4KRSA

Tankyrase-1 complexed with small molecule inhibitor
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
210
structure length
204
Chain Sequence
GTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTIKMAHAPPGHHSVIGRAYAEYVIYRGEQAYPEYLITYQIMKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Efficiency Relationship of [1,2,4]Triazol-3-ylamines as Novel Nicotinamide Isosteres that Inhibit Tankyrases.
pubmed doi rcsb
molecule keywords Tankyrase-1
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
total genus 61
structure length 204
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4krsA00
4R5WA 4TJYA 4BUEA 4L7RA 4UI4A 4BUFA 4BU5A 4HMHA 4PNLA 4BUYA 4HKKA 4PNSA 4PJTA 3L3MA 5LYHA 4PNQA 4UVUA 4HKNA 4BUTA 4LI8A 3KR7A 4ZZYA 2X5YA 4J1ZA 4UI3A 4BS4A 4LI6A 2RCWA 1WOKA 4N4TA 4L7OA 5C5RA 3SMJA 3UDDA 4BUSA 4L7UA 3L3LA 4TKFA 3U9HA 4KRSA 4KZUA 4TJWA 4GV0A 4TKIA 4I9IA 3KR8A 4BUAA 3GJWA 5AL3A 3KCZA 4F1QA 4KZQA 3UH2A 4K4EA 4PNTA 4L7NA 4PY4A 4ZZXA 5AEHA 4UFYA 4L0VA 4L0TA 4W6EA 4L10A 4L6ZA 4U6AA 4UX4A 3SE2A 4UI7A 4UVTA 4UW1A 1A26A 5A00A 4J21A 5AL4A 4AVWA 4BFPA 5ADQA 1GS0A 4GV4A 1UK1A 3C4HA 4K4FA 3GOYA 4BUDA 4BUIA 3U9YA 4UVSA 4UVYA 4BJ9A 4HHYA 4TVJA 4PAXA 2PAWA 4UUHA 3UH4A 4L32A 4MSGA 5LXPA 5AKUA 3KJDA 4W5SA 5DCZA 4L6SA 4BU8A 3BLJA 4OPXC 4OA7A 4ZZZA 4J3MA 5LX6A 5AKWA 3P0QA 4TK5A 4DQYC 4UVWA 1PAXA 4TKGA 4N4VA 4BU9A 4J3LA 4HLHA 5FPGA 4UXBA 4PMLA 4UFUA 4UVZA 4GV7A 3C49A 4UVXA 3W51A 4OQBC 3HKVA 4MT9A 3P0NA 3GEYA 4HYFA 4L7LA 5C5QA 4DVIA 5ADTA 4J22A 4PNRA 2PQFA 1EFYA 1UK0A 4PNMA 4HL5A 4R6EA 4UVNA 5FPFA 4L7PA 4W5IA 4L2FA 2RF5A 3GN7A 4HKIA 4HLKA 4L09A 4L0IA 5AL5A 4BJBA 3MHKA 4AVUA 4KZLA 4UHGA 4UVVA 4F1LA 5ADSA 5ETYA 4UI5A 4BU6A 4BUUA 4TK0A 4BU7A 4HHZA 5EBTA 3FHBA 3UA9A 4L31A 2PAXA 4GV2A 4XHUA 4F0EA 4L70A 4HLFA 4L33A 4BUVA 4UI6A 4UVOA 4HLGA 4L2GA 4RV6A 3PAXA 4L0BA 4L0SA 4PNNA 4M7BA 3CE0A 4BUXA 3SMIA 4OQAC 3P0PA 4UI8A 5ECEA 4LI7A 4TORA 4BJCA 4UVPA 4X52A 2RD6A 5C5PA 4N3RA 4L2KA 4IUEA 4MSKA 4TOSA 5AL2A 4UVLA 5AL1A 4UNDA 4HLMA 4BU3A 5ADRA 4PJVA 4BUWA 3MHJA 4L34A 4TJUA
