4UUHA

X-ray crystal structure of human tnks in complex with a small molecule inhibitor
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
204
Chain Sequence
GTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTIKMAHAPPGHHSVIGRPYAEYVIYRGEQAYPEYLITYQIMKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design and Discovery of 3-Aryl-5-Substituted-Isoquinolin-1- Ones as Potent and Selective Tankyrase Inhibitors
doi rcsb
molecule keywords TANKYRASE-1
molecule tags Transferase
source organism Homo sapiens
total genus 66
structure length 204
sequence length 210
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4uuhA00
4L6SA 4IUEA 4L0VA 4W5IA 4MSGA 4BU3A 4BUXA 4HLGA 4PNSA 4L33A 3GN7A 4L0BA 4LI7A 4R5WA 4HHZA 4TOSA 5C5RA 4GV4A 4UVSA 4PJVA 4L6ZA 4KZUA 4BU5A 5ETYA 4TJWA 4UVLA 4HLKA 5ADRA 4L2GA 2PAXA 3PAXA 4F1QA 4UNDA 4LI8A 4UVYA 5EBTA 1UK1A 4UVZA 3SMJA 4J3LA 4TORA 1PAXA 4L7UA 3CE0A 4HKIA 4N4TA 5ADTA 4UXBA 3SMIA 5C5PA 4K4EA 4MT9A 4UVXA 4KRSA 5A00A 4BUUA 4L2KA 4UVOA 5FPGA 4L2FA 4TVJA 5AL4A 4XHUA 5LXPA 4HL5A 4TK5A 4ZZZA 4L0TA 4UVTA 4BS4A 4BUIA 4UX4A 4L7PA 4PAXA 4UI7A 4U6AA 4OQBC 3SE2A 4UI6A 4UVPA 3C4HA 3KR8A 4BUWA 4TK0A 5AKUA 4L09A 4UI5A 2PAWA 4K4FA 3U9YA 3W51A 4KZLA 5AL2A 4UVWA 4I9IA 4PNNA 5AL1A 4M7BA 1WOKA 3MHKA 4PMLA 4R6EA 4UI4A 5AL3A 5C5QA 4PNTA 4MSKA 4N4VA 4BUVA 4ZZYA 4TKGA 4UI8A 3U9HA 4BUYA 1EFYA 3GJWA 4L7NA 4L7OA 4BJCA 4DQYC 3GOYA 4BUSA 3FHBA 5FPFA 4GV0A 4L32A 4LI6A 4J21A 4BU9A 2PQFA 4J22A 4ZZXA 4TJYA 4BJ9A 3P0QA 5AL5A 4OPXC 3P0NA 3UA9A 4W5SA 3UDDA 4W6EA 3C49A 4BU6A 4L7RA 5AEHA 3L3LA 4HLMA 5LYHA 2RF5A 3KR7A 4N3RA 4TKFA 5ADQA 4BUEA 4L31A 3BLJA 3KCZA 4X52A 1GS0A 4BUAA 4BU8A 1UK0A 4AVWA 4HLHA 5LX6A 4PJTA 4UVVA 5DCZA 4HHYA 4F0EA 4L0SA 4UVNA 4HKKA 4UI3A 5ECEA 4L0IA 4BUFA 4BJBA 2RCWA 4UFYA 3KJDA 4TKIA 4BU7A 4UVUA 4OA7A 4GV7A 2RD6A 4J1ZA 4PNLA 1A26A 4HMHA 5ADSA 4RV6A 4BFPA 4BUDA 4UHGA 3HKVA 3UH2A 4L70A 3UH4A 4PNRA 4GV2A 2X5YA 4HLFA 3GEYA 4HYFA 4UW1A 4PNMA 4UUHA 4AVUA 3L3MA 4UFUA 4PY4A 5AKWA 4F1LA 4KZQA 4BUTA 3MHJA 3P0PA 4J3MA 4L10A 4OQAC 4DVIA 4TJUA 4L7LA 4PNQA 4L34A 4HKNA
