4TK5A

Crystal structure of human tankyrase 2 in complex with eb47.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
201
structure length
201
Chain Sequence
PDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into the binding of PARP inhibitors to the catalytic domain of human tankyrase-2.
pubmed doi rcsb
molecule keywords Tankyrase-2
molecule tags Transferase
source organism Homo sapiens
total genus 64
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4tk5A00
4BUXA 4UI7A 5LX6A 4HLFA 4LI8A 4L7UA 4L2GA 4UNDA 4W5IA 2PAWA 4HLMA 4F1LA 4L2KA 4LI7A 4J1ZA 3UH4A 4MT9A 4BU9A 4M7BA 3MHKA 4L09A 4BU6A 4HYFA 4L34A 3GN7A 3P0PA 4PAXA 3C4HA 4TORA 5FPFA 4PJTA 5AL1A 4TVJA 4OQBC 4UI3A 4TKGA 4TK0A 4UUHA 1UK1A 3GOYA 3SE2A 4BUYA 3UH2A 5LYHA 3P0QA 4BUFA 4TKFA 4HKIA 4MSKA 4UHGA 4UVWA 3C49A 4PNLA 4UVZA 4BUEA 4HLKA 4ZZYA 5ADRA 4X52A 4OA7A 5EBTA 4MSGA 3UDDA 5ECEA 1GS0A 2PAXA 4KRSA 3FHBA 4PNTA 1PAXA 3HKVA 4PNNA 5AL3A 4BJBA 4UFYA 4PY4A 4UVTA 5ADTA 4GV2A 5C5QA 4OQAC 4BS4A 5ADQA 4KZLA 1EFYA 4N4TA 4UVLA 4UW1A 4L0IA 4L7RA 4PNQA 4UVNA 4UFUA 4HKKA 3BLJA 3PAXA 4GV7A 4L7NA 4UI5A 5C5PA 4AVWA 4BUTA 4L6SA 4BUVA 4BJ9A 4ZZXA 3KR7A 4TOSA 4UI6A 5AL5A 5ETYA 5C5RA 4HMHA 1UK0A 4TJYA 4L7PA 4XHUA 5DCZA 4BU7A 4HL5A 2RD6A 4L7LA 4UI4A 5AEHA 5AL4A 5ADSA 3KR8A 4BU5A 4HHZA 4HHYA 4ZZZA 3P0NA 4L32A 4N4VA 4R6EA 4L0VA 4J21A 4L0TA 3GEYA 4K4EA 4PMLA 4BUAA 3MHJA 4PNRA 5A00A 3W51A 4TKIA 4BUUA 4LI6A 4GV0A 4PJVA 2RF5A 4UVSA 1WOKA 4L0SA 4L7OA 4BUDA 4DQYC 4L6ZA 4N3RA 3SMJA 4J3LA 4TK5A 4BUSA 4OPXC 4DVIA 4UI8A 5AKUA 4R5WA 4KZQA 5AKWA 4BUWA 4UVVA 4BU3A 4F0EA 4BFPA 3SMIA 4BU8A 4HKNA 4UVUA 3KCZA 4UVXA 5FPGA 4IUEA 4L70A 4U6AA 4GV4A 3CE0A 4L31A 4HLGA 4UX4A 4KZUA 3U9YA 2PQFA 4UXBA 4K4FA 2X5YA 4L2FA 4UVPA 4AVUA 1A26A 3UA9A 3U9HA 4L0BA 3KJDA 2RCWA 3L3LA 3L3MA 5LXPA 4UVOA 4I9IA 4UVYA 4HLHA 4RV6A 4L33A 4PNSA 4TJWA 5AL2A 4J3MA 4J22A 4PNMA 4BJCA 4F1QA 4W6EA 3GJWA 4W5SA 4L10A 4TJUA 4BUIA
chains in the Genus database with same CATH superfamily