chains in the Genus database with same CATH superfamily
1OS1A 4R5WA 4TJYA 4BUEA 4L7RA 4UI4A 4BUFA 4BU5A 4HMHA 4PNLA 5I67A 4BUYA 2FAHA 4HKKA 4PNSA 4PJTA 3L3MA 5LYHA 4GMZA 2RK8A 4PNQA 4UVUA 4HKNA 2QF2A 4BUTA 4RCGA 4LI8A 1KHEA 3KR7A 4ZZYA 2X5YA 4J1ZA 1K3CA 4UI3A 4LI6A 4BS4A 2RCWA 1WOKA 4N4TA 4L7OA 5C5RA 3SMJA 3UDDA 2QZYA 4BUSA 4L7UA 3L3LA 4TKFA 4OX2A 4KRSA 4KZUA 4TJWA 1M51A 4GV0A 4I9IA 4TKIA 4WIUA 2ZCIA 3KR8A 4WPTA 4BUAA 4YW9A 1J3BA 2FAFA 3GJWA 2RKEA 3KCZA 4GMWA 5AL3A 4GMUA 4F1QA 4KZQA 3UH2A 4WPUA 4K4EA 4PNTA 4L7NA 4PY4A 4ZZXA 5AEHA 4UFYA 1KHBA 4L0VA 4L0TA 4W6EA 4YWDA 5FH2A 4R43A 4L10A 4L6ZA 4U6AA 4UX4A 4GNOA 2GMVA 4UI7A 4UVTA 4UW1A 1A26A 5A00A 3SE2A 4J21A 5AL4A 4AVWA 1KHFA 4BFPA 5ADQA 1GS0A 2QEYA 3MOFA 1UK1A 3C4HA 4GV4A 4K4FA 3GOYA 3DT7A 4BUDA 4BUIA 3U9YA 2RKAA 4UVSA 4UVYA 4BJ9A 5FH1A 4HHYA 3DT4A 1YTMA 4GMMA 2PAWA 4PAXA 4TVJA 4UUHA 4L32A 4MSGA 4WIEA 4WOUA 5AKUA 3KJDA 4W5SA 3UH4A 5LXPA 5DCZA 4L6SA 4BU8A 3BLJA 4OPXC 4OA7A 4ZZZA 3U9HA 4J3MA 5LX6A 5AKWA 3P0QA 4TK5A 1AQ2A 4DQYC 4UVWA 1PAXA 1YVYA 3DTBA 5FH3A 4TKGA 1NHXA 4N4VA 4BU9A 4J3LA 4HLHA 5FPGA 4UXBA 4PMLA 4GNPA 4GNMA 4UFUA 4GV7A 3C49A 4UVZA 4UVXA 3W51A 3HKVA 4OQBC 4MT9A 2PXZX 3P0NA 3GEYA 4HYFA 4L7LA 5C5QA 4DVIA 5ADTA 2QF1A 4J22A 4PNRA 2PQFA 1EFYA 1UK0A 4PNMA 4HL5A 4R6EA 4UVNA 4YWBA 4L7PA 5FPFA 3MOHA 4W5IA 4L2FA 4GNQA 2RF5A 3GN7A 4HKIA 4HLKA 4L09A 4L0IA 5AL5A 5FH0A 4BJBA 3MHKA 4AVUA 1K3DA 4KZLA 4UHGA 4UVVA 4F1LA 5ADSA 5ETYA 4UI5A 4BU6A 4BUUA 1YGGA 4TK0A 5FH4A 4BU7A 4HHZA 5EBTA 3FHBA 1OENA 2RKDA 2PAXA 4GV2A 4L31A 3UA9A 2PY7X 4XHUA 4F0EA 5FH5A 4L70A 4HLFA 4L33A 4BUVA 1XKVA 4UI6A 2OLQA 4UVOA 4HLGA 4L2GA 4RV6A 3PAXA 4L0BA 4WL8A 2OLRA 4L0SA 4PNNA 4M7BA 3DT2A 3CE0A 4BUXA 3SMIA 2QEWA 4OQAC 1AYLA 3P0PA 4UI8A 5ECEA 4LI7A 4TORA 4BJCA 4WPVA 1II2A 1KHGA 2RK7A 4GNLA 4UVPA 4X52A 2RD6A 5C5PA 4N3RA 4L2KA 2PC9A 4IUEA 4MSKA 4TOSA 5AL2A 4UVLA 5AL1A 4UNDA 4HLMA 4BU3A 5ADRA 3MOEA 4PJVA 4YW8A 4BUWA 3MHJA 4L34A 4TJUA 1YLHA