chains in the Genus database with same CATH superfamily
4L6SA 1YVYA 4IUEA 4L0VA 4W5IA 2RKDA 4MSGA 4BU3A 2FAHA 4BUXA 4HLGA 3DT4A 4L33A 3GN7A 1OENA 2GMVA 4L0BA 4HHZA 4LI7A 4GNOA 1K3DA 1KHGA 4GV4A 4L6ZA 4KZUA 4PJVA 4UVSA 4BU5A 5ETYA 4TJWA 4UVLA 4HLKA 4WPUA 5FH3A 1KHBA 5ADRA 4WIEA 4L2GA 2PAXA 3PAXA 2FAFA 4F1QA 4UNDA 4LI8A 4UVYA 5EBTA 1UK1A 4UVZA 3SMJA 1YGGA 4J3LA 4PNSA 4TORA 1PAXA 4L7UA 3CE0A 4HKIA 4WL8A 4N4TA 1KHEA 2ZCIA 4UXBA 3SMIA 5ADTA 4K4EA 5C5PA 4MT9A 4GNQA 5FH0A 4UVXA 4KRSA 4R5WA 5A00A 4BUUA 1YTMA 4L2KA 4UVOA 5FPGA 4L2FA 4TVJA 5AL4A 4XHUA 5LXPA 4HL5A 4TK5A 4WIUA 4ZZZA 4L0TA 4UVTA 4BS4A 4BUIA 4GNMA 4UX4A 4OX2A 4L7PA 4PAXA 4UI7A 1M51A 4GMWA 4U6AA 4OQBC 1AQ2A 3SE2A 4UI6A 1J3BA 2QEWA 3C4HA 1K3CA 3KR8A 4UVPA 4BUWA 4TK0A 5AKUA 4L09A 4GMMA 2PAWA 4GNPA 4K4FA 4UI5A 3U9YA 4KZLA 3W51A 3DT7A 3MOFA 5AL2A 4UVWA 4I9IA 5FH5A 4PNNA 5AL1A 4YW8A 4M7BA 3DTBA 1WOKA 1II2A 3MHKA 4PMLA 4R6EA 4UI4A 5AL3A 4YWBA 4PNTA 5C5QA 4MSKA 4N4VA 5FH2A 4BUVA 4ZZYA 4TKGA 2OLQA 5FH4A 4UI8A 3U9HA 4BUYA 1EFYA 5FH1A 3GJWA 4L7NA 4L7OA 4BJCA 4YW9A 4DQYC 3GOYA 4BUSA 3FHBA 2RK7A 4GMZA 4WPVA 4GV0A 4L32A 4LI6A 5FPFA 3MOEA 4J21A 2PQFA 4J22A 4BU9A 4ZZXA 4TJYA 4BJ9A 3P0QA 5AL5A 4TOSA 3P0NA 4WPTA 4YWDA 3UA9A 4OPXC 4W5SA 3UDDA 4W6EA 3C49A 4BU6A 1OS1A 4L7RA 5AEHA 3L3LA 4HLMA 5LYHA 2RF5A 3KR7A 4N3RA 2PXZX 2QEYA 4TKFA 5ADQA 1YLHA 2QZYA 4BUEA 4L31A 1AYLA 3BLJA 3KCZA 4X52A 1GS0A 4BUAA 4BU8A 1UK0A 4AVWA 4HLHA 5LX6A 4PJTA 2QF2A 4UVVA 2QF1A 4HHYA 5DCZA 4F0EA 4L0SA 4UVNA 4HKKA 4UI3A 5ECEA 4L0IA 4BUFA 4RCGA 3DT2A 4BJBA 2RCWA 4UFYA 3KJDA 1NHXA 4TKIA 4BU7A 4UVUA 2RKEA 4OA7A 4GV7A 2RD6A 4J1ZA 1XKVA 1A26A 4HMHA 4PNLA 4R43A 4RV6A 5ADSA 4PNQA 4BFPA 4BUDA 4UHGA 5I67A 3HKVA 3MOHA 2RK8A 3UH2A 4L70A 3UH4A 4GMUA 4GV2A 4PNRA 2X5YA 2OLRA 2PC9A 4HLFA 3GEYA 4HYFA 4UW1A 1KHFA 4PNMA 4UUHA 5C5RA 4AVUA 3L3MA 4UFUA 4PY4A 5AKWA 4F1LA 4KZQA 4BUTA 3MHJA 3P0PA 4J3MA 2RKAA 4L10A 4WOUA 4DVIA 4OQAC 4TJUA 4L7LA 2PY7X 4L34A 4HKNA 4GNLA
