7PA
chains in the Genus database with same CATH superfamily
4PAXA 4BFPA 4UNDA 4X52A 4UVXA 5AL1A 4WL8A 4ZZYA 4BU8A 4KZLA 1K3DA 3P0PA 4LI6A 4N4TA 4PNLA 4L6ZA 3BLJA 4UI8A 2GMVA 2ZCIA 4RV6A 4KRSA 4GV4A 1II2A 3GJWA 4L0BA 4W5SA 5AL5A 3GEYA 5ETYA 4ZZXA 4PJTA 4W6EA 4BU3A 5FH4A 2QEYA 5AL2A 4BUVA 4L32A 2QF2A 4L7LA 4OX2A 4GMZA 4L0SA 4UVTA 4UVOA 3SE2A 4BJBA 4HMHA 4MT9A 4PNTA 4L09A 4IUEA 4J3MA 4F1LA 1PAXA 1KHGA 2PC9A 5AKUA 4UI3A 4WPVA 4HL5A 4M7BA 1UK1A 1YGGA 4L0TA 2PQFA 4L2GA 5LX6A 4BS4A 2X5YA 1YVYA 2PAWA 2OLQA 4N3RA 5AL3A 3SMIA 4GMMA 3UH2A 4L7OA 2PXZX 1M51A 5A00A 4BUEA 3UH4A 4BUSA 4BU5A 4K4FA 4BUWA 4DVIA 4OPXC 4OQBC 2RK8A 3C49A 3KR7A 3P0NA 4L6SA 5ADSA 1OENA 3HKVA 3PAXA 2RKDA 4LI7A 3MOEA 4L0IA 4BJCA 3U9HA 4J1ZA 4TKIA 4LI8A 1KHEA 4AVUA 4UVLA 4PNRA 4HLGA 4U6AA 4UHGA 5ECEA 4N4VA 5FH2A 5FH5A 4WIEA 1YLHA 5AEHA 3UA9A 4PNSA 1XKVA 4L7UA 4PNNA 4GNLA 4HLKA 4UI7A 4UVZA 5EBTA 1KHBA 3MOHA 4L0VA 4PMLA 4BUYA 4RCGA 5LXPA 5AKWA 3DT4A 3L3MA 3GOYA 4GNQA 4BUIA 4F0EA 1A26A 4UUHA 4TORA 4UXBA 2PAXA 4L10A 4MSKA 4TVJA 4L7RA 4BU6A 3CE0A 4HKNA 4BUAA 4DQYC 1EFYA 4OA7A 5AL4A 2FAHA 4HYFA 4UI5A 3FHBA 3MHKA 4UVYA 3W51A 4GNOA 4BU9A 4TK5A 3KCZA 4J3LA 4L33A 4HLMA 3DT7A 4UX4A 4YW8A 4L7NA 4KZUA 4UVPA 5FH0A 2PY7X 4TKFA 4GV2A 5DCZA 4R5WA 4GMWA 5FH1A 4TJYA 4WIUA 2QEWA 2RK7A 5I67A 4MSGA 4UVNA 4UW1A 4J22A 3KR8A 4YWBA 4PNMA 2QZYA 3U9YA 5C5PA 4L70A 4UVUA 4GNPA 4UVSA 4XHUA 5LYHA 1NHXA 3C4HA 4YW9A 2RD6A 1KHFA 3GN7A 4BJ9A 4TKGA 1J3BA 4WPTA 4TOSA 1UK0A 3SMJA 5ADRA 4L2FA 4PNQA 4AVWA 4L31A 4TJUA 1WOKA 4J21A 4TK0A 4K4EA 1K3CA 4GV0A 4PJVA 4W5IA 4BUUA 4GV7A 5FH3A 4PY4A 3KJDA 2OLRA 1YTMA 4L34A 4R6EA 4WOUA 5C5QA 5ADQA 2RF5A 4BU7A 4HKIA 4HHYA 5FPGA 5FPFA 4UFYA 4BUFA 4GNMA 4WPUA 4BUDA 1GS0A 3L3LA 2RCWA 4HKKA 1AQ2A 3UDDA 2RKEA 4BUTA 4YWDA 1AYLA 3DTBA 4UVWA 4HHZA 4L2KA 4F1QA 4HLFA 4ZZZA 4KZQA 4UFUA 2RKAA 5C5RA 2QF1A 4I9IA 4HLHA 4UI6A 4OQAC 3MHJA 3MOFA 4BUXA 4UVVA 2FAFA 1OS1A 4UI4A 4TJWA 3DT2A 5ADTA 3P0QA 4L7PA 4GMUA 4R43A
chains in the Genus database with same CATH topology