chains in the Genus database with same CATH topology
1OS1A 4R5WA 4TJYA 4BUEA 4L7RA 4UI4A 4BUFA 4BU5A 4HMHA 4PNLA 5I67A 4BUYA 2FAHA 4HKKA 4PNSA 4PJTA 3L3MA 5LYHA 4GMZA 2RK8A 4PNQA 4UVUA 4HKNA 2QF2A 4BUTA 4RCGA 4LI8A 1KHEA 3KR7A 4ZZYA 2X5YA 4J1ZA 1K3CA 4UI3A 4LI6A 4BS4A 2RCWA 1WOKA 4N4TA 4L7OA 5C5RA 3SMJA 3UDDA 2QZYA 4BUSA 4L7UA 3L3LA 4TKFA 4OX2A 4KRSA 4KZUA 4TJWA 1M51A 4GV0A 4I9IA 4TKIA 4WIUA 2ZCIA 3KR8A 4WPTA 4BUAA 4YW9A 1J3BA 2FAFA 3GJWA 2RKEA 3KCZA 4GMWA 5AL3A 4GMUA 4F1QA 4KZQA 3UH2A 4WPUA 4K4EA 4PNTA 4L7NA 4PY4A 4ZZXA 5AEHA 4UFYA 1KHBA 4L0VA 4L0TA 4W6EA 4YWDA 5FH2A 4R43A 4L10A 4L6ZA 4U6AA 4UX4A 4GNOA 2GMVA 4UI7A 4UVTA 4UW1A 1A26A 5A00A 3SE2A 4J21A 5AL4A 4AVWA 1KHFA 4BFPA 5ADQA 1GS0A 2QEYA 3MOFA 1UK1A 3C4HA 4GV4A 4K4FA 3GOYA 3DT7A 4BUDA 4BUIA 3U9YA 2RKAA 4UVSA 4UVYA 4BJ9A 5FH1A 4HHYA 3DT4A 1YTMA 4GMMA 2PAWA 4PAXA 4TVJA 4UUHA 4L32A 4MSGA 4WIEA 4WOUA 5AKUA 3KJDA 4W5SA 3UH4A 5LXPA 5DCZA 4L6SA 4BU8A 3BLJA 4OPXC 4OA7A 4ZZZA 3U9HA 4J3MA 5LX6A 5AKWA 3P0QA 4TK5A 1AQ2A 4DQYC 4UVWA 1PAXA 1YVYA 3DTBA 5FH3A 4TKGA 1NHXA 4N4VA 4BU9A 4J3LA 4HLHA 5FPGA 4UXBA 4PMLA 4GNPA 4GNMA 4UFUA 4GV7A 3C49A 4UVZA 4UVXA 3W51A 3HKVA 4OQBC 4MT9A 2PXZX 3P0NA 3GEYA 4HYFA 4L7LA 5C5QA 4DVIA 5ADTA 2QF1A 4J22A 4PNRA 2PQFA 1EFYA 1UK0A 4PNMA 4HL5A 4R6EA 4UVNA 4YWBA 4L7PA 5FPFA 3MOHA 4W5IA 4L2FA 4GNQA 2RF5A 3GN7A 4HKIA 4HLKA 4L09A 4L0IA 5AL5A 5FH0A 4BJBA 3MHKA 4AVUA 1K3DA 4KZLA 4UHGA 4UVVA 4F1LA 5ADSA 5ETYA 4UI5A 4BU6A 4BUUA 1YGGA 4TK0A 5FH4A 4BU7A 4HHZA 5EBTA 3FHBA 1OENA 2RKDA 2PAXA 4GV2A 4L31A 3UA9A 2PY7X 4XHUA 4F0EA 5FH5A 4L70A 4HLFA 4L33A 4BUVA 1XKVA 4UI6A 2OLQA 4UVOA 4HLGA 4L2GA 4RV6A 3PAXA 4L0BA 4WL8A 2OLRA 4L0SA 4PNNA 4M7BA 3DT2A 3CE0A 4BUXA 3SMIA 2QEWA 4OQAC 1AYLA 3P0PA 4UI8A 5ECEA 4LI7A 4TORA 4BJCA 4WPVA 1II2A 1KHGA 2RK7A 4GNLA 4UVPA 4X52A 2RD6A 5C5PA 4N3RA 4L2KA 2PC9A 4IUEA 4MSKA 4TOSA 5AL2A 4UVLA 5AL1A 4UNDA 4HLMA 4BU3A 5ADRA 3MOEA 4PJVA 4YW8A 4BUWA 3MHJA 4L34A 4TJUA 1YLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R5W