chains in the Genus database with same CATH topology
4L6SA 1YVYA 4IUEA 4L0VA 4W5IA 2RKDA 4MSGA 4BU3A 2FAHA 4BUXA 4HLGA 3DT4A 4L33A 3GN7A 1OENA 2GMVA 4L0BA 4HHZA 4LI7A 4GNOA 1K3DA 1KHGA 4GV4A 4L6ZA 4KZUA 4PJVA 4UVSA 4BU5A 5ETYA 4TJWA 4UVLA 4HLKA 4WPUA 5FH3A 1KHBA 5ADRA 4WIEA 4L2GA 2PAXA 3PAXA 2FAFA 4F1QA 4UNDA 4LI8A 4UVYA 5EBTA 1UK1A 4UVZA 3SMJA 1YGGA 4J3LA 4PNSA 4TORA 1PAXA 4L7UA 3CE0A 4HKIA 4WL8A 4N4TA 1KHEA 2ZCIA 4UXBA 3SMIA 5ADTA 4K4EA 5C5PA 4MT9A 4GNQA 5FH0A 4UVXA 4KRSA 4R5WA 5A00A 4BUUA 1YTMA 4L2KA 4UVOA 5FPGA 4L2FA 4TVJA 5AL4A 4XHUA 5LXPA 4HL5A 4TK5A 4WIUA 4ZZZA 4L0TA 4UVTA 4BS4A 4BUIA 4GNMA 4UX4A 4OX2A 4L7PA 4PAXA 4UI7A 1M51A 4GMWA 4U6AA 4OQBC 1AQ2A 3SE2A 4UI6A 1J3BA 2QEWA 3C4HA 1K3CA 3KR8A 4UVPA 4BUWA 4TK0A 5AKUA 4L09A 4GMMA 2PAWA 4GNPA 4K4FA 4UI5A 3U9YA 4KZLA 3W51A 3DT7A 3MOFA 5AL2A 4UVWA 4I9IA 5FH5A 4PNNA 5AL1A 4YW8A 4M7BA 3DTBA 1WOKA 1II2A 3MHKA 4PMLA 4R6EA 4UI4A 5AL3A 4YWBA 4PNTA 5C5QA 4MSKA 4N4VA 5FH2A 4BUVA 4ZZYA 4TKGA 2OLQA 5FH4A 4UI8A 3U9HA 4BUYA 1EFYA 5FH1A 3GJWA 4L7NA 4L7OA 4BJCA 4YW9A 4DQYC 3GOYA 4BUSA 3FHBA 2RK7A 4GMZA 4WPVA 4GV0A 4L32A 4LI6A 5FPFA 3MOEA 4J21A 2PQFA 4J22A 4BU9A 4ZZXA 4TJYA 4BJ9A 3P0QA 5AL5A 4TOSA 3P0NA 4WPTA 4YWDA 3UA9A 4OPXC 4W5SA 3UDDA 4W6EA 3C49A 4BU6A 1OS1A 4L7RA 5AEHA 3L3LA 4HLMA 5LYHA 2RF5A 3KR7A 4N3RA 2PXZX 2QEYA 4TKFA 5ADQA 1YLHA 2QZYA 4BUEA 4L31A 1AYLA 3BLJA 3KCZA 4X52A 1GS0A 4BUAA 4BU8A 1UK0A 4AVWA 4HLHA 5LX6A 4PJTA 2QF2A 4UVVA 2QF1A 4HHYA 5DCZA 4F0EA 4L0SA 4UVNA 4HKKA 4UI3A 5ECEA 4L0IA 4BUFA 4RCGA 3DT2A 4BJBA 2RCWA 4UFYA 3KJDA 1NHXA 4TKIA 4BU7A 4UVUA 2RKEA 4OA7A 4GV7A 2RD6A 4J1ZA 1XKVA 1A26A 4HMHA 4PNLA 4R43A 4RV6A 5ADSA 4PNQA 4BFPA 4BUDA 4UHGA 5I67A 3HKVA 3MOHA 2RK8A 3UH2A 4L70A 3UH4A 4GMUA 4GV2A 4PNRA 2X5YA 2OLRA 2PC9A 4HLFA 3GEYA 4HYFA 4UW1A 1KHFA 4PNMA 4UUHA 5C5RA 4AVUA 3L3MA 4UFUA 4PY4A 5AKWA 4F1LA 4KZQA 4BUTA 3MHJA 3P0PA 4J3MA 2RKAA 4L10A 4WOUA 4DVIA 4OQAC 4TJUA 4L7LA 2PY7X 4L34A 4HKNA 4GNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L6S