4BUXA 4UI7A 5FH5A 1KHFA 2QF2A 5LX6A 4HLFA 3MOFA 4L7UA 4LI8A 4L2GA 4GMMA 4YW8A 4UNDA 4W5IA 2PAWA 4HLMA 4F1LA 4L2KA 4GNMA 4LI7A 4J1ZA 3UH4A 4MT9A 4BU9A 4M7BA 3MHKA 4L09A 3DT4A 4HYFA 4L34A 3GN7A 3P0PA 4PAXA 3C4HA 4TORA 4BU6A 4PJTA 5AL1A 4TVJA 4OQBC 4UI3A 4TKGA 4TK0A 4UUHA 1UK1A 3GOYA 3SE2A 4BUYA 3UH2A 2RKAA 1YLHA 3P0QA 4BUFA 5LYHA 1YTMA 1KHGA 2PXZX 4HKIA 4TKFA 1YGGA 5FH2A 4MSKA 4UHGA 3DT7A 3C49A 1KHBA 2RK8A 4PNLA 4HLKA 4UVWA 4UVZA 5C5RA 4BUEA 4GNQA 4ZZYA 5ADRA 2OLQA 4X52A 4OA7A 5EBTA 4MSGA 3UDDA 5ECEA 1GS0A 2PAXA 4KRSA 2FAHA 3DT2A 3FHBA 4RCGA 4WIUA 4PNTA 1PAXA 2RKEA 3HKVA 4R43A 2FAFA 4PNNA 5AL3A 4BJBA 4UFYA 1M51A 4PY4A 4UVTA 5ADTA 4GV2A 5C5QA 4OQAC 4BS4A 2PC9A 4WIEA 5ADQA 1KHEA 1EFYA 4KZLA 4YW9A 4WPVA 4N4TA 4UVLA 4UW1A 4L0IA 4L7RA 4PNQA 4GMWA 4UVNA 4UFUA 4HKKA 3BLJA 4GMUA 3PAXA 1OENA 4GV7A 4L7NA 4UI5A 5C5PA 4AVWA 4BUTA 4L6SA 4BUVA 4GNLA 4BJ9A 4ZZXA 3KR7A 1K3CA 2RKDA 2ZCIA 4GMZA 2OLRA 4TOSA 4UI6A 4HMHA 1UK0A 4TJYA 4L7PA 4XHUA 5DCZA 5ETYA 4HL5A 2RD6A 4BU7A 4L7LA 4UI4A 5AEHA 5AL4A 4GNOA 1AQ2A 5ADSA 3KR8A 4GNPA 2QZYA 4BU5A 1II2A 4HHYA 4HHZA 4ZZZA 3P0NA 4L32A 5FPFA 4N4VA 4R6EA 3DTBA 4L0VA 4J21A 4L0TA 4WPUA 3GEYA 4K4EA 4PMLA 4BUAA 3MHJA 1XKVA 4PNRA 5A00A 4TKIA 3W51A 4BUUA 4LI6A 4GV0A 2QEWA 4PJVA 2RF5A 4UVSA 1WOKA 4L0SA 4L7OA 4BUDA 4DQYC 4L6ZA 4N3RA 3SMJA 5AL5A 4J3LA 4TK5A 4BUSA 4OPXC 4DVIA 4UI8A 4YWDA 1J3BA 5AKUA 4R5WA 4KZQA 4WPTA 1OS1A 4UVVA 5AKWA 4BUWA 4BU3A 3MOHA 2PY7X 4F0EA 4BFPA 3SMIA 4WOUA 4BU8A 4HKNA 4OX2A 4UVUA 3KCZA 3MOEA 4UVXA 5FPGA 4IUEA 4L70A 4U6AA 4GV4A 3CE0A 4L31A 4HLGA 1AYLA 4UX4A 1K3DA 4KZUA 2PQFA 5FH1A 3U9YA 4UXBA 4K4FA 5FH0A 2X5YA 4L2FA 4UVPA 4AVUA 5I67A 1A26A 3UA9A 3U9HA 4L0BA 3KJDA 2RCWA 3L3LA 3L3MA 5LXPA 4UVOA 4I9IA 4UVYA 4HLHA 4RV6A 2QEYA 4WL8A 2RK7A 5FH3A 4L33A 1NHXA 4YWBA 4PNSA 4TJWA 5AL2A 4J3MA 2QF1A 4J22A 4PNMA 1YVYA 4BJCA 4W6EA 4F1QA 3GJWA 4W5SA 2GMVA 4L10A 4TJUA 5FH4A 4BUIA
chains in the Genus database with same CATH topology