A;  4TJY A;  4BUE A;  4L7R A;  4UI4 A;  4BUF A;  4BU5 A;  4HMH A;  4PNL A;  4BUY A;  4HKK A;  4PNS A;  4PJT A;  3L3M A;  5LYH A;  4PNQ A;  4UVU A;  4HKN A;  4BUT A;  4LI8 A;  3KR7 A;  4ZZY A;  2X5Y A;  4J1Z A;  4UI3 A;  4BS4 A;  4LI6 A;  2RCW A;  1WOK A;  4N4T A;  4L7O A;  5C5R A;  3SMJ A;  3UDD A;  4BUS A;  4L7U A;  3L3L A;  4TKF A;  3U9H A;  4KRS A;  4KZU A;  4TJW A;  4GV0 A;  4TKI A;  4I9I A;  3KR8 A;  4BUA A;  3GJW A;  5AL3 A;  3KCZ A;  4F1Q A;  4KZQ A;  3UH2 A;  4K4E A;  4PNT A;  4L7N A;  4PY4 A;  4ZZX A;  5AEH A;  4UFY A;  4L0V A;  4L0T A;  4W6E A;  4L10 A;  4L6Z A;  4U6A A;  4UX4 A;  3SE2 A;  4UI7 A;  4UVT A;  4UW1 A;  1A26 A;  5A00 A;  4J21 A;  5AL4 A;  4AVW A;  4BFP A;  5ADQ A;  1GS0 A;  4GV4 A;  1UK1 A;  3C4H A;  4K4F A;  3GOY A;  4BUD A;  4BUI A;  3U9Y A;  4UVS A;  4UVY A;  4BJ9 A;  4HHY A;  4TVJ A;  4PAX A;  2PAW A;  4UUH A;  3UH4 A;  4L32 A;  4MSG A;  5LXP A;  5AKU A;  3KJD A;  4W5S A;  5DCZ A;  4L6S A;  4BU8 A;  3BLJ A;  4OPX C;  4OA7 A;  4ZZZ A;  4J3M A;  5LX6 A;  5AKW A;  3P0Q A;  4TK5 A;  4DQY C;  4UVW A;  1PAX A;  4TKG A;  4N4V A;  4BU9 A;  4J3L A;  4HLH A;  5FPG A;  4UXB A;  4PML A;  4UFU A;  4UVZ A;  4GV7 A;  3C49 A;  4UVX A;  3W51 A;  4OQB C;  3HKV A;  4MT9 A;  3P0N A;  3GEY A;  4HYF A;  4L7L A;  5C5Q A;  4DVI A;  5ADT A;  4J22 A;  4PNR A;  2PQF A;  1EFY A;  1UK0 A;  4PNM A;  4HL5 A;  4R6E A;  4UVN A;  5FPF A;  4L7P A;  4W5I A;  4L2F A;  2RF5 A;  3GN7 A;  4HKI A;  4HLK A;  4L09 A;  4L0I A;  5AL5 A;  4BJB A;  3MHK A;  4AVU A;  4KZL A;  4UHG A;  4UVV A;  4F1L A;  5ADS A;  5ETY A;  4UI5 A;  4BU6 A;  4BUU A;  4TK0 A;  4BU7 A;  4HHZ A;  5EBT A;  3FHB A;  3UA9 A;  4L31 A;  2PAX A;  4GV2 A;  4XHU A;  4F0E A;  4L70 A;  4HLF A;  4L33 A;  4BUV A;  4UI6 A;  4UVO A;  4HLG A;  4L2G A;  4RV6 A;  3PAX A;  4L0B A;  4L0S A;  4PNN A;  4M7B A;  3CE0 A;  4BUX A;  3SMI A;  4OQA C;  3P0P A;  4UI8 A;  5ECE A;  4LI7 A;  4TOR A;  4BJC A;  4UVP A;  4X52 A;  2RD6 A;  5C5P A;  4N3R A;  4L2K A;  4IUE A;  4MSK A;  4TOS A;  5AL2 A;  4UVL A;  5AL1 A;  4UND A;  4HLM A;  4BU3 A;  5ADR A;  4PJV A;  4BUW A;  3MHJ A;  4L34 A;  4TJU A; 