A;  4IUE A;  4L0V A;  4W5I A;  4MSG A;  4BU3 A;  4BUX A;  4HLG A;  4PNS A;  4L33 A;  3GN7 A;  4L0B A;  4LI7 A;  4R5W A;  4HHZ A;  4TOS A;  5C5R A;  4GV4 A;  4UVS A;  4PJV A;  4L6Z A;  4KZU A;  4BU5 A;  5ETY A;  4TJW A;  4UVL A;  4HLK A;  5ADR A;  4L2G A;  2PAX A;  3PAX A;  4F1Q A;  4UND A;  4LI8 A;  4UVY A;  5EBT A;  1UK1 A;  4UVZ A;  3SMJ A;  4J3L A;  4TOR A;  1PAX A;  4L7U A;  3CE0 A;  4HKI A;  4N4T A;  5ADT A;  4UXB A;  3SMI A;  5C5P A;  4K4E A;  4MT9 A;  4UVX A;  4KRS A;  5A00 A;  4BUU A;  4L2K A;  4UVO A;  5FPG A;  4L2F A;  4TVJ A;  5AL4 A;  4XHU A;  5LXP A;  4HL5 A;  4TK5 A;  4ZZZ A;  4L0T A;  4UVT A;  4BS4 A;  4BUI A;  4UX4 A;  4L7P A;  4PAX A;  4UI7 A;  4U6A A;  4OQB C;  3SE2 A;  4UI6 A;  4UVP A;  3C4H A;  3KR8 A;  4BUW A;  4TK0 A;  5AKU A;  4L09 A;  4UI5 A;  2PAW A;  4K4F A;  3U9Y A;  3W51 A;  4KZL A;  5AL2 A;  4UVW A;  4I9I A;  4PNN A;  5AL1 A;  4M7B A;  1WOK A;  3MHK A;  4PML A;  4R6E A;  4UI4 A;  5AL3 A;  5C5Q A;  4PNT A;  4MSK A;  4N4V A;  4BUV A;  4ZZY A;  4TKG A;  4UI8 A;  3U9H A;  4BUY A;  1EFY A;  3GJW A;  4L7N A;  4L7O A;  4BJC A;  4DQY C;  3GOY A;  4BUS A;  3FHB A;  5FPF A;  4GV0 A;  4L32 A;  4LI6 A;  4J21 A;  4BU9 A;  2PQF A;  4J22 A;  4ZZX A;  4TJY A;  4BJ9 A;  3P0Q A;  5AL5 A;  4OPX C;  3P0N A;  3UA9 A;  4W5S A;  3UDD A;  4W6E A;  3C49 A;  4BU6 A;  4L7R A;  5AEH A;  3L3L A;  4HLM A;  5LYH A;  2RF5 A;  3KR7 A;  4N3R A;  4TKF A;  5ADQ A;  4BUE A;  4L31 A;  3BLJ A;  3KCZ A;  4X52 A;  1GS0 A;  4BUA A;  4BU8 A;  1UK0 A;  4AVW A;  4HLH A;  5LX6 A;  4PJT A;  4UVV A;  5DCZ A;  4HHY A;  4F0E A;  4L0S A;  4UVN A;  4HKK A;  4UI3 A;  5ECE A;  4L0I A;  4BUF A;  4BJB A;  2RCW A;  4UFY A;  3KJD A;  4TKI A;  4BU7 A;  4UVU A;  4OA7 A;  4GV7 A;  2RD6 A;  4J1Z A;  4PNL A;  1A26 A;  4HMH A;  5ADS A;  4RV6 A;  4BFP A;  4BUD A;  4UHG A;  3HKV A;  3UH2 A;  4L70 A;  3UH4 A;  4PNR A;  4GV2 A;  2X5Y A;  4HLF A;  3GEY A;  4HYF A;  4UW1 A;  4PNM A;  4UUH A;  4AVU A;  3L3M A;  4UFU A;  4PY4 A;  5AKW A;  4F1L A;  4KZQ A;  4BUT A;  3MHJ A;  3P0P A;  4J3M A;  4L10 A;  4OQA C;  4DVI A;  4TJU A;  4L7L A;  4PNQ A;  4L34 A;  4HKN A; 