4BUXA 4UI7A 5FH5A 1KHFA 2QF2A 5LX6A 4HLFA 3MOFA 4L7UA 4LI8A 4L2GA 4GMMA 4YW8A 4UNDA 4W5IA 2PAWA 4HLMA 4F1LA 4L2KA 4GNMA 4LI7A 4J1ZA 3UH4A 4MT9A 4BU9A 4M7BA 3MHKA 4L09A 3DT4A 4HYFA 4L34A 3GN7A 3P0PA 4PAXA 3C4HA 4TORA 4BU6A 4PJTA 5AL1A 4TVJA 4OQBC 4UI3A 4TKGA 4TK0A 4UUHA 1UK1A 3GOYA 3SE2A 4BUYA 3UH2A 2RKAA 1YLHA 3P0QA 4BUFA 5LYHA 1YTMA 1KHGA 2PXZX 4HKIA 4TKFA 1YGGA 5FH2A 4MSKA 4UHGA 3DT7A 3C49A 1KHBA 2RK8A 4PNLA 4HLKA 4UVWA 4UVZA 5C5RA 4BUEA 4GNQA 4ZZYA 5ADRA 2OLQA 4X52A 4OA7A 5EBTA 4MSGA 3UDDA 5ECEA 1GS0A 2PAXA 4KRSA 2FAHA 3DT2A 3FHBA 4RCGA 4WIUA 4PNTA 1PAXA 2RKEA 3HKVA 4R43A 2FAFA 4PNNA 5AL3A 4BJBA 4UFYA 1M51A 4PY4A 4UVTA 5ADTA 4GV2A 5C5QA 4OQAC 4BS4A 2PC9A 4WIEA 5ADQA 1KHEA 1EFYA 4KZLA 4YW9A 4WPVA 4N4TA 4UVLA 4UW1A 4L0IA 4L7RA 4PNQA 4GMWA 4UVNA 4UFUA 4HKKA 3BLJA 4GMUA 3PAXA 1OENA 4GV7A 4L7NA 4UI5A 5C5PA 4AVWA 4BUTA 4L6SA 4BUVA 4GNLA 4BJ9A 4ZZXA 3KR7A 1K3CA 2RKDA 2ZCIA 4GMZA 2OLRA 4TOSA 4UI6A 4HMHA 1UK0A 4TJYA 4L7PA 4XHUA 5DCZA 5ETYA 4HL5A 2RD6A 4BU7A 4L7LA 4UI4A 5AEHA 5AL4A 4GNOA 1AQ2A 5ADSA 3KR8A 4GNPA 2QZYA 4BU5A 1II2A 4HHYA 4HHZA 4ZZZA 3P0NA 4L32A 5FPFA 4N4VA 4R6EA 3DTBA 4L0VA 4J21A 4L0TA 4WPUA 3GEYA 4K4EA 4PMLA 4BUAA 3MHJA 1XKVA 4PNRA 5A00A 4TKIA 3W51A 4BUUA 4LI6A 4GV0A 2QEWA 4PJVA 2RF5A 4UVSA 1WOKA 4L0SA 4L7OA 4BUDA 4DQYC 4L6ZA 4N3RA 3SMJA 5AL5A 4J3LA 4TK5A 4BUSA 4OPXC 4DVIA 4UI8A 4YWDA 1J3BA 5AKUA 4R5WA 4KZQA 4WPTA 1OS1A 4UVVA 5AKWA 4BUWA 4BU3A 3MOHA 2PY7X 4F0EA 4BFPA 3SMIA 4WOUA 4BU8A 4HKNA 4OX2A 4UVUA 3KCZA 3MOEA 4UVXA 5FPGA 4IUEA 4L70A 4U6AA 4GV4A 3CE0A 4L31A 4HLGA 1AYLA 4UX4A 1K3DA 4KZUA 2PQFA 5FH1A 3U9YA 4UXBA 4K4FA 5FH0A 2X5YA 4L2FA 4UVPA 4AVUA 5I67A 1A26A 3UA9A 3U9HA 4L0BA 3KJDA 2RCWA 3L3LA 3L3MA 5LXPA 4UVOA 4I9IA 4UVYA 4HLHA 4RV6A 2QEYA 4WL8A 2RK7A 5FH3A 4L33A 1NHXA 4YWBA 4PNSA 4TJWA 5AL2A 4J3MA 2QF1A 4J22A 4PNMA 1YVYA 4BJCA 4W6EA 4F1QA 3GJWA 4W5SA 2GMVA 4L10A 4TJUA 5FH4A 4BUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BUX A;  4UI7 A;  5LX6 A;  4HLF A;  4LI8 A;  4L7U A;  4L2G A;  4UND