#chains in the Genus database with same CATH topology
 1OS1 A;  4R5W A;  4TJY A;  4BUE A;  4L7R A;  4UI4 A;  4BUF A;  4BU5 A;  4HMH A;  4PNL A;  5I67 A;  4BUY A;  2FAH A;  4HKK A;  4PNS A;  4PJT A;  3L3M A;  5LYH A;  4GMZ A;  2RK8 A;  4PNQ A;  4UVU A;  4HKN A;  2QF2 A;  4BUT A;  4RCG A;  4LI8 A;  1KHE A;  3KR7 A;  4ZZY A;  2X5Y A;  4J1Z A;  1K3C A;  4UI3 A;  4LI6 A;  4BS4 A;  2RCW A;  1WOK A;  4N4T A;  4L7O A;  5C5R A;  3SMJ A;  3UDD A;  2QZY A;  4BUS A;  4L7U A;  3L3L A;  4TKF A;  4OX2 A;  4KRS A;  4KZU A;  4TJW A;  1M51 A;  4GV0 A;  4I9I A;  4TKI A;  4WIU A;  2ZCI A;  3KR8 A;  4WPT A;  4BUA A;  4YW9 A;  1J3B A;  2FAF A;  3GJW A;  2RKE A;  3KCZ A;  4GMW A;  5AL3 A;  4GMU A;  4F1Q A;  4KZQ A;  3UH2 A;  4WPU A;  4K4E A;  4PNT A;  4L7N A;  4PY4 A;  4ZZX A;  5AEH A;  4UFY A;  1KHB A;  4L0V A;  4L0T A;  4W6E A;  4YWD A;  5FH2 A;  4R43 A;  4L10 A;  4L6Z A;  4U6A A;  4UX4 A;  4GNO A;  2GMV A;  4UI7 A;  4UVT A;  4UW1 A;  1A26 A;  5A00 A;  3SE2 A;  4J21 A;  5AL4 A;  4AVW A;  1KHF A;  4BFP A;  5ADQ A;  1GS0 A;  2QEY A;  3MOF A;  1UK1 A;  3C4H A;  4GV4 A;  4K4F A;  3GOY A;  3DT7 A;  4BUD A;  4BUI A;  3U9Y A;  2RKA A;  4UVS A;  4UVY A;  4BJ9 A;  5FH1 A;  4HHY A;  3DT4 A;  1YTM A;  4GMM A;  2PAW A;  4PAX A;  4TVJ A;  4UUH A;  4L32 A;  4MSG A;  4WIE A;  4WOU A;  5AKU A;  3KJD A;  4W5S A;  3UH4 A;  5LXP A;  5DCZ A;  4L6S A;  4BU8 A;  3BLJ A;  4OPX C;  4OA7 A;  4ZZZ A;  3U9H A;  4J3M A;  5LX6 A;  5AKW A;  3P0Q A;  4TK5 A;  1AQ2 A;  4DQY C;  4UVW A;  1PAX A;  1YVY A;  3DTB A;  5FH3 A;  4TKG A;  1NHX A;  4N4V A;  4BU9 A;  4J3L A;  4HLH A;  5FPG A;  4UXB A;  4PML A;  4GNP A;  4GNM A;  4UFU A;  4GV7 A;  3C49 A;  4UVZ A;  4UVX A;  3W51 A;  3HKV A;  4OQB C;  4MT9 A;  2PXZ X;  3P0N A;  3GEY A;  4HYF A;  4L7L A;  5C5Q A;  4DVI A;  5ADT A;  2QF1 A;  4J22 A;  4PNR A;  2PQF