#chains in the Genus database with same CATH topology
 4L6S A;  1YVY A;  4IUE A;  4L0V A;  4W5I A;  2RKD A;  4MSG A;  4BU3 A;  2FAH A;  4BUX A;  4HLG A;  3DT4 A;  4L33 A;  3GN7 A;  1OEN A;  2GMV A;  4L0B A;  4HHZ A;  4LI7 A;  4GNO A;  1K3D A;  1KHG A;  4GV4 A;  4L6Z A;  4KZU A;  4PJV A;  4UVS A;  4BU5 A;  5ETY A;  4TJW A;  4UVL A;  4HLK A;  4WPU A;  5FH3 A;  1KHB A;  5ADR A;  4WIE A;  4L2G A;  2PAX A;  3PAX A;  2FAF A;  4F1Q A;  4UND A;  4LI8 A;  4UVY A;  5EBT A;  1UK1 A;  4UVZ A;  3SMJ A;  1YGG A;  4J3L A;  4PNS A;  4TOR A;  1PAX A;  4L7U A;  3CE0 A;  4HKI A;  4WL8 A;  4N4T A;  1KHE A;  2ZCI A;  4UXB A;  3SMI A;  5ADT A;  4K4E A;  5C5P A;  4MT9 A;  4GNQ A;  5FH0 A;  4UVX A;  4KRS A;  4R5W A;  5A00 A;  4BUU A;  1YTM A;  4L2K A;  4UVO A;  5FPG A;  4L2F A;  4TVJ A;  5AL4 A;  4XHU A;  5LXP A;  4HL5 A;  4TK5 A;  4WIU A;  4ZZZ A;  4L0T A;  4UVT A;  4BS4 A;  4BUI A;  4GNM A;  4UX4 A;  4OX2 A;  4L7P A;  4PAX A;  4UI7 A;  1M51 A;  4GMW A;  4U6A A;  4OQB C;  1AQ2 A;  3SE2 A;  4UI6 A;  1J3B A;  2QEW A;  3C4H A;  1K3C A;  3KR8 A;  4UVP A;  4BUW A;  4TK0 A;  5AKU A;  4L09 A;  4GMM A;  2PAW A;  4GNP A;  4K4F A;  4UI5 A;  3U9Y A;  4KZL A;  3W51 A;  3DT7 A;  3MOF A;  5AL2 A;  4UVW A;  4I9I A;  5FH5 A;  4PNN A;  5AL1 A;  4YW8 A;  4M7B A;  3DTB A;  1WOK A;  1II2 A;  3MHK A;  4PML A;  4R6E A;  4UI4 A;  5AL3 A;  4YWB A;  4PNT A;  5C5Q A;  4MSK A;  4N4V A;  5FH2 A;  4BUV A;  4ZZY A;  4TKG A;  2OLQ A;  5FH4 A;  4UI8 A;  3U9H A;  4BUY A;  1EFY A;  5FH1 A;  3GJW A;  4L7N A;  4L7O A;  4BJC A;  4YW9 A;  4DQY C;  3GOY A;  4BUS A;  3FHB A;  2RK7 A;  4GMZ A;  4WPV A;  4GV0 A;  4L32 A;  4LI6 A;  5FPF A;  3MOE A;  4J21 A;  2PQF A;  4J22 A;  4BU9 A;  4ZZX A;  4TJY A;  4BJ9 A;  3P0Q A;  5AL5 A;  4TOS A;  3P0N A;  4WPT A;  4YWD A;  3UA9 A;  4OPX C;  4W5S A;  3UDD A;  4W6E A;  