A;  4W5I A;  2PAW A;  4HLM A;  4F1L A;  4L2K A;  4LI7 A;  4J1Z A;  3UH4 A;  4MT9 A;  4BU9 A;  4M7B A;  3MHK A;  4L09 A;  4BU6 A;  4HYF A;  4L34 A;  3GN7 A;  3P0P A;  4PAX A;  3C4H A;  4TOR A;  5FPF A;  4PJT A;  5AL1 A;  4TVJ A;  4OQB C;  4UI3 A;  4TKG A;  4TK0 A;  4UUH A;  1UK1 A;  3GOY A;  3SE2 A;  4BUY A;  3UH2 A;  5LYH A;  3P0Q A;  4BUF A;  4TKF A;  4HKI A;  4MSK A;  4UHG A;  4UVW A;  3C49 A;  4PNL A;  4UVZ A;  4BUE A;  4HLK A;  4ZZY A;  5ADR A;  4X52 A;  4OA7 A;  5EBT A;  4MSG A;  3UDD A;  5ECE A;  1GS0 A;  2PAX A;  4KRS A;  3FHB A;  4PNT A;  1PAX A;  3HKV A;  4PNN A;  5AL3 A;  4BJB A;  4UFY A;  4PY4 A;  4UVT A;  5ADT A;  4GV2 A;  5C5Q A;  4OQA C;  4BS4 A;  5ADQ A;  4KZL A;  1EFY A;  4N4T A;  4UVL A;  4UW1 A;  4L0I A;  4L7R A;  4PNQ A;  4UVN A;  4UFU A;  4HKK A;  3BLJ A;  3PAX A;  4GV7 A;  4L7N A;  4UI5 A;  5C5P A;  4AVW A;  4BUT A;  4L6S A;  4BUV A;  4BJ9 A;  4ZZX A;  3KR7 A;  4TOS A;  4UI6 A;  5AL5 A;  5ETY A;  5C5R A;  4HMH A;  1UK0 A;  4TJY A;  4L7P A;  4XHU A;  5DCZ A;  4BU7 A;  4HL5 A;  2RD6 A;  4L7L A;  4UI4 A;  5AEH A;  5AL4 A;  5ADS A;  3KR8 A;  4BU5 A;  4HHZ A;  4HHY A;  4ZZZ A;  3P0N A;  4L32 A;  4N4V A;  4R6E A;  4L0V A;  4J21 A;  4L0T A;  3GEY A;  4K4E A;  4PML A;  4BUA A;  3MHJ A;  4PNR A;  5A00 A;  3W51 A;  4TKI A;  4BUU A;  4LI6 A;  4GV0 A;  4PJV A;  2RF5 A;  4UVS A;  1WOK A;  4L0S A;  4L7O A;  4BUD A;  4DQY C;  4L6Z A;  4N3R A;  3SMJ A;  4J3L A;  4TK5 A;  4BUS A;  4OPX C;  4DVI A;  4UI8 A;  5AKU A;  4R5W A;  4KZQ A;  5AKW A;  4BUW A;  4UVV A;  4BU3 A;  4F0E A;  4BFP A;  3SMI A;  4BU8 A;  4HKN A;  4UVU A;  3KCZ A;  4UVX A;  5FPG A;  4IUE A;  4L70 A;  4U6A A;  4GV4 A;  3CE0 A;  4L31 A;  4HLG A;  4UX4 A;  4KZU A;  3U9Y A;  2PQF A;  4UXB A;  4K4F A;  2X5Y A;  4L2F A;  4UVP A;  4AVU A;  1A26 A;  3UA9 A;  3U9H A;  4L0B A;  3KJD A;  2RCW A;  3L3L A;  3L3M A;  5LXP A;  4UVO A;  4I9I A;  4UVY A;  4HLH A;  4RV6 A;  4L33 A;  4PNS A;  4TJW A;  5AL2 A;  4J3M A;  4J22 A;  4PNM A;  4BJC A;  4F1Q A;  4W6E A;  3GJW A;  4W5S A;  4L10 A;  4TJU A;  4BUI A; 