A;  1EFY A;  1UK0 A;  4PNM A;  4HL5 A;  4R6E A;  4UVN A;  4YWB A;  4L7P A;  5FPF A;  3MOH A;  4W5I A;  4L2F A;  4GNQ A;  2RF5 A;  3GN7 A;  4HKI A;  4HLK A;  4L09 A;  4L0I A;  5AL5 A;  5FH0 A;  4BJB A;  3MHK A;  4AVU A;  1K3D A;  4KZL A;  4UHG A;  4UVV A;  4F1L A;  5ADS A;  5ETY A;  4UI5 A;  4BU6 A;  4BUU A;  1YGG A;  4TK0 A;  5FH4 A;  4BU7 A;  4HHZ A;  5EBT A;  3FHB A;  1OEN A;  2RKD A;  2PAX A;  4GV2 A;  4L31 A;  3UA9 A;  2PY7 X;  4XHU A;  4F0E A;  5FH5 A;  4L70 A;  4HLF A;  4L33 A;  4BUV A;  1XKV A;  4UI6 A;  2OLQ A;  4UVO A;  4HLG A;  4L2G A;  4RV6 A;  3PAX A;  4L0B A;  4WL8 A;  2OLR A;  4L0S A;  4PNN A;  4M7B A;  3DT2 A;  3CE0 A;  4BUX A;  3SMI A;  2QEW A;  4OQA C;  1AYL A;  3P0P A;  4UI8 A;  5ECE A;  4LI7 A;  4TOR A;  4BJC A;  4WPV A;  1II2 A;  1KHG A;  2RK7 A;  4GNL A;  4UVP A;  4X52 A;  2RD6 A;  5C5P A;  4N3R A;  4L2K A;  2PC9 A;  4IUE A;  4MSK A;  4TOS A;  5AL2 A;  4UVL A;  5AL1 A;  4UND A;  4HLM A;  4BU3 A;  5ADR A;  3MOE A;  4PJV A;  4YW8 A;  4BUW A;  3MHJ A;  4L34 A;  4TJU A;  1YLH A; 
#chains in the Genus database with same CATH homology
 1OS1 A;  4R5W A;  4TJY A;  4BUE A;  4L7R A;  4UI4 A;  4BUF A;  4BU5 A;  4HMH A;  4PNL A;  5I67 A;  4BUY A;  2FAH A;  4HKK A;  4PNS A;  4PJT A;  3L3M A;  5LYH A;  4GMZ A;  2RK8 A;  4PNQ A;  4UVU A;  4HKN A;  2QF2 A;  4BUT A;  4RCG A;  4LI8 A;  1KHE A;  3KR7 A;  4ZZY A;  2X5Y A;  4J1Z A;  1K3C A;  4UI3 A;  4LI6 A;  4BS4 A;  2RCW A;  1WOK A;  4N4T A;  4L7O A;  5C5R A;  3SMJ A;  3UDD A;  2QZY A;  4BUS A;  4L7U A;  3L3L A;  4TKF A;  4OX2 A;  4KRS A;  4KZU A;  4TJW A;  1M51 A;  4GV0 A;  4I9I A;  4TKI A;  4WIU A;  2ZCI A;  3KR8 A;  4WPT A;  4BUA A;  4YW9 A;  1J3B A;  2FAF A;  3GJW A;  2RKE A;  3KCZ A;  4GMW A;  5AL3 A;  4GMU A;  4F1Q A;  4KZQ A;  3UH2 A;  4WPU A;  4K4E A;  4PNT A;  4L7N A;  4PY4 A;  4ZZX A;  5AEH A;  4UFY A;  1KHB A;  4L0V A;  4L0T A;  4W6E A;  4YWD A;  5FH2 A;  4R43 A;  4L10 A;  4L6Z A;  4U6A A;  4UX4 A;  4GNO A;  2GMV A;  4UI7 A;  4UVT