3C49 A;  4BU6 A;  1OS1 A;  4L7R A;  5AEH A;  3L3L A;  4HLM A;  5LYH A;  2RF5 A;  3KR7 A;  4N3R A;  2PXZ X;  2QEY A;  4TKF A;  5ADQ A;  1YLH A;  2QZY A;  4BUE A;  4L31 A;  1AYL A;  3BLJ A;  3KCZ A;  4X52 A;  1GS0 A;  4BUA A;  4BU8 A;  1UK0 A;  4AVW A;  4HLH A;  5LX6 A;  4PJT A;  2QF2 A;  4UVV A;  2QF1 A;  4HHY A;  5DCZ A;  4F0E A;  4L0S A;  4UVN A;  4HKK A;  4UI3 A;  5ECE A;  4L0I A;  4BUF A;  4RCG A;  3DT2 A;  4BJB A;  2RCW A;  4UFY A;  3KJD A;  1NHX A;  4TKI A;  4BU7 A;  4UVU A;  2RKE A;  4OA7 A;  4GV7 A;  2RD6 A;  4J1Z A;  1XKV A;  1A26 A;  4HMH A;  4PNL A;  4R43 A;  4RV6 A;  5ADS A;  4PNQ A;  4BFP A;  4BUD A;  4UHG A;  5I67 A;  3HKV A;  3MOH A;  2RK8 A;  3UH2 A;  4L70 A;  3UH4 A;  4GMU A;  4GV2 A;  4PNR A;  2X5Y A;  2OLR A;  2PC9 A;  4HLF A;  3GEY A;  4HYF A;  4UW1 A;  1KHF A;  4PNM A;  4UUH A;  5C5R A;  4AVU A;  3L3M A;  4UFU A;  4PY4 A;  5AKW A;  4F1L A;  4KZQ A;  4BUT A;  3MHJ A;  3P0P A;  4J3M A;  2RKA A;  4L10 A;  4WOU A;  4DVI A;  4OQA C;  4TJU A;  4L7L A;  2PY7 X;  4L34 A;  4HKN A;  4GNL A; 
#chains in the Genus database with same CATH homology
 4L6S A;  1YVY A;  4IUE A;  4L0V A;  4W5I A;  2RKD A;  4MSG A;  4BU3 A;  2FAH A;  4BUX A;  4HLG A;  3DT4 A;  4L33 A;  3GN7 A;  1OEN A;  2GMV A;  4L0B A;  4HHZ A;  4LI7 A;  4GNO A;  1K3D A;  1KHG A;  4GV4 A;  4L6Z A;  4KZU A;  4PJV A;  4UVS A;  4BU5 A;  5ETY A;  4TJW A;  4UVL A;  4HLK A;  4WPU A;  5FH3 A;  1KHB A;  5ADR A;  4WIE A;  4L2G A;  2PAX A;  3PAX A;  2FAF A;  4F1Q A;  4UND A;  4LI8 A;  4UVY A;  5EBT A;  1UK1 A;  4UVZ A;  3SMJ A;  1YGG A;  4J3L A;  4PNS A;  4TOR A;  1PAX A;  4L7U A;  3CE0 A;  4HKI A;  4WL8 A;  4N4T A;  1KHE A;  2ZCI A;  4UXB A;  3SMI A;  5ADT A;  4K4E A;  5C5P A;  4MT9 A;  4GNQ A;  5FH0 A;  4UVX A;  4KRS A;  4R5W A;  5A00 A;  4BUU A;  1YTM A;  4L2K A;  4UVO A;  5FPG A;  4L2F A;  4TVJ A;  5AL4 A;  4XHU A;  5LXP A;  4HL5 A;  4TK5 A;  4WIU A;  4ZZZ A;  4L0T A;  4UVT A;  4BS4 A;  4BUI A;  4GNM A;  4UX4 A;  4OX2 A;  4L7P A;  