#chains in the Genus database with same CATH topology
 4BUX A;  4UI7 A;  5FH5 A;  1KHF A;  2QF2 A;  5LX6 A;  4HLF A;  3MOF A;  4L7U A;  4LI8 A;  4L2G A;  4GMM A;  4YW8 A;  4UND A;  4W5I A;  2PAW A;  4HLM A;  4F1L A;  4L2K A;  4GNM A;  4LI7 A;  4J1Z A;  3UH4 A;  4MT9 A;  4BU9 A;  4M7B A;  3MHK A;  4L09 A;  3DT4 A;  4HYF A;  4L34 A;  3GN7 A;  3P0P A;  4PAX A;  3C4H A;  4TOR A;  4BU6 A;  4PJT A;  5AL1 A;  4TVJ A;  4OQB C;  4UI3 A;  4TKG A;  4TK0 A;  4UUH A;  1UK1 A;  3GOY A;  3SE2 A;  4BUY A;  3UH2 A;  2RKA A;  1YLH A;  3P0Q A;  4BUF A;  5LYH A;  1YTM A;  1KHG A;  2PXZ X;  4HKI A;  4TKF A;  1YGG A;  5FH2 A;  4MSK A;  4UHG A;  3DT7 A;  3C49 A;  1KHB A;  2RK8 A;  4PNL A;  4HLK A;  4UVW A;  4UVZ A;  5C5R A;  4BUE A;  4GNQ A;  4ZZY A;  5ADR A;  2OLQ A;  4X52 A;  4OA7 A;  5EBT A;  4MSG A;  3UDD A;  5ECE A;  1GS0 A;  2PAX A;  4KRS A;  2FAH A;  3DT2 A;  3FHB A;  4RCG A;  4WIU A;  4PNT A;  1PAX A;  2RKE A;  3HKV A;  4R43 A;  2FAF A;  4PNN A;  5AL3 A;  4BJB A;  4UFY A;  1M51 A;  4PY4 A;  4UVT A;  5ADT A;  4GV2 A;  5C5Q A;  4OQA C;  4BS4 A;  2PC9 A;  4WIE A;  5ADQ A;  1KHE A;  1EFY A;  4KZL A;  4YW9 A;  4WPV A;  4N4T A;  4UVL A;  4UW1 A;  4L0I A;  4L7R A;  4PNQ A;  4GMW A;  4UVN A;  4UFU A;  4HKK A;  3BLJ A;  4GMU A;  3PAX A;  1OEN A;  4GV7 A;  4L7N A;  4UI5 A;  5C5P A;  4AVW A;  4BUT A;  4L6S A;  4BUV A;  4GNL A;  4BJ9 A;  4ZZX A;  3KR7 A;  1K3C A;  2RKD A;  2ZCI A;  4GMZ A;  2OLR A;  4TOS A;  4UI6 A;  4HMH A;  1UK0 A;  4TJY A;  4L7P A;  4XHU A;  5DCZ A;  5ETY A;  4HL5 A;  2RD6 A;  4BU7 A;  4L7L A;  4UI4 A;  5AEH A;  5AL4 A;  4GNO A;  1AQ2 A;  5ADS A;  3KR8 A;  4GNP A;  2QZY A;  4BU5 A;  1II2 A;  4HHY A;  4HHZ A;  4ZZZ A;  3P0N A;  4L32 A;  5FPF A;  4N4V A;  4R6E A;  3DTB A;  4L0V A;  4J21 A;  4L0T A;  4WPU A;  3GEY A;  4K4E A;  4PML A;  4BUA A;  3MHJ A;  1XKV A;  4PNR A;  5A00 A;  4TKI A;  3W51 A;  