A;  4UW1 A;  1A26 A;  5A00 A;  3SE2 A;  4J21 A;  5AL4 A;  4AVW A;  1KHF A;  4BFP A;  5ADQ A;  1GS0 A;  2QEY A;  3MOF A;  1UK1 A;  3C4H A;  4GV4 A;  4K4F A;  3GOY A;  3DT7 A;  4BUD A;  4BUI A;  3U9Y A;  2RKA A;  4UVS A;  4UVY A;  4BJ9 A;  5FH1 A;  4HHY A;  3DT4 A;  1YTM A;  4GMM A;  2PAW A;  4PAX A;  4TVJ A;  4UUH A;  4L32 A;  4MSG A;  4WIE A;  4WOU A;  5AKU A;  3KJD A;  4W5S A;  3UH4 A;  5LXP A;  5DCZ A;  4L6S A;  4BU8 A;  3BLJ A;  4OPX C;  4OA7 A;  4ZZZ A;  3U9H A;  4J3M A;  5LX6 A;  5AKW A;  3P0Q A;  4TK5 A;  1AQ2 A;  4DQY C;  4UVW A;  1PAX A;  1YVY A;  3DTB A;  5FH3 A;  4TKG A;  1NHX A;  4N4V A;  4BU9 A;  4J3L A;  4HLH A;  5FPG A;  4UXB A;  4PML A;  4GNP A;  4GNM A;  4UFU A;  4GV7 A;  3C49 A;  4UVZ A;  4UVX A;  3W51 A;  3HKV A;  4OQB C;  4MT9 A;  2PXZ X;  3P0N A;  3GEY A;  4HYF A;  4L7L A;  5C5Q A;  4DVI A;  5ADT A;  2QF1 A;  4J22 A;  4PNR A;  2PQF A;  1EFY A;  1UK0 A;  4PNM A;  4HL5 A;  4R6E A;  4UVN A;  4YWB A;  4L7P A;  5FPF A;  3MOH A;  4W5I A;  4L2F A;  4GNQ A;  2RF5 A;  3GN7 A;  4HKI A;  4HLK A;  4L09 A;  4L0I A;  5AL5 A;  5FH0 A;  4BJB A;  3MHK A;  4AVU A;  1K3D A;  4KZL A;  4UHG A;  4UVV A;  4F1L A;  5ADS A;  5ETY A;  4UI5 A;  4BU6 A;  4BUU A;  1YGG A;  4TK0 A;  5FH4 A;  4BU7 A;  4HHZ A;  5EBT A;  3FHB A;  1OEN A;  2RKD A;  2PAX A;  4GV2 A;  4L31 A;  3UA9 A;  2PY7 X;  4XHU A;  4F0E A;  5FH5 A;  4L70 A;  4HLF A;  4L33 A;  4BUV A;  1XKV A;  4UI6 A;  2OLQ A;  4UVO A;  4HLG A;  4L2G A;  4RV6 A;  3PAX A;  4L0B A;  4WL8 A;  2OLR A;  4L0S A;  4PNN A;  4M7B A;  3DT2 A;  3CE0 A;  4BUX A;  3SMI A;  2QEW A;  4OQA C;  1AYL A;  3P0P A;  4UI8 A;  5ECE A;  4LI7 A;  4TOR A;  4BJC A;  4WPV A;  1II2 A;  1KHG A;  2RK7 A;  4GNL A;  4UVP A;  4X52 A;  2RD6 A;  5C5P A;  4N3R A;  4L2K A;  2PC9 A;  4IUE A;  4MSK A;  4TOS A;  5AL2 A;  4UVL A;  5AL1 A;  4UND A;  4HLM A;  4BU3 A;  5ADR A;  3MOE A;  4PJV A;  4YW8 A;  4BUW A;  3MHJ A;  4L34 A;  4TJU A;  1YLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...