4PAXA 4BFPA 4UNDA 4X52A 4UVXA 5AL1A 4WL8A 4ZZYA 4BU8A 4KZLA 1K3DA 3P0PA 4LI6A 4N4TA 4PNLA 4L6ZA 3BLJA 4UI8A 2GMVA 2ZCIA 4RV6A 4KRSA 4GV4A 1II2A 3GJWA 4L0BA 4W5SA 5AL5A 3GEYA 5ETYA 4ZZXA 4PJTA 4W6EA 4BU3A 5FH4A 2QEYA 5AL2A 4BUVA 4L32A 2QF2A 4L7LA 4OX2A 4GMZA 4L0SA 4UVTA 4UVOA 3SE2A 4BJBA 4HMHA 4MT9A 4PNTA 4L09A 4IUEA 4J3MA 4F1LA 1PAXA 1KHGA 2PC9A 5AKUA 4UI3A 4WPVA 4HL5A 4M7BA 1UK1A 1YGGA 4L0TA 2PQFA 4L2GA 5LX6A 4BS4A 2X5YA 1YVYA 2PAWA 2OLQA 4N3RA 5AL3A 3SMIA 4GMMA 3UH2A 4L7OA 2PXZX 1M51A 5A00A 4BUEA 3UH4A 4BUSA 4BU5A 4K4FA 4BUWA 4DVIA 4OPXC 4OQBC 2RK8A 3C49A 3KR7A 3P0NA 4L6SA 5ADSA 1OENA 3HKVA 3PAXA 2RKDA 4LI7A 3MOEA 4L0IA 4BJCA 3U9HA 4J1ZA 4TKIA 4LI8A 1KHEA 4AVUA 4UVLA 4PNRA 4HLGA 4U6AA 4UHGA 5ECEA 4N4VA 5FH2A 5FH5A 4WIEA 1YLHA 5AEHA 3UA9A 4PNSA 1XKVA 4L7UA 4PNNA 4GNLA 4HLKA 4UI7A 4UVZA 5EBTA 1KHBA 3MOHA 4L0VA 4PMLA 4BUYA 4RCGA 5LXPA 5AKWA 3DT4A 3L3MA 3GOYA 4GNQA 4BUIA 4F0EA 1A26A 4UUHA 4TORA 4UXBA 2PAXA 4L10A 4MSKA 4TVJA 4L7RA 4BU6A 3CE0A 4HKNA 4BUAA 4DQYC 1EFYA 4OA7A 5AL4A 2FAHA 4HYFA 4UI5A 3FHBA 3MHKA 4UVYA 3W51A 4GNOA 4BU9A 4TK5A 3KCZA 4J3LA 4L33A 4HLMA 3DT7A 4UX4A 4YW8A 4L7NA 4KZUA 4UVPA 5FH0A 2PY7X 4TKFA 4GV2A 5DCZA 4R5WA 4GMWA 5FH1A 4TJYA 4WIUA 2QEWA 2RK7A 5I67A 4MSGA 4UVNA 4UW1A 4J22A 3KR8A 4YWBA 4PNMA 2QZYA 3U9YA 5C5PA 4L70A 4UVUA 4GNPA 4UVSA 4XHUA 5LYHA 1NHXA 3C4HA 4YW9A 2RD6A 1KHFA 3GN7A 4BJ9A 4TKGA 1J3BA 4WPTA 4TOSA 1UK0A 3SMJA 5ADRA 4L2FA 4PNQA 4AVWA 4L31A 4TJUA 1WOKA 4J21A 4TK0A 4K4EA 1K3CA 4GV0A 4PJVA 4W5IA 4BUUA 4GV7A 5FH3A 4PY4A 3KJDA 2OLRA 1YTMA 4L34A 4R6EA 4WOUA 5C5QA 5ADQA 2RF5A 4BU7A 4HKIA 4HHYA 5FPGA 5FPFA 4UFYA 4BUFA 4GNMA 4WPUA 4BUDA 1GS0A 3L3LA 2RCWA 4HKKA 1AQ2A 3UDDA 2RKEA 4BUTA 4YWDA 1AYLA 3DTBA 4UVWA 4HHZA 4L2KA 4F1QA 4HLFA 4ZZZA 4KZQA 4UFUA 2RKAA 5C5RA 2QF1A 4I9IA 4HLHA 4UI6A 4OQAC 3MHJA 3MOFA 4BUXA 4UVVA 2FAFA 1OS1A 4UI4A 4TJWA 3DT2A 5ADTA 3P0QA 4L7PA 4GMUA 4R43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PAX A;  4BFP A;  4UND