4BUU A;  4LI6 A;  4GV0 A;  2QEW A;  4PJV A;  2RF5 A;  4UVS A;  1WOK A;  4L0S A;  4L7O A;  4BUD A;  4DQY C;  4L6Z A;  4N3R A;  3SMJ A;  5AL5 A;  4J3L A;  4TK5 A;  4BUS A;  4OPX C;  4DVI A;  4UI8 A;  4YWD A;  1J3B A;  5AKU A;  4R5W A;  4KZQ A;  4WPT A;  1OS1 A;  4UVV A;  5AKW A;  4BUW A;  4BU3 A;  3MOH A;  2PY7 X;  4F0E A;  4BFP A;  3SMI A;  4WOU A;  4BU8 A;  4HKN A;  4OX2 A;  4UVU A;  3KCZ A;  3MOE A;  4UVX A;  5FPG A;  4IUE A;  4L70 A;  4U6A A;  4GV4 A;  3CE0 A;  4L31 A;  4HLG A;  1AYL A;  4UX4 A;  1K3D A;  4KZU A;  2PQF A;  5FH1 A;  3U9Y A;  4UXB A;  4K4F A;  5FH0 A;  2X5Y A;  4L2F A;  4UVP A;  4AVU A;  5I67 A;  1A26 A;  3UA9 A;  3U9H A;  4L0B A;  3KJD A;  2RCW A;  3L3L A;  3L3M A;  5LXP A;  4UVO A;  4I9I A;  4UVY A;  4HLH A;  4RV6 A;  2QEY A;  4WL8 A;  2RK7 A;  5FH3 A;  4L33 A;  1NHX A;  4YWB A;  4PNS A;  4TJW A;  5AL2 A;  4J3M A;  2QF1 A;  4J22 A;  4PNM A;  1YVY A;  4BJC A;  4W6E A;  4F1Q A;  3GJW A;  4W5S A;  2GMV A;  4L10 A;  4TJU A;  5FH4 A;  4BUI A; 
#chains in the Genus database with same CATH homology
 4BUX A;  4UI7 A;  5FH5 A;  1KHF A;  2QF2 A;  5LX6 A;  4HLF A;  3MOF A;  4L7U A;  4LI8 A;  4L2G A;  4GMM A;  4YW8 A;  4UND A;  4W5I A;  2PAW A;  4HLM A;  4F1L A;  4L2K A;  4GNM A;  4LI7 A;  4J1Z A;  3UH4 A;  4MT9 A;  4BU9 A;  4M7B A;  3MHK A;  4L09 A;  3DT4 A;  4HYF A;  4L34 A;  3GN7 A;  3P0P A;  4PAX A;  3C4H A;  4TOR A;  4BU6 A;  4PJT A;  5AL1 A;  4TVJ A;  4OQB C;  4UI3 A;  4TKG A;  4TK0 A;  4UUH A;  1UK1 A;  3GOY A;  3SE2 A;  4BUY A;  3UH2 A;  2RKA A;  1YLH A;  3P0Q A;  4BUF A;  5LYH A;  1YTM A;  1KHG A;  2PXZ X;  4HKI A;  4TKF A;  1YGG A;  5FH2 A;  4MSK A;  4UHG A;  3DT7 A;  3C49 A;  1KHB A;  2RK8 A;  4PNL A;  4HLK A;  4UVW A;  4UVZ A;  5C5R A;  4BUE A;  4GNQ A;  4ZZY A;  5ADR A;  2OLQ A;  4X52 A;  4OA7 A;  5EBT A;  4MSG A;  3UDD A;  5ECE A;  1GS0 A;  2PAX A;  4KRS A;  2FAH A;  3DT2 A;  3FHB A;  4RCG A;  4WIU A;  4PNT A;  1PAX A;  2RKE A;  3HKV A;  4R43 A;  2FAF