4PAX A;  4UI7 A;  1M51 A;  4GMW A;  4U6A A;  4OQB C;  1AQ2 A;  3SE2 A;  4UI6 A;  1J3B A;  2QEW A;  3C4H A;  1K3C A;  3KR8 A;  4UVP A;  4BUW A;  4TK0 A;  5AKU A;  4L09 A;  4GMM A;  2PAW A;  4GNP A;  4K4F A;  4UI5 A;  3U9Y A;  4KZL A;  3W51 A;  3DT7 A;  3MOF A;  5AL2 A;  4UVW A;  4I9I A;  5FH5 A;  4PNN A;  5AL1 A;  4YW8 A;  4M7B A;  3DTB A;  1WOK A;  1II2 A;  3MHK A;  4PML A;  4R6E A;  4UI4 A;  5AL3 A;  4YWB A;  4PNT A;  5C5Q A;  4MSK A;  4N4V A;  5FH2 A;  4BUV A;  4ZZY A;  4TKG A;  2OLQ A;  5FH4 A;  4UI8 A;  3U9H A;  4BUY A;  1EFY A;  5FH1 A;  3GJW A;  4L7N A;  4L7O A;  4BJC A;  4YW9 A;  4DQY C;  3GOY A;  4BUS A;  3FHB A;  2RK7 A;  4GMZ A;  4WPV A;  4GV0 A;  4L32 A;  4LI6 A;  5FPF A;  3MOE A;  4J21 A;  2PQF A;  4J22 A;  4BU9 A;  4ZZX A;  4TJY A;  4BJ9 A;  3P0Q A;  5AL5 A;  4TOS A;  3P0N A;  4WPT A;  4YWD A;  3UA9 A;  4OPX C;  4W5S A;  3UDD A;  4W6E A;  3C49 A;  4BU6 A;  1OS1 A;  4L7R A;  5AEH A;  3L3L A;  4HLM A;  5LYH A;  2RF5 A;  3KR7 A;  4N3R A;  2PXZ X;  2QEY A;  4TKF A;  5ADQ A;  1YLH A;  2QZY A;  4BUE A;  4L31 A;  1AYL A;  3BLJ A;  3KCZ A;  4X52 A;  1GS0 A;  4BUA A;  4BU8 A;  1UK0 A;  4AVW A;  4HLH A;  5LX6 A;  4PJT A;  2QF2 A;  4UVV A;  2QF1 A;  4HHY A;  5DCZ A;  4F0E A;  4L0S A;  4UVN A;  4HKK A;  4UI3 A;  5ECE A;  4L0I A;  4BUF A;  4RCG A;  3DT2 A;  4BJB A;  2RCW A;  4UFY A;  3KJD A;  1NHX A;  4TKI A;  4BU7 A;  4UVU A;  2RKE A;  4OA7 A;  4GV7 A;  2RD6 A;  4J1Z A;  1XKV A;  1A26 A;  4HMH A;  4PNL A;  4R43 A;  4RV6 A;  5ADS A;  4PNQ A;  4BFP A;  4BUD A;  4UHG A;  5I67 A;  3HKV A;  3MOH A;  2RK8 A;  3UH2 A;  4L70 A;  3UH4 A;  4GMU A;  4GV2 A;  4PNR A;  2X5Y A;  2OLR A;  2PC9 A;  4HLF A;  3GEY A;  4HYF A;  4UW1 A;  1KHF A;  4PNM A;  4UUH A;  5C5R A;  4AVU A;  3L3M A;  4UFU A;  4PY4 A;  5AKW A;  4F1L A;  4KZQ A;  4BUT A;  3MHJ A;  3P0P A;  4J3M A;  2RKA A;  4L10 A;  4WOU A;  4DVI A;  4OQA C;  4TJU A;  4L7L A;  2PY7 X;  4L34 A;  4HKN A;  4GNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...