A;  4X52 A;  4UVX A;  5AL1 A;  4ZZY A;  4BU8 A;  4KZL A;  3P0P A;  4UI8 A;  4LI6 A;  4N4T A;  4PNL A;  4L6Z A;  3BLJ A;  4RV6 A;  4KRS A;  4GV4 A;  5ETY A;  3GJW A;  4L0B A;  4W5S A;  5AL5 A;  3GEY A;  4ZZX A;  4BU3 A;  4PJT A;  4W6E A;  5FPF A;  5AL2 A;  4BUV A;  4L32 A;  4L7L A;  4UVT A;  4L0S A;  4BJB A;  4UVO A;  3SE2 A;  4HMH A;  4MT9 A;  4PNT A;  4L09 A;  4IUE A;  4J3M A;  4F1L A;  1PAX A;  5AKU A;  4UI3 A;  4HL5 A;  4M7B A;  1UK1 A;  4L0T A;  2PQF A;  4L2G A;  5LX6 A;  4BS4 A;  2X5Y A;  2PAW A;  4N3R A;  5AL3 A;  3SMI A;  3UH2 A;  4L7O A;  5A00 A;  4BUE A;  3UH4 A;  4BUS A;  4BU5 A;  4K4F A;  4BUW A;  4DVI A;  4OPX C;  4OQB C;  3KR7 A;  3C49 A;  3P0N A;  4L6S A;  5ADS A;  3HKV A;  3PAX A;  4LI7 A;  4L0I A;  4BJC A;  3U9H A;  4J1Z A;  4TKI A;  4LI8 A;  4AVU A;  4UVL A;  4PNR A;  4HLG A;  4U6A A;  4UHG A;  5ECE A;  4N4V A;  3UA9 A;  5AEH A;  4PNS A;  4L7U A;  4PNN A;  4HLK A;  4UI7 A;  4UVZ A;  5EBT A;  4L0V A;  5LXP A;  4BUY A;  4PML A;  5AKW A;  3L3M A;  3GOY A;  4BUI A;  4F0E A;  1A26 A;  4UUH A;  4TOR A;  4UXB A;  2PAX A;  4L10 A;  4MSK A;  4TVJ A;  4L7R A;  4BU6 A;  3CE0 A;  4HKN A;  4BUA A;  4DQY C;  1EFY A;  4OA7 A;  5AL4 A;  4HYF A;  4UI5 A;  3FHB A;  3MHK A;  4UVY A;  3W51 A;  4BU9 A;  4TK5 A;  3KCZ A;  4J3L A;  4L33 A;  4HLM A;  4UX4 A;  4L7N A;  4KZU A;  4UVP A;  4TKF A;  4GV2 A;  5DCZ A;  4R5W A;  4TJY A;  4MSG A;  4UVN A;  4UW1 A;  4J22 A;  3KR8 A;  4PNM A;  3U9Y A;  5C5P A;  4L70 A;  4UVU A;  4UVS A;  4XHU A;  5LYH A;  3C4H A;  2RD6 A;  3GN7 A;  4BJ9 A;  4TKG A;  4TOS A;  1UK0 A;  3SMJ A;  5ADR A;  4L2F A;  4PNQ A;  4AVW A;  4L31 A;  4TJU A;  1WOK A;  4J21 A;  4TK0 A;  4K4E A;  4GV0 A;  4PJV A;  4W5I A;  4BUU A;  4GV7 A;  4PY4 A;  3KJD A;  4L34 A;  4R6E A;  5ADQ A;  5C5Q A;  2RF5 A;  4BU7 A;  4HKI A;  4HHY A;  5FPG A;  4UFY A;  4BUF A;  4BUD A;  1GS0 A;  3L3L A;  2RCW A;  4HKK A;  3UDD A;  4BUT A;  4UVW A;  4HHZ A;  4L2K A;  4F1Q A;  4HLF A;  4ZZZ A;  4KZQ A;  4UFU A;  5C5R A;  4I9I A;  4HLH A;  4UI6 A;  4OQA C;  3MHJ A;  4BUX A;  4UVV A;  4UI4 A;  4TJW A;  5ADT A;  3P0Q A;  4L7P A; 