A;  4PNN A;  5AL3 A;  4BJB A;  4UFY A;  1M51 A;  4PY4 A;  4UVT A;  5ADT A;  4GV2 A;  5C5Q A;  4OQA C;  4BS4 A;  2PC9 A;  4WIE A;  5ADQ A;  1KHE A;  1EFY A;  4KZL A;  4YW9 A;  4WPV A;  4N4T A;  4UVL A;  4UW1 A;  4L0I A;  4L7R A;  4PNQ A;  4GMW A;  4UVN A;  4UFU A;  4HKK A;  3BLJ A;  4GMU A;  3PAX A;  1OEN A;  4GV7 A;  4L7N A;  4UI5 A;  5C5P A;  4AVW A;  4BUT A;  4L6S A;  4BUV A;  4GNL A;  4BJ9 A;  4ZZX A;  3KR7 A;  1K3C A;  2RKD A;  2ZCI A;  4GMZ A;  2OLR A;  4TOS A;  4UI6 A;  4HMH A;  1UK0 A;  4TJY A;  4L7P A;  4XHU A;  5DCZ A;  5ETY A;  4HL5 A;  2RD6 A;  4BU7 A;  4L7L A;  4UI4 A;  5AEH A;  5AL4 A;  4GNO A;  1AQ2 A;  5ADS A;  3KR8 A;  4GNP A;  2QZY A;  4BU5 A;  1II2 A;  4HHY A;  4HHZ A;  4ZZZ A;  3P0N A;  4L32 A;  5FPF A;  4N4V A;  4R6E A;  3DTB A;  4L0V A;  4J21 A;  4L0T A;  4WPU A;  3GEY A;  4K4E A;  4PML A;  4BUA A;  3MHJ A;  1XKV A;  4PNR A;  5A00 A;  4TKI A;  3W51 A;  4BUU A;  4LI6 A;  4GV0 A;  2QEW A;  4PJV A;  2RF5 A;  4UVS A;  1WOK A;  4L0S A;  4L7O A;  4BUD A;  4DQY C;  4L6Z A;  4N3R A;  3SMJ A;  5AL5 A;  4J3L A;  4TK5 A;  4BUS A;  4OPX C;  4DVI A;  4UI8 A;  4YWD A;  1J3B A;  5AKU A;  4R5W A;  4KZQ A;  4WPT A;  1OS1 A;  4UVV A;  5AKW A;  4BUW A;  4BU3 A;  3MOH A;  2PY7 X;  4F0E A;  4BFP A;  3SMI A;  4WOU A;  4BU8 A;  4HKN A;  4OX2 A;  4UVU A;  3KCZ A;  3MOE A;  4UVX A;  5FPG A;  4IUE A;  4L70 A;  4U6A A;  4GV4 A;  3CE0 A;  4L31 A;  4HLG A;  1AYL A;  4UX4 A;  1K3D A;  4KZU A;  2PQF A;  5FH1 A;  3U9Y A;  4UXB A;  4K4F A;  5FH0 A;  2X5Y A;  4L2F A;  4UVP A;  4AVU A;  5I67 A;  1A26 A;  3UA9 A;  3U9H A;  4L0B A;  3KJD A;  2RCW A;  3L3L A;  3L3M A;  5LXP A;  4UVO A;  4I9I A;  4UVY A;  4HLH A;  4RV6 A;  2QEY A;  4WL8 A;  2RK7 A;  5FH3 A;  4L33 A;  1NHX A;  4YWB A;  4PNS A;  4TJW A;  5AL2 A;  4J3M A;  2QF1 A;  4J22 A;  4PNM A;  1YVY A;  4BJC A;  4W6E A;  4F1Q A;  3GJW A;  4W5S A;  2GMV A;  4L10 A;  4TJU A;  5FH4 A;  4BUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...