#chains in the Genus database with same CATH topology
 4PAX A;  4BFP A;  4UND A;  4X52 A;  4UVX A;  5AL1 A;  4WL8 A;  4ZZY A;  4BU8 A;  4KZL A;  1K3D A;  3P0P A;  4LI6 A;  4N4T A;  4PNL A;  4L6Z A;  3BLJ A;  4UI8 A;  2GMV A;  2ZCI A;  4RV6 A;  4KRS A;  4GV4 A;  1II2 A;  3GJW A;  4L0B A;  4W5S A;  5AL5 A;  3GEY A;  5ETY A;  4ZZX A;  4PJT A;  4W6E A;  4BU3 A;  5FH4 A;  2QEY A;  5AL2 A;  4BUV A;  4L32 A;  2QF2 A;  4L7L A;  4OX2 A;  4GMZ A;  4L0S A;  4UVT A;  4UVO A;  3SE2 A;  4BJB A;  4HMH A;  4MT9 A;  4PNT A;  4L09 A;  4IUE A;  4J3M A;  4F1L A;  1PAX A;  1KHG A;  2PC9 A;  5AKU A;  4UI3 A;  4WPV A;  4HL5 A;  4M7B A;  1UK1 A;  1YGG A;  4L0T A;  2PQF A;  4L2G A;  5LX6 A;  4BS4 A;  2X5Y A;  1YVY A;  2PAW A;  2OLQ A;  4N3R A;  5AL3 A;  3SMI A;  4GMM A;  3UH2 A;  4L7O A;  2PXZ X;  1M51 A;  5A00 A;  4BUE A;  3UH4 A;  4BUS A;  4BU5 A;  4K4F A;  4BUW A;  4DVI A;  4OPX C;  4OQB C;  2RK8 A;  3C49 A;  3KR7 A;  3P0N A;  4L6S A;  5ADS A;  1OEN A;  3HKV A;  3PAX A;  2RKD A;  4LI7 A;  3MOE A;  4L0I A;  4BJC A;  3U9H A;  4J1Z A;  4TKI A;  4LI8 A;  1KHE A;  4AVU A;  4UVL A;  4PNR A;  4HLG A;  4U6A A;  4UHG A;  5ECE A;  4N4V A;  5FH2 A;  5FH5 A;  4WIE A;  1YLH A;  5AEH A;  3UA9 A;  4PNS A;  1XKV A;  4L7U A;  4PNN A;  4GNL A;  4HLK A;  4UI7 A;  4UVZ A;  5EBT A;  1KHB A;  3MOH A;  4L0V A;  4PML A;  4BUY A;  4RCG A;  5LXP A;  5AKW A;  3DT4 A;  3L3M A;  3GOY A;  4GNQ A;  4BUI A;  4F0E A;  1A26 A;  4UUH A;  4TOR A;  4UXB A;  2PAX A;  4L10 A;  4MSK A;  4TVJ A;  4L7R A;  4BU6 A;  3CE0 A;  4HKN A;  4BUA A;  4DQY C;  1EFY A;  4OA7 A;  5AL4 A;  2FAH A;  4HYF A;  4UI5 A;  3FHB A;  3MHK A;  4UVY A;  3W51 A;  4GNO A;  4BU9 A;  4TK5 A;  3KCZ A;  4J3L A;  4L33 A;  4HLM A;  3DT7 A;  4UX4 A;  4YW8 A;  4L7N A;  4KZU A;  4UVP A;  5FH0 A;  2PY7 X;  4TKF A;  4GV2 A;  5DCZ A;  4R5W A;  4GMW A;  5FH1 A;  4TJY A;  4WIU A;  2QEW A;  2RK7 A;  5I67 A;  4MSG A;  4UVN A;  4UW1 A;  4J22 A;  3KR8 A;  4YWB A;  4PNM A;  2QZY A;  3U9Y A;  5C5P A;  4L70 A;  4UVU A;  4GNP A;  4UVS A;  4XHU A;  5LYH A;  1NHX A;  3C4H A;  4YW9 A;  2RD6 A;  1KHF A;  3GN7 A;  4BJ9 A;  4TKG A;  1J3B A;  4WPT A;  4TOS A;  1UK0 A;  3SMJ A;  5ADR A;  4L2F A;  4PNQ A;  4AVW A;  4L31 A;  4TJU A;  1WOK A;  4J21 A;  4TK0 A;  4K4E A;  1K3C A;  4GV0 A;  4PJV A;  4W5I A;  4BUU A;  4GV7 A;  5FH3 A;  4PY4 A;  3KJD A;  2OLR A;  1YTM A;  4L34 A;  4R6E A;  4WOU A;  5C5Q A;  5ADQ A;  2RF5 A;  4BU7 A;  4HKI A;  4HHY A;  5FPG A;  5FPF A;  4UFY A;  4BUF A;  4GNM A;  4WPU A;  4BUD A;  1GS0 A;  3L3L A;  2RCW A;  4HKK A;  1AQ2 A;  3UDD A;  2RKE A;  4BUT A;  4YWD A;  1AYL A;  3DTB A;  4UVW A;  4HHZ A;  4L2K A;  4F1Q A;  4HLF A;  4ZZZ A;  4KZQ A;  4UFU A;  2RKA A;  5C5R A;  2QF1 A;  4I9I A;  4HLH A;  4UI6 A;  4OQA C;  3MHJ A;  3MOF A;  4BUX A;  4UVV A;  2FAF A;  1OS1 A;  4UI4 A;  4TJW A;  3DT2 A;  5ADT A;  3P0Q A;  4L7P A;  4GMU A;  4R43 A; 
#chains in the Genus database with same CATH homology
 4PAX A;  4BFP A;  4UND A;  4X52 A;  4UVX A;  5AL1 A;  4WL8 A;  4ZZY A;  4BU8 A;  4KZL A;  1K3D A;  3P0P A;  4LI6 A;  4N4T A;  4PNL A;  4L6Z A;  3BLJ A;  4UI8 A;  2GMV A;  2ZCI A;  4RV6 A;  4KRS A;  4GV4 A;  1II2 A;  3GJW A;  4L0B A;  4W5S A;  5AL5 A;  3GEY A;  5ETY A;  4ZZX A;  4PJT A;  4W6E A;  4BU3 A;  5FH4 A;  2QEY A;  5AL2 A;  4BUV A;  4L32 A;  2QF2 A;  4L7L A;  4OX2 A;  4GMZ A;  4L0S A;  4UVT A;  4UVO A;  3SE2 A;  4BJB A;  4HMH A;  4MT9 A;  4PNT A;  4L09 A;  4IUE A;  4J3M A;  4F1L A;  1PAX A;  1KHG A;  2PC9 A;  5AKU A;  4UI3 A;  4WPV A;  4HL5 A;  4M7B A;  1UK1 A;  1YGG A;  4L0T A;  2PQF A;  4L2G A;  5LX6 A;  4BS4 A;  2X5Y A;  1YVY A;  2PAW A;  2OLQ A;  4N3R A;  5AL3 A;  3SMI A;  4GMM A;  3UH2 A;  4L7O A;  2PXZ X;  1M51 A;  5A00 A;  4BUE A;  3UH4 A;  4BUS A;  4BU5 A;  4K4F A;  4BUW A;  4DVI A;  4OPX C;  4OQB C;  2RK8 A;  3C49 A;  3KR7 A;  3P0N A;  4L6S A;  5ADS A;  1OEN A;  3HKV A;  3PAX A;  2RKD A;  4LI7 A;  3MOE A;  4L0I A;  4BJC A;  3U9H A;  4J1Z A;  4TKI A;  4LI8 A;  1KHE A;  4AVU A;  4UVL A;  4PNR A;  4HLG A;  4U6A A;  4UHG A;  5ECE A;  4N4V A;  5FH2 A;  5FH5 A;  4WIE A;  1YLH A;  5AEH A;  3UA9 A;  4PNS A;  1XKV A;  4L7U A;  4PNN A;  4GNL A;  4HLK A;  4UI7 A;  4UVZ A;  5EBT A;  1KHB A;  3MOH A;  4L0V A;  4PML A;  4BUY A;  4RCG A;  5LXP A;  5AKW A;  3DT4 A;  3L3M A;  3GOY A;  4GNQ A;  4BUI A;  4F0E A;  1A26 A;  4UUH A;  4TOR A;  4UXB A;  2PAX A;  4L10 A;  4MSK A;  4TVJ A;  4L7R A;  4BU6 A;  3CE0 A;  4HKN A;  4BUA A;  4DQY C;  1EFY A;  4OA7 A;  5AL4 A;  2FAH A;  4HYF A;  4UI5 A;  3FHB A;  3MHK A;  4UVY A;  3W51 A;  4GNO A;  4BU9 A;  4TK5 A;  3KCZ A;  4J3L A;  4L33 A;  4HLM A;  3DT7 A;  4UX4 A;  4YW8 A;  4L7N A;  4KZU A;  4UVP A;  5FH0 A;  2PY7 X;  4TKF A;  4GV2 A;  5DCZ A;  4R5W A;  4GMW A;  5FH1 A;  4TJY A;  4WIU A;  2QEW A;  2RK7 A;  5I67 A;  4MSG A;  4UVN A;  4UW1 A;  4J22 A;  3KR8 A;  4YWB A;  4PNM A;  2QZY A;  3U9Y A;  5C5P A;  4L70 A;  4UVU A;  4GNP A;  4UVS A;  4XHU A;  5LYH A;  1NHX A;  3C4H A;  4YW9 A;  2RD6 A;  1KHF A;  3GN7 A;  4BJ9 A;  4TKG A;  1J3B A;  4WPT A;  4TOS A;  1UK0 A;  3SMJ A;  5ADR A;  4L2F A;  4PNQ A;  4AVW A;  4L31 A;  4TJU A;  1WOK A;  4J21 A;  4TK0 A;  4K4E A;  1K3C A;  4GV0 A;  4PJV A;  4W5I A;  4BUU A;  4GV7 A;  5FH3 A;  4PY4 A;  3KJD A;  2OLR A;  1YTM A;  4L34 A;  4R6E A;  4WOU A;  5C5Q A;  5ADQ A;  2RF5 A;  4BU7 A;  4HKI A;  4HHY A;  5FPG A;  5FPF A;  4UFY A;  4BUF A;  4GNM A;  4WPU A;  4BUD A;  1GS0 A;  3L3L A;  2RCW A;  4HKK A;  1AQ2 A;  3UDD A;  2RKE A;  4BUT A;  4YWD A;  1AYL A;  3DTB A;  4UVW A;  4HHZ A;  4L2K A;  4F1Q A;  4HLF A;  4ZZZ A;  4KZQ A;  4UFU A;  2RKA A;  5C5R A;  2QF1 A;  4I9I A;  4HLH A;  4UI6 A;  4OQA C;  3MHJ A;  3MOF A;  4BUX A;  4UVV A;  2FAF A;  1OS1 A;  4UI4 A;  4TJW A;  3DT2 A;  5ADT A;  3P0Q A;  4L7P A;  4GMU A;  4R43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...